BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25235_g2_i2 len=1361 path=[1:0-74 76:75-84 86:85-140 142:141-218
220:219-242 18068:243-245 247:246-355 357:356-364 366:365-443
445:444-481 483:482-506 7612:507-645 623:646-689 667:690-723
701:724-761 6887:762-789 767:790-838 816:839-876 854:877-1040
1018:1041-1054 1032:1055-1090 8315:1091-1092 1070:1093-1132
1110:1133-1145 1123:1146-1360]

Length=1361
                                                                      Score     E

gb|AHB84678.1|  pectin methylesterase                                   438   5e-145   
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     436   5e-144   
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            435   5e-144   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    434   2e-143   
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     431   3e-142   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          429   2e-141   
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     427   7e-141   
emb|CDP15270.1|  unnamed protein product                                424   3e-139   
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    421   2e-138   
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     421   2e-138   Vitis vinifera
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     421   2e-138   
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     421   4e-138   
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     419   9e-138   
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     417   9e-137   
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     416   2e-136   
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     416   2e-136   
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     416   2e-136   
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             415   4e-136   Populus trichocarpa [western balsam poplar]
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             414   5e-136   
emb|CBI36883.3|  unnamed protein product                                414   7e-136   
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     413   4e-135   
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    412   9e-135   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     412   1e-134   
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    410   3e-134   
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             410   2e-133   
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             408   4e-133   
gb|EPS62329.1|  pectinesterase                                          406   1e-132   
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               402   3e-131   Ricinus communis
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    404   4e-131   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     399   5e-130   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    397   4e-129   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 394   6e-128   
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    393   3e-127   
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     390   1e-126   
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                     389   5e-126   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     384   7e-125   
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     374   7e-120   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     370   2e-118   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     365   5e-118   
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     355   1e-113   
gb|EPS67066.1|  pectinesterase                                          365   2e-112   
gb|AGG23325.1|  pectin methylesterase 1                                 352   1e-111   
gb|ACQ85264.1|  pectin methylesterase                                   352   1e-111   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     352   2e-111   
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     349   2e-110   
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     347   2e-109   
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    343   1e-107   
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    342   1e-107   
gb|KGN44975.1|  Pectinesterase                                          341   9e-107   
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     338   6e-106   
ref|XP_010056842.1|  PREDICTED: pectinesterase-like                     334   7e-105   
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         329   2e-104   
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     328   3e-102   
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          323   1e-100   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          323   4e-100   Sorghum bicolor [broomcorn]
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   313   9e-99    
gb|EEC82670.1|  hypothetical protein OsI_27314                          315   2e-97    Oryza sativa Indica Group [Indian rice]
ref|NP_001060620.1|  Os07g0675100                                       315   2e-97    Oryza sativa Japonica Group [Japonica rice]
gb|ACN40984.1|  unknown                                                 315   5e-97    Picea sitchensis
ref|XP_010058840.1|  PREDICTED: pectinesterase-like                     315   6e-97    
dbj|BAJ96804.1|  predicted protein                                      314   7e-97    
emb|CDP15269.1|  unnamed protein product                                306   3e-96    
ref|XP_010058837.1|  PREDICTED: uncharacterized protein LOC104446716    327   6e-96    
gb|EEE54425.1|  hypothetical protein OsJ_01485                          308   2e-94    Oryza sativa Japonica Group [Japonica rice]
gb|ABG46324.1|  putative pectin methylesterase                          301   3e-94    Picea abies
gb|EEC70505.1|  hypothetical protein OsI_01594                          307   3e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                   303   2e-92    
ref|XP_010456049.1|  PREDICTED: probable pectinesterase/pectinest...    300   7e-92    
gb|ABZ89800.1|  pectin methylesterase-like protein                      301   9e-92    Taiwania cryptomerioides
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   301   1e-91    
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        300   4e-91    
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   298   1e-90    
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   298   1e-90    
ref|XP_002872846.1|  predicted protein                                  296   2e-90    
ref|NP_001146685.1|  pectinesterase precursor                           296   5e-90    Zea mays [maize]
ref|XP_002463382.1|  hypothetical protein SORBIDRAFT_02g042780          296   1e-89    Sorghum bicolor [broomcorn]
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             295   2e-89    
ref|XP_006396438.1|  hypothetical protein EUTSA_v10029453mg             293   2e-89    
gb|AAC50023.1|  ATPME2 precursor                                        294   3e-89    Arabidopsis thaliana [mouse-ear cress]
emb|CDX98441.1|  BnaC05g39340D                                          293   6e-89    
emb|CDX97564.1|  BnaA05g25150D                                          293   8e-89    
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...    293   1e-88    
gb|AFW03475.1|  pectin methylesterase 1                                 293   2e-88    
ref|NP_192139.1|  Probable pectinesterase/pectinesterase inhibito...    291   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                     291   4e-88    
ref|XP_008653464.1|  PREDICTED: pectinesterase-like                     292   5e-88    
gb|AFB77929.1|  pectin methylesterase                                   291   9e-88    
gb|KHG08631.1|  Pectinesterase 3                                        290   1e-87    
emb|CDY08206.1|  BnaA05g14130D                                          290   1e-87    
gb|AFW03480.1|  pectin methylesterase 1                                 290   2e-87    
ref|NP_175786.1|  pectin methylesterase 2                               290   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    290   2e-87    
ref|XP_002891774.1|  ATPME2                                             290   3e-87    
gb|ABQ42392.1|  pectin methylesterase-like protein                      290   3e-87    Taiwania cryptomerioides
ref|XP_010273801.1|  PREDICTED: pectinesterase                          289   4e-87    
ref|XP_002265171.1|  PREDICTED: pectinesterase                          290   5e-87    Vitis vinifera
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          288   7e-87    
emb|CDY33228.1|  BnaC01g37010D                                          288   9e-87    
emb|CDY33229.1|  BnaC01g37020D                                          287   1e-86    
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    288   2e-86    
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    288   2e-86    
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     287   2e-86    
ref|XP_007012502.1|  Pectin methylesterase 3                            286   3e-86    
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    287   3e-86    
gb|AFW03476.1|  pectin methylesterase 2                                 285   4e-86    
emb|CDY51798.1|  BnaC06g41940D                                          286   4e-86    
gb|AFI23415.1|  pectin methylesterase                                   278   7e-86    
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     285   1e-85    
ref|XP_006289196.1|  hypothetical protein CARUB_v10002644mg             284   1e-85    
gb|AER38243.1|  PME2                                                    283   1e-85    
emb|CAB95025.1|  pectin methylesterase                                  285   1e-85    Nicotiana tabacum [American tobacco]
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    285   1e-85    
ref|NP_001274969.1|  pectin methyl esterase                             285   1e-85    
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              284   2e-85    
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             285   2e-85    
ref|XP_009116991.1|  PREDICTED: pectinesterase/pectinesterase inh...    285   2e-85    
gb|AFB77928.1|  pectin methylesterase                                   284   2e-85    
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                        285   2e-85    
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         285   2e-85    
gb|AFW03481.1|  pectin methylesterase 2                                 282   3e-85    
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         283   4e-85    Linum usitatissimum
ref|XP_009117000.1|  PREDICTED: pectinesterase/pectinesterase inh...    283   5e-85    
gb|AAO85706.1|  pectin methyl-esterase                                  283   1e-84    Nicotiana benthamiana
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg             283   1e-84    
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          282   2e-84    
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     282   2e-84    
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         281   4e-84    
ref|XP_002304257.2|  pectinesterase family protein                      280   1e-83    Populus trichocarpa [western balsam poplar]
ref|XP_002885033.1|  ATPME3                                             280   1e-83    
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                    280   2e-83    
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                279   2e-83    
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     279   3e-83    
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     278   3e-83    
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     278   4e-83    
ref|NP_188048.1|  pectin methylesterase 3                               279   4e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297218.1|  hypothetical protein CARUB_v10013226mg             279   7e-83    
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                  275   1e-82    
ref|XP_003559807.1|  PREDICTED: pectinesterase-like                     277   1e-82    
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     276   1e-82    
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    276   3e-82    Citrus sinensis [apfelsine]
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     276   3e-82    
gb|AFI23411.1|  pectin methylesterase                                   276   3e-82    
ref|XP_009135376.1|  PREDICTED: pectinesterase/pectinesterase inh...    276   5e-82    
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    275   8e-82    
ref|XP_006396439.1|  hypothetical protein EUTSA_v10029374mg             273   1e-81    
ref|XP_006355852.1|  PREDICTED: probable pectinesterase/pectinest...    265   1e-81    
gb|AAC72288.1|  putative pectin methylesterase                          275   1e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             274   2e-81    
ref|XP_003627458.1|  Pectinesterase                                     274   2e-81    
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         274   2e-81    
gb|AFQ23194.1|  pectin methylesterase                                   274   2e-81    
ref|NP_192141.1|  probable pectinesterase/pectinesterase inhibito...    272   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  273   4e-81    
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     273   7e-81    
ref|XP_006828588.1|  hypothetical protein AMTR_s00129p00047530          270   2e-80    
emb|CAC01624.1|  putative pectin methylesterase                         271   2e-80    Populus tremula x Populus tremuloides
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             271   3e-80    
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    271   3e-80    
ref|XP_008228105.1|  PREDICTED: pectinesterase                          270   5e-80    
emb|CDX75765.1|  BnaC03g38480D                                          266   1e-79    
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     269   2e-79    
emb|CDY39109.1|  BnaA01g29470D                                          268   2e-79    
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             268   3e-79    
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     268   5e-79    
emb|CDY60700.1|  BnaA01g37100D                                          267   5e-79    
ref|XP_010910828.1|  PREDICTED: pectinesterase 3-like                   259   9e-79    
ref|XP_011084508.1|  PREDICTED: probable pectinesterase/pectinest...    267   1e-78    
ref|NP_001042866.1|  Os01g0312500                                       262   1e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002532944.1|  Pectinesterase-3 precursor, putative               266   2e-78    Ricinus communis
ref|XP_010422610.1|  PREDICTED: probable pectinesterase/pectinest...    265   2e-78    
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    266   2e-78    
ref|NP_001275859.1|  pectinesterase 1 precursor                         266   2e-78    
ref|XP_010466998.1|  PREDICTED: probable pectinesterase/pectinest...    261   2e-78    
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          265   2e-78    
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    266   3e-78    
ref|XP_011093902.1|  PREDICTED: pectinesterase/pectinesterase inh...    263   3e-78    
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    265   4e-78    
ref|XP_010266532.1|  PREDICTED: probable pectinesterase/pectinest...    266   4e-78    
gb|KFK35693.1|  hypothetical protein AALP_AA4G024900                    265   5e-78    
emb|CDY52779.1|  BnaCnng23240D                                          264   6e-78    
ref|XP_004240956.1|  PREDICTED: probable pectinesterase/pectinest...    265   7e-78    
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    264   1e-77    Citrus sinensis [apfelsine]
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              263   1e-77    Linum usitatissimum
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     264   1e-77    
ref|XP_008450600.1|  PREDICTED: putative pectinesterase/pectinest...    263   2e-77    
ref|XP_003554631.1|  PREDICTED: putative pectinesterase/pectinest...    263   2e-77    
ref|XP_004157240.1|  PREDICTED: putative pectinesterase/pectinest...    262   2e-77    
ref|XP_006287480.1|  hypothetical protein CARUB_v10000691mg             262   2e-77    
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    263   2e-77    
ref|XP_004135600.1|  PREDICTED: putative pectinesterase/pectinest...    262   3e-77    
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                   263   3e-77    
gb|KHN43320.1|  Putative pectinesterase/pectinesterase inhibitor 22     261   3e-77    
ref|XP_006841646.1|  hypothetical protein AMTR_s00003p00238240          262   3e-77    
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...    263   4e-77    
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    262   7e-77    
ref|XP_006433467.1|  hypothetical protein CICLE_v10000816mg             261   8e-77    
ref|XP_010261669.1|  PREDICTED: probable pectinesterase/pectinest...    261   1e-76    
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   262   1e-76    
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     261   1e-76    
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    258   2e-76    
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   261   2e-76    
ref|XP_008245555.1|  PREDICTED: putative pectinesterase/pectinest...    259   3e-76    
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    260   4e-76    
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   256   4e-76    
ref|XP_004494573.1|  PREDICTED: putative pectinesterase/pectinest...    259   5e-76    
emb|CDP05068.1|  unnamed protein product                                260   8e-76    
ref|XP_007146997.1|  hypothetical protein PHAVU_006G088000g             258   9e-76    
gb|KHN03710.1|  Putative pectinesterase/pectinesterase inhibitor 40     254   9e-76    
ref|XP_002512462.1|  Pectinesterase PPE8B precursor, putative           258   1e-75    Ricinus communis
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...    259   1e-75    
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     258   1e-75    
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     259   1e-75    
ref|XP_010482728.1|  PREDICTED: probable pectinesterase/pectinest...    259   2e-75    
ref|XP_008450601.1|  PREDICTED: putative pectinesterase/pectinest...    255   2e-75    
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...    258   2e-75    
gb|KFK26958.1|  hypothetical protein AALP_AA8G315400                    258   2e-75    
ref|NP_200149.1|  pectin methylesterase PCR fragment F                  258   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    258   3e-75    
ref|XP_009338231.1|  PREDICTED: putative pectinesterase/pectinest...    256   3e-75    
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     258   3e-75    
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    258   3e-75    
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          257   4e-75    
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                258   4e-75    
ref|XP_010049073.1|  PREDICTED: probable pectinesterase/pectinest...    257   5e-75    
ref|XP_009421463.1|  PREDICTED: probable pectinesterase/pectinest...    257   7e-75    
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     257   7e-75    
ref|XP_002865971.1|  pectinesterase family protein                      256   9e-75    
ref|XP_008380988.1|  PREDICTED: probable pectinesterase/pectinest...    257   1e-74    
ref|XP_002872845.1|  pectinesterase family protein                      253   1e-74    
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    257   1e-74    
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    256   1e-74    
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...    256   1e-74    
gb|KDP23440.1|  hypothetical protein JCGZ_23273                         255   1e-74    
ref|XP_009351999.1|  PREDICTED: probable pectinesterase/pectinest...    256   2e-74    
ref|XP_003588521.1|  Pectinesterase                                     256   2e-74    
ref|XP_009111300.1|  PREDICTED: probable pectinesterase/pectinest...    254   2e-74    
emb|CDP17209.1|  unnamed protein product                                255   2e-74    
ref|XP_010043041.1|  PREDICTED: putative pectinesterase/pectinest...    254   2e-74    
ref|XP_007031047.1|  Plant invertase/pectin methylesterase inhibi...    254   2e-74    
ref|XP_009111299.1|  PREDICTED: probable pectinesterase/pectinest...    254   2e-74    
ref|XP_010273802.1|  PREDICTED: pectinesterase/pectinesterase inh...    253   3e-74    
ref|XP_003626198.1|  Pectinesterase                                     254   3e-74    
ref|XP_007012504.1|  Pectinesterase/pectinesterase inhibitor PPE8B      254   4e-74    
ref|XP_006385197.1|  hypothetical protein POPTR_0003s00980g             254   4e-74    
ref|XP_009414355.1|  PREDICTED: putative pectinesterase/pectinest...    253   5e-74    
ref|XP_006389479.1|  putative pectin methylesterase LuPME5 family...    254   5e-74    
ref|XP_011092101.1|  PREDICTED: putative pectinesterase/pectinest...    253   5e-74    
ref|XP_009111301.1|  PREDICTED: probable pectinesterase/pectinest...    253   5e-74    
ref|XP_004242901.1|  PREDICTED: pectinesterase/pectinesterase inh...    253   8e-74    
ref|XP_008370416.1|  PREDICTED: putative pectinesterase/pectinest...    253   8e-74    
gb|KHN10485.1|  Putative pectinesterase/pectinesterase inhibitor 12     253   1e-73    
ref|XP_002317777.2|  hypothetical protein POPTR_0012s02170g             254   1e-73    Populus trichocarpa [western balsam poplar]
emb|CBI27756.3|  unnamed protein product                                252   1e-73    
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    254   1e-73    
gb|KHG26122.1|  putative pectinesterase/pectinesterase inhibitor ...    253   1e-73    
gb|ACJ68111.1|  pectinesterase                                          251   2e-73    Brassica napus [oilseed rape]
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               253   2e-73    Ricinus communis
ref|XP_004144447.1|  PREDICTED: pectinesterase 3-like                   252   2e-73    
emb|CDY22044.1|  BnaA09g00730D                                          248   2e-73    
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             253   3e-73    
ref|XP_002277473.1|  PREDICTED: pectinesterase                          253   3e-73    Vitis vinifera
ref|XP_008437596.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    253   3e-73    
ref|XP_006344555.1|  PREDICTED: pectinesterase/pectinesterase inh...    251   3e-73    
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g             253   3e-73    
ref|XP_006587077.1|  PREDICTED: probable pectinesterase/pectinest...    251   3e-73    
ref|XP_007207382.1|  hypothetical protein PRUPE_ppa004437mg             250   4e-73    
ref|XP_011047860.1|  PREDICTED: pectinesterase-like                     252   4e-73    
gb|EYU42198.1|  hypothetical protein MIMGU_mgv1a019879mg                250   5e-73    
ref|XP_010424662.1|  PREDICTED: probable pectinesterase/pectinest...    246   6e-73    
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             251   7e-73    
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     251   7e-73    
ref|XP_004159762.1|  PREDICTED: pectinesterase/pectinesterase inh...    247   7e-73    
ref|XP_011076457.1|  PREDICTED: probable pectinesterase/pectinest...    251   8e-73    
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                249   8e-73    
ref|XP_006828579.1|  hypothetical protein AMTR_s00129p00033080          250   1e-72    
ref|XP_006441080.1|  hypothetical protein CICLE_v10019376mg             251   1e-72    
ref|XP_010546740.1|  PREDICTED: putative pectinesterase/pectinest...    251   1e-72    
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    251   1e-72    
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...    251   2e-72    
ref|XP_009127175.1|  PREDICTED: probable pectinesterase/pectinest...    251   2e-72    
gb|EPS73427.1|  pectinesterase                                          250   2e-72    
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                251   2e-72    
ref|XP_003546531.1|  PREDICTED: probable pectinesterase/pectinest...    249   2e-72    
ref|NP_001289259.1|  probable pectinesterase/pectinesterase inhib...    251   2e-72    
ref|XP_007012505.1|  Plant invertase/pectin methylesterase inhibi...    249   3e-72    
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    250   3e-72    
gb|KHG13374.1|  Pectinesterase/pectinesterase inhibitor PPE8B           246   3e-72    
ref|XP_009594432.1|  PREDICTED: putative pectinesterase/pectinest...    249   3e-72    
ref|XP_002278061.1|  PREDICTED: probable pectinesterase/pectinest...    250   3e-72    
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     248   4e-72    
ref|NP_001265901.1|  pectinesterase 3-like                              249   4e-72    
gb|AGR44473.1|  pectin methylesterase 4                                 245   5e-72    
ref|XP_004146188.1|  PREDICTED: pectinesterase/pectinesterase inh...    247   6e-72    
gb|EYU40533.1|  hypothetical protein MIMGU_mgv1a019770mg                247   7e-72    
ref|XP_008388514.1|  PREDICTED: putative pectinesterase/pectinest...    248   7e-72    
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     248   8e-72    
ref|XP_004230262.1|  PREDICTED: putative pectinesterase/pectinest...    248   8e-72    
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    248   8e-72    
ref|XP_006419127.1|  hypothetical protein EUTSA_v10002482mg             247   8e-72    
emb|CDY12333.1|  BnaA06g20110D                                          247   9e-72    
emb|CDP19933.1|  unnamed protein product                                247   9e-72    
ref|XP_009768722.1|  PREDICTED: probable pectinesterase/pectinest...    248   9e-72    
ref|XP_009401623.1|  PREDICTED: pectinesterase 3-like                   242   9e-72    
ref|XP_009357300.1|  PREDICTED: probable pectinesterase/pectinest...    249   9e-72    
gb|AFW03477.1|  pectin methylesterase 3                                 247   9e-72    
ref|XP_002875955.1|  pectinesterase family protein                      249   1e-71    
ref|XP_004302271.1|  PREDICTED: putative pectinesterase/pectinest...    248   1e-71    
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...    249   1e-71    
gb|AER38246.1|  PME3                                                    246   1e-71    
gb|ABJ99594.1|  pectinesterase inhibitor                                248   1e-71    
dbj|BAF42041.1|  pectin methylesterase 4                                246   2e-71    
ref|XP_006344697.1|  PREDICTED: putative pectinesterase/pectinest...    246   2e-71    
ref|XP_011036906.1|  PREDICTED: putative pectinesterase/pectinest...    246   2e-71    
emb|CDY52778.1|  BnaCnng23230D                                          246   2e-71    
ref|XP_010271168.1|  PREDICTED: probable pectinesterase/pectinest...    246   2e-71    
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     246   2e-71    
ref|XP_004145986.1|  PREDICTED: probable pectinesterase/pectinest...    246   2e-71    
ref|XP_008448427.1|  PREDICTED: pectinesterase/pectinesterase inh...    247   2e-71    
gb|KGN55582.1|  hypothetical protein Csa_3G000060                       247   3e-71    
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             248   3e-71    
ref|XP_002877272.1|  pectinesterase family protein                      246   3e-71    
ref|XP_011039647.1|  PREDICTED: pectinesterase-like                     247   3e-71    
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    248   3e-71    
ref|XP_011023723.1|  PREDICTED: putative pectinesterase/pectinest...    246   3e-71    
ref|XP_009796151.1|  PREDICTED: putative pectinesterase/pectinest...    246   4e-71    
ref|XP_006404164.1|  hypothetical protein EUTSA_v10010220mg             247   4e-71    
ref|XP_011101135.1|  PREDICTED: probable pectinesterase/pectinest...    246   5e-71    
ref|XP_009359674.1|  PREDICTED: pectinesterase/pectinesterase inh...    244   5e-71    
ref|XP_009150156.1|  PREDICTED: probable pectinesterase/pectinest...    246   5e-71    
ref|XP_006374102.1|  hypothetical protein POPTR_0015s01610g             246   7e-71    
dbj|BAF42038.1|  pectin methylesterase 1                                247   8e-71    
gb|ABK24761.1|  unknown                                                 245   8e-71    
ref|XP_002321999.2|  pectin methylesterase family protein               246   8e-71    
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     244   8e-71    
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   244   9e-71    
ref|XP_010674080.1|  PREDICTED: putative pectinesterase/pectinest...    244   1e-70    
gb|KHF97563.1|  Pectinesterase/pectinesterase inhibitor PPE8B           244   1e-70    
gb|KGN49865.1|  hypothetical protein Csa_5G139430                       246   1e-70    
ref|XP_004172937.1|  PREDICTED: probable pectinesterase/pectinest...    246   1e-70    
ref|XP_010259726.1|  PREDICTED: pectinesterase-like                     244   2e-70    
ref|XP_004499740.1|  PREDICTED: putative pectinesterase/pectinest...    245   2e-70    
ref|NP_190491.1|  putative pectinesterase/pectinesterase inhibito...    245   2e-70    
emb|CBI39536.3|  unnamed protein product                                244   2e-70    
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    244   3e-70    
ref|XP_009604014.1|  PREDICTED: probable pectinesterase/pectinest...    244   3e-70    
gb|EYU28290.1|  hypothetical protein MIMGU_mgv1a004392mg                243   3e-70    
ref|XP_010520512.1|  PREDICTED: probable pectinesterase/pectinest...    243   3e-70    
ref|XP_002884519.1|  pectinesterase family protein                      246   4e-70    
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     244   4e-70    
ref|XP_010659655.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    243   4e-70    
gb|EPS61512.1|  pectinesterase                                          242   4e-70    
ref|XP_003595381.1|  hypothetical protein MTR_2g044810                  243   4e-70    
ref|XP_011006351.1|  PREDICTED: probable pectinesterase/pectinest...    244   4e-70    
ref|XP_002309641.2|  putative pectin methylesterase LuPME5 family...    244   4e-70    
sp|P85076.1|PME_ACTDE  RecName: Full=Pectinesterase; Short=PE; Al...    236   5e-70    
ref|XP_006382445.1|  pectinesterase family protein                      242   5e-70    
ref|XP_006852649.1|  hypothetical protein AMTR_s00021p00242180          244   5e-70    
gb|AAQ21124.1|  pectinesterase                                          242   5e-70    
ref|XP_010671450.1|  PREDICTED: probable pectinesterase/pectinest...    244   5e-70    
gb|KFK33850.1|  hypothetical protein AALP_AA5G068300                    242   5e-70    
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     243   6e-70    
ref|XP_004287682.1|  PREDICTED: pectinesterase/pectinesterase inh...    242   6e-70    
gb|KDO73733.1|  hypothetical protein CISIN_1g008261mg                   243   7e-70    
gb|AFW03482.1|  pectin methylesterase 3                                 242   7e-70    
ref|XP_010426432.1|  PREDICTED: probable pectinesterase/pectinest...    244   7e-70    
ref|XP_009119880.1|  PREDICTED: probable pectinesterase/pectinest...    243   8e-70    
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g             243   8e-70    
ref|XP_002318977.1|  pectinesterase family protein                      242   9e-70    
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             243   1e-69    
emb|CDX96216.1|  BnaC02g14350D                                          240   1e-69    
ref|XP_010261671.1|  PREDICTED: pectinesterase-like                     243   1e-69    
emb|CDP00815.1|  unnamed protein product                                242   1e-69    
ref|XP_006493306.1|  PREDICTED: probable pectinesterase/pectinest...    243   1e-69    
ref|XP_011003715.1|  PREDICTED: pectinesterase-like                     243   1e-69    
ref|XP_004146219.1|  PREDICTED: probable pectinesterase/pectinest...    243   1e-69    
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     241   1e-69    
ref|XP_008337790.1|  PREDICTED: pectinesterase/pectinesterase inh...    241   1e-69    
ref|XP_010269595.1|  PREDICTED: putative pectinesterase/pectinest...    242   1e-69    
ref|XP_007157169.1|  hypothetical protein PHAVU_002G048400g             242   2e-69    
gb|EPS63648.1|  pectinesterase                                          241   2e-69    
ref|NP_189913.3|  probable pectinesterase/pectinesterase inhibito...    241   2e-69    
ref|NP_001275846.1|  putative thermostable pectinesterase               243   2e-69    
emb|CDY49170.1|  BnaA02g10290D                                          239   2e-69    
emb|CDY35644.1|  BnaC09g29660D                                          239   2e-69    
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     241   2e-69    
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   240   2e-69    
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     243   3e-69    
ref|XP_003602238.1|  Pectinesterase                                     242   3e-69    
gb|AFW03478.1|  pectin methylesterase 4                                 240   3e-69    
ref|XP_010671449.1|  PREDICTED: probable pectinesterase/pectinest...    242   3e-69    
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   237   3e-69    
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    243   3e-69    
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    242   4e-69    
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    241   4e-69    
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    241   4e-69    
gb|ABJ99595.1|  pectinesterase inhibitor                                241   4e-69    
ref|XP_011047961.1|  PREDICTED: pectinesterase-like                     240   4e-69    
ref|XP_010503572.1|  PREDICTED: probable pectinesterase/pectinest...    242   5e-69    
ref|XP_010271283.1|  PREDICTED: pectinesterase                          240   5e-69    
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...    241   6e-69    
gb|KFK32510.1|  hypothetical protein AALP_AA6G251900                    240   6e-69    
ref|XP_008242144.1|  PREDICTED: pectinesterase/pectinesterase inh...    239   6e-69    
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     239   6e-69    
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    241   7e-69    
emb|CBI29628.3|  unnamed protein product                                239   7e-69    
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...    241   8e-69    
gb|AFW03483.1|  pectin methylesterase 4                                 239   8e-69    
ref|NP_001268091.1|  pectin methylesterase PME1 precursor               239   8e-69    
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...    241   8e-69    
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          239   9e-69    
ref|XP_009404434.1|  PREDICTED: probable pectinesterase/pectinest...    241   9e-69    
emb|CAN60612.1|  hypothetical protein VITISV_003251                     239   9e-69    
ref|XP_011078158.1|  PREDICTED: pectinesterase/pectinesterase inh...    239   9e-69    
ref|XP_010035249.1|  PREDICTED: probable pectinesterase/pectinest...    241   1e-68    
ref|XP_010526022.1|  PREDICTED: probable pectinesterase/pectinest...    239   1e-68    
gb|EPS74082.1|  hypothetical protein M569_00674                         238   1e-68    
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   238   2e-68    
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   238   2e-68    
ref|XP_004240117.1|  PREDICTED: probable pectinesterase/pectinest...    239   2e-68    
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        238   2e-68    
emb|CAC18726.1|  putative pectin methylesterase                         239   2e-68    
ref|XP_006290776.1|  hypothetical protein CARUB_v10016881mg             240   2e-68    
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                238   2e-68    
gb|AER38245.1|  PME4                                                    238   2e-68    
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    239   2e-68    
ref|XP_002890570.1|  predicted protein                                  239   2e-68    
ref|XP_006360646.1|  PREDICTED: probable pectinesterase/pectinest...    239   2e-68    
ref|XP_011093901.1|  PREDICTED: probable pectinesterase/pectinest...    238   3e-68    
ref|XP_007204326.1|  hypothetical protein PRUPE_ppa004300mg             238   3e-68    
sp|Q43062.1|PME_PRUPE  RecName: Full=Pectinesterase/pectinesteras...    238   3e-68    
ref|XP_004488157.1|  PREDICTED: probable pectinesterase/pectinest...    238   3e-68    
ref|XP_006367330.1|  PREDICTED: probable pectinesterase/pectinest...    239   4e-68    
ref|XP_007219746.1|  hypothetical protein PRUPE_ppa024156mg             239   4e-68    
gb|KDP33983.1|  hypothetical protein JCGZ_07554                         237   4e-68    
ref|XP_009123268.1|  PREDICTED: probable pectinesterase/pectinest...    236   4e-68    
ref|XP_006593974.1|  PREDICTED: probable pectinesterase/pectinest...    237   6e-68    
ref|XP_009786706.1|  PREDICTED: pectinesterase/pectinesterase inh...    237   6e-68    
gb|KHN45040.1|  Putative pectinesterase/pectinesterase inhibitor 12     237   7e-68    
ref|XP_009123267.1|  PREDICTED: probable pectinesterase/pectinest...    237   7e-68    
ref|XP_008356804.1|  PREDICTED: putative pectinesterase/pectinest...    238   8e-68    
ref|XP_002516192.1|  Pectinesterase PPE8B precursor, putative           237   8e-68    
ref|XP_008375414.1|  PREDICTED: putative pectinesterase/pectinest...    238   8e-68    
dbj|BAC42986.1|  putative pectinesterase                                240   8e-68    
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...    238   8e-68    
ref|XP_009614349.1|  PREDICTED: probable pectinesterase/pectinest...    238   9e-68    
ref|XP_010526020.1|  PREDICTED: probable pectinesterase/pectinest...    237   9e-68    
ref|XP_003595386.1|  Pectinesterase                                     236   9e-68    
ref|XP_009413991.1|  PREDICTED: pectinesterase-like                     237   9e-68    
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   236   1e-67    
gb|KHN35617.1|  Pectinesterase 2                                        236   1e-67    
ref|XP_006452913.1|  hypothetical protein CICLE_v10007942mg             236   1e-67    
ref|XP_002314796.1|  pectin methylesterase 6 family protein             236   1e-67    
emb|CDY22045.1|  BnaA09g00740D                                          236   1e-67    
emb|CDY27749.1|  BnaA05g31580D                                          236   1e-67    
ref|XP_009369733.1|  PREDICTED: pectinesterase/pectinesterase inh...    236   1e-67    
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   235   1e-67    
emb|CDY05190.1|  BnaC05g46130D                                          236   1e-67    
ref|XP_010273804.1|  PREDICTED: probable pectinesterase/pectinest...    236   1e-67    
ref|XP_010541676.1|  PREDICTED: probable pectinesterase/pectinest...    236   2e-67    
emb|CDP08022.1|  unnamed protein product                                236   2e-67    
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     235   2e-67    
emb|CDP20872.1|  unnamed protein product                                235   2e-67    
gb|KFK37971.1|  hypothetical protein AALP_AA3G053500                    236   2e-67    
ref|XP_009359675.1|  PREDICTED: probable pectinesterase/pectinest...    236   2e-67    
ref|XP_007133558.1|  hypothetical protein PHAVU_011G1890000g            233   2e-67    
ref|XP_008231878.1|  PREDICTED: probable pectinesterase/pectinest...    237   2e-67    
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     239   2e-67    
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   235   2e-67    
ref|XP_006474555.1|  PREDICTED: pectinesterase/pectinesterase inh...    235   2e-67    
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   235   2e-67    
ref|XP_010503036.1|  PREDICTED: probable pectinesterase/pectinest...    235   2e-67    
gb|KEH19215.1|  pectinesterase/pectinesterase inhibitor                 236   2e-67    
ref|XP_007154533.1|  hypothetical protein PHAVU_003G126600g             235   3e-67    
ref|XP_006452917.1|  hypothetical protein CICLE_v10007993mg             235   3e-67    
ref|XP_011005054.1|  PREDICTED: probable pectinesterase/pectinest...    236   3e-67    
emb|CDY14384.1|  BnaA10g06710D                                          233   3e-67    
ref|XP_010515266.1|  PREDICTED: probable pectinesterase/pectinest...    237   3e-67    
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   235   3e-67    
ref|XP_010047426.1|  PREDICTED: probable pectinesterase/pectinest...    235   4e-67    
ref|XP_003518980.1|  PREDICTED: probable pectinesterase/pectinest...    235   4e-67    
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             238   4e-67    
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 234   5e-67    
emb|CDY38712.1|  BnaC01g27850D                                          235   5e-67    
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        234   6e-67    
emb|CDP19931.1|  unnamed protein product                                235   6e-67    
ref|XP_009147217.1|  PREDICTED: putative pectinesterase/pectinest...    234   6e-67    
ref|XP_007138600.1|  hypothetical protein PHAVU_009G222500g             234   6e-67    
ref|XP_010107092.1|  Pectinesterase/pectinesterase inhibitor PPE8B      241   6e-67    
ref|XP_004307984.1|  PREDICTED: probable pectinesterase/pectinest...    236   6e-67    
gb|KDO73736.1|  hypothetical protein CISIN_1g010718mg                   233   6e-67    
ref|XP_010654104.1|  PREDICTED: pectinesterase                          234   6e-67    
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                   236   7e-67    
emb|CDP03036.1|  unnamed protein product                                236   7e-67    
ref|XP_010100757.1|  putative pectinesterase/pectinesterase inhib...    236   8e-67    
gb|KDO73735.1|  hypothetical protein CISIN_1g010718mg                   233   8e-67    
gb|AFW03479.1|  pectin methylesterase 5                                 234   8e-67    
ref|XP_004139621.1|  PREDICTED: pectinesterase/pectinesterase inh...    234   8e-67    
gb|KDP33982.1|  hypothetical protein JCGZ_07553                         234   9e-67    
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...    235   9e-67    
ref|XP_004154436.1|  PREDICTED: pectinesterase/pectinesterase inh...    234   9e-67    



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   438 bits (1127),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 224/396 (57%), Positives = 277/396 (70%), Gaps = 22/396 (6%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATTSDDIH-------QVAHSACDRSLYRDLCVSTLVKTPDL  1003
             + LL   LS     +   N  T+D  H       QVAHSAC+ +LY +LCVSTL+  PDL
Sbjct  24    IFLLLFVLSAVSVTTLKKNPKTTDAPHLRVHKHFQVAHSACEGTLYPELCVSTLLSVPDL  83

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLR  823
              +K +PE+IS T+N T+SE++ +++NCS I +  P+  T+E RA+  CLELF DT+ +L+
Sbjct  84    ASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAINDCLELFHDTIVELK  143

Query  822   TVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVS  649
             + L+ L  + SP+K Y DLQTL S AMTNQYTCL+GF YS+ NVR  I   +  ISRHVS
Sbjct  144   SALNDLSPKKSPSKHYHDLQTLFSGAMTNQYTCLDGFAYSDGNVREVIKSSLYNISRHVS  203

Query  648   NALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKK  469
             N+L ML KI  +         P         E+G +K GFP WLS  DR LL+    K  
Sbjct  204   NSLVMLKKIPGDNMSSKYEVFP---------EYGRIKRGFPTWLSLNDRKLLQ----KSV  250

Query  468   RKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFV  289
                K D+ VAKDGSG+F +I  A+ AAP+ S+TR+VI+IKAG+Y+E V+VDKKKTM+MFV
Sbjct  251   NLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAGAYFENVEVDKKKTMLMFV  310

Query  288   GDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSD  109
             GDGIGKT +K NR+V DGW TFRSATVAVVGTGFIA GI+ ENSAGP KHQAVALR+ SD
Sbjct  311   GDGIGKTLVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAVALRSGSD  370

Query  108   YSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              S FY C FVGYQDTLYVHS RQF+RECDVYGTVDF
Sbjct  371   LSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDF  406



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   436 bits (1120),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 225/417 (54%), Positives = 285/417 (68%), Gaps = 30/417 (7%)
 Frame = -3

Query  1200  MQNLGRNPIMLVPVVLLAAFLSLTVF---------QSSAMNATTSDDIH-----QVAHSA  1063
             M N+   P +++ ++   A + LT F          S A   T +  IH     Q+A S 
Sbjct  1     MYNIRHKPSLILTILASTALILLTFFVLLSNPKSSSSRAAEKTMTPHIHVHKNIQIAQSH  60

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             C+ +L+ +LCVSTL   P+L  KSI EIIS+TV + V E++ +A NCS +RR VP L  +
Sbjct  61    CEGTLHPELCVSTLSSFPNLHRKSIAEIISSTVKIAVGEVRASAHNCSDLRRHVPKLEPI  120

Query  882   ESRALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYS  709
             E RAL  C+EL  +T+A+LRT L  L  + S +K Y D+QTLLS AMTN+ TCL+G  YS
Sbjct  121   EKRALQDCVELLGETIAELRTALSDLSPKKSASKHYNDIQTLLSAAMTNEDTCLDGLFYS  180

Query  708   NKN-VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDG  532
              KN +  ++   +  I+ HVSN+L+ML KIK+     S    P         E+G MK+G
Sbjct  181   TKNNLTRYVEDNLHTIAHHVSNSLAMLNKIKRTSVSSSDEVFP---------EYGAMKNG  231

Query  531   FPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHI  352
             FPKWL RR+RALL+ P      + K D+ VAKDGSG+F +IN ALSAAP+S++TR+VI+I
Sbjct  232   FPKWLKRRERALLQVPV----NETKFDLAVAKDGSGNFTTINEALSAAPNSTNTRFVIYI  287

Query  351   KAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGI  172
             K GSY+EYV+VDKKK MIMFVGDG+GKT+IKGNRN  DGW TFRSATVAVVG GF+A GI
Sbjct  288   KEGSYFEYVEVDKKKNMIMFVGDGVGKTKIKGNRNHVDGWTTFRSATVAVVGKGFLAKGI  347

Query  171   SFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +FEN AGP KHQAV LR+ SD S FY C FV YQDTLYVHS RQF+RECD+YGTVDF
Sbjct  348   TFENYAGPSKHQAVTLRSSSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDIYGTVDF  404



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   435 bits (1118),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 223/396 (56%), Positives = 276/396 (70%), Gaps = 22/396 (6%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATTSDDIH-------QVAHSACDRSLYRDLCVSTLVKTPDL  1003
             + LL   LS     +   N  T+D  H       QVAHSAC+ +LY +LCVSTL+  PDL
Sbjct  3     IFLLLFVLSAVSVTTLKKNPKTTDAPHLRVHKHFQVAHSACEGTLYPELCVSTLLSVPDL  62

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLR  823
              +K +PE+IS T+N T+SE++ +++NCS I +  P+  T+E RA+  CLELF DT+ +L+
Sbjct  63    ASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAINDCLELFHDTIVELK  122

Query  822   TVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVS  649
             + L+ L  +  P+K Y DLQTL S AMTNQYTCL+GF YS+ NVR  I   +  ISRHVS
Sbjct  123   SALNDLSPKKLPSKHYHDLQTLFSGAMTNQYTCLDGFAYSDGNVRDVIKSSLYNISRHVS  182

Query  648   NALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKK  469
             N+L ML KI  +         P         E+G +K GFP WLS  DR LL+    K  
Sbjct  183   NSLVMLKKIPGDNMSSKYEVFP---------EYGRIKRGFPTWLSLNDRKLLQ----KSV  229

Query  468   RKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFV  289
                K D+ VAKDGSG+F +I  A+ AAP+ S+TR+VI+IKAG+Y+E V+VDKKKTM+MFV
Sbjct  230   NLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAGAYFENVEVDKKKTMLMFV  289

Query  288   GDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSD  109
             GDGIGKT +K NR+V DGW TFRSATVAVVGTGFIA GI+ ENSAGP KHQAVALR+ SD
Sbjct  290   GDGIGKTVVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAVALRSGSD  349

Query  108   YSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              S FY C FVGYQDTLYVHS RQF+RECDVYGTVDF
Sbjct  350   LSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDF  385



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   434 bits (1117),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 223/396 (56%), Positives = 276/396 (70%), Gaps = 22/396 (6%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATTSDDIH-------QVAHSACDRSLYRDLCVSTLVKTPDL  1003
             + LL   LS     +   N  T+D  H       QVAHSAC+ +LY +LCVSTL+  PDL
Sbjct  24    IFLLLFVLSAVSVTTLKKNPKTTDAPHLRVHKHFQVAHSACEGTLYPELCVSTLLSVPDL  83

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLR  823
              +K +PE+IS T+N T+SE++ +++NCS I +  P+  T+E RA+  CLELF DT+ +L+
Sbjct  84    ASKRVPELISVTINRTLSELRASSSNCSSIGQSYPNFNTLEKRAINDCLELFHDTIVELK  143

Query  822   TVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVS  649
             + L+ L  +  P+K Y DLQTL S AMTNQYTCL+GF YS+ NVR  I   +  ISRHVS
Sbjct  144   SALNDLSPKKLPSKHYHDLQTLFSGAMTNQYTCLDGFAYSDGNVRDVIKSSLYNISRHVS  203

Query  648   NALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKK  469
             N+L ML KI  +         P         E+G +K GFP WLS  DR LL+    K  
Sbjct  204   NSLVMLKKIPGDNMSSKYEVFP---------EYGRIKRGFPTWLSLNDRKLLQ----KSV  250

Query  468   RKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFV  289
                K D+ VAKDGSG+F +I  A+ AAP+ S+TR+VI+IKAG+Y+E V+VDKKKTM+MFV
Sbjct  251   NLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAGAYFENVEVDKKKTMLMFV  310

Query  288   GDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSD  109
             GDGIGKT +K NR+V DGW TFRSATVAVVGTGFIA GI+ ENSAGP KHQAVALR+ SD
Sbjct  311   GDGIGKTVVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAVALRSGSD  370

Query  108   YSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              S FY C FVGYQDTLYVHS RQF+RECDVYGTVDF
Sbjct  371   LSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDF  406



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   431 bits (1108),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 218/365 (60%), Positives = 268/365 (73%), Gaps = 10/365 (3%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             ++AHS C  +LY  LC+STL   P+L  K+IPEIIS+TVN T+ E+K +  NC++I   +
Sbjct  37    EIAHSHCQDTLYPQLCISTLSLIPNLHQKTIPEIISSTVNATIDEVKGSTENCTKILHKM  96

Query  900   PDLGTMESRALYVCLELFSD-TLADLRTVLDGL----ENSPAKRYADLQTLLSTAMTNQY  736
               L  +E RAL  C+EL  D T+++L T L  L     NSP K Y DLQTLLS AMTNQ 
Sbjct  97    SKLDPIEKRALDDCIELLGDSTISELNTTLYDLSTKNHNSPYKHYNDLQTLLSAAMTNQD  156

Query  735   TCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQ  556
             TCL GF  S  N+R ++   +  I +HVSN+L+ML K+K E    S++   S S   F  
Sbjct  157   TCLSGFDDSKHNLRHYVEHNLHTIEQHVSNSLAMLKKLKPESAPGSSISSSSNSKEVF-P  215

Query  555   EHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSS  376
             E+G MK+G+PKWL ++DR LL+AP      +IK D+ VAKDGSG+F++IN ALSAAP SS
Sbjct  216   EYGAMKNGYPKWLKKKDRTLLQAPI----NQIKFDLVVAKDGSGNFRTINEALSAAPTSS  271

Query  375   DTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVG  196
              TR+VI+IKAG+Y EY+DV++KK+MIMFVGDGIGKT+IKGNRNV DGW TFRSATVAVVG
Sbjct  272   STRFVIYIKAGTYSEYIDVERKKSMIMFVGDGIGKTQIKGNRNVVDGWTTFRSATVAVVG  331

Query  195   TGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVY  16
              GFIA GI+FEN AGP KHQAVALR+ SD S FY C FV YQDTLYVHS RQF+RECDVY
Sbjct  332   NGFIARGITFENFAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDVY  391

Query  15    GTVDF  1
             GTVDF
Sbjct  392   GTVDF  396



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 221/392 (56%), Positives = 280/392 (71%), Gaps = 20/392 (5%)
 Frame = -3

Query  1143  FLSLTVFQSSAMNATTSDDIH-----QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEI  979
             FL    F   ++  +++  IH     Q+A+S C  +LY  LC+STL   P+L  KSIPEI
Sbjct  18    FLLTFFFPPKSLLVSSTQQIHVHKNIQIANSHCQDTLYPKLCISTLSLIPNLHKKSIPEI  77

Query  978   ISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLAD-LRTVLDGLE  802
             IS+ VNVT++E+K++A NCS I   +  L  +E RAL  C+EL  DT  D L+T L+ L 
Sbjct  78    ISSNVNVTMNEVKSSAENCSNILHHMSKLDPIEKRALDDCIELLGDTTIDELQTTLNDLS  137

Query  801   -----NSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALS  637
                  NSP K Y DLQTLLS AMTNQ TCLEG   S   +  +I K +  IS HVSN+L+
Sbjct  138   TKNSSNSPLKHYNDLQTLLSGAMTNQDTCLEGIHKSKHKLSQYIEKNLHTISHHVSNSLA  197

Query  636   MLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIK  457
             ML K+K   ++ S+      +S+    E+G MK+G+PKWL ++DR LL+AP      +IK
Sbjct  198   MLKKLKTGSSQGSSS-----NSNEVFPEYGTMKNGYPKWLQKKDRTLLQAPL----NQIK  248

Query  456   ADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGI  277
              ++ VAKDGSG+F +INAALSAAP+SS TR+VI+IKAG+Y+EY+DV++KK+MIMF+GDGI
Sbjct  249   FNLVVAKDGSGNFTTINAALSAAPNSSSTRFVIYIKAGTYFEYIDVERKKSMIMFIGDGI  308

Query  276   GKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVF  97
             GKT IKGNRNV DGW TFRSATVAVVG GF+A GI+FEN AGP KHQAVALR+ SD S F
Sbjct  309   GKTVIKGNRNVVDGWTTFRSATVAVVGNGFLARGITFENYAGPSKHQAVALRSGSDLSAF  368

Query  96    YDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             Y C F+ YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  369   YQCSFIAYQDTLYVHSLRQFYRDCDVYGTVDF  400



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   427 bits (1099),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 221/381 (58%), Positives = 271/381 (71%), Gaps = 21/381 (6%)
 Frame = -3

Query  1119  SSAMNATTSDDIH-----QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVT  955
             SS   AT +  IH     Q+A S C+ +L+ +LCVSTL   P+L  KSI EIIS+TV V 
Sbjct  36    SSTAVATRTPHIHVHKNIQIAQSHCEGTLHPELCVSTLSSFPNLHRKSIAEIISSTVKVA  95

Query  954   VSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL--ENSPAKRY  781
             V E++ +A NCS +RR VP L  +E RAL  C+EL  +T+A+LRT L  L  + S +K Y
Sbjct  96    VGEVRDSAHNCSDLRRNVPKLEPIEKRALQDCVELLGETIAELRTALTDLSPKKSASKHY  155

Query  780   ADLQTLLSTAMTNQYTCLEGFPYSNKN-VRPFIIKRVEQISRHVSNALSMLTKIKKEKNK  604
              D+QTLLS AMTN+ TCL+G  Y  KN +  ++   +  I+ HVSN+L+ML KIK+    
Sbjct  156   NDIQTLLSAAMTNEDTCLDGLFYCTKNNLTRYVEDNLHTIAHHVSNSLAMLNKIKRTSVS  215

Query  603   PSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSG  424
              S    P         E+G +K+GFP WL RR+RALL+ P  +     K D+ VAKDGSG
Sbjct  216   SSEEVFP---------EYGAVKNGFPNWLKRRERALLQTPVSQ----TKLDLVVAKDGSG  262

Query  423   DFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNV  244
             +F +IN ALSAAP+SS TR+VI+IK GSY+EYV+VDKKKTMIMFVGDGIGKT+IKGNRN 
Sbjct  263   NFTTINEALSAAPNSSSTRFVIYIKEGSYFEYVEVDKKKTMIMFVGDGIGKTKIKGNRNH  322

Query  243   KDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDT  64
              DGW TFRSATVAVVG GF+A GI+FEN AGP KHQAVALR+ SD S FY C FV YQDT
Sbjct  323   VDGWTTFRSATVAVVGKGFLAKGITFENYAGPSKHQAVALRSSSDLSAFYQCSFVAYQDT  382

Query  63    LYVHSRRQFFRECDVYGTVDF  1
             LYVHS RQF+R+CDVYGTVDF
Sbjct  383   LYVHSLRQFYRDCDVYGTVDF  403



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   424 bits (1090),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 210/369 (57%), Positives = 266/369 (72%), Gaps = 22/369 (6%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             Q+AHS C  + Y DLCVSTL   PDLR +++PEIIS  VN TV E++ +  NC+RIRR +
Sbjct  68    QIAHSTCQDTFYPDLCVSTLATFPDLRQRTLPEIISGMVNSTVFEVRDSKQNCTRIRRKL  127

Query  900   PDLGTMESRALYVCLELFSDTLADLRTVLDGLEN--SPAKRYADLQTLLSTAMTNQYTCL  727
              +L  ++ RAL  CL+L  DT A L+  +  L +  S  + Y DLQTL S AMTNQ TCL
Sbjct  128   QNLDPLDRRALEDCLQLLDDTFAQLKAAISDLSSNKSALQHYMDLQTLFSAAMTNQDTCL  187

Query  726   EGFPYSN-KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH  550
             +GF +S  K +R FI  R+ +IS HVSN+L+ML ++KK++    A+F          +E 
Sbjct  188   DGFAFSGRKYIRKFIEGRLRKISHHVSNSLAMLKRVKKQQAAAGAVF---------PEEE  238

Query  549   GEMK------DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAA  388
             GE        DGFP WL ++DRALL+AP      + K ++TVAKDGSG+F +IN AL AA
Sbjct  239   GEFGTPVKSGDGFPTWLKKKDRALLQAPL----NQTKVNLTVAKDGSGNFTTINDALQAA  294

Query  387   PDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATV  208
             P+SS TR+VI+IKAG+YYEY++V+++KTMIMF+GDGIGKT IKGNR+V  GW TFRS+TV
Sbjct  295   PNSSTTRFVIYIKAGAYYEYIEVERRKTMIMFMGDGIGKTVIKGNRSVGAGWTTFRSSTV  354

Query  207   AVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRE  28
             AVVG GFIA GI+ EN AGP +HQAVALR+ SD S FY C F+GYQDTLYVHS RQF+RE
Sbjct  355   AVVGDGFIARGITVENYAGPSQHQAVALRSGSDLSAFYQCSFIGYQDTLYVHSLRQFYRE  414

Query  27    CDVYGTVDF  1
             CDVYGTVDF
Sbjct  415   CDVYGTVDF  423



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 218/412 (53%), Positives = 285/412 (69%), Gaps = 24/412 (6%)
 Frame = -3

Query  1200  MQNLGRNPIMLVPVVLLAAFLSLTVFQSSAMNATTSDD----------IHQVAHSACDRS  1051
             M NL    I+ V   LL  FL  T F ++ +  T + D          I  VA S C  +
Sbjct  1     MNNLTLASILTVISALLL-FLGTTHFTNTPITITRAPDQKHLHHFQKHIQVVAKSTCQGT  59

Query  1050  LYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRA  871
             LY DLCVSTL   PDL  KS+P++IS+ VN T+ E+++++ NCS +++++ +L  ++ RA
Sbjct  60    LYPDLCVSTLATFPDLATKSVPQVISSVVNHTMYEVRSSSYNCSGLKKMLKNLNPLDQRA  119

Query  870   LYVCLELFSDTLADLRTVLDGLENSP--AKRYADLQTLLSTAMTNQYTCLEGFPYSNKNV  697
             L  CL+LF DT  +L+  +D L  S   +KR+ DLQT+LS AMTN YTCL+GF YS   V
Sbjct  120   LDDCLKLFEDTNVELKATIDDLSKSTIGSKRHHDLQTMLSGAMTNLYTCLDGFAYSKGRV  179

Query  696   RPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWL  517
             R  I K++ +IS HVSN+L+ML K+   K   +       S S    E+G MK GFP W+
Sbjct  180   RDRIEKKLLEISHHVSNSLAMLNKVPGVKKLTT-------SESVVFPEYGNMKKGFPSWV  232

Query  516   SRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSY  337
             S +DR LL+A    K ++ K D+ VAKDG+G+F +I  AL+ AP+SS TR+VIHIK G+Y
Sbjct  233   SSKDRKLLQA----KVKETKFDLLVAKDGTGNFTTIGEALAVAPNSSTTRFVIHIKEGAY  288

Query  336   YEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENS  157
             +E V+V +KKT +MFVGDGIGKT +KG+RNV DGW TF+SATVAVVG GFIA GI+FENS
Sbjct  289   FENVEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVVGAGFIAKGITFENS  348

Query  156   AGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AGP+KHQAVALR+ +D+S FY C FVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  349   AGPDKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  400



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 207/362 (57%), Positives = 264/362 (73%), Gaps = 16/362 (4%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             Q+AHS C+ +LY +LCVSTL   PDL +K++PE+I+ATV+ TV E+K +A+NCS IRR +
Sbjct  50    QIAHSHCEGTLYPELCVSTLSTFPDLASKTVPEVIAATVSHTVGEVKLSASNCSGIRRKL  109

Query  900   PDLGTMESRALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCL  727
              +L T+E RA+  CLEL   T+A L++ +  L   NSPAK Y DLQTLLS ++TN YTCL
Sbjct  110   KNLNTLEGRAINDCLELHDCTIAQLQSTISDLSHNNSPAKHYHDLQTLLSGSITNLYTCL  169

Query  726   EGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHG  547
             +GF YS K++R  I   +  IS HVSN+L+ML KI   ++  S +F           E+G
Sbjct  170   DGFAYSKKHIRSSIEGPLRNISHHVSNSLAMLKKIPGVQSSKSEIF----------PEYG  219

Query  546   EMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTR  367
               KDGFP WLS +DR LL+A       +I  ++TVAKDGSGDF +I  A++AAP+SS TR
Sbjct  220   STKDGFPAWLSGKDRRLLQA----SASQIHYNLTVAKDGSGDFTTIGEAIAAAPNSSTTR  275

Query  366   YVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGF  187
             +VIHIKAG+Y+EY+D+ + KTM+M VGDG+  T IKGNR+V  GW TF+S TVAVV   F
Sbjct  276   FVIHIKAGAYFEYLDIARSKTMLMLVGDGLENTYIKGNRSVGGGWTTFQSGTVAVVANNF  335

Query  186   IAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTV  7
             IA GISFEN AGP  HQAVALR+ +D SVFY CRF+GYQDTLYVHS RQF+RECDVYGT+
Sbjct  336   IAKGISFENYAGPSNHQAVALRSGADLSVFYLCRFIGYQDTLYVHSLRQFYRECDVYGTI  395

Query  6     DF  1
             DF
Sbjct  396   DF  397



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 230/405 (57%), Positives = 287/405 (71%), Gaps = 14/405 (3%)
 Frame = -3

Query  1200  MQNLGRNPIMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTL  1021
             M N  R P +L+    L+A + L +F S  ++  T +   ++AHS C  +LY  LC+STL
Sbjct  1     MYNQRRKPSLLL---TLSAII-LLIFFSLPISLQTQNIQLEIAHSHCQDTLYPQLCISTL  56

Query  1020  VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSD  841
                P+L  K+IPEIIS+TVN TV E+K +  NC+ I   +  L  +E RAL  C+EL  D
Sbjct  57    SLIPNLHQKTIPEIISSTVNTTVDEVKASTENCTNILHKMSKLDPIEKRALDDCIELLGD  116

Query  840   -TLADLRTVLDGL----ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKR  676
              T+++L T L  L     NSP K Y DLQTLLS AMTNQ TCL GF  S  N+R +I   
Sbjct  117   STISELNTTLYDLSTKNHNSPYKHYNDLQTLLSAAMTNQDTCLGGFDDSKHNLRHYIEHN  176

Query  675   VEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRAL  496
             +  I +HVSN+L+ML K+K     P +    S +S+    E+G MK+G+PKWL ++DRAL
Sbjct  177   LHTIEQHVSNSLAMLKKLKT-GTAPGSSIPSSSNSNEVFPEYGAMKNGYPKWLKKKDRAL  235

Query  495   LEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVD  316
             L+AP      +IK D+ VAKDGSG+F++IN ALSAAP SS TR+VI+IKAG+Y+EY+DV+
Sbjct  236   LQAPI----NQIKFDLVVAKDGSGNFRTINEALSAAPSSSSTRFVIYIKAGTYFEYIDVE  291

Query  315   KKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQ  136
             +KK+MIMFVGDGIGKT+IKGNRNV DGW TFRSATVAVVG GFIA GI+FEN AGP KHQ
Sbjct  292   RKKSMIMFVGDGIGKTQIKGNRNVVDGWTTFRSATVAVVGNGFIARGITFENFAGPSKHQ  351

Query  135   AVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR+ SD S FY C FV YQDTLYVHS RQF+RECDVYGTVDF
Sbjct  352   AVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDF  396



>ref|XP_011079629.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=566

 Score =   421 bits (1081),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 208/363 (57%), Positives = 272/363 (75%), Gaps = 14/363 (4%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRR-V  904
             Q+A S C+ +LY DLCVST+   P+LR K++PEIIS T+NVT+ E++ +A+NCS +RR +
Sbjct  48    QIAKSTCEGTLYPDLCVSTVAAFPELRRKTLPEIISGTINVTMKEVRASASNCSSLRRKL  107

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLE--NSPAKRYADLQTLLSTAMTNQYTC  730
             +  L  ++ +AL  CLELFSDT+ +L+ +L  L   NSP K Y DLQTLLS AMTNQ TC
Sbjct  108   MKKLAPLDLQALDDCLELFSDTVGELKRILAELSAGNSPEKYYDDLQTLLSGAMTNQDTC  167

Query  729   LEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH  550
             L+GF YS  N R  I  R+++I++H+SN+L+M+ K+KK   K      P +       E+
Sbjct  168   LDGFAYSKNNTRQLIQGRLKRITKHMSNSLAMVKKLKKRSKK-----KPGHGEEF--PEY  220

Query  549   GEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDT  370
             G+MKDG+P WL + DR LL+        + K D+ VA+DGSG+F +IN AL AAP++SDT
Sbjct  221   GQMKDGYPTWLKKNDRRLLQTAA----NETKYDLVVAQDGSGNFTTINEALDAAPNNSDT  276

Query  369   RYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTG  190
             R+VI+IK G+YYEY++V +KKTMIMF+GDGIGKT IKGNR+V DGW TFRS+TVAV+G G
Sbjct  277   RFVIYIKGGAYYEYIEVVRKKTMIMFLGDGIGKTLIKGNRSVVDGWTTFRSSTVAVLGNG  336

Query  189   FIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGT  10
             FIA GI+FEN AGP KHQAVALR+ +D+S FY C FV YQDTLYVHS RQF+RECD+YGT
Sbjct  337   FIAKGITFENYAGPSKHQAVALRSGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDIYGT  396

Query  9     VDF  1
             +DF
Sbjct  397   IDF  399



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   419 bits (1078),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 218/402 (54%), Positives = 282/402 (70%), Gaps = 27/402 (7%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIH--------QVAHSACDRSLYRDLCVSTL  1021
             + L+P+ +L   ++L  F+  A  ++ + +I         Q+AHSAC  +LY +LCVSTL
Sbjct  12    LFLLPISILV--VTLLSFKRPAKFSSKTIEIPRLHIHKHIQIAHSACKGTLYPELCVSTL  69

Query  1020  VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSD  841
             V  PDL +KS+PE ISAT+N T+ E++ ++ANC+ IR  +  LG +E  AL  C+ELF D
Sbjct  70    VSLPDLASKSLPEFISATLNKTMDEVRASSANCNAIRNKI-KLGPLEKVALKDCIELFDD  128

Query  840   TLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQ  667
             T+A+L++ +  L    S +K Y DLQTLLS AMTNQYTCL+GF  S   VR  I K +  
Sbjct  129   TIAELKSAISDLAPRKSTSKHYHDLQTLLSGAMTNQYTCLDGFARSKGKVRKAIKKGLYN  188

Query  666   ISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA  487
             IS HVSN+L+ML KI           G + S S    E+G +K GFP WLS +DR LL+A
Sbjct  189   ISHHVSNSLAMLKKIP----------GVNTSKSEVFPEYGNVKHGFPSWLSSKDRKLLQA  238

Query  486   PTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKK  307
                      K D+ VAKDG+G+F +I+ A+ AAP+SSDTR+VI+IKAG+Y+E V+V++KK
Sbjct  239   SA----NATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIYIKAGAYFENVEVERKK  294

Query  306   TMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVA  127
              M++F+GDGIGKT +K  R+V DGW TFRSATVAVVG GFIA GI+FENSAGP KHQAVA
Sbjct  295   KMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQAVA  354

Query  126   LRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             LR+ SD S FY C FVGYQDTLYVHS RQF+RECDVYGT+DF
Sbjct  355   LRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDF  396



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   417 bits (1071),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 210/362 (58%), Positives = 266/362 (73%), Gaps = 15/362 (4%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             Q+AHSAC+ +LY +LCVST+   PDL +K+IP+IISATV  TV+E++T+A+NC+  R   
Sbjct  51    QIAHSACEGTLYPELCVSTVSSFPDLASKTIPDIISATVQHTVNEVRTSASNCTGJRMKR  110

Query  900   PDLGTMESRALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCL  727
               L  ++  AL  CLEL  +T+A+L++ L  L  +NSP++ Y DL TLLS AMTN+YTCL
Sbjct  111   RTLDPLQQMALDDCLELLDETVAELKSALSDLSPKNSPSRHYNDLGTLLSAAMTNEYTCL  170

Query  726   EGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHG  547
             +GF +S  NVR  I + +  IS  VSN+L+ML KI K      A   P         E+G
Sbjct  171   DGFVHSKGNVREEIKQGLYNISHSVSNSLAMLKKIPKSNRSSKAEVFP---------EYG  221

Query  546   EMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTR  367
              M  GFP+W+S RDR LL+A T       K D+ VAKDGSG+F +I+ A++AAP+S+ TR
Sbjct  222   RMVGGFPRWVSPRDRKLLQAST----NTTKFDLVVAKDGSGNFTTISDAVAAAPNSTTTR  277

Query  366   YVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGF  187
             +VI+IKAG+Y+E VDVDKKKTM+MFVGDGIGKT +K NR+V DGW TFRSATVAVVG GF
Sbjct  278   FVIYIKAGAYFENVDVDKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGNGF  337

Query  186   IAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTV  7
             IA  ++FENSAGP KHQAVALR+ SD S FY C FVGYQDTLYVHS RQF+R+CD+YGTV
Sbjct  338   IARDMTFENSAGPNKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRDCDIYGTV  397

Query  6     DF  1
             DF
Sbjct  398   DF  399



>ref|XP_009628637.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=567

 Score =   416 bits (1070),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 229/414 (55%), Positives = 287/414 (69%), Gaps = 25/414 (6%)
 Frame = -3

Query  1200  MQNLGRNPIMLVPVVLLAAFLSLTVF-------QSSAMNATTSDDIH-----QVAHSACD  1057
             M NL R   +L+ +  L+A +SLT F        SS    TT+  IH     Q+AHS C 
Sbjct  1     MYNLRRKTSLLLTLFALSAIVSLTFFTLSNNPKSSSKTVLTTTPHIHVHKNIQIAHSHCQ  60

Query  1056  RSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMES  877
              + Y  LCVSTL   PDL  KSI +IIS+T+NVTV+E+K +A NC+ IR  +P L   E 
Sbjct  61    DTRYPKLCVSTLSLIPDLAQKSISQIISSTINVTVAEVKASARNCTDIREDLPQLEPYEK  120

Query  876   RALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNK  703
             RAL  C++L  +T+ +LRT L  L  +  P++ Y DLQTLLS AMTNQ TCL+G   S K
Sbjct  121   RALEDCVQLLDNTIIELRTTLSDLNPKKPPSQNYNDLQTLLSAAMTNQATCLDGLARSKK  180

Query  702   NVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPK  523
             N+R ++   +  I+ HVSN LSML K+KK           S  S     E+G +K+GFPK
Sbjct  181   NLRRYVQHNLHTIAHHVSNCLSMLKKMKKSSFS-------SSKSQEIYPEYGAVKNGFPK  233

Query  522   WLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAG  343
             WL +RDRALL+AP  +     K D+ VAKDGSG+F +IN ALSAAP++S TR+VI+IKAG
Sbjct  234   WLKKRDRALLQAPINE----TKIDLVVAKDGSGNFSTINEALSAAPNASTTRFVIYIKAG  289

Query  342   SYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFE  163
             +Y+EY++V +KK MIMF+GDGIGKT IKGNR+V DGW TFRSATVAVVG GF+A GI+FE
Sbjct  290   AYFEYIEVVRKKPMIMFLGDGIGKTLIKGNRSVVDGWTTFRSATVAVVGNGFLAKGITFE  349

Query  162   NSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             N AGP KHQAVA+R+ SD+S FY C FV YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  350   NYAGPSKHQAVAVRSGSDFSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDF  403



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 217/402 (54%), Positives = 281/402 (70%), Gaps = 27/402 (7%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIH--------QVAHSACDRSLYRDLCVSTL  1021
             + L+P+ +L   ++L  F+  A  ++ + +I         Q+AHSAC  +LY +LCVSTL
Sbjct  12    LFLLPISILV--VTLLSFKRPAKFSSKTIEIPRLHIHKHIQIAHSACKGTLYPELCVSTL  69

Query  1020  VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSD  841
             V   DL +KS+PE ISAT+N T+ E++ ++ANC+ IR  +  LG +E  AL  C+ELF D
Sbjct  70    VSLSDLASKSLPEFISATLNKTMDEVRASSANCNAIRNKI-KLGPLEKVALKDCIELFDD  128

Query  840   TLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQ  667
             T+A+L++ +  L    S +K Y DLQTLLS AMTNQYTCL+GF  S   VR  I K +  
Sbjct  129   TIAELKSAISDLAPRKSTSKHYHDLQTLLSGAMTNQYTCLDGFARSKGKVRKAIKKGLYN  188

Query  666   ISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA  487
             IS HVSN+L+ML KI           G + S S    E+G +K GFP WLS +DR LL+A
Sbjct  189   ISHHVSNSLAMLKKIP----------GVNTSKSEVFPEYGNVKHGFPSWLSSKDRKLLQA  238

Query  486   PTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKK  307
                      K D+ VAKDG+G+F +I+ A+ AAP+SSDTR+VI+IKAG+Y+E V+V++KK
Sbjct  239   SA----NATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIYIKAGAYFENVEVERKK  294

Query  306   TMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVA  127
              M++F+GDGIGKT +K  R+V DGW TFRSATVAVVG GFIA GI+FENSAGP KHQAVA
Sbjct  295   KMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQAVA  354

Query  126   LRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             LR+ SD S FY C FVGYQDTLYVHS RQF+RECDVYGT+DF
Sbjct  355   LRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDF  396



>ref|XP_009765668.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=566

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 227/413 (55%), Positives = 287/413 (69%), Gaps = 24/413 (6%)
 Frame = -3

Query  1200  MQNLGRNPIMLVPVVLLAAFLSLTVF------QSSAMNATTSDDIH-----QVAHSACDR  1054
             M NL R   +L+ +  L+A +S+T F      +SS+    T+  IH     Q+AHS C  
Sbjct  1     MYNLRRKTPLLLTLFALSAIVSVTFFGLSNNPKSSSKTVQTTPHIHVHKNIQIAHSHCQD  60

Query  1053  SLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESR  874
             + Y  LCVSTL   PDL  KSI +IIS+T+NVTV+E+K +A NC+ IR  +P L   E R
Sbjct  61    TRYPKLCVSTLSLIPDLAQKSISQIISSTINVTVAEVKASAKNCTEIREDLPRLEPYEKR  120

Query  873   ALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKN  700
             AL  C++L  +T+ +L+T L  L  + SP++ Y DLQTLLS AMTNQ TCL+G     KN
Sbjct  121   ALEDCVQLLDNTIIELKTTLSDLHPKKSPSQNYNDLQTLLSAAMTNQATCLDGLARCKKN  180

Query  699   VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKW  520
             +R ++   +  I+ HVSN L+ML K+KK           S  S     E+G +K+GFPKW
Sbjct  181   LRRYVQHNLHTIAHHVSNCLAMLKKMKKSSFA-------SSKSQEIYPEYGAVKNGFPKW  233

Query  519   LSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGS  340
             L +RDRALL+AP  +     K D+ VAKDGSG+F +IN ALSAAP++S TR+VIHIKAG+
Sbjct  234   LKKRDRALLQAPINE----TKIDLVVAKDGSGNFSTINEALSAAPNASRTRFVIHIKAGA  289

Query  339   YYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFEN  160
             YYEY++V ++K MIMF+GDGIGKT IKGNR+V DGW TFRSATVAVVG GFIA GI+FEN
Sbjct  290   YYEYIEVVRRKPMIMFLGDGIGKTLIKGNRSVVDGWTTFRSATVAVVGNGFIAKGITFEN  349

Query  159   SAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              AGP KHQAVA+R+ SD S FY C FV YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  350   FAGPSKHQAVAVRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDF  402



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 215/402 (53%), Positives = 281/402 (70%), Gaps = 27/402 (7%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIH--------QVAHSACDRSLYRDLCVSTL  1021
             + L+P+ +L   ++L  F+  A  ++ + +I         Q+AHSAC  +LY +LCVSTL
Sbjct  12    LFLLPISILV--VTLLSFKRPAKFSSKTIEIPRLHIHKHIQIAHSACKGTLYPELCVSTL  69

Query  1020  VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSD  841
             V  PDL +KS+ E ISAT+N T+ E++ ++A+C+ IR  +  LG +E  AL  C+ELF D
Sbjct  70    VSLPDLASKSLQEFISATLNKTMDEVRASSADCNAIRNKM-KLGPLEKVALKDCIELFDD  128

Query  840   TLADLRTVLD--GLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQ  667
             T+A+L++ +    L    +K Y DLQTLLS AMTNQYTCL+GF  S   VR  I K +  
Sbjct  129   TIAELKSAISNLALRKPTSKHYHDLQTLLSGAMTNQYTCLDGFARSKGKVRKAIKKGLYN  188

Query  666   ISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA  487
             IS HVSN+L+ML KI           G + S S    E+G +K GFP WLS +DR LL+A
Sbjct  189   ISHHVSNSLAMLKKIP----------GVNASKSEVFPEYGNVKHGFPSWLSTKDRKLLQA  238

Query  486   PTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKK  307
                      K D+ VAKDG+G+F +I+ A+ AAP+SSDTR+VIHIKAG+Y+E V+V++KK
Sbjct  239   SA----NATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIHIKAGAYFENVEVERKK  294

Query  306   TMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVA  127
              M++F+GDGIGKT +K NR+V DGW TFRSATVAVVG GFIA GI+FENSAGP KHQAVA
Sbjct  295   KMLVFIGDGIGKTVVKANRSVVDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQAVA  354

Query  126   LRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             LR+ SD S FY C FVGYQDTLYVH+ RQF+RECD+YGT+DF
Sbjct  355   LRSGSDLSAFYQCSFVGYQDTLYVHTLRQFYRECDIYGTIDF  396



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   414 bits (1065),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 214/407 (53%), Positives = 284/407 (70%), Gaps = 23/407 (6%)
 Frame = -3

Query  1200  MQNLGRNPIMLVPVVLLAAFLSLTVFQSSAMNATTSDDIH-----QVAHSACDRSLYRDL  1036
             M NL    I+ V    ++A L L+   ++    ++   +H     QVA S C  +LY DL
Sbjct  1     MNNLTLASILTV----ISALLFLSTHFTNTPTRSSEKHLHFHKHMQVAQSTCQGTLYPDL  56

Query  1035  CVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCL  856
             CVSTL   PDL +KS+P++IS+ VN T+ E+K++  NCS +++ + +L  ++ RAL  CL
Sbjct  57    CVSTLATFPDLTSKSVPQVISSVVNHTMYEVKSSFYNCSSLKKKIRNLNPLDQRALDDCL  116

Query  855   ELFSDTLADLRTVLDGLENSP--AKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFII  682
             +LF DT  +L+T +D L  S   +KR+ DLQTLLS AMTN YTCL+GF YS   VR  I 
Sbjct  117   KLFQDTNLELKTTIDDLSKSSIGSKRHHDLQTLLSGAMTNLYTCLDGFAYSKGRVRDRIE  176

Query  681   KRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDR  502
             K++ +IS H+SN+L+ML K+   K + S         S    E+G+MK GFP W+S +DR
Sbjct  177   KKLLEISHHMSNSLAMLKKVPGVKTRTS--------KSEVFPEYGKMKKGFPLWVSPKDR  228

Query  501   ALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVD  322
              LL+A   + K     D+ VAKDG+G+F +I  AL+ AP+SS TR+VIHIK G+Y+E V+
Sbjct  229   KLLQASVNESK----FDLVVAKDGTGNFTTIGEALALAPNSSTTRFVIHIKEGAYFENVE  284

Query  321   VDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEK  142
             V +KKT +MFVGDGIGKT +KG+RNV DGW TF+SATVAV+G GFIA GI+FENSAGPEK
Sbjct  285   VIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVLGEGFIAKGITFENSAGPEK  344

Query  141   HQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             HQAVALR+ +D+S F+ C FVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  345   HQAVALRSGADFSAFFRCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  391



>emb|CBI36883.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   414 bits (1064),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 206/362 (57%), Positives = 261/362 (72%), Gaps = 23/362 (6%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             Q+AHS C+ +LY +LCVSTL   PDL +K++PE+I+ATV+ TV E+K +A+NCS IRR +
Sbjct  60    QIAHSHCEGTLYPELCVSTLSTFPDLASKTVPEVIAATVSHTVGEVKLSASNCSGIRRKL  119

Query  900   PDLGTMESRALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCL  727
              +L T+E RA+  CLEL   T+A L++ +  L   NSPAK Y DLQTLLS ++TN YTCL
Sbjct  120   KNLNTLEGRAINDCLELHDCTIAQLQSTISDLSHNNSPAKHYHDLQTLLSGSITNLYTCL  179

Query  726   EGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHG  547
             +GF YS K++R  I   +  IS HVSN+L+ML KI         +F           E+G
Sbjct  180   DGFAYSKKHIRSSIEGPLRNISHHVSNSLAMLKKIP-------GIF----------PEYG  222

Query  546   EMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTR  367
               KDGFP WLS +DR LL+A   +    I  ++TVAKDGSGDF +I  A++AAP+SS TR
Sbjct  223   STKDGFPAWLSGKDRRLLQASASQ----IHYNLTVAKDGSGDFTTIGEAIAAAPNSSTTR  278

Query  366   YVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGF  187
             +VIHIKAG+Y+EY+D+ + KTM+M VGDG+  T IKGNR+V  GW TF+S TVAVV   F
Sbjct  279   FVIHIKAGAYFEYLDIARSKTMLMLVGDGLENTYIKGNRSVGGGWTTFQSGTVAVVANNF  338

Query  186   IAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTV  7
             IA GISFEN AGP  HQAVALR+ +D SVFY CRF+GYQDTLYVHS RQF+RECDVYGT+
Sbjct  339   IAKGISFENYAGPSNHQAVALRSGADLSVFYLCRFIGYQDTLYVHSLRQFYRECDVYGTI  398

Query  6     DF  1
             DF
Sbjct  399   DF  400



>ref|XP_004247400.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=562

 Score =   413 bits (1061),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 227/404 (56%), Positives = 286/404 (71%), Gaps = 21/404 (5%)
 Frame = -3

Query  1185  RNPIMLVPVVLLAAFL--SLTVFQSSAMNATTSDDIH-----QVAHSACDRSLYRDLCVS  1027
             + P++L    LLA F+  SLT F S + N++    IH     Q+AHS C+ +LY+ LCVS
Sbjct  7     KTPLLLS---LLAIFIIVSLTFFTSLSKNSSEIVHIHVHKNIQIAHSHCEDALYKQLCVS  63

Query  1026  TLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELF  847
             TL   PDL  KSI +IIS+T+NVTV E+K +A NC+ IR  +P L   E RAL  C++L 
Sbjct  64    TLASIPDLPQKSISQIISSTINVTVVEVKASAKNCTDIREDLPKLEPYEKRALEDCIQLL  123

Query  846   SDTLADLRTVLDGLE--NSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRV  673
              DT+ +L++ L  L    S ++ Y DLQTLLS AMTNQ TCL+G   S KN+R F+ +R+
Sbjct  124   DDTIIELKSSLVALHPNRSLSQNYNDLQTLLSAAMTNQATCLDGLGRSTKNLRRFVQRRL  183

Query  672   EQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALL  493
               IS HVSN L+ML K+KK  +        +  S     E+G + DGFP W+ RRDRALL
Sbjct  184   HTISHHVSNCLAMLKKLKKSSSSLK-----TRKSLEIYPEYGVVHDGFPNWIKRRDRALL  238

Query  492   EAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDK  313
             + P      + K D+ VAKDG+G+F +IN ALSAAP+SS TR+VI+IKAG+Y+EYV+V K
Sbjct  239   QTPI----NQTKIDLIVAKDGTGNFSTINDALSAAPNSSKTRFVIYIKAGAYFEYVEVVK  294

Query  312   KKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQA  133
             KK+MIMF+GDGIGKT IKGNR+V DGW TFRSATVAVVG GF+A GI+FEN AGP KHQA
Sbjct  295   KKSMIMFLGDGIGKTLIKGNRSVVDGWTTFRSATVAVVGNGFLAKGITFENYAGPSKHQA  354

Query  132   VALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VA+R+ SD S FY C FV YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  355   VAVRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDF  398



>ref|XP_006359860.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=562

 Score =   412 bits (1058),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 221/387 (57%), Positives = 280/387 (72%), Gaps = 16/387 (4%)
 Frame = -3

Query  1140  LSLTVFQSSAMNATTSDDIH-----QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEII  976
             + LT F S + N++ +  IH     Q+AHS C+ +LY+ LCVSTL   PDL  KSI +II
Sbjct  21    VCLTFFTSLSKNSSETVHIHVHKNIQIAHSHCEDALYKQLCVSTLSSIPDLPQKSISQII  80

Query  975   SATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL--E  802
             S+T+NVTV E+K +A NC+ IR  +P L   E RAL  C++L  +T+ DL++ L  L   
Sbjct  81    SSTINVTVVEVKASAKNCTDIREDLPKLEPYEKRALEDCIQLLDNTIIDLKSSLLALSPN  140

Query  801   NSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKI  622
              S ++ Y DLQTLLS AMTNQ TCL+G   S KN+R F+ +R+  IS HVSN L+ML K+
Sbjct  141   RSLSQNYNDLQTLLSAAMTNQATCLDGLGRSKKNLRRFVQRRLHTISHHVSNCLAMLKKL  200

Query  621   KKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTV  442
             KK  +        +  S     E+G + DGFPKW+ RRDRALL+AP      + K D+ V
Sbjct  201   KKSSSSLK-----TRKSLEIYPEYGVVHDGFPKWIKRRDRALLQAPI----NQTKIDLVV  251

Query  441   AKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRI  262
             AKDG+G+F +IN ALSAAP+SS TR+VI+IKAG+Y+EYV+V KK++MIMF+GDGIGKT I
Sbjct  252   AKDGTGNFSTINEALSAAPNSSRTRFVIYIKAGAYFEYVEVVKKQSMIMFLGDGIGKTLI  311

Query  261   KGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRF  82
             KGNR+V DGW TFRSATVAVVG GF+A GI+FEN AGP KHQAVA+R+ SD+S FY C F
Sbjct  312   KGNRSVVDGWTTFRSATVAVVGNGFLAKGITFENYAGPSKHQAVAVRSGSDFSAFYQCSF  371

Query  81    VGYQDTLYVHSRRQFFRECDVYGTVDF  1
             V YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  372   VAYQDTLYVHSLRQFYRDCDVYGTVDF  398



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   412 bits (1059),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 213/390 (55%), Positives = 278/390 (71%), Gaps = 16/390 (4%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPE  982
             + LL   +S+T+F   A ++       Q+AHSAC+ +LY +LCVSTL   PDL +K+I +
Sbjct  45    IQLLVLTISITLFLVQASSSIPVLHHLQIAHSACEGTLYPELCVSTLSSFPDLTSKTISQ  104

Query  981   IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL-  805
             +IS+TVN TV E++ +A+NC+ IR+ +     +E RAL  CLELF +T+++L+T L  L 
Sbjct  105   MISSTVNYTVKEVEISASNCTDIRKNLKAQDPLEQRALDDCLELFDETISELQTALSDLS  164

Query  804   -ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNV-RPFIIKRVEQISRHVSNALSML  631
              ++SP+K Y DLQTLLS AMTNQYTCL+G    N+ V R  I + +  IS  VSN+L+ML
Sbjct  165   PKSSPSKHYNDLQTLLSAAMTNQYTCLDGLSLGNEQVIREEIKQNLNNISHLVSNSLAML  224

Query  630   TKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKAD  451
             TK+ K  +       P         E+G+M   FP W+S +DR LL+A T      +K D
Sbjct  225   TKMPKAADTLKDEVFP---------EYGKMAGRFPGWVSPKDRKLLQAST----NTMKFD  271

Query  450   VTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGK  271
             + VAKDGSG+F++I  A++AAP+SS TR+VI+IKAG+Y+E VDV KKKTM+MFVGDGIGK
Sbjct  272   LVVAKDGSGNFRTIGEAVAAAPNSSATRFVIYIKAGTYFENVDVGKKKTMLMFVGDGIGK  331

Query  270   TRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYD  91
             T +K +RNV DGW TFRSATVAVVG GFIA  ++ EN+AGP KHQAVALR+ SD S FY 
Sbjct  332   TVVKASRNVVDGWTTFRSATVAVVGNGFIARDMTIENAAGPSKHQAVALRSGSDLSAFYR  391

Query  90    CRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             C FVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  392   CSFVGYQDTLYVHSLRQFYRECDIYGTVDF  421



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   410 bits (1055),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 204/363 (56%), Positives = 262/363 (72%), Gaps = 17/363 (5%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             Q+AHSAC+ +LY DLCVST+   PDL +K++PE+I AT+N T+ E++ ++ANC+ I + +
Sbjct  50    QIAHSACEGTLYPDLCVSTISVLPDLASKTLPELIQATLNQTMYEVRLSSANCTGIEKRI  109

Query  900   PDLGTMESRALYVCLELFSDTLADLRTVLDGL---ENSPAKRYADLQTLLSTAMTNQYTC  730
                   E  A+  CLELF DTL +L+  L  L   + + ++ Y DLQT LS AMTNQYTC
Sbjct  110   KSYSKREEAAINDCLELFDDTLEELKVALADLAPKKLAVSRNYHDLQTFLSAAMTNQYTC  169

Query  729   LEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH  550
             L+GF  S  NVR  I K +  I+ HVSN+L ML K+           G + S S +  + 
Sbjct  170   LDGFARSKGNVRNIIKKGLHNITHHVSNSLVMLKKVP----------GVNKSKSEYFPQQ  219

Query  549   GEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDT  370
             G +K+GFP WLSR+DR LL+A       + + D+ VAKDG+G+F +IN A++AAP++S+T
Sbjct  220   GRLKNGFPSWLSRQDRILLQASV----NETEFDLIVAKDGTGNFTTINDAVAAAPNNSNT  275

Query  369   RYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTG  190
             R+VI+IKAGSY+E V+V KKK M+MFVGDGIGKT +K NRNV DG+ TFRSATVAVVG G
Sbjct  276   RFVIYIKAGSYFENVEVVKKKKMLMFVGDGIGKTVVKANRNVVDGFTTFRSATVAVVGEG  335

Query  189   FIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGT  10
             FIA GI+FENSAGP KHQAVALR+ SD S FY C FV YQDTLYVHS RQF+RECD+YGT
Sbjct  336   FIAKGITFENSAGPSKHQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGT  395

Query  9     VDF  1
             VDF
Sbjct  396   VDF  398



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   410 bits (1053),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 214/406 (53%), Positives = 281/406 (69%), Gaps = 24/406 (6%)
 Frame = -3

Query  1185  RNPIML--VPVVLLAA----FLSLTVFQ--SSAMNATTSDDIH-QVAHSACDRSLYRDLC  1033
             + P ML  +P +  A       S+T F   + A  +   + +H  VA+S C+ +LY DLC
Sbjct  47    KTPPMLPHIPCIFSAVHVLLLFSVTQFSITAGATRSLQQNHLHFHVANSTCEGTLYPDLC  106

Query  1032  VSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLE  853
             VSTL   PDL +K++PE+I + VN T+ E+  +++NCS +R+ +P L  +E RAL  CL 
Sbjct  107   VSTLTSFPDLTSKTVPEMIRSVVNHTIYEVTLSSSNCSSLRKKLPGLNKLEKRALDDCLN  166

Query  852   LFSDTLADLRTVLDGLENSP--AKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIK  679
             LF +T+ +L+T +  L  S   +KRY D QT LS AMTN YTCL+GF YS  NVR  I +
Sbjct  167   LFDETVEELKTTVKDLSQSTIGSKRYHDSQTFLSGAMTNLYTCLDGFAYSKGNVRDRIEE  226

Query  678   RVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRA  499
              V +IS  VSN+L+ML K+ ++K +         S +    E+G+MKDGFP W+S  DR 
Sbjct  227   GVLEISHLVSNSLAMLKKVPEKKKQ---------SKNEVFPEYGKMKDGFPSWVSPNDRK  277

Query  498   LLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDV  319
             LL+A       + K D+ VAKDGSG+F +I AA++AAP+SS TR+VIHIKAG+Y+E V+V
Sbjct  278   LLQAAV----NETKFDLVVAKDGSGNFTTIGAAVAAAPNSSATRFVIHIKAGAYFENVEV  333

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKH  139
              +KK+ +M+VGDGIGKT +K +RNV DGW TF+SATVAVVG GFIA GI+FENSAGP KH
Sbjct  334   IRKKSNLMWVGDGIGKTVVKASRNVVDGWTTFQSATVAVVGDGFIAKGITFENSAGPSKH  393

Query  138   QAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR+ +D S FY C FV YQDTLYVHS RQF+RECDVYGTVDF
Sbjct  394   QAVALRSGADLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDF  439



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   408 bits (1049),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 220/424 (52%), Positives = 292/424 (69%), Gaps = 29/424 (7%)
 Frame = -3

Query  1227  SYHSTIDSEMQNLGRNPIMLVPVVLLAAFLSLTVFQSSAMNATTS--------DDIHQVA  1072
             S H+T  + M NL R   +L+ V+  +A L + +F ++ +  + S        + I   A
Sbjct  6     SLHTT--TTMYNLRRRTKLLLSVLPTSALLLILLFSNTHLRNSNSITPKTHVHNRIQLAA  63

Query  1071  HSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI-RRVVPD  895
             HSAC  +LY+DLCVSTL   PDL  KS+P+IIS TV+ TVSE++ +++NC+ I ++    
Sbjct  64    HSACQDTLYKDLCVSTLSTFPDLSTKSVPQIISYTVSHTVSEVQASSSNCTGIIKKQFKK  123

Query  894   LGTMESRALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEG  721
             L  ++  AL  CLELF DT+A+L+ V+  L  E   + RY DL+TLLS AMTNQYTCL+G
Sbjct  124   LDALQQIALDDCLELFDDTIAELKAVISDLSVEKLSSDRYYDLKTLLSGAMTNQYTCLDG  183

Query  720   FPYSNKNVRPFIIKRVEQISRHVSNALSMLTKI----KKEKNKPSALFGPSYSSSSFRQE  553
             F  +   VR  I  R++ IS+HVSNAL ML KI    K E +K S       +SS    E
Sbjct  184   FNDTGI-VRHEIQSRLQTISQHVSNALVMLKKIPGALKYENSKSS-------TSSEMFPE  235

Query  552   HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSD  373
              G M++GFP W+S +DR LL++     K     D+ VAKDG+G+F +I+ A++ AP+SS 
Sbjct  236   FGPMRNGFPTWVSSKDRKLLQSVVNGTKY----DLVVAKDGTGNFTTISEAVAVAPNSSA  291

Query  372   TRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGT  193
             TR+VI+IK+G+Y+E V+V +KKT +MF+GDGIGKT +K +RNV DGW TFRSATVAVVG 
Sbjct  292   TRFVIYIKSGAYFENVEVVRKKTKLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGD  351

Query  192   GFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYG  13
             GFIA GI+FEN+AGP KHQAVA R+ SD+S FY C FVGYQDTLYVHS RQF+RECD+YG
Sbjct  352   GFIAQGITFENAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYG  411

Query  12    TVDF  1
             TVDF
Sbjct  412   TVDF  415



>gb|EPS62329.1| pectinesterase [Genlisea aurea]
Length=560

 Score =   406 bits (1044),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 206/364 (57%), Positives = 262/364 (72%), Gaps = 13/364 (4%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKT-PDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             QVA SACD +LY DLCVST+    P+LR K++PEII+AT+NVT+ E++TA++NCS +RR 
Sbjct  41    QVAESACDGTLYPDLCVSTVSAVLPELRRKTLPEIIAATINVTMKEVRTASSNCSSLRRK  100

Query  903   V-PDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPA--KRYADLQTLLSTAMTNQYT  733
             +   L  +E RAL  CLELFS T +DL  +   L+ S A  K Y DL+TLLS AMTNQYT
Sbjct  101   LNKKLEPLELRALEDCLELFSYTASDLSKIFSDLKASSAQEKYYDDLRTLLSAAMTNQYT  160

Query  732   CLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQE  553
             CL+GF YS  N R  I  R+++IS H SNAL+M+ K+K+   K      P  +       
Sbjct  161   CLDGFAYSKNNTREIIQGRLKRISHHASNALAMVRKLKRRSRKLIEEDSPVVARM-----  215

Query  552   HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSD  373
                 +DGFP W+ + DR  L++           D+ VA+DGSG+F +IN AL+AAP++S+
Sbjct  216   ---RRDGFPAWMKKSDRRFLQS-AANSTNSTSYDLIVAQDGSGNFSTINDALNAAPNNSN  271

Query  372   TRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGT  193
             TR+VI+IK+G+YYEYVD+ + KT+I FVGDGIGKT IKGNR+V DGW TFRSATVAVVG 
Sbjct  272   TRFVIYIKSGAYYEYVDIPRSKTLISFVGDGIGKTLIKGNRSVIDGWTTFRSATVAVVGN  331

Query  192   GFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYG  13
             GFIA GI+ EN AG  KHQAVALR+ +D+S FY C FVGYQDTLYV+S RQFFR+CD+YG
Sbjct  332   GFIATGITIENYAGAVKHQAVALRSGADFSAFYRCSFVGYQDTLYVYSNRQFFRQCDIYG  391

Query  12    TVDF  1
             TVDF
Sbjct  392   TVDF  395



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   402 bits (1034),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 209/403 (52%), Positives = 276/403 (68%), Gaps = 20/403 (5%)
 Frame = -3

Query  1188  GRNPIMLVPVVLLAAFLSLTVFQSSAMNATTSDDIH-----QVAHSACDRSLYRDLCVST  1024
             GR+  +L  + + A +L + +      N+     +H     Q+AHSAC+ +LY +LCVST
Sbjct  6     GRSKFLLTLLPISALYLIILLATPHFKNSEEIPHLHIQKHNQIAHSACEGTLYPELCVST  65

Query  1023  LVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFS  844
             L   PDL  +S+ ++IS+T++ T+ E++ + +NCS I+  +  L  +E  AL  CLELF+
Sbjct  66    LSSLPDLTYRSLQQLISSTISRTMYEVRVSYSNCSGIKNKLRKLNKIERVALNDCLELFT  125

Query  843   DTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVE  670
             +T+ +L   +  L    S ++ + DLQTLLS AMTNQYTCL+GF YS   VR  I   + 
Sbjct  126   ETMDELNVAISDLTSRKSVSQHHHDLQTLLSGAMTNQYTCLDGFAYSRGRVRKTIKNSLY  185

Query  669   QISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLE  490
              ISRHVSN+L+ML KI             S  S +F  E+GE+K GFP WLS +D  LL+
Sbjct  186   NISRHVSNSLAMLKKIPG--------VNASKESEAF-PEYGEVKHGFPSWLSSKDLELLQ  236

Query  489   APTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKK  310
             AP        K D+ VAKDG+G+F +I+ A++AAP+SS TR+VI+IK G+Y+E VDVDKK
Sbjct  237   APL----NATKFDLVVAKDGTGNFSTISQAVAAAPNSSLTRFVIYIKEGAYFENVDVDKK  292

Query  309   KTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
             KT +MF+GDGIGKT +K NR+V  GW TFRSATVAVVG GF+A GI+FENSAGP+ HQAV
Sbjct  293   KTNLMFIGDGIGKTVVKANRSVVGGWTTFRSATVAVVGNGFVAKGITFENSAGPDMHQAV  352

Query  129   ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR+ SD S FY C FVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  353   ALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  395



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score =   404 bits (1038),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 218/430 (51%), Positives = 286/430 (67%), Gaps = 33/430 (8%)
 Frame = -3

Query  1263  YIY--FPPVSSVWLSYHSTIDSEMQNLGRNPIMLVPVVLLAAFLSLTVFQSSAMNATTSD  1090
             YIY  + P+S       S +D+         I+    VLL + L+     ++A      +
Sbjct  48    YIYTMYSPISRKKPPMESHVDT---------ILSAIFVLLLSSLTHFSITANATRTPQEN  98

Query  1089  DIH-QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  913
              +H QVA+S C+ +LY DLCVSTL   PDL +K++P++I + VN T+ E+  +A+NCS +
Sbjct  99    SLHFQVANSTCEGTLYSDLCVSTLASFPDLTSKTLPQMIRSVVNHTIYEVTLSASNCSGL  158

Query  912   RRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSP--AKRYADLQTLLSTAMTNQ  739
             RR +P L  +E RAL  CL LF DT+++L T +  L  S    KRY D QTLLS AMTN 
Sbjct  159   RRNLPKLDKLEQRALDDCLNLFDDTVSELETTIADLSQSTIGPKRYHDAQTLLSGAMTNL  218

Query  738   YTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTK----IKKEKNKPSALFGPSYSS  571
             YTCL+GF YS  +VR    + + +IS HVSN+L+ML K    +KK  +K     G     
Sbjct  219   YTCLDGFAYSKGHVRDRFEEGLLEISHHVSNSLAMLKKLPAGVKKLASKNEVFPG-----  273

Query  570   SSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                   +G++KDGFP WLS +DR LL+A       +   ++ VAKDG+G+F +I  A++ 
Sbjct  274   ------YGKIKDGFPTWLSTKDRKLLQAAV----NETNFNLLVAKDGTGNFTTIAEAVAV  323

Query  390   APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
             AP+SS TR+VIHIKAG+Y+E V+V +KKT +MFVGDGIGKT +K +RNV DGW TF+SAT
Sbjct  324   APNSSATRFVIHIKAGAYFENVEVIRKKTNLMFVGDGIGKTVVKASRNVVDGWTTFQSAT  383

Query  210   VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
             VAVVG GFIA GI+FENSAGP KHQAVALR+ SD+S FY C FV YQDTLYVHS RQF+R
Sbjct  384   VAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDFSAFYKCSFVAYQDTLYVHSLRQFYR  443

Query  30    ECDVYGTVDF  1
             +CDVYGTVDF
Sbjct  444   DCDVYGTVDF  453



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   399 bits (1026),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 215/411 (52%), Positives = 282/411 (69%), Gaps = 23/411 (6%)
 Frame = -3

Query  1200  MQNLGRNPIMLVPVVLLAAFLSLTVFQSSAMNATTSDD--------IHQVAHSACDRSLY  1045
             M NL R   +L+ V+  +A L + +F ++    + S+         I   AHSAC  +LY
Sbjct  1     MYNLRRRTKLLLSVLPTSALLLILLFSNTHFRNSNSNTPKTHVHNRIQLAAHSACQDTLY  60

Query  1044  RDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMESRAL  868
             + LCVSTL   PDL  KS+P+IIS TV+ TVSE++ +++NC+ I ++    L  ++  AL
Sbjct  61    KLLCVSTLSTFPDLTTKSVPQIISYTVSHTVSEVQASSSNCTGIIKKQFKKLDALQQIAL  120

Query  867   YVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVR  694
               CLELF DT+A+L  V+  L  +   + RY DL+TLLS AMTNQYTCL+GF  +   VR
Sbjct  121   DDCLELFDDTIAELNAVISDLSIKKLSSNRYYDLKTLLSGAMTNQYTCLDGFNDTGI-VR  179

Query  693   PFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLS  514
               I  R++ IS+HVSNAL ML KI      P AL   +  S  F  E G MK+GFP W+S
Sbjct  180   QEIQSRLQTISQHVSNALVMLKKI------PGALKYENSKSEMF-PEFGPMKNGFPTWVS  232

Query  513   RRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYY  334
              +DR LL++         K D+ VAKDG+G+F +I+ A++ AP+SS TR+VI+IK+G+Y+
Sbjct  233   SKDRKLLQSVA----NGTKYDLVVAKDGTGNFTTISEAVAVAPNSSATRFVIYIKSGAYF  288

Query  333   EYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSA  154
             E V+V +KKT +MF+GDGIGKT +K +RNV DGW TFRSATVAVVG GFIA GI+FEN+A
Sbjct  289   ENVEVVRKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFIAQGITFENAA  348

Query  153   GPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             GP KHQAVA R+ SD+S FY C FVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  349   GPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  399



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score =   397 bits (1019),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 202/393 (51%), Positives = 277/393 (70%), Gaps = 18/393 (5%)
 Frame = -3

Query  1164  PVVLLAAFLSLTVFQSSAMNATTSDDIH---QVAHSACDRSLYRDLCVSTLVKTPDLRAK  994
             P++ L +F+ L    +S+   TT        QVAHS C  +LY +LCVSTL    DL +K
Sbjct  8     PLLALISFVLLFSLTNSSNLPTTPPQTKTHLQVAHSTCQGTLYPNLCVSTLSTFQDLASK  67

Query  993   SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVL  814
             S+P+II +T+N T++E+K+++ NC+R+++  P L   + RAL  CL LF +T+ +L++ +
Sbjct  68    SVPQIICSTLNSTINEVKSSSFNCTRLKKR-PSLHPYDQRALDDCLNLFDNTIEELKSTI  126

Query  813   DGLENSP--AKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNAL  640
             + L  +   +K Y + QTLLS AMTN YTCL+GF YS  N+R  I K++ +IS HVSN+L
Sbjct  127   NDLSQTKITSKPYHNCQTLLSGAMTNVYTCLDGFAYSKTNLRHKIEKKLYKISNHVSNSL  186

Query  639   SMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKI  460
             ++L K+   KNK S        S +F  E+GE+  GFP W++R+DR LL+A   +     
Sbjct  187   ALLMKVPGVKNKSS-------ESEAF-PEYGEVNGGFPSWITRKDRKLLQAAVSE----T  234

Query  459   KADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDG  280
               ++ VAKDG+G+F +I  AL+AAP+SS TR+VIHIK G+Y+E V+V KKK  +M VGDG
Sbjct  235   HFNLVVAKDGTGNFSTIGEALAAAPNSSTTRFVIHIKEGAYFENVEVIKKKINLMLVGDG  294

Query  279   IGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSV  100
             IGKT +K +RNV DGW TF+SAT AVVG+ FIA GI+FENSAGP KHQAVA+R+ +D+S 
Sbjct  295   IGKTVVKASRNVIDGWTTFQSATFAVVGSNFIAKGITFENSAGPSKHQAVAVRSGADFSA  354

Query  99    FYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FY+C FV YQDTLYVHS RQF+RECD+YGTVDF
Sbjct  355   FYNCSFVAYQDTLYVHSLRQFYRECDIYGTVDF  387



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   394 bits (1012),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 206/401 (51%), Positives = 274/401 (68%), Gaps = 23/401 (6%)
 Frame = -3

Query  1176  IMLVPVV--LLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDL  1003
             + L+P++  +L    S+T F   A  AT   +  QVA SAC+ +LY+DLCVSTL   PDL
Sbjct  9     LALMPILSTILVLLFSVTNFSKLATAATLQTNHIQVAQSACEGTLYQDLCVSTLSTLPDL  68

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMESRALYVCLELFSDTLADL  826
              +K++P+II + +N T+ E+K +++NC+ +R R       ++ RAL  C+ LF  T+ +L
Sbjct  69    TSKTVPQIICSVLNNTIKEVKQSSSNCTGLRIRGRSAQSILDQRALEDCVNLFDTTIDEL  128

Query  825   RTVLDGLEN------SPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQI  664
             +T +  L        S +KR  D QTLLS AMTN YTCL+GF YS   +R  I  ++  I
Sbjct  129   KTTISDLSQTQTTVASSSKR--DCQTLLSGAMTNVYTCLDGFAYSKSKLRKKIEAKLNDI  186

Query  663   SRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAP  484
             S HVSN+L+ML K+   K K S        S +F  E+G++KDGFP W+S +DR LL+A 
Sbjct  187   SSHVSNSLAMLKKVPGVKTKAS-------ESETF-PEYGKVKDGFPSWVSPKDRKLLQAA  238

Query  483   TGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKT  304
                   + K D+ VAKDG+G+F +I  A++AAP+SS TR+VIHIKAG+Y+E V+V KKKT
Sbjct  239   V----NQTKFDLVVAKDGTGNFATIGEAIAAAPNSSATRFVIHIKAGAYFENVEVIKKKT  294

Query  303   MIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVAL  124
              +M VGDGIG+T +K +RNV DGW TF+S+T AVVG  FIA GI+FENSAGP KHQAVA+
Sbjct  295   NLMLVGDGIGQTVVKASRNVVDGWTTFQSSTFAVVGDKFIAKGITFENSAGPSKHQAVAV  354

Query  123   RADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             R  +D+S FY C FV YQDTLYVHS RQF+RECDVYGTVDF
Sbjct  355   RNGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDF  395



>ref|XP_004290811.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   393 bits (1009),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 209/409 (51%), Positives = 273/409 (67%), Gaps = 32/409 (8%)
 Frame = -3

Query  1176  IMLVPV--VLLAAFLSLTVFQSS-------AMNATTSDDIHQVAHSACDRSLYRDLCVST  1024
             + L+P    +L  F SL  F +S        ++    + ++QVAHS C  +LY+DLCVST
Sbjct  12    LSLLPTSAFILIIFFSLNHFTNSPKPTKEFTIHVEKHNQLNQVAHSTCQNTLYKDLCVST  71

Query  1023  LVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD-LGTMESRALYVCLELF  847
             L   P+L +K++P+IIS+TVN T+ E+  + +NC+ I++   + L  ++ +AL  CLELF
Sbjct  72    LTSFPNLSSKTVPQIISSTVNKTMYEVIASNSNCTGIKKHNKNKLAAVQQQALDDCLELF  131

Query  846   SDTLADLRTVLDGL--ENSPA-KRYADLQTLLSTAMTNQYTCLEGFPYSN----KNVRPF  688
              DT+A L+  +  L  + SPA K Y  L+TLLS AMTNQYTCLEGF  S     K V+  
Sbjct  132   DDTVAQLKVTMSELSSKKSPAAKHYNHLRTLLSAAMTNQYTCLEGFDSSTSSTVKAVKAE  191

Query  687   IIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRR  508
             +  R+    +H SNAL ML KI+    + S              E G MK+GFP W+  +
Sbjct  192   LESRLNTTCKHFSNALVMLKKIRGVVEREST------------DEFGAMKNGFPTWVGSK  239

Query  507   DRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY  328
              R LL+  +  +    K D+ VAKDGSG+F +I  A++AAP+SS TR+VI+IKAG+Y+E 
Sbjct  240   ARKLLQTSSANQ---TKYDLLVAKDGSGNFTTITDAVAAAPNSSATRFVIYIKAGAYFEN  296

Query  327   VDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGP  148
             V+V  KKT +MF+GDGIGKT +K +RNV DGW TFRSATVAVVG GFIA GI+FENSAGP
Sbjct  297   VEVVSKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGGGFIAKGITFENSAGP  356

Query  147   EKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              KHQAVALR+ SD S FY C FVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  357   SKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  405



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   390 bits (1003),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 211/366 (58%), Positives = 268/366 (73%), Gaps = 13/366 (4%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI-RRV  904
             QVAHS C  +LY DLCVSTL   PDL +KS+PEIIS+TVN+T ++ ++A+++CS + RR+
Sbjct  41    QVAHSTCQGTLYPDLCVSTLASFPDLASKSVPEIISSTVNLTSAQARSASSSCSALERRL  100

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENS-----PAKRYADLQTLLSTAMTNQ  739
                LG +E RAL  CLEL + T+ +    +  L ++     PA  + DLQTLLS AMTNQ
Sbjct  101   AAKLGPLERRALDDCLELLARTVDEFGKAISDLSSANGPTAPAAHFHDLQTLLSGAMTNQ  160

Query  738   YTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFR  559
             YTCL+GF YS + VR  I   +  ISRHVSN+L ML K+   K +PS    P+ +   F 
Sbjct  161   YTCLDGFAYSKQKVRDAIQSNLFNISRHVSNSLVMLKKLPGVKGRPSG--SPAAAGEVF-  217

Query  558   QEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDS  379
              E+G M++GFP WLS +DR LL+AP          +V+VA+DG+G+F +++AA++AAP++
Sbjct  218   PEYGRMRNGFPAWLSPKDRRLLQAPVSATSY----NVSVAQDGTGNFTTVSAAVAAAPNA  273

Query  378   SDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVV  199
             S TR+VI+IKAGSY+E V+V  KKT IMF+GDGIGKT IKGNRNV DGW TFRSATVA V
Sbjct  274   STTRFVIYIKAGSYFENVEVISKKTNIMFLGDGIGKTWIKGNRNVVDGWTTFRSATVAAV  333

Query  198   GTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDV  19
             G+GFIA GISFEN AGP KHQAVA R+ SD S FY C F+GYQDTLYVHS RQF+RECD+
Sbjct  334   GSGFIAKGISFENYAGPSKHQAVAFRSGSDLSAFYSCSFIGYQDTLYVHSLRQFYRECDI  393

Query  18    YGTVDF  1
             YGTVDF
Sbjct  394   YGTVDF  399



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score =   389 bits (998),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 209/372 (56%), Positives = 263/372 (71%), Gaps = 22/372 (6%)
 Frame = -3

Query  1098  TSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCS  919
             TS    ++  +AC+R+ ++DLC S L   P   + S+PE+I+ATVN T+SE+  +++NCS
Sbjct  39    TSQTPSRLVRTACERTRFKDLCFSPLSSLPPGNSSSVPELIAATVNETISEVMISSSNCS  98

Query  918   RI-RRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLEN-SPAKRYADLQTLLSTAMT  745
              + RR+ PDL   +SRAL  CLEL  DT  DL   L  L + S A+ + DLQTLLS AMT
Sbjct  99    GLQRRLGPDLSPRDSRALEDCLELLGDTAGDLDDALADLHSPSAAREFYDLQTLLSAAMT  158

Query  744   NQYTCLEGFPYSNKN----VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSY  577
             NQYTCL+GF ++ +N    VR  I   +  ISRHVSN+L+ML +I     KP     P Y
Sbjct  159   NQYTCLDGFAFNERNRKYRVRDSIKDSLFNISRHVSNSLAMLQEIPA---KPGVF--PEY  213

Query  576   SSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAAL  397
                  R E+G    GFP W+SR DR LL+AP    K     D+ VAKDG+G+F +++AA+
Sbjct  214   G----RVENG----GFPTWVSRSDRRLLQAPANDTKL---FDLVVAKDGTGNFTTVSAAV  262

Query  396   SAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRS  217
             +AAP+SS TR+VI+IK G+Y+E V+V +KKTM+M VGDGIGKT +K NRNV DGW TFRS
Sbjct  263   AAAPNSSTTRFVIYIKEGAYFENVEVGRKKTMLMLVGDGIGKTVVKANRNVVDGWTTFRS  322

Query  216   ATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQF  37
             ATVAVVG GFIA GI+FEN AGP KHQAVALR+ SD+S FY C FVGYQDTLYVHS RQF
Sbjct  323   ATVAVVGNGFIAKGITFENFAGPTKHQAVALRSGSDHSAFYLCSFVGYQDTLYVHSFRQF  382

Query  36    FRECDVYGTVDF  1
             FRECD+YGTVDF
Sbjct  383   FRECDIYGTVDF  394



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   384 bits (985),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 236/324 (73%), Gaps = 15/324 (5%)
 Frame = -3

Query  954  VSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLAD-LRTVLDGLE-----NSP  793
            ++E+K++A NCS I   V  L  +E RAL  C+EL  DT  D L+T L  L      NSP
Sbjct  1    MNEVKSSAENCSNILHHVSKLDPIEKRALDDCIELLGDTTIDELQTTLYDLSTKNSSNSP  60

Query  792  AKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKE  613
             K Y DLQTLLS AMTNQ TCL G   S  N+  +I K +  IS+HVSN+L ML K+K  
Sbjct  61   LKHYNDLQTLLSGAMTNQDTCLNGIYNSKHNLSQYIEKNLHTISQHVSNSLVMLKKLKTG  120

Query  612  KNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKD  433
              +     G S +S+    E+G MK+G+PKWL ++DR LL+AP      +IK D+ VAKD
Sbjct  121  SAQ-----GSSSNSNEVFPEYGTMKNGYPKWLKKKDRTLLQAPV----NQIKFDLVVAKD  171

Query  432  GSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGN  253
            GSG+F +INAALSAAP+SS TR+VI+IKAG+Y+EY+DV++KK+MIMFVGDGIGKT IKGN
Sbjct  172  GSGNFTTINAALSAAPNSSSTRFVIYIKAGTYFEYIDVERKKSMIMFVGDGIGKTVIKGN  231

Query  252  RNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGY  73
            RNV DGW TFRSATVAVVG GF+A GI+FEN AGP KHQAVALR+ SD S FY C FV Y
Sbjct  232  RNVVDGWTTFRSATVAVVGNGFLARGITFENYAGPSKHQAVALRSGSDLSAFYQCSFVAY  291

Query  72   QDTLYVHSRRQFFRECDVYGTVDF  1
            QDTLYVHS RQF+R CDVYGTVDF
Sbjct  292  QDTLYVHSLRQFYRNCDVYGTVDF  315



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   374 bits (960),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 279/427 (65%), Gaps = 38/427 (9%)
 Frame = -3

Query  1200  MQNLGRNPIMLVPVVLLAA-FLSLTVFQSSAMNATT-SDDIH----------QVAHSACD  1057
             M NL R  I+L  + L +  FLSL   +    N+ + S  IH          + AH AC 
Sbjct  1     MYNLRRTKILLSTLFLTSILFLSLLFSKPHFKNSNSKSPKIHFQNHIQKQVLETAHWACQ  60

Query  1056  RSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRR-VVPDLGTME  880
              +LY+ LC+STL   P+L +K++P+IIS+TV+ TV E+K +++NC+ I++     L +++
Sbjct  61    DTLYKSLCLSTLATFPNLASKTLPQIISSTVSHTVLEVKASSSNCTSIKKQFSKKLSSLQ  120

Query  879   SRALYVCLELFSDTLADLRTVLDGLENSP---AKRYADLQTLLSTAMTNQYTCLEGF---  718
               AL  CLEL  +T+ +L++ +  L  +    + RY DL+ LLS AMTNQ TCL+GF   
Sbjct  121   QWALDDCLELLDNTIDELKSAISDLSXNKTLNSNRYYDLKALLSAAMTNQDTCLDGFSAN  180

Query  717   ---PYSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSA---LFGPSYSSSSF  562
                P S+    VR  I  R+  IS+HVSNAL ML KI      P A    +  +  S  F
Sbjct  181   GTAPRSSNXGIVRSEIEGRINTISQHVSNALVMLKKI------PGAHKYEYSETMKSEMF  234

Query  561   RQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPD  382
               + G  K  FP W+S +DR LL++ T     + K D+ VAKDG+G+F +I+ A+  AP+
Sbjct  235   -PDFGPAKKKFPTWVSSKDRRLLQSST----NETKYDLVVAKDGTGNFTTISEAVDVAPN  289

Query  381   SSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAV  202
             SS TR+VI+IKAG+Y+E V+V KKKT +MF+GDGIG T +K +RNV DGW TFRSATVAV
Sbjct  290   SSATRFVIYIKAGAYFENVEVVKKKTNLMFLGDGIGNTIVKASRNVVDGWTTFRSATVAV  349

Query  201   VGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECD  22
             VG GFIA GI+FEN AGP KHQAVALR+ +D+S FY C FVGYQDTLYVHS RQF+RECD
Sbjct  350   VGBGFIAKGITFENGAGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRECD  409

Query  21    VYGTVDF  1
             VYGTVDF
Sbjct  410   VYGTVDF  416



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   370 bits (949),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/363 (53%), Positives = 247/363 (68%), Gaps = 19/363 (5%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             QVA   CD +LY DLCVSTL   P+L +K +P++I+A VN T + ++++A+NC+      
Sbjct  50    QVASRHCDGTLYPDLCVSTLADIPNLSSKPLPDVIAAVVNRTAAAVRSSASNCTSYLHRR  109

Query  900   PDLGTMESRALYVCLELFSDTLADLRTVLDGLE--NSPAKRYADLQTLLSTAMTNQYTCL  727
               +   +  AL  CLEL   TL DLRT +  L   NS A   +DLQT+LS A+TNQYTCL
Sbjct  110   GHMDFRQRLALNDCLELLDQTLDDLRTAIADLAGCNSSA-HVSDLQTVLSAAITNQYTCL  168

Query  726   EGFPYSNKN-VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH  550
             +GF Y N   VRP I  R+  +S  VSN+L+M+ KI++++    A            +E+
Sbjct  169   DGFAYVNGGGVRPSIEGRLYHVSHLVSNSLAMVKKIRRQRRGREAF-----------EEY  217

Query  549   GEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDT  370
             G M  GFP W++R+DR LL+A           D+ VAKDGSG+F +I  A++AAP++S T
Sbjct  218   GRMSGGFPTWVTRKDRRLLQAAA----NATSPDLVVAKDGSGNFTTIGEAVAAAPNNSAT  273

Query  369   RYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTG  190
             R+VI+IKAG+Y+E VDV K K  +MF+GDGIGKT +K +RNV DGW TFRSATVAVVG G
Sbjct  274   RFVIYIKAGAYFENVDVAKNKKNLMFIGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDG  333

Query  189   FIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGT  10
             F+A  I+ ENSAGP KHQAVALR  +D S FY C FV YQDTLYVHS RQF+R+CDVYGT
Sbjct  334   FLARDITIENSAGPSKHQAVALRVGADLSAFYRCSFVAYQDTLYVHSLRQFYRDCDVYGT  393

Query  9     VDF  1
             VDF
Sbjct  394   VDF  396



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 237/321 (74%), Gaps = 19/321 (6%)
 Frame = -3

Query  948  EIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSP--AKRYAD  775
            E+++++ NCS +++++ +L  ++ RAL  CL+LF DT  +L+  +D L  S   +KR+ D
Sbjct  3    EVRSSSYNCSGLKKMLKNLNPLDQRALDDCLKLFEDTNVELKATIDDLSKSTIGSKRHHD  62

Query  774  LQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKI---KKEKNK  604
            LQT+LS AMTN YTCL+GF YS   VR  I K++ +IS HVSN+L+ML K+   KK    
Sbjct  63   LQTMLSGAMTNLYTCLDGFAYSKGRVRDRIEKKLLEISHHVSNSLAMLNKVPGVKKLTTS  122

Query  603  PSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSG  424
             S +F           E+G MK GFP W+S +DR LL+A    K ++ K D+ VAKDG+G
Sbjct  123  ESVVF----------PEYGNMKKGFPSWVSSKDRKLLQA----KVKETKFDLLVAKDGTG  168

Query  423  DFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNV  244
            +F +I  AL+ AP+SS TR+VIHIK G+Y+E V+V +KKT +MFVGDGIGKT +KG+RNV
Sbjct  169  NFTTIGEALAVAPNSSTTRFVIHIKEGAYFENVEVIRKKTNLMFVGDGIGKTVVKGSRNV  228

Query  243  KDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDT  64
             DGW TF+SATVAVVG GFIA GI+FENSAGP+KHQAVALR+ +D+S FY C FVGYQDT
Sbjct  229  VDGWTTFQSATVAVVGAGFIAKGITFENSAGPDKHQAVALRSGADFSAFYQCSFVGYQDT  288

Query  63   LYVHSRRQFFRECDVYGTVDF  1
            LYVHS RQF+RECD+YGTVDF
Sbjct  289  LYVHSLRQFYRECDIYGTVDF  309



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 236/334 (71%), Gaps = 22/334 (7%)
 Frame = -3

Query  981  IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLE  802
            +I + VN T+ E+  +A+NCS +RR +P+L  +E RAL  CL LF DT+++L T +  L 
Sbjct  1    MIRSVVNHTIYEVTLSASNCSGLRRNLPELDKLEQRALDDCLNLFDDTVSELETTIADLS  60

Query  801  NSP--AKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLT  628
             S    KRY D QTLLS AMTN YTCL+GF YS  +VR    + + +IS HVSN+L+ML 
Sbjct  61   QSTIGPKRYHDAQTLLSGAMTNLYTCLDGFAYSKGHVRDRFEEGLLEISHHVSNSLAMLK  120

Query  627  K----IKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKI  460
            K    +KK  +K     G           +G++KDGFP WLS +DR LL+A       + 
Sbjct  121  KLPAGVKKLASKNEVFPG-----------YGKIKDGFPTWLSTKDRKLLQAAV----NET  165

Query  459  KADVTVAKDGSGDFKSINAALSAAPDSSDTR-YVIHIKAGSYYEYVDVDKKKTMIMFVGD  283
              ++ VAKDG+G+F +I  A++ AP+SS TR +VIHIKAG+Y+E V+V +KKT +MFVGD
Sbjct  166  NFNLLVAKDGTGNFTTIAEAVAVAPNSSATRQFVIHIKAGAYFENVEVIRKKTNLMFVGD  225

Query  282  GIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYS  103
            GIGKT +K +RNV DGW TF+SATVAVVG GFIA GI+FENSAGP KHQAVALR+ SD+S
Sbjct  226  GIGKTVVKASRNVVDGWTTFQSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDFS  285

Query  102  VFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FY C FV YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  286  AFYKCSFVAYQDTLYVHSLRQFYRDCDVYGTVDF  319



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   365 bits (937),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 198/387 (51%), Positives = 258/387 (67%), Gaps = 19/387 (5%)
 Frame = -3

Query  1155  LLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEII  976
              L A LS     +S  + T SD +H +A SACD +LY DLCVST+V T   R  ++PE+I
Sbjct  423   FLKALLS-AANNNSTDSGTNSDYVH-LAESACDGALYDDLCVSTVV-TKLRRNTTLPEMI  479

Query  975   SATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLD--GLE  802
             +ATV+V ++E+ +A++N   +RR +     ++ RAL  CLEL S T  +L  VL+     
Sbjct  480   AATVDVAMAEVMSASSNFRNLRRKLKKAELLDVRALDDCLELLSSTAEELSEVLEMTTAP  539

Query  801   NSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKI  622
              SP K Y DL+TLLS +MTNQYTCL+G  Y N   R  I  R  +IS H+SNAL+++ K+
Sbjct  540   ASPVKHYDDLKTLLSGSMTNQYTCLDGLAYGNTRRR-LIEARTRRISHHLSNALALVGKL  598

Query  621   KKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTV  442
             K++      L    ++  S R E       FP W+SR DR  L++           ++ V
Sbjct  599   KRKSRPSDELL--EFAKLSSRTE-------FPNWMSRSDRRFLQS----AANSTNYNLIV  645

Query  441   AKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRI  262
             A+DG+G+F +IN A++A+P++S TR+VI+IKAG+YYEYV V   K MI FVGDGIGKT I
Sbjct  646   AQDGTGNFSTINDAINASPNNSRTRFVIYIKAGAYYEYVQVPSNKIMISFVGDGIGKTLI  705

Query  261   KGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRF  82
             KGNR+V DGW T++SATVAV G GFIA GI+ EN AGPEKHQAVALR  +D S FY C F
Sbjct  706   KGNRSVVDGWTTYQSATVAVAGQGFIATGITIENYAGPEKHQAVALRCGADMSAFYQCSF  765

Query  81    VGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VGYQDTLYV S RQF+RECD+YGTVDF
Sbjct  766   VGYQDTLYVFSLRQFYRECDIYGTVDF  792



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   352 bits (904),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/363 (50%), Positives = 240/363 (66%), Gaps = 15/363 (4%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSR-IRRV  904
             Q A   CD +LY DLC STL   PDL +KS+PE+I AT+N +   +  +A NC++ +   
Sbjct  54    QDATXHCDGTLYPDLCASTLSTIPDLHSKSLPEVICATINASEXAVIKSAKNCTKYLHHH  113

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLE  724
                L T +  AL  CL+LFS TL +L      L  +P      +QTLLS A+TNQYTCL+
Sbjct  114   NYTLDTRQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQYTCLD  173

Query  723   GFPYSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH  550
             GF Y  K+   R  I + +  +S  VSN+L+M+ KI+++K        P +      + +
Sbjct  174   GFAYVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQK--------PXHPRREALEGY  225

Query  549   GEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDT  370
             GE+ +GFP W+S +DR LL+A           ++ VAKDGSG+F +I+ A++AAP  S+T
Sbjct  226   GEVAEGFPVWVSGKDRRLLQA----AANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSET  281

Query  369   RYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTG  190
             R+VI+IKAG+Y E V+V K KT +MF+GDGIGKT +K +RNV DGW TFRSATVA+VG G
Sbjct  282   RFVIYIKAGAYLENVEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNG  341

Query  189   FIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGT  10
             F+   ++ ENSAGP KHQAVALR  +D S FY C FVGYQDTLY HS RQF+RECDVYGT
Sbjct  342   FLMRDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGT  401

Query  9     VDF  1
             +DF
Sbjct  402   IDF  404



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   352 bits (903),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/363 (50%), Positives = 240/363 (66%), Gaps = 15/363 (4%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSR-IRRV  904
             Q A   CD +LY DLC STL   PDL +KS+PE+I AT+N +   +  +A NC++ +   
Sbjct  53    QDATGHCDGTLYPDLCASTLSTIPDLHSKSLPEVICATINASEGAVIKSAKNCTKYLHHH  112

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLE  724
                L T +  AL  CL+LFS TL +L      L  +P      +QTLLS A+TNQYTCL+
Sbjct  113   NYTLDTRQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQYTCLD  172

Query  723   GFPYSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH  550
             GF Y  K+   R  I + +  +S  VSN+L+M+ KI+++K        P +      + +
Sbjct  173   GFAYVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQK--------PPHPRREALEGY  224

Query  549   GEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDT  370
             GE+ +GFP W+S +DR LL+A           ++ VAKDGSG+F +I+ A++AAP  S+T
Sbjct  225   GEVAEGFPVWVSGKDRRLLQA----AANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSET  280

Query  369   RYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTG  190
             R+VI+IKAG+Y E V+V K KT +MF+GDGIGKT +K +RNV DGW TFRSATVA+VG G
Sbjct  281   RFVIYIKAGAYLENVEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNG  340

Query  189   FIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGT  10
             F+   ++ ENSAGP KHQAVALR  +D S FY C FVGYQDTLY HS RQF+RECDVYGT
Sbjct  341   FLMRDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGT  400

Query  9     VDF  1
             +DF
Sbjct  401   IDF  403



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   352 bits (903),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/363 (50%), Positives = 241/363 (66%), Gaps = 15/363 (4%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSR-IRRV  904
             Q A   CD +LY DLC STL   PDL +KS+PE+I AT+N + + +  +A NC++ +   
Sbjct  54    QDATDHCDGTLYPDLCASTLSTIPDLHSKSLPEVICATINASEAAVIKSAKNCTKYLHHH  113

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLE  724
                L T +  AL  CL+LFS TL +L      L  +P      +QTLLS A+TNQYTCL+
Sbjct  114   NYTLDTRQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQYTCLD  173

Query  723   GFPYSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH  550
             GF Y  K+   R  I + +  +S  VSN+L+M+ KI+++K        P +      + +
Sbjct  174   GFAYVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQK--------PPHPRREALEGY  225

Query  549   GEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDT  370
             GE+ +GFP W+S +DR LL+A           ++ VAKDGSG+F +I+ A++AAP  S+T
Sbjct  226   GEVAEGFPVWVSGKDRRLLQA----AANTTTPNLIVAKDGSGNFTTISEAVAAAPSKSET  281

Query  369   RYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTG  190
             R+VI+IKAG+Y E V+V K +T +MF+GDGIGKT +K +RNV DGW TFRSATVA+VG G
Sbjct  282   RFVIYIKAGAYLENVEVGKSQTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNG  341

Query  189   FIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGT  10
             F+   ++ ENSAGP KHQAVALR  +D S FY C FVGYQDTLY HS RQF+RECDVYGT
Sbjct  342   FLMRDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGT  401

Query  9     VDF  1
             +DF
Sbjct  402   IDF  404



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   349 bits (896),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 239/356 (67%), Gaps = 14/356 (4%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             CD +LY DLCVSTL   PDL AKS+PE+I A+VN T + ++ AA NC+        L   
Sbjct  62    CDGTLYPDLCVSTLSTIPDLHAKSLPEVICASVNTTAAAVRNAAKNCTNFLHRRGYLDPR  121

Query  882   ESRALYVCLELFSDTLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNK  703
             +  A+  CL+LFS TL +L      L   PA    D+QT+LS A+TNQYTCL+GF Y  +
Sbjct  122   QRLAVTDCLDLFSQTLDELGAASAALAADPAAHVDDVQTVLSAAITNQYTCLDGFAYVGR  181

Query  702   N--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGF  529
                 RP I +R+  +S  VSN+L+M+        K       S       + +GE+ +GF
Sbjct  182   GGGYRPAIERRLYHVSHLVSNSLAMV--------KRIRRRRASRPRRGALEGYGEVSEGF  233

Query  528   PKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIK  349
             P W+S +DR LL+APT         D+ VAKDGSG+F +I+ A++AAP+++DTR+VI++K
Sbjct  234   PAWVSAKDRKLLQAPT----NATIPDLEVAKDGSGNFTTISDAVAAAPNNTDTRFVIYVK  289

Query  348   AGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGIS  169
             AG+Y+E V+V K KT ++ +GDGIGKT +K +R+V DGW TFRSATVAVVG GF+   I+
Sbjct  290   AGAYFENVEVGKSKTNLLLIGDGIGKTVVKASRSVVDGWTTFRSATVAVVGDGFLMRDIT  349

Query  168   FENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              EN+AGP KHQAVALR  +D S FY C FVGYQDTLYVHS RQF+REC+VYGTVDF
Sbjct  350   IENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRECNVYGTVDF  405



>ref|XP_010684346.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=576

 Score =   347 bits (890),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 245/368 (67%), Gaps = 8/368 (2%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV-  904
             Q+A S CD +LY DLC+STL   P L  KS+ EI+   ++VT +E++ +A N S +  V 
Sbjct  47    QLAQSHCDGTLYTDLCISTLSNIPHLHKKSLTEILRYVISVTEAEVRASATNISGLESVN  106

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTC  730
                L  ++  A+  CLEL +DT  +L TVLD +  +  P+   ++++T LS AMT QYTC
Sbjct  107   RHTLSRLQHFAVRDCLELLADTTDELDTVLDEMTGQCGPSNNVSNIRTYLSAAMTYQYTC  166

Query  729   LEGFPY-SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKN-KPSALFGPSYSSSSFRQ  556
             L+GF   S+K +R  I   +  I+ HVSN+L+ML KI+  ++ K   +  P Y       
Sbjct  167   LDGFDVGSSKTLRRLIETGLLNITHHVSNSLAMLNKIRGPRHCKDKTMSSPPYHDDDLHD  226

Query  555   EHGEMKDGFPKWLSRRDRALLEAP---TGKKKRKIKADVTVAKDGSGDFKSINAALSAAP  385
              +G  + G P+W+ ++DR LL+     +       + D+ VAKDGSG+F +I  A++AA 
Sbjct  227   RNGLDRAGLPRWMEKKDRRLLQTAKPASPGSGTTTQVDIVVAKDGSGNFTTIREAVAAAR  286

Query  384   DSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVA  205
             + S TR+VI+IK G+Y+E V+V KKKT IMF+GDGIGKT IK  RNV DG+ TFRSAT+A
Sbjct  287   NWSTTRFVIYIKTGAYFENVEVKKKKTNIMFLGDGIGKTVIKAKRNVADGYTTFRSATLA  346

Query  204   VVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFREC  25
             VVG GFIA  ++ EN AGP KHQAVALR+ SD+S FY C F+GYQDTLY HS RQF+REC
Sbjct  347   VVGAGFIAKDLTVENYAGPAKHQAVALRSGSDFSAFYRCSFIGYQDTLYTHSLRQFYREC  406

Query  24    DVYGTVDF  1
             D+YGTVDF
Sbjct  407   DIYGTVDF  414



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score =   343 bits (879),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 179/370 (48%), Positives = 247/370 (67%), Gaps = 14/370 (4%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             +++  IHQ A S C+ +L+ DLC S L   P L + S  ++  + +N T  E+  A  NC
Sbjct  69    SSNPQIHQTARSLCNGTLFPDLCFSKLSSFPLLASLSPEKLAGSALNFTSREVLLAYTNC  128

Query  921   SRIR-RVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTA  751
             + ++  +   L   +  AL  CLEL   ++A+L+  +  L    SPA    DL TL+S A
Sbjct  129   TNLKTHLYSGLNPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAA  188

Query  750   MTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSS  571
             MTN  TC++GF  S+  VR  +   + +I +H+S  L+ML KI    N+ + +       
Sbjct  189   MTNHRTCVDGFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPG-VNRATGV------D  241

Query  570   SSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                  E+G +K GFPKW+S +DR LL+A       + K ++ VAKDGSG+F +++ A++A
Sbjct  242   QEMLPEYGAVKGGFPKWVSVKDRRLLQAAV----NETKFNMVVAKDGSGNFTTVSEAVAA  297

Query  390   APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
             AP++S TR+VI+IKAG+Y+E V++ + K+ +MFVGDGIGKT IK +RNV DGW TFRSAT
Sbjct  298   APNASTTRFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSAT  357

Query  210   VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
             VAVVGTGFIA GI+FEN AGP KHQAVALR++SD+S FY C F+GYQDTLYVHS RQF+R
Sbjct  358   VAVVGTGFIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYR  417

Query  30    ECDVYGTVDF  1
             ECDVYGT+DF
Sbjct  418   ECDVYGTIDF  427



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score =   342 bits (876),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 177/370 (48%), Positives = 247/370 (67%), Gaps = 14/370 (4%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             +++  +HQ A S C+ +L+ DLC S L   P L + S  ++  + +N T  E+  A  NC
Sbjct  39    SSNPQVHQTARSLCNGTLFPDLCFSKLSSFPQLASLSPEKLAGSALNFTSREVLLAYTNC  98

Query  921   SRIR-RVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTA  751
             + ++  +   L   +  AL  CLEL   ++A+L+  +  L    SPA    DL TL+S A
Sbjct  99    TNLKTHLYSGLNPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAA  158

Query  750   MTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSS  571
             MTN  TC++GF  S+  VR  +   + +I +H+S  L+ML KI    N+ + +       
Sbjct  159   MTNHRTCVDGFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPG-VNRATGV------D  211

Query  570   SSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                  E+G +K GFPKW+S +DR LL+A       + K ++ VAKDGSG+F +++ A++A
Sbjct  212   QEMLPEYGAVKGGFPKWVSVKDRRLLQAAV----NETKFNMVVAKDGSGNFTTVSEAVAA  267

Query  390   APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
             AP++S TR+VI+IKAG+Y+E V++ + K+ +MFVGDGIGKT IK +RNV DGW TFRSAT
Sbjct  268   APNASTTRFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSAT  327

Query  210   VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
             VAVVGTGFIA GI+FEN AGP KHQAVALR++SD+S FY C F+GYQDTLYVHS RQF+R
Sbjct  328   VAVVGTGFIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYR  387

Query  30    ECDVYGTVDF  1
             +CDVYGT+DF
Sbjct  388   DCDVYGTIDF  397



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score =   341 bits (875),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 177/365 (48%), Positives = 243/365 (67%), Gaps = 14/365 (4%)
 Frame = -3

Query  1086  IHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIR-  910
              HQ A S C+ +L+ DLC S L   P L + S  ++  + +N T  E+  A  NC+ ++ 
Sbjct  97    FHQTARSLCNGTLFPDLCFSKLSSFPQLASLSPEKLAGSALNFTSREVLLAYTNCTNLKT  156

Query  909   RVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQY  736
              +   L   +  AL  CLEL   ++A+L+  +  L    SPA    DL TL+S AMTN  
Sbjct  157   HLYSGLNPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAAMTNHR  216

Query  735   TCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQ  556
             TC++GF  S+  VR  +   + +I +H+S  L+ML KI    N+ + +            
Sbjct  217   TCVDGFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPG-VNRATGV------DQEMLP  269

Query  555   EHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSS  376
             E+G +K GFPKW+S +DR LL+A       + K ++ VAKDGSG+F +++ A++AAP++S
Sbjct  270   EYGAVKGGFPKWVSVKDRRLLQAAV----NETKFNMVVAKDGSGNFTTVSEAVAAAPNAS  325

Query  375   DTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVG  196
              TR+VI+IKAG+Y+E V++ + K+ +MFVGDGIGKT IK +RNV DGW TFRSATVAVVG
Sbjct  326   TTRFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVG  385

Query  195   TGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVY  16
             TGFIA GI+FEN AGP KHQAVALR++SD+S FY C F+GYQDTLYVHS RQF+R+CDVY
Sbjct  386   TGFIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVY  445

Query  15    GTVDF  1
             GT+DF
Sbjct  446   GTIDF  450



>ref|XP_008451545.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=595

 Score =   338 bits (868),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 253/370 (68%), Gaps = 15/370 (4%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             +++  IHQ A S C+ +L+ +LC S L   P L + S  ++  + +N T  E+  A ANC
Sbjct  74    SSNPQIHQTARSLCNGTLFPNLCFSKLSSFPQLASLSPEKLAGSALNFTTREVLLAYANC  133

Query  921   SRIR-RVVPDLGTMESRALYVCLELFSDTLADLR-TVLD-GLENSPAKRYADLQTLLSTA  751
             + ++  +   L   +  AL  CLEL  D++A+L+ ++LD G   S A+   DL TL+S A
Sbjct  134   TNLKTHLYCGLNPTDRHALDDCLELLDDSIAELKASILDLGPSQSAARHSHDLLTLVSAA  193

Query  750   MTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSS  571
             MTN  TC++GF  S+  VR  +   + +I +H+S  L+ML KI    N+ + +       
Sbjct  194   MTNHRTCVDGFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPG-VNRATKV-------  245

Query  570   SSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                  E+G +K GFPKW+S +DR LL+A       + K ++ VAKDGSG+F ++N A++A
Sbjct  246   EEVLPEYGAVKGGFPKWVSVKDRRLLQAAV----NETKFNLVVAKDGSGNFTTVNEAVAA  301

Query  390   APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
             AP+SS TR+VI+IKAG+Y+E V++ + K+ +MFVGDGIGKT IKG+RNV DGW TFRSAT
Sbjct  302   APNSSTTRFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKGDRNVVDGWTTFRSAT  361

Query  210   VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
             VAVVGTGFIA GI+FEN AGP KHQAVALR++SD+S FY C F+GYQDTLYVHS RQF+R
Sbjct  362   VAVVGTGFIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYR  421

Query  30    ECDVYGTVDF  1
             ECD+YGT+DF
Sbjct  422   ECDIYGTIDF  431



>ref|XP_010056842.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=538

 Score =   334 bits (856),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 179/365 (49%), Positives = 235/365 (64%), Gaps = 25/365 (7%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIR-RV  904
             QV HS C  + Y DLCVSTL     L + S PEIISA ++ + SE++ A+ +C+ ++   
Sbjct  32    QVTHSRCRGTPYSDLCVSTLASFTGLASMSFPEIISAMLHQSASEVRAASTHCTVMKNHF  91

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPA--KRYADLQTLLSTAMTNQYTC  730
             +  L  +E +AL +CLELF D   D    +  LE+S    + Y DLQ+LLS  MTN YTC
Sbjct  92    LGKLSMLERQALDICLELFRDIFDDFDNAVSYLESSKVTVRHYYDLQSLLSGMMTNVYTC  151

Query  729   LEGF-PYS-NKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQ  556
              + F P++ N N+   +  R+  I RHVSN+L +L KI+   N PS              
Sbjct  152   TDEFDPHTDNLNLGDSMKDRLSNILRHVSNSLFLLAKIRG-VNNPSG-------------  197

Query  555   EHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSS  376
              HG +++ FP W+S  D  L++ PT       K D+ VAKDGSG+F SIN A++AAPD+S
Sbjct  198   -HG-IRERFPAWMSLEDSLLVQTPT----NATKFDLVVAKDGSGNFTSINDAVAAAPDNS  251

Query  375   DTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVG  196
              TR+VI+IK G Y EYV V+K KT +MFVGDGI KT IKGNRN  DGW  + SATVA+ G
Sbjct  252   KTRFVIYIKEGDYLEYVTVNKTKTNLMFVGDGIEKTLIKGNRNYDDGWTAYWSATVAIEG  311

Query  195   TGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVY  16
              GF+A GI+FEN AGP+K QA A R+ SD S F+ C F  YQDT+YVHS RQF+R+CD+Y
Sbjct  312   DGFLAKGITFENFAGPKKGQAAAFRSRSDKSAFFQCNFSSYQDTMYVHSHRQFYRDCDIY  371

Query  15    GTVDF  1
             GT+DF
Sbjct  372   GTIDF  376



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/283 (59%), Positives = 201/283 (71%), Gaps = 19/283 (7%)
 Frame = -3

Query  837  LADLRTVLDGL--ENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQI  664
            + +L+  L+ L    S ++ Y +LQTLLS AMTNQYTCL+GF YS  NVR  I   +  I
Sbjct  1    MDELKVALNDLYSRKSASQHYHELQTLLSAAMTNQYTCLDGFAYSEGNVRKVIKSNLYNI  60

Query  663  SRHVSNALSMLTKIKKEK--NKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLE  490
            S HVSN+L ML KI      NK     G           HG++K GFP WLS +DR LL+
Sbjct  61   SHHVSNSLVMLKKIPGVNISNKSEVFTG-----------HGDIKHGFPSWLSSKDRKLLQ  109

Query  489  APTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKK  310
            AP          ++ VAKDGSG+F +++ A++AAP+SS+ R+VI+IKAG+Y+E VDV KK
Sbjct  110  APL----NATTFNLIVAKDGSGNFTTVSEAVAAAPNSSNARFVIYIKAGAYFENVDVHKK  165

Query  309  KTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
            K M+MF+GDGIGKT IK NR+V DGW TFRSATVAVVG GFIA GI+FENSAGP  HQAV
Sbjct  166  KNMLMFIGDGIGKTVIKANRSVVDGWTTFRSATVAVVGNGFIAKGITFENSAGPSMHQAV  225

Query  129  ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            ALR+ SD S FY C FVGYQDTLYVHS RQF+RECDVYGT+DF
Sbjct  226  ALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDF  268



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   328 bits (840),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 179/367 (49%), Positives = 234/367 (64%), Gaps = 22/367 (6%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             C+ +LY +LC+STL   PDL  K +P++I ATVN T  E+   A+NCS   +    L   
Sbjct  43    CEGTLYPELCLSTLATVPDLHKKPLPDVICATVNRTEVEVADMASNCSSFLQQGKSLPPR  102

Query  882   ESRALYVCLELFSDTLADLRTVLDGLE--NSPAKRYADLQTLLSTAMTNQYTCLEGFPYS  709
             +  A+  C+EL   T+ +L+     L+  ++ A     + T+LS A+TNQ+TCL GF Y 
Sbjct  103   DRVAIADCIELLGTTMDELQATTSDLQQPSNGATVVDHVMTVLSGAITNQHTCLSGFTYH  162

Query  708   NKN-------VRPFIIKRVEQISRHVSNALSMLTKIKKEK-NKPSALFGPSYSSSSFRQE  553
                        RP++   +  ISR VSN L+M  K++  K N PS    PS      RQ 
Sbjct  163   GPRNGGQVSLARPYMEPGIRHISRMVSNTLAMAKKMRSTKPNSPS----PSVQVQR-RQP  217

Query  552   ---HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPD  382
                +G+M  GFP+W+   DR LL+A        I A+  VAKDGSG + +++AA++AAP 
Sbjct  218   FTGYGQMVKGFPRWVRPGDRRLLQA----AASGITANAVVAKDGSGGYTTVSAAVTAAPA  273

Query  381   SSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAV  202
             +S +RYVI+IKAG+Y E V+V K +  +MF+GDGIGKT IK +RNV DG+ TFRSATVAV
Sbjct  274   NSKSRYVIYIKAGAYLENVEVGKNQKNLMFIGDGIGKTVIKASRNVVDGYTTFRSATVAV  333

Query  201   VGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECD  22
             VG  FIA  ++ ENSAGP KHQAVALR  +D S FY C FVGYQDTLYVHS RQFFR+CD
Sbjct  334   VGNNFIARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCD  393

Query  21    VYGTVDF  1
             VYGTVDF
Sbjct  394   VYGTVDF  400



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 184/393 (47%), Positives = 249/393 (63%), Gaps = 26/393 (7%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHS-ACDRSLYRDLCVSTLVKTPDLRA  997
             + + V  +A FL L +  SSA+           +HS  C+ +LY DLC+STL  +     
Sbjct  10    ITMAVATIATFLLLFIPSSSAL-----------SHSHMCEDTLYPDLCLSTLSSSLKTTP  58

Query  996   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTV  817
             +   + I+AT+N+T      A ++CS +   +      + RAL  C EL S +L D+ + 
Sbjct  59    R---QSIAATLNLTAKSATEAISSCSNLSHEISSTDLPDQRALSDCEELLSTSLGDISSC  115

Query  816   LDGLENSPAKRYA-DLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNAL  640
             L  L NS ++  +  LQT LS A+TNQYTCL+GF Y+N  +R  I   +  ISRH+SN+L
Sbjct  116   LADLSNSSSRSSSIHLQTFLSAAITNQYTCLDGFSYANHTLRSRIEANIVNISRHISNSL  175

Query  639   SMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKI  460
             +M  K++  +   ++  G  +      +E+G +  GFP W+  +DR LL+A       + 
Sbjct  176   AMFKKVRASELPENSDSGEVF------EEYGRVDGGFPAWIPPKDRRLLQA----SANQT  225

Query  459   KADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDG  280
              AD+ VAKDGSGDF +I+ A++  PD+  TR+VI+IK G Y E VDV +KKT +M +GDG
Sbjct  226   NADLVVAKDGSGDFTTISEAIAKVPDNGKTRFVIYIKTGEYLENVDVGEKKTNLMLIGDG  285

Query  279   IGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSV  100
             I KT +K +RNV DGW TFRSAT AVVG+ FIA  +SFENSAGP KHQAVALR+ +D S 
Sbjct  286   IEKTVVKASRNVVDGWTTFRSATFAVVGSNFIARDMSFENSAGPSKHQAVALRSGADLSA  345

Query  99    FYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FY C FVGYQDTLYVHS RQF+RECDVYGTVDF
Sbjct  346   FYRCSFVGYQDTLYVHSLRQFYRECDVYGTVDF  378



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score =   323 bits (827),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 232/372 (62%), Gaps = 23/372 (6%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             CD +LY +LC+STL   PDL  K +P++I A VN T   +   + NCS   +    L   
Sbjct  49    CDGTLYPELCLSTLADIPDLHKKPLPDVICAAVNHTEDVVTATSTNCSYYLQDR-SLSAR  107

Query  882   ESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA--------------DLQTLLSTAMT  745
             +  A+  CLEL S T+ +LR     L  S     +               + T+LS A+T
Sbjct  108   DRLAINDCLELLSTTMDELRATTADLSTSSGGNGSAAAPSVGTRRVTMDHVMTVLSAAIT  167

Query  744   NQYTCLEGFPYSNKN-VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSS  568
             NQYTCL+GF Y N   VR +I      +SR VSN+L+M  K+      PS+    + +++
Sbjct  168   NQYTCLDGFAYQNGGRVRHYIEPTFHHVSRMVSNSLAMAKKLPGASPSPSSAPTTTETAA  227

Query  567   SFRQE---HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAAL  397
               RQ    +G+M  GFP+W+   DR LL+AP       I AD  VAKDGSG + +++AA+
Sbjct  228   VARQPFMGYGQMVKGFPRWVRPGDRRLLQAPA----TAITADAVVAKDGSGGYTTVSAAV  283

Query  396   SAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRS  217
             +AAP +S  RYVI+IKAG+Y E V+V KK   +MFVGDGIGKT IK +RNV DG+ TFRS
Sbjct  284   AAAPTNSKKRYVIYIKAGAYMENVEVGKKHVNLMFVGDGIGKTVIKASRNVVDGYTTFRS  343

Query  216   ATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQF  37
             ATVAVVG  F+A  ++ ENSAGP KHQAVALR  +D S FY C FVGYQDTLYVHS RQF
Sbjct  344   ATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQF  403

Query  36    FRECDVYGTVDF  1
             FR+CD+YGT+DF
Sbjct  404   FRDCDIYGTIDF  415



>gb|KDO87160.1| hypothetical protein CISIN_1g015794mg [Citrus sinensis]
Length=400

 Score =   313 bits (803),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 158/250 (63%), Positives = 183/250 (73%), Gaps = 13/250 (5%)
 Frame = -3

Query  750  MTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSS  571
            MTNQYTCL+GF YS+ NVR  I   +  ISRHVSN+L ML KI  +         P    
Sbjct  1    MTNQYTCLDGFAYSDGNVRDVIKSSLYNISRHVSNSLVMLKKIPGDNMSSKYEVFP----  56

Query  570  SSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                 E+G +K GFP WLS  DR LL+    K     K D+ VAKDGSG+F +I  A+ A
Sbjct  57   -----EYGRIKRGFPTWLSLNDRKLLQ----KSVNLTKFDLIVAKDGSGNFTTITEAVEA  107

Query  390  APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
            AP+ S+TR+VI+IKAG+Y+E V+VDKKKTM+MFVGDGIGKT +K NR+V DGW TFRSAT
Sbjct  108  APNKSNTRFVIYIKAGAYFENVEVDKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSAT  167

Query  210  VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
            VAVVGTGFIA GI+ ENSAGP KHQAVALR+ SD S FY C FVGYQDTLYVHS RQF+R
Sbjct  168  VAVVGTGFIAKGITVENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYR  227

Query  30   ECDVYGTVDF  1
            ECDVYGTVDF
Sbjct  228  ECDVYGTVDF  237



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score =   315 bits (808),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 173/361 (48%), Positives = 239/361 (66%), Gaps = 22/361 (6%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             C  +L+RD+CVSTL   P+L  K + ++IS  V    S ++ +++NC+   +    L T 
Sbjct  72    CAGTLHRDVCVSTLSTIPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRTR  131

Query  882   ESRALYVCLELFSDTLADLRTVLDGLE--NSPAKR-YADLQTLLSTAMTNQYTCLEGF--  718
             +  AL  CLELF  TL  L T    L   NS A+   A +QT+LS AMTNQYTCL+GF  
Sbjct  132   DRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMTNQYTCLDGFAG  191

Query  717   PYSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGE  544
             P ++++  VRPFI  R+  ++  VSN+L+M+ ++  ++ + +             + +G 
Sbjct  192   PSASEDGRVRPFIQGRIYHVAHLVSNSLAMVRRLPTQRRRGA--------EEEPLEGYGR  243

Query  543   MKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRY  364
             ++ GFP W+S  DR  L+       +++ ADV VAKDGSG F +++ A++AAP++S+TRY
Sbjct  244   VRRGFPSWVSASDRRRLQ-------QQVAADVVVAKDGSGKFTTVSEAVAAAPNNSETRY  296

Query  363   VIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFI  184
             VI+IKAG Y+E V+V  +KT IMFVGDG  KT IK +RNV D   TFRSAT+AVVGTGF+
Sbjct  297   VIYIKAGGYFENVEVGSEKTNIMFVGDGTWKTVIKASRNVVDNSTTFRSATLAVVGTGFL  356

Query  183   AIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVD  4
             A  I+ EN+AGP KHQAVALR ++D S FY C F GYQDTLY HS RQF+R+CD+YGTVD
Sbjct  357   ARDITVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVD  416

Query  3     F  1
             F
Sbjct  417   F  417



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score =   315 bits (808),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 173/361 (48%), Positives = 239/361 (66%), Gaps = 22/361 (6%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             C  +L+RD+CVSTL   P+L  K + ++IS  V    S ++ +++NC+   +    L T 
Sbjct  72    CAGTLHRDVCVSTLSTIPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRTR  131

Query  882   ESRALYVCLELFSDTLADLRTVLDGLE--NSPAKR-YADLQTLLSTAMTNQYTCLEGF--  718
             +  AL  CLELF  TL  L T    L   NS A+   A +QT+LS AMTNQYTCL+GF  
Sbjct  132   DRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMTNQYTCLDGFAG  191

Query  717   PYSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGE  544
             P ++++  VRPFI  R+  ++  VSN+L+M+ ++  ++ + +             + +G 
Sbjct  192   PSASEDGRVRPFIQGRIYHVAHLVSNSLAMVRRLPTQRRRGA--------EEEPLEGYGR  243

Query  543   MKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRY  364
             ++ GFP W+S  DR  L+       +++ ADV VAKDGSG F +++ A++AAP++S+TRY
Sbjct  244   VRRGFPSWVSASDRRRLQ-------QQVAADVVVAKDGSGKFTTVSEAVAAAPNNSETRY  296

Query  363   VIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFI  184
             VI+IKAG Y+E V+V  +KT IMFVGDG  KT IK +RNV D   TFRSAT+AVVGTGF+
Sbjct  297   VIYIKAGGYFENVEVGSEKTNIMFVGDGTWKTVIKASRNVVDNSTTFRSATLAVVGTGFL  356

Query  183   AIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVD  4
             A  I+ EN+AGP KHQAVALR ++D S FY C F GYQDTLY HS RQF+R+CD+YGTVD
Sbjct  357   ARDITVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVD  416

Query  3     F  1
             F
Sbjct  417   F  417



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score =   315 bits (808),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 176/370 (48%), Positives = 238/370 (64%), Gaps = 15/370 (4%)
 Frame = -3

Query  1086  IHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAANCSRIR  910
             + +V   AC  +LY +LCVS++   P L  ++ P EI+   ++V+++ ++ A A  +RI 
Sbjct  77    VPKVVQDACSSTLYPELCVSSVSSFPGLSDRAGPIEIVHVVLSVSIAAVEKANA-LARIM  135

Query  909   RVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLEN----SPAKRYADLQTLLSTAMTN  742
                P L   +  AL  CLELF +TL +L   +  L+N    S  ++  DL+TLLS A+TN
Sbjct  136   WTRPGLSHRKRGALQDCLELFDETLDELYETVSNLKNGSCMSAPEKVNDLETLLSAAITN  195

Query  741   QYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPS--ALFGPSYSSS  568
             QYTCL+    SN  +R  +   +  IS  VSN+L+++  I    +  +  ++      S 
Sbjct  196   QYTCLDSSARSN--LRQELQGGLMSISHLVSNSLAIVKNIATRASNVTVNSIHNRRLLSD  253

Query  567   SFRQEHGEMK-DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                 E   M+ DGFP W+S ++R+LL++     +  I  +  VAKDGSG   SI  A++A
Sbjct  254   DQGSEFMAMESDGFPSWMSAKERSLLQS----SRDNIMPNAVVAKDGSGHHTSIGDAVNA  309

Query  390   APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
             AP  S TRYVIHIKAG Y+E V+V+KKKT +MF+GDGIG T + GNRNVKDG+ T+RSAT
Sbjct  310   APQKSRTRYVIHIKAGIYWENVEVNKKKTHLMFIGDGIGATVVAGNRNVKDGYTTYRSAT  369

Query  210   VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
             VAV G GFIA  I+FEN+AG  KHQAVALR  SD+S FY C F GYQDTLYVHS RQF+R
Sbjct  370   VAVNGNGFIARDITFENTAGAAKHQAVALRVGSDFSAFYRCSFQGYQDTLYVHSLRQFYR  429

Query  30    ECDVYGTVDF  1
             EC+VYGTVDF
Sbjct  430   ECNVYGTVDF  439



>ref|XP_010058840.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=599

 Score =   315 bits (807),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 169/358 (47%), Positives = 227/358 (63%), Gaps = 25/358 (7%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGT  886
             C  + Y  LCVSTL     L + S PEIIS  ++ + SE++ A+ +C+ ++   +  L  
Sbjct  99    CRGTPYSGLCVSTLASFTGLASMSFPEIISGMLHQSASEVRAASTHCTVMKNHFLEKLSM  158

Query  885   MESRALYVCLELFSDTLADLRTVLDGLENSPA--KRYADLQTLLSTAMTNQYTCLEGFP-  715
             +E +AL +CLELF D L D    +  L++     + Y DLQ+LLS  MTN YTC + F  
Sbjct  159   LERQALDICLELFRDILDDFDNTVSYLDSLKVTIRHYYDLQSLLSGMMTNVYTCTDEFDP  218

Query  714   -YSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMK  538
                N N+   +  R+  ISR VSN+L +LTK++   N PS               HG ++
Sbjct  219   NTDNLNLGDSMKDRLSNISRQVSNSLFLLTKMRG-VNNPSG--------------HG-IR  262

Query  537   DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVI  358
             + FP W+S  D  L++ PT       K D+ VAKDGSG+F SIN +++AAPD+S+TR+VI
Sbjct  263   ERFPAWMSLEDSLLVQTPT----NATKFDLVVAKDGSGNFTSINDSVAAAPDNSNTRFVI  318

Query  357   HIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAI  178
             +IK G Y EYV V+K KT +MFVGDGI KT IKGNRN  DGW  + SATVA+ G GF+A 
Sbjct  319   YIKEGDYLEYVTVNKTKTNLMFVGDGIEKTLIKGNRNYDDGWTAYWSATVAIEGDGFLAK  378

Query  177   GISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVD  4
             GI+FEN AGP+K QA A R+ SD S F+ C F  YQDT+YVHS RQF+R+CD+YGT+D
Sbjct  379   GITFENFAGPKKGQAAAFRSRSDKSAFFQCNFSSYQDTMYVHSHRQFYRDCDIYGTID  436



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 179/362 (49%), Positives = 233/362 (64%), Gaps = 19/362 (5%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             CD +LY +LC+STL   PDL  K +P++I A VN T +E+ T +ANCS   R    L   
Sbjct  55    CDGTLYPELCLSTLADIPDLHKKPLPDVICAAVNRTETEVTTMSANCSGYLRER-SLSGR  113

Query  882   ESRALYVCLELFSDTLADLRTVLDGLENSPAKRYADL---QTLLSTAMTNQYTCLEGFPY  712
             +  A+  C+EL   T+ +L      LE+  A R   +    T+LS A+TNQ TCLEGF Y
Sbjct  114   DHLAVTDCMELLETTMEELVATTADLESPSAARRPTMDHAMTVLSAAITNQQTCLEGFSY  173

Query  711   S-NKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQE---HGE  544
                  VR ++   +  I++ VSN+L+M  K+     KPS     S   S  RQ    +G+
Sbjct  174   QKGGEVRRYMEPGILHIAKMVSNSLAMAKKLPG-ATKPS-----STERSVARQPFTGYGQ  227

Query  543   M-KDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTR  367
             + K GFP+W+   DR LL+AP       IKA+  VAKDGSG F +++AA++AAP +S +R
Sbjct  228   VVKGGFPRWVRPGDRRLLQAPA----SGIKANAVVAKDGSGGFTTVSAAVAAAPTNSQSR  283

Query  366   YVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGF  187
             YVI+IKAG+Y E V+V K    +MF+GDG+GKT IK + NV DG  TFRSATVAVVG  F
Sbjct  284   YVIYIKAGAYMENVEVGKNHKNLMFMGDGMGKTVIKASLNVVDGSTTFRSATVAVVGNNF  343

Query  186   IAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTV  7
             +A  ++ EN+AGP KHQAVALR  +D S FY C FVGYQDTLYVHS RQFFRECD+YGT+
Sbjct  344   LARDLTIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTI  403

Query  6     DF  1
             DF
Sbjct  404   DF  405



>emb|CDP15269.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   306 bits (785),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 207/301 (69%), Gaps = 22/301 (7%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             Q+AHS C  + Y DLCVSTL   PDLR +++PEIIS  VN TV E++ +  NC+RIRR +
Sbjct  76    QIAHSTCQDTFYPDLCVSTLATFPDLRQRTLPEIISGMVNSTVFEVRDSKQNCTRIRRKL  135

Query  900   PDLGTMESRALYVCLELFSDTLADLRTVLDGLEN--SPAKRYADLQTLLSTAMTNQYTCL  727
              +L  ++ RAL  CL+L  DT+A L+  +  L +  S  + Y DLQTL S AMTNQ TCL
Sbjct  136   QNLDPLDRRALEDCLQLLDDTVAQLKAAISDLSSNKSALQHYMDLQTLFSAAMTNQDTCL  195

Query  726   EGFPYSN-KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH  550
             +GF +S  K +R FI  R+ +IS HVSN+L+ML ++KK++    A+F         ++E 
Sbjct  196   DGFAFSRRKYIREFIEGRLRKISHHVSNSLAMLKRVKKQQAAAGAVF---------QEEE  246

Query  549   GEMKD------GFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAA  388
             GE         GFP WL ++DRALL+AP  +     K ++TVAKDGSG+F +IN AL AA
Sbjct  247   GEFGTPVKSGAGFPTWLKKKDRALLQAPLNQ----TKVNLTVAKDGSGNFTTINDALQAA  302

Query  387   PDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATV  208
             P+SS TR+VI+IKAG+YYEY++V+ +K MIMF+GDGIGKT IKGNR+V  GW TFRS+TV
Sbjct  303   PNSSTTRFVIYIKAGAYYEYIEVESRKKMIMFLGDGIGKTVIKGNRSVGAGWTTFRSSTV  362

Query  207   A  205
              
Sbjct  363   G  363



>ref|XP_010058837.1| PREDICTED: uncharacterized protein LOC104446716 [Eucalyptus grandis]
Length=1688

 Score =   327 bits (839),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 179/359 (50%), Positives = 233/359 (65%), Gaps = 25/359 (7%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD-LGT  886
             C  + Y DLCVSTL     L   S PEIISA ++ + SE++ A+ +C+ ++   P+ L  
Sbjct  1189  CRGTPYSDLCVSTLASFTGLATMSFPEIISAMLHQSASEVRAASTHCTVMKNHFPEKLSM  1248

Query  885   MESRALYVCLELFSDTLADLRTVLDGLENSPA--KRYADLQTLLSTAMTNQYTCLEGF-P  715
             +E +AL +CLEL  D L D    +  LE+S    + Y DLQ+LLS  MTN YTC +   P
Sbjct  1249  LERQALDICLELSRDILDDFDNAVSYLESSKVTIRHYYDLQSLLSGVMTNVYTCTDELDP  1308

Query  714   YS-NKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMK  538
             ++ N N+   +  R+  ISRHVSN+L +LTK+    N PS               HG ++
Sbjct  1309  HTDNLNLGDSMKDRLSNISRHVSNSLFLLTKMCGVNN-PSG--------------HG-IR  1352

Query  537   DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVI  358
             + FP W+S  D  L++ PT  KK     ++ VAKDGSG+F SIN A++AAPD+S+TR+VI
Sbjct  1353  ERFPAWMSLEDSLLVQTPTNAKK----FNLVVAKDGSGNFTSINDAVAAAPDNSNTRFVI  1408

Query  357   HIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAI  178
             +IK G Y EYV V K KT +MFVGDGI KT IKGNRN  DGW TF SATVA+ G GF+A 
Sbjct  1409  YIKEGDYLEYVTVSKTKTNLMFVGDGIEKTLIKGNRNSADGWATFWSATVAIEGDGFLAK  1468

Query  177   GISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             GI+FEN AGP K QAVA R+ SD S  + C F+GYQDT+YVHS RQF+R+CD+YGT DF
Sbjct  1469  GITFENFAGPTKGQAVAFRSGSDKSALFQCNFLGYQDTMYVHSHRQFYRDCDIYGTTDF  1527



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 181/384 (47%), Positives = 236/384 (61%), Gaps = 39/384 (10%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI---RRVVPDL  892
             C+ +LY +LC+STL   PDL  KS+P++I  TVN T   +   + NCS     + + P  
Sbjct  49    CEGTLYPELCLSTLADIPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKYLTP--  106

Query  891   GTMESRALYVCLELFSDTLADLRTVLDGLENSPA-------------KRYA--DLQTLLS  757
                +  A+  C+EL   T+ +L+     LE SPA             KR     + T LS
Sbjct  107   --RDRLAISDCMELLDTTMDELQATTSDLE-SPAVAGGNNGSASMAAKRVTMDHVMTELS  163

Query  756   TAMTNQYTCLEGFPYSN-KNVRPFIIKRVEQISRHVSNALSMLTKIK--------KEKNK  604
              AMTNQYTCL+GF Y + + VR ++   +  +SR VSN+L+M  K+            + 
Sbjct  164   AAMTNQYTCLDGFDYKDGERVRHYMESSIHHVSRMVSNSLAMAKKLPGAGGGGMTPSSSS  223

Query  603   PSALFGPSYSSSSFRQE---HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKD  433
             P        S ++ RQ    +G+M +GFPKW+   DR LL+AP       I  D  VAKD
Sbjct  224   PDTATQSESSETTQRQPFMGYGQMANGFPKWVRPGDRRLLQAPA----SSITPDAVVAKD  279

Query  432   GSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGN  253
             GSG + +++AA++AAP +S+ RYVIHIKAG+Y E V+V K K  +MF+GDGIGKT IK +
Sbjct  280   GSGGYTTVSAAVAAAPANSNKRYVIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTVIKAS  339

Query  252   RNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGY  73
             RNV DG  TFRSATVAVVG  F+A  ++ ENSAGP KHQAVALR  +D S FY C FVGY
Sbjct  340   RNVVDGSTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGY  399

Query  72    QDTLYVHSRRQFFRECDVYGTVDF  1
             QDTLYVHS RQFFRECD+YGT+DF
Sbjct  400   QDTLYVHSLRQFFRECDIYGTIDF  423



>gb|ABG46324.1| putative pectin methylesterase [Picea abies]
Length=393

 Score =   301 bits (772),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 166/369 (45%), Positives = 227/369 (62%), Gaps = 22/369 (6%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAANCSRIRRV  904
             +  H AC  +LY + CVS++   P L  +  P EI+   V ++++ ++ A A   R+ R 
Sbjct  32    KAVHHACSSTLYPEFCVSSVSSFPGLSKRPGPMEILKVVVKLSIAAVEKANARARRLSR-  90

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLEN----SPAKRYADLQTLLSTAMTNQY  736
              P L   +  AL  C ELF +TL +L + L  L+N    S  +  +DL+TLLS A+TNQY
Sbjct  91    -PGLDQRQRGALQDCFELFDETLDELYSTLSDLKNKTFISIPQSASDLETLLSAAITNQY  149

Query  735   TCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQ  556
             TC++ F +   N++  ++  +  IS  VSN+L+M+  I  E    S L   + S+ + R 
Sbjct  150   TCIDSFTHCKGNLKQSLLGGLRNISHLVSNSLAMVKNISAE---ASNLARRTVSNQNRRL  206

Query  555   EHGEM--------KDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAA  400
                +          DGFP W+S  DR LL+  TG     +K +  VAKDGSG++ +I  A
Sbjct  207   LSDQSDPNFMPMDSDGFPSWMSAGDRRLLQTSTGT----VKPNAVVAKDGSGNYTNITEA  262

Query  399   LSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFR  220
             + AAP+ S TRYVIHIKAG Y E V++ KKKT +MF+GDG+  T + GNRNVK+ + TFR
Sbjct  263   VEAAPEKSKTRYVIHIKAGVYAENVELHKKKTNLMFIGDGMDVTVVTGNRNVKENFTTFR  322

Query  219   SATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQ  40
             SATVAV+G GFIA  ++FEN+AG  KHQAVALR  SD S FY C F GYQDTLY HS RQ
Sbjct  323   SATVAVLGKGFIARDMTFENTAGAAKHQAVALRVGSDLSAFYRCSFKGYQDTLYAHSLRQ  382

Query  39    FFRECDVYG  13
             F+RE  +YG
Sbjct  383   FYREWHIYG  391



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   307 bits (786),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 180/373 (48%), Positives = 233/373 (62%), Gaps = 36/373 (10%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI---RRVVPDL  892
             C+ +LY +LC+STL   PDL  KS+P++I  TVN T   +   + NCS     + + P  
Sbjct  49    CEGTLYPELCLSTLADIPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKYLTP--  106

Query  891   GTMESRALYVCLELFSDTLADLRTVLDGLENSPA-------------KRYA--DLQTLLS  757
                +  A+  C+EL   T+ +L+     LE SPA             KR     + T LS
Sbjct  107   --RDRLAISDCMELLDTTMDELQATTSDLE-SPAVAGGNNGSASMAAKRVTMDHVMTELS  163

Query  756   TAMTNQYTCLEGFPYSN-KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPS  580
              AMTNQYTCL+GF Y + + VR ++   +  +SR VSN+L+M  K+      P A  G  
Sbjct  164   AAMTNQYTCLDGFDYKDGERVRHYMESSIHHVSRMVSNSLAMAKKL------PGA--GGE  215

Query  579   YSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAA  400
              +       +G+M +GFPKW+   DR LL+AP       I  D  VAKDGSG + +++AA
Sbjct  216   TTQRQPFMGYGQMANGFPKWVRPGDRRLLQAPA----SSITPDAVVAKDGSGGYTTVSAA  271

Query  399   LSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFR  220
             ++AAP +S+ RYVIHIKAG+Y E V+V K K  +MF+GDGIGKT IK +RNV DG  TFR
Sbjct  272   VAAAPANSNKRYVIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTVIKASRNVVDGSTTFR  331

Query  219   SATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQ  40
             SATVAVVG  F+A  ++ ENSAGP KHQAVALR  +D S FY C FVGYQDTLYVHS RQ
Sbjct  332   SATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQ  391

Query  39    FFRECDVYGTVDF  1
             FFRECD+YGT+DF
Sbjct  392   FFRECDIYGTIDF  404



>ref|XP_004958677.1| PREDICTED: pectinesterase 3-like [Setaria italica]
Length=598

 Score =   303 bits (776),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 165/361 (46%), Positives = 234/361 (65%), Gaps = 21/361 (6%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             C  +L+R++C STL   P+L  K + ++IS  V    + ++ +++NCS   R    L   
Sbjct  90    CAGTLHREVCASTLASIPNLARKPLRDVISDVVARAAAAVRASSSNCSSYLRRPRGLRVR  149

Query  882   ESRALYVCLELFSDTLADLRTVLDGL---ENSPAKRYADLQTLLSTAMTNQYTCLEGF--  718
             +  AL  CLELF  TL  L T  D L     +  +  A +QT+LS A+TNQYTCLEGF  
Sbjct  150   DRLALSDCLELFGRTLGQLGTAADELSAGNRTAEESIAGVQTVLSAALTNQYTCLEGFAG  209

Query  717   PYSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGE  544
             P ++++  VRP+I  R+  ++  VSN+L+ML ++ + + +               + +G 
Sbjct  210   PSASEDGRVRPYIQGRIYHVAHLVSNSLAMLRRLPQRRRR---------RGREALEGYGR  260

Query  543   MKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRY  364
             ++ GFP W+S  DR  L  P+        AD+ VAKDGSG+F ++  A++AAP++S++R+
Sbjct  261   VRRGFPSWVSAGDRRRLLEPSAGA-----ADLVVAKDGSGNFTTVGEAVAAAPNNSESRF  315

Query  363   VIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFI  184
             VI+IKAG Y+E V+V  +KT +MFVGDG+ KT IK +RNV D   T+RSAT+AVVGTGF+
Sbjct  316   VIYIKAGGYFENVEVGPEKTNLMFVGDGMWKTVIKASRNVVDNSTTYRSATLAVVGTGFL  375

Query  183   AIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVD  4
             A  ++ EN+AGP KHQAVALR ++D S FY C F GYQDTLY HS RQF+R+CDVYGTVD
Sbjct  376   ARDLTVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDVYGTVD  435

Query  3     F  1
             F
Sbjct  436   F  436



>ref|XP_010456049.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39 
[Camelina sativa]
Length=532

 Score =   300 bits (768),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 230/343 (67%), Gaps = 31/343 (9%)
 Frame = -3

Query  996  KSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMESRALYVCLELFSDTLADLRT  820
            K  PE++ AT+N T+ ++  A+++ S ++ R  P+L + E  AL  CL L  DT++DL+ 
Sbjct  49   KVTPELVIATLNQTILKVSVASSSFSDLQNRFGPNLSSRERCALEDCLGLLDDTISDLQA  108

Query  819  VLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFP------YSNKNVRPFIIKRVEQ---  667
             L  L +S  + + D++ LLS A+TNQ TCL+GF        +N ++   + K +++   
Sbjct  109  ALSNLRSSSFESH-DVKMLLSNAITNQDTCLDGFSRCRNDNENNNDMSVALPKNLKESIL  167

Query  666  -ISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLE  490
             IS ++SN+L ML ++   KN       PS  SS       ++   +P W+S  D+ LL+
Sbjct  168  NISNNLSNSLDML-QVMSRKN-------PSRESS-------DVDVKYPGWVSEFDQRLLQ  212

Query  489  APTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKK  310
            AP     ++   +++VAKDG+G+F +I+AA+SAAP+SS+TR++I+IK G Y+E V+V KK
Sbjct  213  APV----QETSFNLSVAKDGTGNFTTISAAVSAAPNSSETRFIIYIKGGEYFENVEVPKK  268

Query  309  KTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
            KTMIMFVGDGIGKT IK NRN  DGWPTFR+ATV V G GFIA  I+F N AGP K QAV
Sbjct  269  KTMIMFVGDGIGKTVIKANRNCVDGWPTFRTATVGVKGKGFIAKDITFVNFAGPAKKQAV  328

Query  129  ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            ALR+ SD S FY C F GYQDTLYVHS +QF+RECD+YGT+DF
Sbjct  329  ALRSGSDLSAFYRCAFYGYQDTLYVHSAKQFYRECDIYGTIDF  371



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   301 bits (771),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 169/370 (46%), Positives = 227/370 (61%), Gaps = 20/370 (5%)
 Frame = -3

Query  1077  VAHSACDRSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAANCSRIRRVV  901
             V   AC  +L+ +LCVS++     L +K+   EI+ + V V +  ++ A A+  R+ R  
Sbjct  62    VLKDACSSTLHPELCVSSIASYGGLSSKADHMEIVESAVRVGIGAVEKAKAHVRRLSR--  119

Query  900   PDLGTMESRALYVCLELFSDTLADLRTVLDGLENS---PAKRYAD-LQTLLSTAMTNQYT  733
             P L   +  AL  C+E+F DTL +L+  L  L+N+      +YAD L+TLLS A+TNQYT
Sbjct  120   PGLDFRQRGALKDCMEMFDDTLEELQDTLTDLQNATFMSLPKYADDLKTLLSGAITNQYT  179

Query  732   CLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQE  553
             CL+GF     ++R  +   +  IS  VSN+L+M+    ++ N      G + S S  R+ 
Sbjct  180   CLDGFHLCKGHLRQDLNAELLNISHLVSNSLAMVCNFSQQANLA---LGNADSLSDRRRR  236

Query  552   ------HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                         GFP W+S  DR LL+ P     + I A+  VAKDGSG + +I+AA++A
Sbjct  237   LLSNDFMSSDDHGFPSWMSAGDRRLLQTPA----QNINANAVVAKDGSGSYTTISAAVAA  292

Query  390   APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
             AP+ S +RYVIHIK G Y E VD+ K K  +MF+GDG   T +  NRNV DG+ TF SAT
Sbjct  293   APEKSTSRYVIHIKKGVYQENVDIPKNKHNLMFIGDGKDVTVVTANRNVVDGYTTFHSAT  352

Query  210   VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
              AV G GF+A  ++F+N+AGP KHQAVALR  SD S F  C F GYQDTLYVHS RQF+R
Sbjct  353   AAVTGKGFVARDMTFKNTAGPTKHQAVALRVGSDLSAFLRCTFEGYQDTLYVHSLRQFYR  412

Query  30    ECDVYGTVDF  1
             ECDVYGTVDF
Sbjct  413   ECDVYGTVDF  422



>ref|XP_006658118.1| PREDICTED: pectinesterase 3-like [Oryza brachyantha]
Length=577

 Score =   301 bits (770),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 170/362 (47%), Positives = 236/362 (65%), Gaps = 17/362 (5%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             C  +L+RD+CVSTL   P+L  K + ++IS  V    S ++ ++ANCS   +    L   
Sbjct  63    CAGTLHRDVCVSTLATIPNLAQKPLRDVISEVVGRAASAVRASSANCSSYLQRSQQLRVR  122

Query  882   ESRALYVCLELFSDTLADLRTV---LDGLENSPAKRYADLQTLLSTAMTNQYTCLEGF--  718
             +  AL  CLELF  TL  L T    L     S  +  A +QT+LS AMTNQYTCLEGF  
Sbjct  123   DRLALSDCLELFGHTLDQLGTAAAELSAGNRSAEESIAGVQTVLSAAMTNQYTCLEGFAG  182

Query  717   PYSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGE  544
             P ++++  VRP+I  R+  ++  VSN+L+M+ ++ +++            S    + +G 
Sbjct  183   PSASEDGRVRPYIQGRIYHVAHLVSNSLAMVRRLPQQRRGRGR----GLRSKEPLEGYGR  238

Query  543   MKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRY  364
             ++ GFP W+S  DR  L+     ++    A+V VAKDGSG+F +++ A++AAP++S+TRY
Sbjct  239   VRRGFPSWVSGSDRRRLQ-----QQVAPAANVVVAKDGSGNFTTVSEAVAAAPNNSETRY  293

Query  363   VIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAV-VGTGF  187
             VI+IKAG Y+E V+V  +KT IMFVGDG+ +T IK +RNV D   TFRSAT+AV  GTGF
Sbjct  294   VIYIKAGGYFENVEVGSEKTNIMFVGDGMWRTVIKASRNVVDNSTTFRSATLAVGGGTGF  353

Query  186   IAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTV  7
             +A  I+ EN+AGP KHQAVALR ++D S FY C F GYQDTLY HS RQF+R+CD+YGTV
Sbjct  354   LARDITVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTV  413

Query  6     DF  1
             DF
Sbjct  414   DF  415



>ref|XP_010462289.1| PREDICTED: pectinesterase 2 [Camelina sativa]
Length=584

 Score =   300 bits (767),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 176/421 (42%), Positives = 241/421 (57%), Gaps = 25/421 (6%)
 Frame = -3

Query  1206  SEMQNLGRNPIMLVPVVLLAAFLSLTVFQSSAMNA---------TTSDDIHQVAHSACDR  1054
             S+  +   N  +++    +A FL  TV   +A  +         T S   H V  S C  
Sbjct  9     SKFSDFKNNKKLILSSAAVALFLFATVVGVAATKSNQNKIQEITTLSSTSHAVLKSVCSS  68

Query  1053  SLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESR  874
             +LY +LC S +  T      S  ++I A++N+T   ++       ++      L   E  
Sbjct  69    TLYPELCFSAVAATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTAREVT  128

Query  873   ALYVCLELFSDTLADLRTVLDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEGFPYS  709
             AL+ CLE   +TL +L   ++ L   P      K   DL+TL+S+A+TNQ TCL+GF Y 
Sbjct  129   ALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFSYD  188

Query  708   N--KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS--FRQEHGEM  541
             N  K VR  ++K    +    SNAL+M+  +         L   S + ++   ++  GE+
Sbjct  189   NADKQVRKALLKGQVHVEHMCSNALAMIKNMTDTDIAKFELIDKSSTPTNRKLKEITGEL  248

Query  540   K-DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRY  364
               +G+P WLS  DR LL+  T      +KAD TVA DGSGDF++I AA++AAP+ S+ R+
Sbjct  249   DGEGWPHWLSVGDRRLLQGST------VKADATVAADGSGDFRTIVAAVTAAPEKSNKRF  302

Query  363   VIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFI  184
             VIHIKAG Y E V+V KKK  IMF+GDG GKT I  +RNV DG  TF SATVA VG  F+
Sbjct  303   VIHIKAGVYRENVEVTKKKKNIMFLGDGRGKTIITASRNVVDGSTTFHSATVAAVGERFL  362

Query  183   AIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVD  4
             A  I+F+N+AGP KHQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTVD
Sbjct  363   ARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVD  422

Query  3     F  1
             F
Sbjct  423   F  423



>ref|XP_010501045.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 174/410 (42%), Positives = 238/410 (58%), Gaps = 29/410 (7%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATT-------------SDDIHQVAHSACDRSLYRDLCVSTL  1021
             ++L +A ++L VF +    ATT             S   H V  S C  +LY DLC S +
Sbjct  30    LILSSATVALLVFATVVGVATTKSNQNKNQEITTLSSTSHAVLKSVCSSTLYPDLCFSAV  89

Query  1020  VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSD  841
               T      S  ++I A++N+T   ++       ++      L   E  AL+ CLE+  +
Sbjct  90    AATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTAREVTALHDCLEMIDE  149

Query  840   TLADLRTVLDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEGFPYSN--KNVRPFII  682
             TL  L   ++ L   P      K   DL+TL+S+A+TNQ TCL+GF Y N  K VR  ++
Sbjct  150   TLDGLHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFSYDNADKQVRKALL  209

Query  681   KRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS--FRQEHGEM-KDGFPKWLSR  511
             K    +    SNAL+M+  +         L   S + ++   ++  G++  +G+P WLS 
Sbjct  210   KGQVHVEHMCSNALAMIKNMTDTDIAKFELINKSSTPTNRKLKEITGDLDSEGWPHWLSV  269

Query  510   RDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYE  331
              +R LL+  T      + AD TVA DGSGDF++I AA++AAP+ S+ R+VIHIKAG Y E
Sbjct  270   GERRLLQGST------VNADATVAADGSGDFRTIVAAVAAAPEKSNKRFVIHIKAGVYRE  323

Query  330   YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAG  151
              V+V KKK  IMF+GDG GKT I G+RNV DG  TF SATVA VG  F+A  I+F+N+AG
Sbjct  324   NVEVTKKKKNIMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAG  383

Query  150   PEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             P KHQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  384   PSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVDF  433



>ref|XP_010479961.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 175/410 (43%), Positives = 238/410 (58%), Gaps = 29/410 (7%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATT-------------SDDIHQVAHSACDRSLYRDLCVSTL  1021
             ++L +A ++L VF +    ATT             S   H V  S C  +LY DLC S +
Sbjct  30    LILSSATVALLVFATVVGVATTKSNQNKNQEITTLSSTSHAVLKSVCSSTLYPDLCFSAV  89

Query  1020  VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSD  841
               T      S  ++I A++N+T   ++       ++      L   E  AL+ CLE   +
Sbjct  90    AATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTAREVTALHDCLETIDE  149

Query  840   TLADLRTVLDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEGFPYSN--KNVRPFII  682
             TL +L   ++ L   P      K   DL+TL+S+A+TNQ TCL+GF Y N  K VR  ++
Sbjct  150   TLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFSYDNADKQVRKALL  209

Query  681   KRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS--FRQEHGEMK-DGFPKWLSR  511
             K    +    SNAL+M+  +         L   S + ++   ++  G++  +G+P WLS 
Sbjct  210   KGQVHVEHMCSNALAMIKNMTDTDIAKFELIDKSSTPTNRKLKEITGDLDGEGWPHWLSV  269

Query  510   RDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYE  331
              DR LL+  T      +KAD TVA DGSGDF++I AA++AAP+ S+ R+VIHIKAG Y E
Sbjct  270   GDRRLLQGST------VKADATVAADGSGDFRTIVAAVAAAPEKSNKRFVIHIKAGVYRE  323

Query  330   YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAG  151
              V+V KKK  IMF+GDG GKT I  +RNV DG  TF SATVA VG  F+A  I+F+N+AG
Sbjct  324   NVEVTKKKKNIMFLGDGRGKTIITASRNVVDGSTTFHSATVAAVGERFLARDITFQNTAG  383

Query  150   PEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             P KHQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  384   PSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVDF  433



>ref|XP_002872846.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49105.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=531

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/343 (48%), Positives = 222/343 (65%), Gaps = 28/343 (8%)
 Frame = -3

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMESRALYVCLELFSDTLADL  826
               K+IPE+I A +N+T+ ++  A++N S ++ R+ P+L   E  A   CL L  DT++DL
Sbjct  47    ETKTIPELIIADLNLTILKVNLASSNFSDLQTRLGPNLTHCERCAFEDCLGLLDDTISDL  106

Query  825   RTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYS-NKNVRPFIIKRVEQ------  667
             +T +  L +S +  + D+  LLS AMT+Q TCL+GF  S N+N    + +  E       
Sbjct  107   KTAISKLRSS-SFEFNDVSLLLSNAMTDQDTCLDGFSTSDNENNNDMMYELPENLKESIL  165

Query  666   -ISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLE  490
              IS  +SN+L ML  I     K S L            E  E+   +P W+S+ D+ LLE
Sbjct  166   DISNDLSNSLDMLQMIS---GKNSTL------------ESSEVDVEYPSWVSKNDKRLLE  210

Query  489   APTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKK  310
             AP    +     +++VA DG+G+F +INAA+SAAP+ SDTR++I+IK G Y+E V++ KK
Sbjct  211   APV---QEITNFNLSVAIDGTGNFTTINAAVSAAPNKSDTRFIIYIKGGEYFENVELPKK  267

Query  309   KTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
             KTMIMF+GDGIGKT IK NR+  DGW TF++ATV V G GFIA  ISF N AG  K QAV
Sbjct  268   KTMIMFIGDGIGKTVIKANRSRIDGWSTFQTATVGVKGKGFIAKDISFVNFAGLAKEQAV  327

Query  129   ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR+ SD+S FY C F GYQDTLYVHS +QF+RECD+YGT+DF
Sbjct  328   ALRSGSDHSAFYRCEFDGYQDTLYVHSAKQFYRECDIYGTIDF  370



>ref|NP_001146685.1| pectinesterase precursor [Zea mays]
 gb|ACL54524.1| unknown [Zea mays]
 tpg|DAA54385.1| TPA: pectinesterase [Zea mays]
Length=563

 Score =   296 bits (758),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 181/377 (48%), Positives = 233/377 (62%), Gaps = 33/377 (9%)
 Frame = -3

Query  1074  AHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD  895
             A + CD +LY +LC+STL   PDL  K +P++I A VN T   +   ++NCS   +    
Sbjct  40    AAAHCDGTLYPELCLSTLADIPDLHKKPLPDVICAAVNRTEDVVVATSSNCSYYLQDR-S  98

Query  894   LGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA---------------DLQTLL  760
             L   +  A+  CLEL S T+ +LR     L  SPA R +                + T+L
Sbjct  99    LSARDRLAINDCLELLSTTMDELRASTADLA-SPAGRGSASAGVSQGARRATMEHVMTVL  157

Query  759   STAMTNQYTCLEGFPY-SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGP  583
             S A+TNQYTCL+GF Y S   VR +I      +SR VSN+L+M  K+             
Sbjct  158   SAAITNQYTCLDGFAYQSGGRVRRYIEPTFHHVSRMVSNSLAMAKKLPGAGA--------  209

Query  582   SYSSSSFRQE---HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKS  412
             S + +  RQ    +G+M  GFP+W+   DR LL+A        + AD  VAKDGSGD+ +
Sbjct  210   SAAPAPPRQPFTGYGQMVKGFPRWVRPGDRRLLQA----PASAVAADAVVAKDGSGDYTT  265

Query  411   INAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGW  232
             + AA++AAP +S  R+VI+IKAG+Y E V+V KK   +MFVGDGIGKT IK +RNV DG+
Sbjct  266   VAAAVAAAPTNSKKRHVIYIKAGAYMENVEVGKKHVNLMFVGDGIGKTVIKASRNVVDGY  325

Query  231   PTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVH  52
              TFRSATVAVVG  F+A  ++ ENSAGP KHQAVALR  +D S FY C FVGYQDTLYVH
Sbjct  326   TTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVH  385

Query  51    SRRQFFRECDVYGTVDF  1
             S RQFFR+CDVYGT+DF
Sbjct  386   SLRQFFRDCDVYGTIDF  402



>ref|XP_002463382.1| hypothetical protein SORBIDRAFT_02g042780 [Sorghum bicolor]
 gb|EER99903.1| hypothetical protein SORBIDRAFT_02g042780 [Sorghum bicolor]
Length=599

 Score =   296 bits (757),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 239/371 (64%), Gaps = 30/371 (8%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             C  +L+RD+C STL   PDL  K + ++ISA V    + ++ +A+NCS   R     G +
Sbjct  80    CAGTLHRDVCASTLSAIPDLAQKPVRDVISAVVARAAAAVRASASNCSAYLRRPAGAGAL  139

Query  882   ESR---ALYVCLELFSDTLADLRTVLDGLENSPA----------KRYADLQTLLSTAMTN  742
               R   AL  C+EL   TLA L T    L  + +          +  A +QT+LS A+TN
Sbjct  140   RVRDRLALSDCVELLQHTLAQLGTAEAELSAANSSTSTSTSTDEESVAGVQTVLSAALTN  199

Query  741   QYTCLEGF--PYSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYS  574
             QYTCL+GF  P ++++  VRP+I  R+  ++  VSN+L+ML ++ + + +          
Sbjct  200   QYTCLDGFAGPSASEDGRVRPYIQGRIYHVAHLVSNSLAMLRRLPQRRRR-------RGR  252

Query  573   SSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALS  394
              +   + +G ++ GFP W+S  DR  L+      ++++  D+ VAKDGSG+F ++  A++
Sbjct  253   EALELEGYGRVRRGFPSWVSAADRRRLQ------QQQVVPDLVVAKDGSGNFTTVGEAVA  306

Query  393   AAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSA  214
             AAP++S++R+VI+IKAG Y+E V+V  +KT +MFVGDG+ KT IK +RNV D   TFRSA
Sbjct  307   AAPNNSESRFVIYIKAGGYFENVEVGSEKTNLMFVGDGMWKTVIKASRNVVDNSTTFRSA  366

Query  213   TVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFF  34
             T+AVVGTGF+A  ++ EN+AGP KHQAVALR ++D + FY C F GYQDTLY HS RQF+
Sbjct  367   TLAVVGTGFLARDLTVENAAGPSKHQAVALRVNADLAAFYRCSFAGYQDTLYAHSLRQFY  426

Query  33    RECDVYGTVDF  1
             R+CDVYGTVDF
Sbjct  427   RDCDVYGTVDF  437



>ref|XP_006307088.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
 gb|EOA39986.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
Length=584

 Score =   295 bits (755),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 174/406 (43%), Positives = 238/406 (59%), Gaps = 26/406 (6%)
 Frame = -3

Query  1167  VPVVLLAAFLSLTVFQSSAMN----ATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLR  1000
             + ++L A  + +   +S+        T S   H V  S C  +LY +LC S +  +    
Sbjct  27    IALILFATIVGVAATKSNQNKNQQITTISSTSHAVLKSVCSSTLYPELCYSAVAASGGKE  86

Query  999   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVV---PDLGTMESRALYVCLELFSDTLAD  829
               S  ++I A++N+T    K    N   +++++     L   E  AL+ CLE   +TL +
Sbjct  87    LTSHKDVIEASLNLTT---KAVTHNYFAVKKLITKRKGLTAREVTALHDCLETIDETLDE  143

Query  828   LRTVLDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEGFPYSN--KNVRPFIIKRVE  670
             L    + L   P      K   DL+TL+S+A+TNQ TCL+GF Y N  K VR  ++K   
Sbjct  144   LHEAKEDLHMYPTQKSLRKHADDLKTLISSAITNQGTCLDGFSYDNADKKVRKALLKGQV  203

Query  669   QISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFR--QEHGEMK-DGFPKWLSRRDRA  499
              +    SNAL+M+  +         L   S +S++ +  +  G++  +G+P WLS  DR 
Sbjct  204   HVEHMCSNALAMIKNMTDTDIANFELRDKSSTSNNRKLMEITGDLDGEGWPHWLSVGDRR  263

Query  498   LLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDV  319
             LL+  T      +KAD TVA DGSGDFK+I AA++AAP+ S  R+VIHIKAG Y E V+V
Sbjct  264   LLQGST------VKADATVAADGSGDFKTIVAAVAAAPEKSSKRFVIHIKAGVYRENVEV  317

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKH  139
              KKK  IMF+GDG GKT I  +RNV DG  TF SATVA VG GF+A  I+F+N+AGP KH
Sbjct  318   SKKKKNIMFLGDGRGKTIITASRNVVDGSTTFHSATVAAVGEGFLARDITFQNTAGPSKH  377

Query  138   QAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  378   QAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIVGTVDF  423



>ref|XP_006396438.1| hypothetical protein EUTSA_v10029453mg [Eutrema salsugineum]
 gb|ESQ37891.1| hypothetical protein EUTSA_v10029453mg [Eutrema salsugineum]
Length=524

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/343 (47%), Positives = 220/343 (64%), Gaps = 34/343 (10%)
 Frame = -3

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMESRALYVCLELFSDTLADL  826
             ++    E++ AT+N T+S++  +++N   ++ R+ P L   +  A   CL L  DT++DL
Sbjct  46    KSNDTTELVVATLNQTISKVNLSSSNFFDLQNRLGPTLTFRDRCAFEDCLGLLDDTISDL  105

Query  825   RTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSN---KNVRPF-----IIKRVE  670
             +T +  L++S    + D+  LLS AMTNQ TCLEGF  SN    N R +     + + + 
Sbjct  106   KTAISKLQSSSFGSH-DVSMLLSDAMTNQDTCLEGFTASNDENNNDRTYELNESLKESIL  164

Query  669   QISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLE  490
              IS ++ N+L M+ KI   K+ P                       FP W+S  D+ LL+
Sbjct  165   NISNNLGNSLDMVQKIPGNKHFPDV--------------------EFPSWVSENDKRLLQ  204

Query  489   APTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKK  310
             A      ++ K +++VA+DGSG+F +I++A+SAAP+SS+TR+ I+IK G Y+E V++ KK
Sbjct  205   ASV----KETKFNLSVAQDGSGNFTTISSAVSAAPNSSETRFTIYIKGGVYFENVEIPKK  260

Query  309   KTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
             KTMIMFVGDGIGKT IK NR+  DGW TF+SATV V G GFIA GISF N AG  KHQAV
Sbjct  261   KTMIMFVGDGIGKTIIKANRSRVDGWSTFQSATVGVKGKGFIAKGISFVNFAGLAKHQAV  320

Query  129   ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR+ SD S FY C F GYQDTLYVHS +QF+RECD++GTVDF
Sbjct  321   ALRSGSDLSAFYQCAFEGYQDTLYVHSAKQFYRECDIFGTVDF  363



>gb|AAC50023.1| ATPME2 precursor, partial [Arabidopsis thaliana]
Length=582

 Score =   294 bits (753),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 168/374 (45%), Positives = 223/374 (60%), Gaps = 19/374 (5%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             H +  S C  +LY +LC S +  T      S  E+I A++N+T   +K       ++   
Sbjct  54    HAILKSVCSSTLYPELCFSAVAATGGKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAK  113

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPA-----KRYADLQTLLSTAMTNQ  739
                L   E  AL+ CLE   +TL +L   ++ L   P      K   DL+TL+S+A+TNQ
Sbjct  114   RKGLTPREVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQ  173

Query  738   YTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS  565
              TCL+GF Y  +++ VR  ++K    +    SNAL+M+  + +       L    ++   
Sbjct  174   GTCLDGFSYDDADRKVRKALLKGQVHVEHMCSNALAMIKNMTETDIANFELRDKFFNLHQ  233

Query  564   FRQEH-----GEM-KDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINA  403
              +Q       G++  DG+PKWLS  DR LL+  T      IKAD TVA DGSGDF + +A
Sbjct  234   QQQRKLKEVTGDLDSDGWPKWLSVGDRRLLQGST------IKADATVADDGSGDFDNGSA  287

Query  402   ALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTF  223
             A++AAP+ S+ R+VIHIKAG Y E V+V KKKT IMF+GDG GKT I G+RNV DG  TF
Sbjct  288   AVAAAPEKSNKRFVIHIKAGVYRENVEVTKKKTNIMFLGDGRGKTIITGSRNVVDGSTTF  347

Query  222   RSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRR  43
              SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C    YQDTLYVHS R
Sbjct  348   HSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNR  407

Query  42    QFFRECDVYGTVDF  1
             QFF +C + GTVDF
Sbjct  408   QFFVKCHITGTVDF  421



>emb|CDX98441.1| BnaC05g39340D [Brassica napus]
Length=572

 Score =   293 bits (751),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 168/374 (45%), Positives = 225/374 (60%), Gaps = 21/374 (6%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             T S   H V  SAC  +LY +LC+S +     ++  S  ++I A++N+T + ++      
Sbjct  52    TLSPTSHAVLRSACSSTLYPELCISAVATAGGVKLMSQKDVIEASLNLTTTAVEHNYFGV  111

Query  921   SRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKR-----YADLQTLLS  757
              ++ +    L   E  AL+ CLE   +TL +L   L+ L   P K+       DL+TL+S
Sbjct  112   KKLIKNTKGLTPREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLIS  171

Query  756   TAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGP  583
             +A+TNQ TCL+GF +  ++K VR  ++K    +    SNAL+M   IK   +   A F  
Sbjct  172   SAITNQETCLDGFSHDAADKKVRKALLKGQMHVEHMCSNALAM---IKNMTDTDIANFEL  228

Query  582   SYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINA  403
                 +S  +      DG+P WLS  DR LL+  T      +KAD TVA DGSG F +I+A
Sbjct  229   KAKLTSNNRA-----DGWPTWLSAGDRRLLQGST------VKADATVAADGSGTFTTISA  277

Query  402   ALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTF  223
             A++AAP++S+ RYVIHIKAG Y E VDV KKK  IMF+GDG   T I  +RNV DG  TF
Sbjct  278   AVAAAPENSNKRYVIHIKAGVYRENVDVAKKKKNIMFMGDGRTTTIITASRNVVDGSTTF  337

Query  222   RSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRR  43
              SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C  + YQDTLYVHS R
Sbjct  338   HSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNR  397

Query  42    QFFRECDVYGTVDF  1
             QFF +C + GTVDF
Sbjct  398   QFFVKCLIAGTVDF  411



>emb|CDX97564.1| BnaA05g25150D [Brassica napus]
Length=592

 Score =   293 bits (751),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 172/389 (44%), Positives = 230/389 (59%), Gaps = 31/389 (8%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             T S   H V  SAC  +LY +LC+S +     ++  S  ++I A++N+T + ++      
Sbjct  52    TLSPTSHAVLRSACSSTLYPELCISAVATAGGVKLTSQKDVIEASLNLTTTAVEHNYFGV  111

Query  921   SRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKR-----YADLQTLLS  757
              ++ +    L   E  AL+ CLE   +TL +L   L+ L   P K+       DL+TL+S
Sbjct  112   KKLIKKTKGLTPREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLIS  171

Query  756   TAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGP  583
             +A+TNQ TCL+GF +  ++K VR  ++K    +    SNAL+M   IK   +   A F  
Sbjct  172   SAITNQETCLDGFSHDAADKKVRKALLKGQMHVEHMCSNALAM---IKNMTDTDIANFEL  228

Query  582   SYSSSS----FRQEH----------GEM-KDGFPKWLSRRDRALLEAPTGKKKRKIKADV  448
                 SS     ++E           GE+  DG+P WLS  DR LL+  T      +KAD 
Sbjct  229   KAKLSSNNRKLKEEETTVAVDIAGAGELGADGWPTWLSAGDRRLLQGST------VKADA  282

Query  447   TVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKT  268
             TVA DGSG F +I+AA++AAP++S+ RYVIHIKAG Y E VDV KKK  IMF+GDG   T
Sbjct  283   TVAADGSGTFTTISAAVAAAPENSNKRYVIHIKAGVYRENVDVAKKKKNIMFMGDGRTTT  342

Query  267   RIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDC  88
              I  +RNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C
Sbjct  343   IITASRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQC  402

Query  87    RFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               + YQDTLYVHS RQFF +C + GTVDF
Sbjct  403   DMLAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>ref|XP_009146386.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Brassica 
rapa]
Length=592

 Score =   293 bits (751),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 172/389 (44%), Positives = 230/389 (59%), Gaps = 31/389 (8%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             T S   H V  SAC  +LY +LC+S +     ++  S  ++I A++N+T + ++      
Sbjct  52    TLSPTSHAVLRSACSSTLYPELCISAVATAGGVKLTSQKDVIEASLNLTTTAVEHNYFGV  111

Query  921   SRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKR-----YADLQTLLS  757
              ++ +    L   E  AL+ CLE   +TL +L   L+ L   P K+       DL+TL+S
Sbjct  112   KKLIKKTKGLTPREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLIS  171

Query  756   TAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGP  583
             +A+TNQ TCL+GF +  ++K VR  ++K    +    SNAL+M   IK   +   A F  
Sbjct  172   SAITNQETCLDGFSHDAADKKVRKALLKGQMHVEHMCSNALAM---IKNMTDTDIANFEL  228

Query  582   SYSSSS----FRQEH----------GEM-KDGFPKWLSRRDRALLEAPTGKKKRKIKADV  448
                 SS     ++E           GE+  DG+P WLS  DR LL+  T      +KAD 
Sbjct  229   KAKLSSNNRKLKEEETTVAVDIAGAGELGADGWPTWLSAGDRRLLQGST------VKADA  282

Query  447   TVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKT  268
             TVA DGSG F +I+AA++AAP++S+ RYVIHIKAG Y E VDV KKK  IMF+GDG   T
Sbjct  283   TVAADGSGTFTTISAAVAAAPENSNKRYVIHIKAGVYRENVDVAKKKKNIMFMGDGRTTT  342

Query  267   RIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDC  88
              I  +RNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C
Sbjct  343   IITASRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQC  402

Query  87    RFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               + YQDTLYVHS RQFF +C + GTVDF
Sbjct  403   DMLAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/404 (42%), Positives = 241/404 (60%), Gaps = 26/404 (6%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQ-VAHSACDRSLYRDLCVSTLVKTPDLRA  997
             +   +V++AA + +    SS  N+  SD  H  V  SAC  + Y DLC S +   P   A
Sbjct  31    LFASLVIVAAIIGIVAGVSSRNNSDESDTSHHAVVKSACSGTFYPDLCFSAVTTVPAGTA  90

Query  996   KSI---PEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMESRALYVCLELFSDTLA  832
             K +    ++I  ++N+T + ++    N  +I++++   DL T E  AL+ CLE   +TL 
Sbjct  91    KKVRSQKDVIELSLNITTTAVE---HNYFKIKKLLARKDLTTREKTALHDCLETIDETLD  147

Query  831   DLRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRV  673
             +L   ++ L   P K+       DL+TL+S AMTNQ TCL+GF +  ++K +R  +I   
Sbjct  148   ELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLIDGE  207

Query  672   EQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALL  493
             + + +  SNAL+M+  +         +      SS+ + +  E    +P+WLS  DR LL
Sbjct  208   KYVEKMCSNALAMIKNMTDTDIANEMML----KSSNRKLKEDESGIAWPEWLSAGDRRLL  263

Query  492   EAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDK  313
             ++ +      +  +V VA DGSG+FK+++ A++ AP+ S  RY+I IKAG Y E V+V K
Sbjct  264   QSSS------VTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPK  317

Query  312   KKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQA  133
             KK+ IMF+GDG  KT I G+RNV DG  TF SATVAVVG  F+A  I+F+N+AGP KHQA
Sbjct  318   KKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLARDITFQNTAGPSKHQA  377

Query  132   VALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VALR  SD S FY+C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  378   VALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDF  421



>ref|NP_192139.1| Probable pectinesterase/pectinesterase inhibitor 39 [Arabidopsis 
thaliana]
 sp|O81415.1|PME39_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
39; Includes: RecName: Full=Pectinesterase inhibitor 39; AltName: 
Full=Pectin methylesterase inhibitor 39; Includes: RecName: 
Full=Pectinesterase 39; Short=PE 39; AltName: Full=Pectin 
methylesterase 39; Short=AtPME39; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC28174.1| T2H3.6 [Arabidopsis thaliana]
 emb|CAB80723.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAY78785.1| pectinesterase family protein [Arabidopsis thaliana]
 gb|AEE82152.1| Probable pectinesterase/pectinesterase inhibitor 39 [Arabidopsis 
thaliana]
Length=532

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/343 (46%), Positives = 218/343 (64%), Gaps = 29/343 (8%)
 Frame = -3

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMESRALYVCLELFSDTLADL  826
               K+IPE+I A +N+T+ ++  A++N S ++ R+ P+L   E  A   CL L  DT++DL
Sbjct  49    ETKTIPELIIADLNLTILKVNLASSNFSDLQTRLFPNLTHYERCAFEDCLGLLDDTISDL  108

Query  825   RTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYS-NKNVRPFIIKRVEQ------  667
              T +  L +S +  + D+  LL+  MT Q TCL+GF  S N+N      +  E       
Sbjct  109   ETAVSDLRSS-SLEFNDISMLLTNVMTYQDTCLDGFSTSDNENNNDMTYELPENLKEIIL  167

Query  666   -ISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLE  490
              IS ++SN+L ML  I ++K  P +                E+   +P WLS  D+ LLE
Sbjct  168   DISNNLSNSLHMLQVISRKKPSPKS---------------SEVDVEYPSWLSENDQRLLE  212

Query  489   APTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKK  310
             AP     ++   +++VA DG+G+F +IN A+ AAP+ S+TR++I+IK G Y+E V++ KK
Sbjct  213   APV----QETNYNLSVAIDGTGNFTTINDAVFAAPNMSETRFIIYIKGGEYFENVELPKK  268

Query  309   KTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
             KTMIMF+GDGIGKT IK NR+  DGW TF++ TV V G G+IA  ISF NSAGP K QAV
Sbjct  269   KTMIMFIGDGIGKTVIKANRSRIDGWSTFQTPTVGVKGKGYIAKDISFVNSAGPAKAQAV  328

Query  129   ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             A R+ SD+S FY C F GYQDTLYVHS +QF+RECD+YGT+DF
Sbjct  329   AFRSGSDHSAFYRCEFDGYQDTLYVHSAKQFYRECDIYGTIDF  371



>ref|XP_010937249.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=582

 Score =   291 bits (746),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 171/425 (40%), Positives = 252/425 (59%), Gaps = 21/425 (5%)
 Frame = -3

Query  1230  LSYHSTIDSEMQNLGRNPIMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAH----SA  1063
             ++ H   DS  +   R  ++L   ++LAA ++ T    +   AT S D   V+H    S+
Sbjct  1     MTTHHNSDSNPKK--RRKLLLTSFLVLAALITTTSILIARRTATASSDDPTVSHAILRSS  58

Query  1062  CDRSLYRDLCVSTLVKTPDL-RAKSIP-EIISATVNVTVSEIKTAAANCSRIRRVVPDLG  889
             C  + + DLC S +  TP L    S P ++I A++N+T++ I+ +  +  R+     +L 
Sbjct  59    CRSARFPDLCYSAIAATPPLVHTISKPKDVIHASLNLTITAIERSFRHVERLSAAAANLT  118

Query  888   TMESRALYVCLELFSDTLADLRTVLDGLENSPA----KRYA-DLQTLLSTAMTNQYTCLE  724
               E  AL+ CLE+F ++L +LR     L   PA    +R+A DL+ L+S AMTNQ +C +
Sbjct  119   ARERTALHDCLEMFDESLDELRLTDADLRAYPAGKPLRRHALDLEILVSAAMTNQESCAD  178

Query  723   GFPYSN--KNVRPFIIKRVEQISRHVSNALSMLTKIK-KEKNKPSALFGPSYSSSSFRQE  553
             GF + +  + +R  ++  +  ++R   NAL+M+  +   +     A+   S  +   R  
Sbjct  179   GFSHGDVDRRLRSELVSGLMHVTRMCRNALAMIKNMTGADIAAAEAVVDGSIGTRGRRML  238

Query  552   HGEM-KDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSS  376
                + ++G P W+ ++DR  L    G+    +KA+  VA DGSGD+K++  A++AAP  S
Sbjct  239   GFNIDEEGLPDWIEKKDRRRLLQAAGE----VKANAVVAADGSGDYKTVGKAVAAAPAKS  294

Query  375   DTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVG  196
              TR+VI IKAG+Y E V+V KKKT +MF+GDG   T I G+RNV DG  TF SAT+AVVG
Sbjct  295   KTRWVIRIKAGTYEENVEVPKKKTNLMFIGDGRKTTIITGSRNVVDGSTTFHSATLAVVG  354

Query  195   TGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVY  16
              GF+A G+S +N+AGP KHQAVALR  SD S FYDC  + YQDTLY+HS R FFR C + 
Sbjct  355   AGFLARGLSIQNTAGPSKHQAVALRVSSDLSAFYDCDIIAYQDTLYLHSLRHFFRSCLIQ  414

Query  15    GTVDF  1
             GTVDF
Sbjct  415   GTVDF  419



>ref|XP_008653464.1| PREDICTED: pectinesterase-like [Zea mays]
 tpg|DAA64103.1| TPA: hypothetical protein ZEAMMB73_876271 [Zea mays]
Length=605

 Score =   292 bits (747),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 168/368 (46%), Positives = 236/368 (64%), Gaps = 24/368 (7%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSR-IRRVVPDLGT  886
             C  +L+RD+C STL   PDL  K   E+ISA V    S ++ +A+NCS  +RR    L  
Sbjct  86    CAGTLHRDVCASTLGSIPDLARKPAREVISAVVARAASAVRASASNCSAYLRRPAGALRV  145

Query  885   MESRALYVCLELFSDTLADLRTVLDGLENS---------PAKRYADLQTLLSTAMTNQYT  733
              +  AL  C+EL   TLA L T    L             ++  A +QT+LS A+TNQYT
Sbjct  146   RDRLALADCVELLGHTLAQLGTAEAELSAGNFTAAEAEVESESLAAVQTVLSAALTNQYT  205

Query  732   CLEGF--PYSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS  565
             CL+GF  P ++++  VRP+I  R+  ++  VSN+L+ML ++ + + +             
Sbjct  206   CLDGFAGPSASEDGRVRPYIQGRMYHVAHLVSNSLAMLRRLPQRRRRRQGRGALEL----  261

Query  564   FRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAP  385
               + +G ++ GFP W+S  DR  L+    +++     D+ VAKDGSG+F ++  A++AAP
Sbjct  262   --EGYGRVRRGFPSWVSGADRRRLQ----QQQVVPGPDLVVAKDGSGNFTTVGEAVAAAP  315

Query  384   DSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVA  205
             ++S+TR+VI+IKAG Y+E V+V  +KT +MFVGDG+ +T IK +RNV D   TFRSAT+A
Sbjct  316   NNSETRFVIYIKAGGYFENVEVGSEKTNLMFVGDGMWRTVIKASRNVVDNSTTFRSATLA  375

Query  204   VVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFREC  25
             VVGTGF+A  ++ EN+AGP KHQAVALR ++D S FY C F GYQDTLY HS RQF+R+C
Sbjct  376   VVGTGFLARDLTVENAAGPSKHQAVALRVNADLSAFYRCAFAGYQDTLYAHSLRQFYRDC  435

Query  24    DVYGTVDF  1
             DVYGTVDF
Sbjct  436   DVYGTVDF  443



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   291 bits (744),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 167/404 (41%), Positives = 240/404 (59%), Gaps = 26/404 (6%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQ-VAHSACDRSLYRDLCVSTLVKTPDLRA  997
             +   +V++AA + +    SS  N+  SD  H  V  SAC  + Y DLC S +   P   A
Sbjct  31    LFASLVIVAAIIGIVAGVSSRNNSDESDTSHHAVVKSACSGTFYPDLCFSAVTTVPAGTA  90

Query  996   KSI---PEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMESRALYVCLELFSDTLA  832
             K +    ++I  ++N+T + ++    N  +I++++   DL T E  AL+ CLE   +TL 
Sbjct  91    KKVRSQKDVIELSLNITTTAVE---HNYFKIKKLLARKDLTTREKTALHDCLETIDETLD  147

Query  831   DLRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRV  673
             +L   ++ L   P K+       DL+TL+S AMTNQ TCL+GF +  ++K +R  +I   
Sbjct  148   ELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLIDGE  207

Query  672   EQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALL  493
             + + +  SNAL+M+  +         +      SS+ + +  E    +P+WLS  DR LL
Sbjct  208   KYVEKMCSNALAMIKNMTDTDIANEMML----KSSNRKLKEDESGIAWPEWLSAGDRRLL  263

Query  492   EAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDK  313
             ++ +      +  +V VA DGSG+FK+++ A++ AP+ S  RY+I IKAG Y E V+V K
Sbjct  264   QSSS------VTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPK  317

Query  312   KKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQA  133
             KK+ IMF+GDG  KT I G+RNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQA
Sbjct  318   KKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQNTAGPSKHQA  377

Query  132   VALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VALR  SD S FY+C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  378   VALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDF  421



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   290 bits (743),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 166/404 (41%), Positives = 240/404 (59%), Gaps = 26/404 (6%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQ-VAHSACDRSLYRDLCVSTLVKTPDLRA  997
             +   +V++AA + +    SS  N+  SD  H  +  SAC  + Y DLC S +   P   A
Sbjct  31    LFASLVIVAAIIGIVAGVSSRNNSDESDTSHHAIVKSACSGTFYPDLCFSAVATVPAGTA  90

Query  996   KSI---PEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMESRALYVCLELFSDTLA  832
             K +    ++I  ++N+T + ++    N  +I++++   DL T E  AL+ CLE   +TL 
Sbjct  91    KKVRSQKDVIELSLNITTTAVE---HNYFKIKKLLARKDLTTREKTALHDCLETIDETLD  147

Query  831   DLRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRV  673
             +L   ++ L   P K+       DL+TL+S AMTNQ TCL+GF +  ++K +R  +I   
Sbjct  148   ELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLIDGE  207

Query  672   EQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALL  493
             + + +  SNAL+M+  +         +      SS+ + +  E    +P+WLS  DR LL
Sbjct  208   KYVEKMCSNALAMIKNMTDTDIANEMML----KSSNRKLKEDESGIAWPEWLSAGDRRLL  263

Query  492   EAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDK  313
             ++ +      +  +V VA DGSG+FK+++ A++ AP+ S  RY+I IKAG Y E V+V K
Sbjct  264   QSSS------VTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYIENVEVPK  317

Query  312   KKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQA  133
             KK+ IMF+GDG  KT I G+RNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQA
Sbjct  318   KKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQNTAGPSKHQA  377

Query  132   VALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VALR  SD S FY+C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  378   VALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDF  421



>emb|CDY08206.1| BnaA05g14130D [Brassica napus]
Length=585

 Score =   290 bits (743),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 177/409 (43%), Positives = 243/409 (59%), Gaps = 29/409 (7%)
 Frame = -3

Query  1170  LVPVVLLAAFLSLTVFQSSAMNATTSDDI-------HQVAHSACDRSLYRDLCVSTLVKT  1012
             ++ +VL +A + + V +S   N T +  I       H V  S C  +LY +LC S +  T
Sbjct  26    VLALVLFSAVVGIAVTKS---NQTKNQKIPTLTPTSHAVLKSVCSSTLYPELCFSAVAAT  82

Query  1011  PDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLA  832
                +  S  ++I A++N+T + +K       ++      L   E  AL+ CLE+  +TL 
Sbjct  83    GK-KLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTAREVTALHDCLEIIDETLD  141

Query  831   DLRTVLDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRV  673
             +L   L+ L+  P      K   DL+TL+S+A+TNQ TCL+GF Y  +++ +R  ++K  
Sbjct  142   ELHVALEDLDQYPKGKSLRKHADDLKTLISSAITNQGTCLDGFSYDKADRKLRKALLKGQ  201

Query  672   EQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKD-----GFPKWLSRR  508
               +    SNAL+M+  + +       L   S SS+  R+   E+ D     G+P WLS  
Sbjct  202   VHVEHMCSNALAMIKNMTETDIAKFELKDKS-SSTKNRKLKEELTDDLDGEGWPNWLSIG  260

Query  507   DRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY  328
             DR LL+  TG     + AD TVA DGSGDF ++ AA++AAP+ S+ RYVIHIKAG Y E 
Sbjct  261   DRRLLQGSTG-----VNADATVAADGSGDFTTVAAAVAAAPEKSNKRYVIHIKAGVYREN  315

Query  327   VDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGP  148
             V+V KKK  IMF+GDG GKT I G RNV DG  TF SATVA VG  F+A  I+F+N+AGP
Sbjct  316   VEVSKKKKNIMFLGDGRGKTIITGKRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGP  375

Query  147   EKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              KHQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  376   SKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIAGTVDF  424



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 168/404 (42%), Positives = 239/404 (59%), Gaps = 26/404 (6%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQ-VAHSACDRSLYRDLCVSTLVKTPDLRA  997
             +   +V++AA + +    SS  N+  SD  H  V  SAC  + Y DLC S +   P   A
Sbjct  31    LFASLVIVAAIIGIVAGVSSRNNSDESDTSHHAVVKSACSGTFYPDLCFSAVTAVPAGTA  90

Query  996   KSI---PEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMESRALYVCLELFSDTLA  832
             K +    ++I  ++N T + ++    N  +I++++   DL T E  AL+ CLE   +TL 
Sbjct  91    KKVRSQKDVIELSLNTTTTAVE---HNYFKIKKLLARKDLTTREKTALHDCLETIDETLD  147

Query  831   DLRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRV  673
             +L   ++ L   P K+       DL+TL+S AMTNQ TCL+GF +  ++K +R  +I   
Sbjct  148   ELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLIDGE  207

Query  672   EQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALL  493
             + + +  SNAL+M+  +         +      SS+ + +  E    +P+WLS  DR LL
Sbjct  208   KYVEKMCSNALAMIKNMTDTDIANEMML----KSSNRKLKEDESGIAWPEWLSAGDRRLL  263

Query  492   EAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDK  313
             ++ +      +  +V VA DGSG+FK+++ A++ AP+ S  RY I IKAG Y E V+V K
Sbjct  264   QSSS------VTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYTIRIKAGVYRENVEVPK  317

Query  312   KKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQA  133
             KK+ IMF+GDG  KT I G+RNV DG  TF SATVAVVG  F+A  I+F+N+AGP KHQA
Sbjct  318   KKSSIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLAREITFQNTAGPSKHQA  377

Query  132   VALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VALR  SD S FY+C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  378   VALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDF  421



>ref|NP_175786.1| pectin methylesterase 2 [Arabidopsis thaliana]
 sp|Q42534.2|PME2_ARATH RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase 2; Short=AtPME2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02856.1|AC009324_5 pectinesterase 2 [Arabidopsis thaliana]
 gb|AAK32805.1|AF361637_1 At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AAM91439.1| At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AEE33007.1| pectin methylesterase 2 [Arabidopsis thaliana]
Length=587

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 171/381 (45%), Positives = 229/381 (60%), Gaps = 21/381 (6%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             T S   H +  S C  +LY +LC S +  T      S  E+I A++N+T   +K      
Sbjct  53    TLSSTSHAILKSVCSSTLYPELCFSAVAATGGKELTSQKEVIEASLNLTTKAVKHNYFAV  112

Query  921   SRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPA-----KRYADLQTLLS  757
              ++      L   E  AL+ CLE   +TL +L   ++ L   P      K   DL+TL+S
Sbjct  113   KKLIAKRKGLTPREVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLIS  172

Query  756   TAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKK------EKNKP  601
             +A+TNQ TCL+GF Y  +++ VR  ++K    +    SNAL+M+  + +      E    
Sbjct  173   SAITNQGTCLDGFSYDDADRKVRKALLKGQVHVEHMCSNALAMIKNMTETDIANFELRDK  232

Query  600   SALFGPSYSSSSFRQEHGEM-KDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSG  424
             S+ F  + ++   ++  G++  DG+PKWLS  DR LL+  T      IKAD TVA DGSG
Sbjct  233   SSTF-TNNNNRKLKEVTGDLDSDGWPKWLSVGDRRLLQGST------IKADATVADDGSG  285

Query  423   DFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNV  244
             DF ++ AA++AAP+ S+ R+VIHIKAG Y E V+V KKKT IMF+GDG GKT I G+RNV
Sbjct  286   DFTTVAAAVAAAPEKSNKRFVIHIKAGVYRENVEVTKKKTNIMFLGDGRGKTIITGSRNV  345

Query  243   KDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDT  64
              DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C    YQDT
Sbjct  346   VDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDT  405

Query  63    LYVHSRRQFFRECDVYGTVDF  1
             LYVHS RQFF +C + GTVDF
Sbjct  406   LYVHSNRQFFVKCHITGTVDF  426



>ref|XP_010534986.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
 ref|XP_010534987.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
Length=587

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 229/387 (59%), Gaps = 43/387 (11%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTP--DLRAKSIPEIISATVNVTVSEIKTAAANCSRIR  910
             H V  SAC  + Y+DLCVS +  +    +   S  ++I A++N+T + ++       ++ 
Sbjct  57    HVVLRSACSSARYQDLCVSAISTSALTGVELTSQRDVIEASLNITTTAVEHNYFTIKKLL  116

Query  909   RVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTAMT  745
                  L   E  AL+ CLE   +TL +L   +D L   P K+       DL+TL+S+A+T
Sbjct  117   EKRKGLTKREKTALHDCLETIDETLDELHEAMDDLNEYPDKKSLRQHADDLKTLISSAIT  176

Query  744   NQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKI----------------K  619
             NQ TCL+GF +  ++K VR  + K    +    SNAL+M+  +                +
Sbjct  177   NQETCLDGFSHDDADKKVRKALEKGQIHVEHMCSNALAMIKNMTDTDIANFELKANNHHR  236

Query  618   KEKNKPSALFGPSYSSSSFRQEHGEMK-DGFPKWLSRRDRALLEAPTGKKKRKIKADVTV  442
             K    P+A+ G            GEM  DG+PKWLS  DR LL++ T      +KAD TV
Sbjct  237   KLVEDPAAVVGG-----------GEMDGDGWPKWLSAGDRRLLQSTT------VKADATV  279

Query  441   AKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRI  262
             A DGSG+F+++ A ++AAP++S+ RYVIHIKAG Y E V+V KKK  IMF+GDG  +T I
Sbjct  280   AADGSGNFRTVAAGVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTII  339

Query  261   KGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRF  82
              G+RNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C  
Sbjct  340   TGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDI  399

Query  81    VGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + YQD+LYVHS RQFF +C V GTVDF
Sbjct  400   LAYQDSLYVHSNRQFFVKCLVTGTVDF  426



>ref|XP_002891774.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68033.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   290 bits (741),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 181/409 (44%), Positives = 238/409 (58%), Gaps = 30/409 (7%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATT-SDDIHQVAHSACDRSLYRDLCVSTLVKTPDLR  1000
             ++   VV +AA    T  Q+     TT S   H V  S C  +LY +LC ST+  T   +
Sbjct  30    LLFATVVGIAA----TTNQNKNKKITTLSSTSHAVLKSVCSSTLYPELCFSTVAATGGKQ  85

Query  999   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRT  820
               S  E+I A++N+T   +K       ++      L   E  AL+ CLE   +TL +L  
Sbjct  86    LTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTPREVTALHDCLETIDETLDELHV  145

Query  819   VLDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQIS  661
              ++ +   P      K   DL+TL+S+A+TNQ TCL+GF Y  +++ VR  ++K    + 
Sbjct  146   AVEDIHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFSYDDADRKVRKVLLKGQVHVE  205

Query  660   RHVSNALSMLTKIKKEKNKPSALFGPSYSSSSF--------RQEHGEM-KDGFPKWLSRR  508
                SNAL+M   IK       A F     SSSF        ++  G++  +G+P WLS  
Sbjct  206   HMCSNALAM---IKNMTETDIANFELRDKSSSFTNNNNRKLKEVTGDLDSEGWPMWLSVG  262

Query  507   DRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY  328
             DR LL+  T      IKAD TVA DGSGDF ++ AA++AAP+ S+ R+VIHIKAG Y E 
Sbjct  263   DRRLLQGST------IKADATVAADGSGDFTTVAAAVAAAPEKSNKRFVIHIKAGVYREN  316

Query  327   VDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGP  148
             V+V KKK  IMF+GDG GKT I G+RNV DG  TF SATVA VG  F+A  I+F+N+AGP
Sbjct  317   VEVTKKKKNIMFLGDGQGKTIITGSRNVVDGSTTFHSATVAAVGENFLARDITFQNTAGP  376

Query  147   EKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              KHQAVALR  SD+S FY C    YQDTLYVHS RQFF +C + GTVDF
Sbjct  377   SKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNRQFFVKCHITGTVDF  425



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   290 bits (741),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 161/367 (44%), Positives = 226/367 (62%), Gaps = 20/367 (5%)
 Frame = -3

Query  1068  SACDRSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAANCSRIRRVVPDL  892
             +AC  +LY++LCVS++     L +++   EI+ A VNV ++ +K   A+   +     DL
Sbjct  76    NACSSTLYQELCVSSISSYEGLSSQAGHMEILDAAVNVAINAVKKGQAHTRSL--FSRDL  133

Query  891   GTMESRALYVCLELFSDTLADLRTVLDGLEN----SPAKRYADLQTLLSTAMTNQYTCLE  724
              + +  AL  C+E++ DTL +L   L  L N    S  K  ADL+TLLS A+TNQ+TCLE
Sbjct  134   DSRQRGALNDCMEMYDDTLDELHDTLSDLHNATFLSMPKHAADLETLLSAAITNQFTCLE  193

Query  723   GFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGE  544
             GF     +++  +   +  +S  VSN+L+ +  I     +     G + S +  R+   E
Sbjct  194   GFTLCKGHLKQQVKGELHNVSHLVSNSLATVGNISARAKQA---LGIADSLADRRRLLSE  250

Query  543   M-----KDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDS  379
                   ++GFP W+S  DR LL+         I A+  VAKDGSG + +I+AA+ AAP+ 
Sbjct  251   SFVSTDEEGFPSWMSVGDRRLLQVNV----TNITANAVVAKDGSGHYSTISAAVDAAPEK  306

Query  378   SDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVK-DGWPTFRSATVAV  202
             S TR++I++K G Y E V++ KKK  +MF+GDG G T +  +R+V+     TF SATVAV
Sbjct  307   STTRFIIYVKKGVYQENVEIHKKKHFLMFIGDGEGVTVVTASRSVRGSNHTTFHSATVAV  366

Query  201   VGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECD  22
              G GFIA  ++FEN+AGP  HQAVALR  SD+SVFY C F GYQDTLYVHS RQFFR+CD
Sbjct  367   TGKGFIARDMTFENTAGPSNHQAVALRVGSDFSVFYRCSFKGYQDTLYVHSLRQFFRDCD  426

Query  21    VYGTVDF  1
             +YGTVDF
Sbjct  427   IYGTVDF  433



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 172/408 (42%), Positives = 241/408 (59%), Gaps = 36/408 (9%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNAT-TSDDIHQVAHSACDRSLYRDLCVSTLVKTPDL--  1003
             ++   +L+A+ + +    +S  N++      H +  S+C  +LY DLC S +   P    
Sbjct  31    LIASFLLVASVIGIVAGVASRKNSSKIPSSAHAILKSSCSSTLYPDLCYSAIATVPGAAD  90

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMESRALYVCLELFSDTLAD  829
                +  ++I  ++N+T + ++    N   I++++    L   E  AL+ CLE+  +TL +
Sbjct  91    NLSTQKDVIEISLNITTTAVE---HNYFTIKKLLAHEKLTEREKTALHDCLEMVDETLDE  147

Query  828   LRTVLDGLENSPAKR-----YADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVE  670
             L    + L+  P K+       DL+ LLS AMTNQ TC++GF +  ++K VR  ++K  E
Sbjct  148   LHETAEDLKQYPNKKSLDEHAEDLKILLSAAMTNQDTCIDGFSHEQADKEVRNALLKGQE  207

Query  669   QISRHVSNALSML-----TKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRD  505
              +    SNAL+M+     T + +EK K     G S          GE+ DGFP WLS  D
Sbjct  208   HVYHMCSNALAMIKNMTDTDMAEEKLKMGRKLGEST---------GEI-DGFPGWLSAGD  257

Query  504   RALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYV  325
             R LL+A T      +  DVTVA DGSG++K+++ A++AAP +S+ RY+I IKAG Y E V
Sbjct  258   RRLLQAST------VTPDVTVASDGSGNYKTVSEAVAAAPINSNKRYIIRIKAGVYKENV  311

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPE  145
             DV KKK  IMFVGDG   T I G+RNV DG  TF SATVA VG GF+A  I+F+N+AGP 
Sbjct  312   DVSKKKKNIMFVGDGRKNTIITGSRNVVDGSTTFHSATVAAVGEGFLARDITFQNTAGPS  371

Query  144   KHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KHQAVALR  SD S FY C  + YQDTLYVHS RQF+ +C + GTVDF
Sbjct  372   KHQAVALRVGSDKSAFYRCDMLAYQDTLYVHSLRQFYVDCLIVGTVDF  419



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   290 bits (741),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 174/411 (42%), Positives = 242/411 (59%), Gaps = 39/411 (9%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDI---HQVAHSACDRSLYRDLCVSTLVKTPD  1006
             ++   V+L+AA + +     S  ++T    +   H V  SAC  + Y DLC S +   P 
Sbjct  60    LVFSSVLLIAAVVGIVAGVHSRKSSTNDVGLTAGHAVLKSACSSTRYPDLCYSAIATVPG  119

Query  1005  LRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVV--PDLGTMESRALYVCLELFSDT  838
                K  S  ++I+ ++N+TV+ ++    N   I +++   +L   E  AL+ CLE   +T
Sbjct  120   ASKKVTSQKDVIAVSLNITVTAVE---HNYFTIEKLLDFKNLTKREKAALHDCLETIDET  176

Query  837   LADLRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIK  679
             L +L   +D L+  P K+       DL+TL+S AMTNQ TCL+GF +  ++K+VR  ++K
Sbjct  177   LDELHVAMDDLDEYPDKKSLTQHADDLKTLMSAAMTNQETCLDGFSHDDADKHVREVLLK  236

Query  678   RVEQISRHVSNALSML-----TKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLS  514
                 +    SNAL+M+     T I +E+            +    +E  E   G+PKWLS
Sbjct  237   GQRHVEHMCSNALAMIKNMTDTDIAREREA---------MNRKLMEERDE--SGWPKWLS  285

Query  513   RRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYY  334
               DR LL++ +      +  DV VA DGSGD+K+++AA++AAP+ S  RY+I IKAG Y 
Sbjct  286   AGDRRLLQSSS------VTPDVVVAADGSGDYKTVSAAVAAAPEKSSKRYIIGIKAGVYK  339

Query  333   EYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSA  154
             E V+V KKKT IMF+GDG   T I G++NV DG  TF SATVAVVG  FIA  I+F+N+A
Sbjct  340   ENVEVGKKKTNIMFLGDGRSNTIITGSKNVVDGSTTFNSATVAVVGEKFIARDITFQNTA  399

Query  153   GPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             GP KHQAVALR  SD S FY C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  400   GPSKHQAVALRVGSDLSAFYKCDMLAYQDTLYVHSNRQFYINCLVAGTVDF  450



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   288 bits (736),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 232/377 (62%), Gaps = 29/377 (8%)
 Frame = -3

Query  1086  IHQVAHSACDRSLYRDLCVSTLVKTPDL--RAKSIPEIISATVNVTVSEIKTAAANCSRI  913
              H V  SAC  +LY +LC S+L   P    +A S  ++I A +N++++  + A     ++
Sbjct  41    FHAVVKSACSSTLYPELCFSSLSAFPAAAEKASSQKDVIEAALNLSITAGEHAYFKLKKL  100

Query  912   --RRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKR-----YADLQTLLST  754
               R+   D+   E  AL+ CLEL  +TL +LR   + LE  P+K+      +DL+TLLS 
Sbjct  101   YGRK---DVLEAEHTALHDCLELVDETLDELRKTDEELELYPSKKSISDHASDLKTLLSG  157

Query  753   AMTNQYTCLEGFPY-SNKNVRPFIIKRVEQISRHVSNALSML-----TKIKKEKNKPSAL  592
             AMTNQ TCL+GF +     VR  I      + + +SNAL+M+     T +  E++     
Sbjct  158   AMTNQETCLDGFSHIKGGGVRKIISGGCVYVEKLISNALAMIKNMTDTDMAAERSAAGRK  217

Query  591   FGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKS  412
                +    SF  E     DGFP W+S  DR LL++ +      +  +V VA DGSGDFK+
Sbjct  218   LEENNLPESFAGE-----DGFPAWMSAGDRRLLQSSS------VTPNVVVAADGSGDFKT  266

Query  411   INAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGW  232
             + AA++AAP+ S  RYVI IKAG Y E V+V KKKT IMF+GDG  KT I G++NVKDG 
Sbjct  267   VAAAVAAAPEKSSKRYVIRIKAGVYRENVEVPKKKTNIMFLGDGRMKTIITGSKNVKDGS  326

Query  231   PTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVH  52
              TFRSATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C  + YQDTLYVH
Sbjct  327   TTFRSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYRCDMIAYQDTLYVH  386

Query  51    SRRQFFRECDVYGTVDF  1
             S RQF+REC +YGTVDF
Sbjct  387   SLRQFYRECFIYGTVDF  403



>emb|CDY33228.1| BnaC01g37010D [Brassica napus]
Length=592

 Score =   288 bits (738),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 166/380 (44%), Positives = 230/380 (61%), Gaps = 25/380 (7%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             H V  SAC  +LY +LC+S +  +  ++  S  ++I A++N+T   ++       ++ + 
Sbjct  58    HAVLRSACSSTLYPELCISAVATSGGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKN  117

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLSTAMTNQ  739
                L   E  AL+ CLE   +TL +L   L+ L+  P K+       DL+TL+S+A+TNQ
Sbjct  118   RKGLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQ  177

Query  738   YTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS  565
              TCL+GF +  ++K VR  ++K    +    SNAL+M+  +         L   S+S++ 
Sbjct  178   ETCLDGFSHDDADKKVRKVLLKGQVHVEHMCSNALAMIKNMTDTDIANFELKAKSFSNNR  237

Query  564   FRQEH-----------GEMK-DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGD  421
               +E            GE+  +G+P WLS  DR LL+  +      ++AD TVA +GSG 
Sbjct  238   KLKEEETTVSVDISGAGEVDAEGWPTWLSAGDRRLLQGSS------VRADATVAANGSGK  291

Query  420   FKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVK  241
             FK+I AA++AAPD+S  RYVIHIKAG Y E VDV KKK  IMF+GDG  +T I GNRNV 
Sbjct  292   FKTIAAAVAAAPDNSKRRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRTIITGNRNVV  351

Query  240   DGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTL  61
             DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C  + YQDTL
Sbjct  352   DGSTTFHSATVAAVGESFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDILAYQDTL  411

Query  60    YVHSRRQFFRECDVYGTVDF  1
             YVHS RQ+F +C + GTVDF
Sbjct  412   YVHSNRQYFIKCLIAGTVDF  431



>emb|CDY33229.1| BnaC01g37020D [Brassica napus]
Length=570

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 229/369 (62%), Gaps = 25/369 (7%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             H V  SAC  +LY +LCVS +  +  ++  S  ++I A++N+T + ++       ++ + 
Sbjct  58    HAVLRSACSSTLYPELCVSAVAISGGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKN  117

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLSTAMTNQ  739
                L   E  AL+ CLE   +TL +L   L+ L+  P K+       DL+TL+S+A+TNQ
Sbjct  118   KKGLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQ  177

Query  738   YTCLEGFPY--SNKNVRPFIIKRVEQISRHV-SNALSMLTKIKKEKNKPSALFGPSYSSS  568
              TCL+GF +  ++K VR F++K      +H+ SNAL+M   IK   +   A F      S
Sbjct  178   ETCLDGFSHDDADKKVRNFLLK-----GQHMCSNALAM---IKNMTDTDIANFELKAKLS  229

Query  567   SFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAA  388
             S  Q   E   G+P WLS  DR LL+  +      ++AD TVA +GSG FK+I AA++AA
Sbjct  230   SNNQLDAE---GWPTWLSAGDRRLLQGSS------VRADATVAANGSGKFKTIAAAVAAA  280

Query  387   PDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATV  208
             PD+S  RYVIHIKAG Y E V+V KKK  IMF+GDG  +T I GNRNV DG  TF SATV
Sbjct  281   PDNSKRRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATV  340

Query  207   AVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRE  28
             A VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C  + YQDTLYVHS RQFF +
Sbjct  341   AAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVK  400

Query  27    CDVYGTVDF  1
             C + GTVDF
Sbjct  401   CLIAGTVDF  409



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score =   288 bits (736),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 164/408 (40%), Positives = 241/408 (59%), Gaps = 27/408 (7%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTV-FQSSAMNATTSDDI-------HQVAHSACDRSLYRDLCVSTLV  1018
             ++  V+L+AA + +    +S + N+    DI       H +  SAC+ +L+ +LC ST+ 
Sbjct  31    VVASVLLVAAVIGVVAGVKSRSNNSNDHADIQAITSAAHAIVKSACENTLHPELCYSTIA  90

Query  1017  KTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFS  844
                D   K  S  ++I  ++N+T   ++       ++ +    L   E  AL+ CLE   
Sbjct  91    SVSDFSKKVTSQKDVIELSLNITCKAVQHNFFTVEKLIKTRKGLTPREKVALHDCLETID  150

Query  843   DTLADLRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFI  685
             +TL +L T +D LE  P K+       DL+TL+S+A+TNQ TCL+GF +  ++K VR  +
Sbjct  151   ETLDELHTAIDDLELYPNKKSLKDHADDLKTLISSAITNQETCLDGFSHDDADKKVRKAL  210

Query  684   IKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRD  505
             +K  + + +  SNAL+M+  +             + ++   R+++ E    +P+WLS  D
Sbjct  211   LKGQKHVEKMCSNALAMICNMTDTDIANEMKLKGTTTNRKLREDNSE----WPEWLSAGD  266

Query  504   RALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYV  325
             R +L++ T      +  DV VA DGSG+F++++ A++ AP+ S  RYVI IKAG Y E V
Sbjct  267   RRMLQSST------VSPDVVVAADGSGNFRTVSEAVAKAPEKSSKRYVIRIKAGVYRENV  320

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPE  145
             DV KKKT IMF+GDG   T I G+RNVKDG  TF SATVA VG  F+A  I+F+N+AG  
Sbjct  321   DVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFNSATVAAVGEKFLARDITFQNTAGAA  380

Query  144   KHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KHQAVALR  SD S FY C  + YQD+LYVHS RQ+F +C + GTVDF
Sbjct  381   KHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDF  428



>ref|XP_010465323.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Camelina 
sativa]
Length=592

 Score =   288 bits (736),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 167/391 (43%), Positives = 232/391 (59%), Gaps = 33/391 (8%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             T S   H V  S+C  +LY +LC+S +     ++  S  ++I A++N+T + ++      
Sbjct  50    TLSPSSHAVLRSSCSSTLYPELCISAVATAGGVKLTSQKDVIEASLNLTTTAVEHNYFTV  109

Query  921   SRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLS  757
              ++ +    L   E  AL+ CLE   +TL +L   ++ L   P K+      ADL+TL+S
Sbjct  110   KKLIKKRKGLTPREKTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAADLKTLIS  169

Query  756   TAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGP  583
             +A+TNQ TCL+GF +  ++K VR  +      +    SNAL+M   IK   +   A F  
Sbjct  170   SAITNQETCLDGFSHDGADKQVRKALQMGQIHVEHMCSNALAM---IKNMTDTDIANFEQ  226

Query  582   SYSSSS----FRQEH------------GEM-KDGFPKWLSRRDRALLEAPTGKKKRKIKA  454
                 +S     ++E+            GE+  +G+P WLS  DR LL+         ++A
Sbjct  227   KAKITSNNRKLKEENQETSVAVDIAGAGELDSEGWPTWLSAGDRRLLQGS------GVRA  280

Query  453   DVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIG  274
             D TVA DGSG FK++ +A++AAP++S+ RYVIHIKAG Y E VDV KKK  IMF+GDG  
Sbjct  281   DATVAADGSGKFKTVASAVAAAPENSNKRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRT  340

Query  273   KTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFY  94
             +T I GNRNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY
Sbjct  341   RTIITGNRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFY  400

Query  93    DCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  401   NCDMLAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 167/409 (41%), Positives = 243/409 (59%), Gaps = 26/409 (6%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTV-FQSSAMNATTSDDI-------HQVAHSACDRSLYRDLCVSTLV  1018
             ++  V+L+AA + + +    S  N++    I       H +  S+C  +L++ LC ST+ 
Sbjct  32    LIASVLLIAAVIGVVIGVNYSRKNSSNQAQIQAISLATHTIVKSSCSITLHQQLCYSTIA  91

Query  1017  KT-PDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELF  847
                P+   K  +  ++I  ++N+T   ++       ++ +    L   E  AL+ CLE  
Sbjct  92    NNIPNFSKKVTNQKDVIELSLNITTKAVQRNYYAIDKLIKTRKGLTEREKIALHDCLETI  151

Query  846   SDTLADLRTVLDGLENSPA----KRYAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVRPF  688
              +T+ +L T ++ LE  P     +++AD L+TL+S A+TNQ TCL+GF +  ++K VR  
Sbjct  152   DETIDELHTAVEDLEKYPNAKALRQHADDLKTLISAAITNQETCLDGFSHDEADKKVRKV  211

Query  687   IIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRR  508
             ++K    + +  SNAL+M+  +     +     G S   +  R+ + E    +P+WLS  
Sbjct  212   LLKGQVYVEKLCSNALAMIKNMTDTDIQNEMKLGSSGKVN--RKLNEESSGTWPEWLSTG  269

Query  507   DRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY  328
             DR LL++P+      + ADV VA DGSGD+K++  A++ AP+ S  RYVI IKAG Y E 
Sbjct  270   DRRLLQSPS------VTADVVVAADGSGDYKTVAEAVANAPEKSSKRYVIRIKAGVYKEN  323

Query  327   VDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGP  148
             V+V KKK  IMF+GDG   T I G+RNVKDG  TF SATVA VG GF+A  I+FEN+AG 
Sbjct  324   VEVSKKKKNIMFMGDGRENTIITGSRNVKDGSTTFHSATVAAVGEGFLARDITFENTAGH  383

Query  147   EKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             EKHQAVALR  +D S FY C  +GYQDTLYVHS RQFF +C + GTVDF
Sbjct  384   EKHQAVALRVGADLSAFYKCDMLGYQDTLYVHSNRQFFVQCFISGTVDF  432



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score =   286 bits (732),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 243/405 (60%), Gaps = 27/405 (7%)
 Frame = -3

Query  1173  MLVPVVLLAAFLS----LTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPD  1006
             +   V+L+ A +S    L+V +  + N  +++  H +  S+C  +LY +LC+ST+   PD
Sbjct  21    LFASVLLVTAIVSIATTLSVSKRKSSNNNSNNAAHSIIKSSCSSTLYPELCLSTISAAPD  80

Query  1005  --LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLA  832
                + KS  ++I  ++N+T++ +++   +  ++     +L   E  AL  CLEL  +TL 
Sbjct  81    AETKIKSPKDVIVTSMNLTITAVQSNYLSIKKLISTNKNLPKREKTALNDCLELEDETLD  140

Query  831   DLRTVLDGLENSPA-----KRYAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKR  676
             +L      L + P       ++AD L+TLLS AMTNQ TCL+GF +  ++K VR  +I  
Sbjct  141   ELYKAEQDLSDYPTFNKSISQHADELKTLLSAAMTNQETCLDGFSHDSADKKVRQALIDG  200

Query  675   VEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRAL  496
                +    SNAL+M+  +       + +    Y S    +E  E +  +P+WLS  DR L
Sbjct  201   QMHVFHMCSNALAMIKNLTD-----TDMASQGYPSGRQLEEQDETE--WPEWLSAGDRRL  253

Query  495   LEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVD  316
             L+APT      +  DVTVA DGSGDF++++ A++AAP+ S  RY+I IKAG Y E VDV 
Sbjct  254   LQAPT------VTPDVTVAADGSGDFRTVSEAVAAAPERSTRRYIIKIKAGVYKENVDVP  307

Query  315   KKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQ  136
             + KT +MFVGDG   T I  +RNV DG  TF SATVA VG GF+A  I+F+N+AGP KHQ
Sbjct  308   RGKTNLMFVGDGRVNTIITASRNVVDGSTTFNSATVAAVGDGFLARDITFQNTAGPSKHQ  367

Query  135   AVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR  SD S FY C  + YQDTLYVHS RQF+ +C V GTVDF
Sbjct  368   AVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYVQCLVAGTVDF  412



>ref|XP_010501842.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=592

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 165/385 (43%), Positives = 230/385 (60%), Gaps = 33/385 (9%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             H V  S+C  +LY +LC+S +     ++  S  ++I A++N+T + ++       ++ + 
Sbjct  56    HAVLRSSCSSTLYPELCISAVATAGGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKK  115

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLSTAMTNQ  739
                L   E  AL+ CLE   +TL +L   ++ L   P K+      +DL+TL+S+A+TNQ
Sbjct  116   RKGLTPREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLREHASDLKTLISSAITNQ  175

Query  738   YTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS  565
              TCL+GF +  ++K VR  + K    +    SNAL+M   IK   +   A F      +S
Sbjct  176   ETCLDGFSHDSADKEVRKALQKGQIHVEHMCSNALAM---IKNMTDTDIANFEQKAKITS  232

Query  564   ----FRQEH------------GEM-KDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAK  436
                  ++E             GE+  +G+P WLS  DR LL+         ++AD TVA 
Sbjct  233   NNRKLKEESQETTVAVDIAGAGELDAEGWPTWLSAGDRRLLQGS------GVRADATVAA  286

Query  435   DGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKG  256
             DGSG FK++ +A++AAP++S+ RYVIHIKAG Y E VDV KKK  IMF+GDG  +T I G
Sbjct  287   DGSGTFKTVASAVAAAPENSNKRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRTIITG  346

Query  255   NRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVG  76
             NRNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY+C  + 
Sbjct  347   NRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLA  406

Query  75    YQDTLYVHSRRQFFRECDVYGTVDF  1
             YQDTLYVHS RQFF +C + GTVDF
Sbjct  407   YQDTLYVHSNRQFFVKCLIAGTVDF  431



>gb|AFW03476.1| pectin methylesterase 2 [Gossypium barbadense]
Length=521

 Score =   285 bits (728),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 170/406 (42%), Positives = 241/406 (59%), Gaps = 33/406 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPD--L  1003
             +++  +V +A  +S++  +SS   A      H +  S+C  +LY +LC ST+   PD   
Sbjct  20    LLVTAIVTIATTVSISKKKSSNTVAA-----HSIIKSSCSSTLYPELCYSTISSAPDAET  74

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP----DLGTMESRALYVCLELFSDTL  835
             + K+  ++I  ++N+TV+ +++   N   I++++      L   E  AL  CLEL  +TL
Sbjct  75    KVKNPKDVIELSLNLTVTAVQS---NYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  834   ADLRTVLDGLENSPA------KRYADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIK  679
              +L      L + P+      +   DL++LLS AMTNQ TCL+GF +  ++K VR  ++ 
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  678   RVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRA  499
                 +    SNAL+M+  +       + +    Y  SS RQ   + +  +PKWLS  DR 
Sbjct  192   GQMHVFHMCSNALAMIKNLTD-----TDMASQGYHPSSGRQLEEQDQTEWPKWLSEGDRR  246

Query  498   LLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDV  319
             LL+A T      +  +VTVA DGSGDF +++ A++AAP+ S TRY+I IKAG Y E VDV
Sbjct  247   LLQATT------VIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDV  300

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKH  139
               KKT +MFVGDG   T I  +RNV DG  TF SATVA VG GF+A  I+F+N+AGP KH
Sbjct  301   PSKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKH  360

Query  138   QAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR  SD S FY C  + YQDTLYVHS RQF+ +C V G+VDF
Sbjct  361   QAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDF  406



>emb|CDY51798.1| BnaC06g41940D [Brassica napus]
Length=585

 Score =   286 bits (733),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 173/405 (43%), Positives = 243/405 (60%), Gaps = 21/405 (5%)
 Frame = -3

Query  1170  LVPVVLLAAFLSLTVFQSSAMN----ATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDL  1003
             ++ +VL +A + + V +S+        T S   H V  S C  +LY +LC S +  T   
Sbjct  26    VLALVLFSAVVGIAVTKSNQTKNQKIPTLSPTSHAVLKSVCSSTLYPELCFSAVAATGK-  84

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLR  823
             +  S  ++I A++N+T + +K       ++      L   E  AL+ CLE+  +TL +L 
Sbjct  85    KLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTARELTALHDCLEIIDETLDELH  144

Query  822   TVLDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQI  664
               L+ L   P      K   DL+TL+S+A+TNQ TCL+GF Y  +++ +R  ++K    +
Sbjct  145   VALEDLHQYPKGKSLRKHADDLKTLISSAITNQGTCLDGFSYDKADRKLRKALLKGQVHV  204

Query  663   SRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS--FRQE-HGEMK-DGFPKWLSRRDRAL  496
                 SNAL+M+  +         L   S S+++   ++E  G++  +G+P WLS  DR L
Sbjct  205   EHMCSNALAMIKNMTDTDIANFELKDKSGSTNNRKLKEELTGDLDGEGWPNWLSIGDRRL  264

Query  495   LEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVD  316
             L+  TG     + AD TVA DGSGDF ++ AA++AAP+ S+ RYVIHIKAG Y E V+V 
Sbjct  265   LQGSTG-----VNADATVAADGSGDFTTVAAAVAAAPEKSNKRYVIHIKAGVYRENVEVS  319

Query  315   KKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQ  136
             KKK  IMF+GDG GKT I G RNV DG  TF SATVA VG  F+A  ++F+N+AGP KHQ
Sbjct  320   KKKKNIMFLGDGRGKTIITGKRNVVDGSTTFHSATVAAVGERFLARDMTFQNTAGPSKHQ  379

Query  135   AVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  380   AVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIAGTVDF  424



>gb|AFI23415.1| pectin methylesterase [Coffea arabica]
Length=325

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 165/218 (76%), Gaps = 19/218 (9%)
 Frame = -3

Query  636  MLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMK------DGFPKWLSRRDRALLEAPTGK  475
            ML ++K ++    A+F          +E GE        DGFP WL ++DRALL+AP   
Sbjct  1    MLXRVKTQQAAAGAVF---------PEEEGEFGTPVKSGDGFPTWLKKKDRALLQAPL--  49

Query  474  KKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIM  295
               + K ++TVAKDGSG+F +INAAL AAP+SS TR+VI+IKAG+Y+EY++V++KKTMIM
Sbjct  50   --NQTKVNLTVAKDGSGNFTTINAALQAAPNSSTTRFVIYIKAGAYFEYIEVERKKTMIM  107

Query  294  FVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRAD  115
            F+GDGIGKT IKGNR+V  GW TFRS+TVAVVG GFIA GI+ EN AGP +HQAVALR+ 
Sbjct  108  FLGDGIGKTVIKGNRSVGAGWTTFRSSTVAVVGDGFIARGITIENYAGPSQHQAVALRSG  167

Query  114  SDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            SD S FY C F+GYQDTLYVHS RQF+RECDVYGTVDF
Sbjct  168  SDLSAFYQCSFIGYQDTLYVHSLRQFYRECDVYGTVDF  205



>ref|XP_010939846.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=591

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/393 (42%), Positives = 234/393 (60%), Gaps = 23/393 (6%)
 Frame = -3

Query  1131  TVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDL-RAKSIP-EIISATVNV  958
             T+F   A+ +      H +  S+C  + Y DLC S +  TP L +  S P ++I A++N+
Sbjct  43    TLFARRAVTSHEPTVSHAILRSSCRSTRYPDLCYSAVAATPALIQTISKPKDVIHASINL  102

Query  957   TVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTL-------ADLRTVLDGLEN  799
             T++ I+ +  +  R+    P+L T E  AL+ CLE+F ++L       ADLR    G   
Sbjct  103   TITAIQRSFRHVERLSASYPNLTTRERTALHDCLEMFDESLDELNLTDADLRAYPAG---  159

Query  798   SPAKRYA-DLQTLLSTAMTNQYTCLEGFPYSN--KNVRPFIIKRVEQISRHVSNALSMLT  628
              P +R+A DL+ L+S AMTNQ +C +GF Y +    +R  I   +  ++R   NAL+M+ 
Sbjct  160   KPLRRHALDLEILVSAAMTNQESCSDGFSYEDIEGRLRREIRSELTHVTRMCRNALAMIK  219

Query  627   KIKKEKNKPSALFGPSYSS--SSFRQEHG--EMKDGFPKWLSRRDRALLEAPTGKKKRKI  460
              +       +     +     +  R+  G    ++GFP W+ ++DR  L    G+    +
Sbjct  220   NMIDADIAAAEAEAGADGGALNQGRRMSGFDVDEEGFPDWMEKKDRRRLLQAAGE----V  275

Query  459   KADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDG  280
             + +  VA DGSGD+K++  A++AAP  S TR+VI IKAG+Y E V+V KKKT +MF+GDG
Sbjct  276   QVNAVVAADGSGDYKTVGEAVAAAPAKSTTRWVIRIKAGTYEENVEVPKKKTNLMFIGDG  335

Query  279   IGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSV  100
                T I G+RNV DG  TF SAT+AVVGTGF A G+  EN+AGP KHQAVALR  SD S 
Sbjct  336   RTATIITGSRNVMDGSTTFHSATLAVVGTGFQARGLRIENTAGPSKHQAVALRVSSDLSA  395

Query  99    FYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FYDC  +GYQDTLY+HS R FFR C + GTVDF
Sbjct  396   FYDCDLIGYQDTLYLHSLRHFFRSCLIQGTVDF  428



>ref|XP_006289196.1| hypothetical protein CARUB_v10002644mg [Capsella rubella]
 gb|EOA22094.1| hypothetical protein CARUB_v10002644mg [Capsella rubella]
Length=530

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 162/347 (47%), Positives = 222/347 (64%), Gaps = 37/347 (11%)
 Frame = -3

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMESRALYVCLELFSDTLADL  826
               K  PE++ AT+N+T+S+++ +++N S ++ RV P L   E  A   CL L  DT++DL
Sbjct  47    ETKITPELVIATLNLTISKVRLSSSNFSDLQNRVGPILTHGERCAFEDCLGLLDDTISDL  106

Query  825   RTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSN------------KNVRPFII  682
             +  L  L +S  K + D+  LL+ AMTNQ TCL+GF  S             +N++  I+
Sbjct  107   QATLSNLRSSSLKSH-DVNMLLTNAMTNQDTCLDGFSTSGDGDNIAMTFELPQNLKENIL  165

Query  681   KRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDR  502
                  IS ++SN+L ML ++   KN PS+             E  E+   +P W+S  D+
Sbjct  166   N----ISNNLSNSLDML-QVMWRKN-PSS-------------ESSEVDVEYPSWVSELDQ  206

Query  501   ALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVD  322
              +L+AP     ++   +++VAKDG+G+F +I+ A+ AAP+SS+TR++I+IK G Y E V+
Sbjct  207   RVLQAPV----QETSFNLSVAKDGTGNFTTISDAVYAAPNSSETRFIIYIKGGEYIENVE  262

Query  321   VDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEK  142
             + KKKTMIMFVGDGIG T IK NR+  DGW TF++ATV V G GFIA  ISF N AG  K
Sbjct  263   LRKKKTMIMFVGDGIGITVIKANRSRVDGWSTFQTATVGVKGKGFIAKDISFVNFAGLAK  322

Query  141   HQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              QAVALR+ SD S FY C F GYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  323   GQAVALRSGSDLSAFYRCEFDGYQDTLYVHSARQFYRECDIYGTVDF  369



>gb|AER38243.1| PME2 [Gossypium barbadense]
Length=521

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 170/406 (42%), Positives = 240/406 (59%), Gaps = 33/406 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPD--L  1003
             +++  +V +A  +S++  +SS   A      H +  S+C  +LY +LC ST+   PD   
Sbjct  20    LLVTAIVTIATTVSISKKKSSNTVAA-----HSIIKSSCSSTLYPELCYSTISSAPDAET  74

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP----DLGTMESRALYVCLELFSDTL  835
             + K+   +I  ++N+TV+ +++   N   I++++      L   E  AL  CLEL  +TL
Sbjct  75    KVKNPKGVIELSLNLTVTAVQS---NYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  834   ADLRTVLDGLENSPA------KRYADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIK  679
              +L      L + P+      +   DL++LLS AMTNQ TCL+GF +  ++K VR  ++ 
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  678   RVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRA  499
                 +    SNAL+M+  +       + +    Y  SS RQ   + +  +PKWLS  DR 
Sbjct  192   GQMHVFHMCSNALAMIKNLTD-----TDMASQGYHPSSGRQLEEQDQTEWPKWLSEGDRR  246

Query  498   LLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDV  319
             LL+A T      +  +VTVA DGSGDF +++ A++AAP+ S TRY+I IKAG Y E VDV
Sbjct  247   LLQATT------VIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDV  300

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKH  139
               KKT +MFVGDG   T I  +RNV DG  TF SATVA VG GF+A  I+F+N+AGP KH
Sbjct  301   PSKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKH  360

Query  138   QAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR  SD S FY C  + YQDTLYVHS RQF+ +C V G+VDF
Sbjct  361   QAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDF  406



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 157/370 (42%), Positives = 224/370 (61%), Gaps = 19/370 (5%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  SAC+ +L+ +LC ST+    D   K  S  ++I  ++N+T   ++       ++ 
Sbjct  59    HAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNFFKVEKLI  118

Query  909   RVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTAMT  745
             +    L   E  AL+ CLE   +TL +L T +  LE  P K+       DL+TL+S+A+T
Sbjct  119   KTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKTLISSAIT  178

Query  744   NQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSS  571
             NQ TCL+GF +  ++K VR  ++K  + + +  SNAL+M+  +             + ++
Sbjct  179   NQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTTTN  238

Query  570   SSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                R+++ E    +P+WLS  DR LL++ T      ++ DV VA DGSG+FK+++ A++ 
Sbjct  239   RKLREDNSE----WPEWLSAGDRRLLQSST------VRPDVVVAADGSGNFKTVSEAVAK  288

Query  390   APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
             AP+ S  RYVI IKAG Y E VDV KKKT IMF+GDG   T I G+RNVKDG  TF SAT
Sbjct  289   APEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSAT  348

Query  210   VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
             VA VG  F+A  I+F+N+AG  KHQAVALR  SD S FY C  + YQD+LYVHS RQ+F 
Sbjct  349   VAAVGEKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFV  408

Query  30    ECDVYGTVDF  1
             +C + GTVDF
Sbjct  409   QCLIAGTVDF  418



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 157/370 (42%), Positives = 224/370 (61%), Gaps = 19/370 (5%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  SAC+ +L+ +LC ST+    D   K  S  ++I  ++N+T   ++       ++ 
Sbjct  69    HAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNFFKVEKLI  128

Query  909   RVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTAMT  745
             +    L   E  AL+ CLE   +TL +L T +  LE  P K+       DL+TL+S+A+T
Sbjct  129   KTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKTLISSAIT  188

Query  744   NQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSS  571
             NQ TCL+GF +  ++K VR  ++K  + + +  SNAL+M+  +             + ++
Sbjct  189   NQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTTTN  248

Query  570   SSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                R+++ E    +P+WLS  DR LL++ T      ++ DV VA DGSG+FK+++ A++ 
Sbjct  249   RKLREDNSE----WPEWLSAGDRRLLQSST------VRPDVVVAADGSGNFKTVSEAVAK  298

Query  390   APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
             AP+ S  RYVI IKAG Y E VDV KKKT IMF+GDG   T I G+RNVKDG  TF SAT
Sbjct  299   APEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSAT  358

Query  210   VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
             VA VG  F+A  I+F+N+AG  KHQAVALR  SD S FY C  + YQD+LYVHS RQ+F 
Sbjct  359   VAAVGEKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFV  418

Query  30    ECDVYGTVDF  1
             +C + GTVDF
Sbjct  419   QCLIAGTVDF  428



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 171/408 (42%), Positives = 237/408 (58%), Gaps = 30/408 (7%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSD-DI-------HQVAHSACDRSLYRDLCVSTLV  1018
             ++  V+L+AA + +     S  N +  D DI       H +  SAC  +L+ +LC S +V
Sbjct  21    IVASVLLVAAVIGVVAGVKSRSNNSDDDADIMAISSSAHAIVKSACSNTLHPELCYSAIV  80

Query  1017  KTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFS  844
                D   K  S  ++I  ++N+TV  ++        + +    L   E  AL+ CLE   
Sbjct  81    NVTDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGLTPREKVALHDCLETMD  140

Query  843   DTLADLRTVLDGLENSPAKR-----YADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFI  685
             +TL +L T +  LE  P K+       DL+TL+S+A+TNQ TCL+GF +  ++K VR  +
Sbjct  141   ETLDELHTAVADLELYPNKKSLKEHAEDLKTLISSAITNQETCLDGFSHDEADKKVRKVL  200

Query  684   IKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRD  505
             +K  + + +  SNAL+M+  +    N   A       S    +++GE    +P+WLS  D
Sbjct  201   LKGQKHVEKMCSNALAMICNMT---NTDIANEMKLSGSRKLVEDNGE----WPEWLSAGD  253

Query  504   RALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYV  325
             R LL++ T      +  DV VA DGSGD+K+++ A++ AP+ S  RYVI IKAG Y E V
Sbjct  254   RRLLQSST------VTPDVVVAADGSGDYKTVSEAVAKAPEKSSKRYVIRIKAGVYRENV  307

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPE  145
             DV KKKT IMF+GDG   T I  +RNV+DG  TF SATVA VG  F+A  I+F+N+AG  
Sbjct  308   DVPKKKTNIMFMGDGRSNTIITASRNVQDGSTTFHSATVAAVGEKFLARDITFQNTAGAS  367

Query  144   KHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KHQAVALR  SD S FY C  + YQDTLYVHS RQFF +C V GTVDF
Sbjct  368   KHQAVALRVGSDLSAFYKCDILAYQDTLYVHSNRQFFVQCLVAGTVDF  415



>gb|KHF97383.1| Pectinesterase/pectinesterase inhibitor U1 [Gossypium arboreum]
Length=567

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 170/406 (42%), Positives = 241/406 (59%), Gaps = 33/406 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPD--L  1003
             +++  +V +A  +S++  +SS   A      H +  S+C  +LY +LC ST+   PD   
Sbjct  20    LLVTAIVTIATTVSISKKKSSNTVAA-----HSIIKSSCSSTLYPELCYSTISSAPDAET  74

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP----DLGTMESRALYVCLELFSDTL  835
             + K+  ++I  ++N+TV+ +++   N   I++++      L   E  AL  CLEL  +TL
Sbjct  75    KVKNPKDVIELSLNLTVTAVQS---NYLSIKKLISTRRKSLTEREKAALNDCLELVDETL  131

Query  834   ADLRTVLDGLENSPA------KRYADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIK  679
              +L      L + P+      +   DL++LLS AMTNQ TCL+GF +  ++K VR  ++ 
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  678   RVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRA  499
                 +    SNAL+M+  +       + +    Y  SS RQ   + +  +PKWLS  DR 
Sbjct  192   GQMHVFHMCSNALAMIKNLTD-----TDMASQGYHPSSGRQLEEQDQTEWPKWLSEGDRR  246

Query  498   LLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDV  319
             LL+A T      +  +VTVA DGSGDF +++ A++AAP+ S TRY+I IKAG Y E VDV
Sbjct  247   LLQATT------VIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDV  300

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKH  139
               KKT +MFVGDG   T I  +RNV DG  TF SATVA VG GF+A  I+F+N+AGP KH
Sbjct  301   PSKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKH  360

Query  138   QAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR  SD S FY C  + YQDTLYVHS RQF+ +C V G+VDF
Sbjct  361   QAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDF  406



>ref|XP_006392745.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
 gb|ESQ30031.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
Length=584

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 177/425 (42%), Positives = 249/425 (59%), Gaps = 33/425 (8%)
 Frame = -3

Query  1206  SEMQNLGRNPIMLVPVVLLAAFLSLTVF---------QSSAMNATTSDDIHQVAHSACDR  1054
             S+  +   N  ++    +LA  L  TV           +S    T S   H V  S C  
Sbjct  9     SKFSDFKNNKKLVFSSAVLALLLFATVVGIATTKANHNNSQKTKTLSLTSHAVLKSVCTS  68

Query  1053  SLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD----LGT  886
             + Y +LC S +  T   +  S  ++I A++N+T + +K    N   +++++      L  
Sbjct  69    TRYPELCFSAVASTGK-KLTSHKDVIEASLNLTTNVVK---HNYFAVKKLITKRKGGLRA  124

Query  885   MESRALYVCLELFSDTLADLRTVLDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEG  721
              E+ AL+ CLE   +TL +L   ++ L   P      K   DL+TL+S+A+TNQ TCL+G
Sbjct  125   REATALHDCLETIDETLDELHVAVEDLHQYPKGKSLRKHADDLKTLISSAITNQETCLDG  184

Query  720   FPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS--FRQE  553
             F Y  +++ VR  ++K    +    SNAL+M+  +         L   S SS++   ++ 
Sbjct  185   FSYDDADRKVRKALMKGQVHVEHMCSNALAMIKNMTDTDIANFELKDRSTSSNNRKLKEV  244

Query  552   HGEMK-DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSS  376
              G++  +G+P WLS  DR LL+  T      +KADVTVA DGSGDF++I AA++AAP+ S
Sbjct  245   TGDLDGEGWPNWLSVGDRRLLQGST------VKADVTVAADGSGDFRTIAAAVAAAPEKS  298

Query  375   DTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVG  196
             + R+VIHIKAG Y E V+V KKK  +MF+GDG GKT I G+RNV DG  TF SATVA VG
Sbjct  299   NKRFVIHIKAGVYRENVEVTKKKKNVMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAVG  358

Query  195   TGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVY  16
               F+A  I+F+N+AGP KHQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + 
Sbjct  359   ERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHII  418

Query  15    GTVDF  1
             GTVDF
Sbjct  419   GTVDF  423



>ref|XP_009116991.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   285 bits (729),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 230/378 (61%), Gaps = 25/378 (7%)
 Frame = -3

Query  1077  VAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP  898
             V  SAC  +LY +LC+S +  +  ++  S  ++I A++N+T   ++       ++ + + 
Sbjct  60    VLRSACSSTLYTELCISAVATSGGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNMK  119

Query  897   DLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLSTAMTNQYT  733
              L   E  AL+ CLE   +TL +L   L+ L+  P K+       DL+TL+S+A+TNQ T
Sbjct  120   GLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQET  179

Query  732   CLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFR  559
             CL+GF +  ++K VR  ++K    +    SNAL+M+  +         L   S+S++   
Sbjct  180   CLDGFSHDDADKKVRKVLLKGQVHVEHMCSNALAMIKNMTDPDIANFELKAKSFSNNRKL  239

Query  558   QEH-----------GEMK-DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFK  415
             +E            GE+  +G+P WLS  DR LL+  +      ++AD TVA +GSG FK
Sbjct  240   KEEETTVSVDIAGAGEVDAEGWPTWLSAGDRRLLQGSS------VRADATVAANGSGKFK  293

Query  414   SINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDG  235
             +I AA++AAPD+S  RYVIHIKAG Y E V+V KKK  IMF+GDG  +T I GNRNV DG
Sbjct  294   TIAAAVAAAPDNSKRRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNRNVVDG  353

Query  234   WPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYV  55
               TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C  + YQDTLYV
Sbjct  354   STTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYV  413

Query  54    HSRRQFFRECDVYGTVDF  1
             HS RQ+F +C + GTVDF
Sbjct  414   HSNRQYFVKCLIAGTVDF  431



>gb|AFB77928.1| pectin methylesterase [Gossypium hirsutum]
Length=567

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 170/406 (42%), Positives = 241/406 (59%), Gaps = 33/406 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPD--L  1003
             +++  +V +A  +S++  +SS   A      H +  S+C  +LY +LC ST+   PD   
Sbjct  20    LLVTAIVTIATTVSISKKKSSNTVAA-----HSIIKSSCSSTLYPELCYSTISSAPDAET  74

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP----DLGTMESRALYVCLELFSDTL  835
             + K+  ++I  ++N+TV+ +++   N   I++++      L   E  AL  CLEL  +TL
Sbjct  75    KVKNPKDVIELSLNLTVTAVQS---NYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  834   ADLRTVLDGLENSPA------KRYADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIK  679
              +L      L + P+      +   DL++LLS AMTNQ TCL+GF +  ++K VR  ++ 
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  678   RVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRA  499
                 +    SNAL+M+  +       + +    Y  SS RQ   + +  +PKWLS  DR 
Sbjct  192   GQMHVFHMCSNALAMIKNLTD-----TDMASQGYHPSSGRQLEEQDQTEWPKWLSEGDRR  246

Query  498   LLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDV  319
             LL+A T      +  +VTVA DGSGDF +++ A++AAP+ S TRY+I IKAG Y E VDV
Sbjct  247   LLQATT------VIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDV  300

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKH  139
               KKT +MFVGDG   T I  +RNV DG  TF SATVA VG GF+A  I+F+N+AGP KH
Sbjct  301   PSKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKH  360

Query  138   QAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR  SD S FY C  + YQDTLYVHS RQF+ +C V G+VDF
Sbjct  361   QAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDF  406



>ref|XP_009123661.1| PREDICTED: pectinesterase 2 [Brassica rapa]
Length=604

 Score =   285 bits (729),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 177/427 (41%), Positives = 245/427 (57%), Gaps = 46/427 (11%)
 Frame = -3

Query  1170  LVPVVLLAAFLSLTVFQSSAMNATTSDDI-------HQVAHSACDRSLYRDLCVSTLVKT  1012
             ++ +VL +A + + V +S   N T +  I       H V  S C  +LY +LC S +  T
Sbjct  26    VLALVLFSAVVGIAVTKS---NQTKNQKIPTLTPTSHAVLKSVCSSTLYPELCFSAVAAT  82

Query  1011  -----PDLRAKSIP-------------EIISATVNVTVSEIKTAAANCSRIRRVVPDLGT  886
                  PD      P             ++I A++N+T + +K       ++      L  
Sbjct  83    GKKLTPDKDVIEAPAVAATGKKLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTA  142

Query  885   MESRALYVCLELFSDTLADLRTVLDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEG  721
              E  AL+ CLE+  +TL +L   L+ L+  P      K   DL+TL+S+A+TNQ TCL+G
Sbjct  143   REVTALHDCLEIIDETLDELHVALEDLDQYPKGKSLRKHADDLKTLISSAITNQGTCLDG  202

Query  720   FPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHG  547
             F Y  +++ +R  ++K    +    SNAL+M+  +  E +  +       SS++ R+   
Sbjct  203   FSYDKADRKLRKALLKGQVHVEHMCSNALAMIKNMT-ETDIANFELKDKSSSTNNRKLKE  261

Query  546   EMK-----DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPD  382
             E+      +G+P WLS  DR LL+  TG     + AD TVA DGSGDF ++ AA++AAP+
Sbjct  262   ELTGDLDGEGWPNWLSIGDRRLLQGSTG-----VNADATVAADGSGDFTTVAAAVAAAPE  316

Query  381   SSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAV  202
              S+ RYVIHIKAG Y E V+V KKK  IMF+GDG GKT I G RNV DG  TF SATVA 
Sbjct  317   KSNKRYVIHIKAGVYRENVEVSKKKKNIMFLGDGRGKTIITGKRNVVDGSTTFHSATVAA  376

Query  201   VGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECD  22
             VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C 
Sbjct  377   VGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCH  436

Query  21    VYGTVDF  1
             + GTVDF
Sbjct  437   IAGTVDF  443



>gb|KDP33985.1| hypothetical protein JCGZ_07556 [Jatropha curcas]
Length=583

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 170/406 (42%), Positives = 240/406 (59%), Gaps = 24/406 (6%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIH-QVAH----SACDRSLYRDLCVSTLVKTP  1009
             +   ++L+ A +S+    +S  + T S + H Q AH    S+C  +LY +LC ST+   P
Sbjct  26    LFASILLITAIVSIVAGVASRKSTTISANAHHQAAHVVLKSSCSTTLYPELCFSTISTLP  85

Query  1008  D---LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDT  838
             D    + KS  ++I  ++NVT   +K   +   ++     +    E  A + CL + ++T
Sbjct  86    DDAVTKIKSTRDVIDLSLNVTKDSVKQTYSKIEKLAYSGTNYTQRERIAFHDCLLVLNET  145

Query  837   LADLRTVLDGLENSPAK----RYAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIK  679
             L ++  V D L+   +K    ++AD L+ LLS AMTNQ TCL+GF Y  ++K +R   + 
Sbjct  146   LDEINKVEDELKEYSSKETISQHADVLKILLSAAMTNQETCLDGFSYDTADKEIRQLFLD  205

Query  678   RVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRA  499
                 + R  SN+L+M   IK   +   +     +SSSS R+   E +  +PKW+S  DR 
Sbjct  206   DERHVYRLCSNSLAM---IKNLTDTDMSNNNEQHSSSSERKLEEENELEWPKWMSAGDRR  262

Query  498   LLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDV  319
             LL+A +      +  +V VA DGSG+F+++  A+ AAP+   TRY+I IKAG Y E V+V
Sbjct  263   LLQAGS------VTPNVVVAADGSGNFRTVKEAVDAAPEGLTTRYIIKIKAGVYRENVEV  316

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKH  139
              KKKT IMF+GDG   T I G+RNV DG  TF SATVA VG GF+A  I+F+N+AGP KH
Sbjct  317   PKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFNSATVAAVGDGFLARDITFQNTAGPSKH  376

Query  138   QAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR  SD S FY C  + YQDTLYVHS RQF+  C V G+VDF
Sbjct  377   QAVALRVGSDQSAFYRCDMIAYQDTLYVHSLRQFYVSCIVIGSVDF  422



>gb|AFW03481.1| pectin methylesterase 2, partial [Gossypium hirsutum]
Length=521

 Score =   282 bits (722),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 170/406 (42%), Positives = 242/406 (60%), Gaps = 33/406 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPD--L  1003
             +++  +V +A  +S++  +SS   A      H +  S+C  +LY +LC ST+   PD   
Sbjct  20    LLVTAIVTIATTVSISKKKSSNTVAA-----HSIIKSSCSSTLYPELCYSTISSAPDAET  74

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP----DLGTMESRALYVCLELFSDTL  835
             + K+  ++   ++N+TV+ +++   N   I++++      L   E  AL  CLEL  +TL
Sbjct  75    KVKNPKDVTELSLNLTVTAVQS---NYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  834   ADLRTVLDGLENSPA-----KRYAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIK  679
              +L      L + P+      ++AD L++LLS AMTNQ TCL+GF +  ++K VR  ++ 
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADVLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  678   RVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRA  499
                 +    SNAL+M+  +       + +    Y  SS RQ   + +  +PKWLS  DR 
Sbjct  192   GQMHVFHMCSNALAMIKNLTD-----TDMASQGYHPSSGRQLEEQDQTEWPKWLSEGDRR  246

Query  498   LLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDV  319
             LL+A T      +  +VTVA DGSGDF +++ A++AAP+ S TRY+I IKAG Y E VDV
Sbjct  247   LLQATT------VIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDV  300

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKH  139
               KKT +MFVGDG   T I  +RNV DG  TF SATVA VG GF+A  I+F+N+AGP KH
Sbjct  301   PSKKTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKH  360

Query  138   QAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR  SD S FY C  + YQDTLYVHS RQF+ +C V G+VDF
Sbjct  361   QAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDF  406



>gb|AAK69696.1|AF355057_1 putative pectin methylesterase LuPME5 [Linum usitatissimum]
Length=553

 Score =   283 bits (724),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 245/394 (62%), Gaps = 27/394 (7%)
 Frame = -3

Query  1143  FLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA--KSIPEIISA  970
             FL LT   +  + ATT+   H V  S+C  +LY +LC S    +  + +  K+  +++  
Sbjct  13    FLLLTFSAAILITATTATVHHPVIKSSCSTTLYPELCHSAASASAAVLSDIKTTTDVVDL  72

Query  969   TVNVTVSEIKTAAANCSRIRRVVPD----LGTMESRALYVCLELFSDTLAD-LRTV--LD  811
             ++N T++ ++   AN   I++++      L   E  AL  C+EL  +T+ + ++T+  L 
Sbjct  73    SLNATIAAVQ---ANNQAIKKIISSRSLSLTKREKAALADCIELCGETMDEPVKTIEELH  129

Query  810   GLENSPAKRYADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALS  637
             G + S A+R  DL+TLLS AMTNQ TCL+GF +   +K VR  +      + R  SN+L+
Sbjct  130   GKKKSAAERGEDLKTLLSAAMTNQETCLDGFSHDKGDKKVRELLAAGQTNVGRMCSNSLA  189

Query  636   MLTKIKKEKNKPSALF--GPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRK  463
             M+  I +E+     +F  G + S  S  ++ GE +DG+P+W+S  DR LL+A T      
Sbjct  190   MVENITEEE-----VFREGKTASFLSEGRKMGEEEDGWPRWISAGDRRLLQAGT------  238

Query  462   IKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGD  283
             +  +V VA DGSG+F++++ A++AAP+ S +RYVI IKAG Y E + V KKKT +MFVGD
Sbjct  239   VTPNVVVAADGSGNFRTVSQAVAAAPEGSTSRYVIRIKAGVYRETLVVPKKKTNLMFVGD  298

Query  282   GIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYS  103
             G   T I G+ NV DG  TF SATVAVVG  F+A  ++F+N+AGP KHQAVALR ++D++
Sbjct  299   GRTSTIITGSMNVVDGSTTFNSATVAVVGDRFMARDLTFQNTAGPSKHQAVALRVNADFT  358

Query  102   VFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              FY C  + YQDTLYVHS RQF+  C + GTVDF
Sbjct  359   AFYRCDMLAYQDTLYVHSLRQFYVSCFIAGTVDF  392



>ref|XP_009117000.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   283 bits (725),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 168/383 (44%), Positives = 229/383 (60%), Gaps = 31/383 (8%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             H V  SAC  +LY +LC+S +  +  ++  S  ++I A++N+T + ++       ++ + 
Sbjct  58    HAVLRSACSSTLYPELCISAVATSGGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKN  117

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLSTAMTNQ  739
             +  L   E  AL+ CLE   +TL +L   L+ L+  P K+       DL+TL+S+A+TNQ
Sbjct  118   MKGLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQ  177

Query  738   YTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS  565
              TCL+GF +  ++K VR F++K    +    SNAL+M   IK   +   A F      SS
Sbjct  178   ETCLDGFSHDDADKKVRKFLLKGQVHVEHMCSNALAM---IKNMTDTDIANFELKAKLSS  234

Query  564   FRQEHGEMK---------------DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDG  430
               ++  E K                G+P WLS  DR LL+  +      ++AD TVA +G
Sbjct  235   NNRKLKEEKTPEAVDIAGSEELDAKGWPTWLSAGDRRLLQGSS------VRADATVAANG  288

Query  429   SGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNR  250
             SG FK+I AA++AAPD+S  RYVIHIKAG Y E V+V KKK  IMF+GDG  +T I GNR
Sbjct  289   SGKFKTIAAAVAAAPDNSKRRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNR  348

Query  249   NVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQ  70
             NV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C  + YQ
Sbjct  349   NVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQ  408

Query  69    DTLYVHSRRQFFRECDVYGTVDF  1
             DTLYVHS+RQFF +    GTVDF
Sbjct  409   DTLYVHSKRQFFVKGLTAGTVDF  431



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/370 (42%), Positives = 225/370 (61%), Gaps = 19/370 (5%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  SAC+ +L+ +LC ST+    D   K  S  ++I  ++N+T   ++       ++ 
Sbjct  59    HAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNFFKVEKLI  118

Query  909   RVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKR----YAD-LQTLLSTAMT  745
             +    L   E  AL+ CLE   +TL +L T +  LE  P K+    +AD L+TL+S+A+T
Sbjct  119   KTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADGLKTLISSAIT  178

Query  744   NQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSS  571
             NQ TCL+GF +  ++K VR  ++K  + + +  SNAL+M+  +             + ++
Sbjct  179   NQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTTTN  238

Query  570   SSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                R+++ E    +P+WL   DR LL++ T      ++ DV VA DGSG+FK+++ A++ 
Sbjct  239   RKLREDNSE----WPEWLPAGDRRLLQSST------VRPDVVVAADGSGNFKTVSEAVAK  288

Query  390   APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
             AP+ S  RYVI IKAG Y E VDV KKKT IMF+GDG   T I G+RNVKDG  TF SAT
Sbjct  289   APEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSAT  348

Query  210   VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
             VA VG  F+A  I+F+N+AG  KHQAVALR  SD S FY C  + YQD+LYVHS RQ+F 
Sbjct  349   VAAVGEKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFV  408

Query  30    ECDVYGTVDF  1
             +C + GTVDF
Sbjct  409   QCLIAGTVDF  418



>ref|XP_006407094.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
 gb|ESQ48547.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
Length=592

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 167/386 (43%), Positives = 231/386 (60%), Gaps = 25/386 (6%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             T S   H V  S+C  +LY +LCVS +  + D++  S  ++I A++N+T   ++      
Sbjct  52    TLSASSHAVLRSSCSSTLYPELCVSAVATSGDVKLTSQKDVIEASLNLTTIAVEHNYFTV  111

Query  921   SRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLS  757
              ++ +    L   E  AL+ CLE   +TL +L   ++ L   P K+       DL+TL+S
Sbjct  112   KKLIKNRKGLTPREKTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAGDLKTLIS  171

Query  756   TAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGP  583
             +A+TNQ TCL+GF +  ++K VR  ++K    +    SNAL+M+  +         L   
Sbjct  172   SAITNQETCLDGFSHDAADKKVRKALMKGQIHVEHMCSNALAMIKNMTDTDIANFELKAK  231

Query  582   SYSSSSFRQEH-----------GEM-KDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVA  439
               S++   +E            GE+  +G+P WLS  DR LL+  T      +KAD TVA
Sbjct  232   LTSNNRKLKEEETTASINIAGAGELDSEGWPTWLSAGDRRLLQGST------VKADATVA  285

Query  438   KDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIK  259
              DGSG FK++ AA++AAP++S+ RYVIHIKAG Y E V+V KKK  IMF+GDG  +T I 
Sbjct  286   ADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTIIT  345

Query  258   GNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFV  79
              NRNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY+C  +
Sbjct  346   ANRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDML  405

Query  78    GYQDTLYVHSRRQFFRECDVYGTVDF  1
              YQDTLYVHS RQFF +C + GTVDF
Sbjct  406   AYQDTLYVHSNRQFFVKCLIAGTVDF  431



>ref|XP_008800482.1| PREDICTED: pectinesterase-like isoform X1 [Phoenix dactylifera]
Length=585

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 161/383 (42%), Positives = 232/383 (61%), Gaps = 18/383 (5%)
 Frame = -3

Query  1113  AMNATTSDDI---HQVAHSACDRSLYRDLCVSTLVKTPDL-RAKSIP-EIISATVNVTVS  949
             A +A TS +    H +  S+C  + Y DLC S +   P L +  S P ++I A++N+T++
Sbjct  46    ARHAVTSHEATVSHAILRSSCLSARYPDLCYSAVAANPALVQTISKPKDVIHASINLTIT  105

Query  948   EIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPA----KRY  781
              I+ +  +  R+     +L T E  AL+ CLE+F ++L +LR     L   PA    +R+
Sbjct  106   AIQRSFRHVERLSASHANLTTRERTALHDCLEMFDESLDELRLTDADLRAYPAGKPLRRH  165

Query  780   A-DLQTLLSTAMTNQYTCLEGFPYSN--KNVRPFIIKRVEQISRHVSNALSMLTKIKKEK  610
             A DL+ L+S +MTNQ +C +GF Y +  + +R  I+  +  ++    NAL+M+  +    
Sbjct  166   ALDLEILVSASMTNQESCSDGFSYEDVERRLRREILSGLTHVTHMCRNALAMIKNMIDAD  225

Query  609   NKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDG  430
                + +            +  E  +GFP W+ ++DR  L   TG+    +KA+  VA DG
Sbjct  226   IAAADVAADGRGRRMLGFDIDE--EGFPDWMEKKDRRRLLQATGE----VKANAVVAPDG  279

Query  429   SGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNR  250
             SGD+K++  A++AAP  S TR+VI I AG+Y E V+V KKKT +MF+G+G   T I G+R
Sbjct  280   SGDYKTVGEAVAAAPAKSKTRWVIQITAGTYEENVEVPKKKTNLMFIGEGRKTTIITGSR  339

Query  249   NVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQ  70
             NV DG  TFRSAT+AVVG GF+A G+  +N+AGP KHQAVALR  SD S FYDC  +GYQ
Sbjct  340   NVVDGSTTFRSATLAVVGEGFLARGLRIQNTAGPSKHQAVALRVGSDLSAFYDCDIIGYQ  399

Query  69    DTLYVHSRRQFFRECDVYGTVDF  1
             DTLY+HS R FFR C + GTVDF
Sbjct  400   DTLYLHSLRHFFRSCLIQGTVDF  422



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score =   282 bits (722),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 161/376 (43%), Positives = 228/376 (61%), Gaps = 28/376 (7%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSI---PEIISATVNVTVSEIKTAAANCSRI  913
             H +  S+C  +L+++LC ST+       +K +    ++I  ++N+T   ++       ++
Sbjct  69    HTIVKSSCSITLHQELCYSTIANNIPNSSKKVTNQKDVIELSLNITTKAVQRNYYAIDKL  128

Query  912   RRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPA----KRYAD-LQTLLSTAM  748
              +    L   E  AL+ CLE   +T+ +L T ++ LE  P     +++AD L+TL+S A+
Sbjct  129   VKTRKGLTEREKIALHDCLETIDETIDELHTAVEDLEKYPNAKSLRQHADDLKTLISAAI  188

Query  747   TNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSML-----TKIKKEKNKPSALF  589
             TNQ TCL+GF +  ++K VR  ++K    + +  SNAL+M+     T I+ E    +   
Sbjct  189   TNQETCLDGFSHDEADKKVRKILLKGQVYVEKLCSNALAMIKNMTDTDIQNEMKLVA---  245

Query  588   GPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSI  409
                 S    R+ + E    +P+WLS  DR LL++P+      + ADV VA DGSGD+K++
Sbjct  246   ----SGKVKRKLNEESSGTWPEWLSTGDRRLLQSPS------VTADVVVAADGSGDYKTV  295

Query  408   NAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWP  229
               A++ AP+ S  RYVI IKAG Y E V+V KKK  IMF+GDG   T I G+RNVKDG  
Sbjct  296   AEAVANAPEKSSKRYVIRIKAGVYKESVEVSKKKKNIMFMGDGRENTIITGSRNVKDGST  355

Query  228   TFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHS  49
             TF SATVA VG GF+A  I+FEN+AG EKHQAVALR  +D S FY C  +GYQDTLYVHS
Sbjct  356   TFHSATVAAVGEGFLARDITFENTAGHEKHQAVALRVGADLSAFYKCDMLGYQDTLYVHS  415

Query  48    RRQFFRECDVYGTVDF  1
              RQFF +C + GTVDF
Sbjct  416   NRQFFVQCFISGTVDF  431



>gb|KDP33984.1| hypothetical protein JCGZ_07555 [Jatropha curcas]
Length=583

 Score =   281 bits (719),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 163/426 (38%), Positives = 243/426 (57%), Gaps = 26/426 (6%)
 Frame = -3

Query  1224  YHSTIDSEMQNLGRNPIMLV---PVVLLAAFLSLTVFQSSAMNATTSDDIHQVAH----S  1066
             + S + ++ +N+ +  ++L+    ++L+ A +S+    +S  N+T  ++ HQ AH    S
Sbjct  5     FPSGVTAKFKNMNKKKLLLILFASILLITAIVSMIACVASRKNSTAKNEYHQAAHAIIKS  64

Query  1065  ACDRSLYRDLCVSTLVKTPDL---RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD  895
             +C  +LY DLC ST+   P+    + ++  ++I  ++NVT   +  A    +RI   +  
Sbjct  65    SCSATLYPDLCFSTISTLPNAAISKVRNTRDVIGLSLNVTKESVTKAYLKINRISSGLKK  124

Query  894   LGTMESRALYVCLELFSDTLADLRTVLDGLENSP------AKRYADLQTLLSTAMTNQYT  733
             L   E  A   C EL + T+  +  V   L + P      A+   + + LLS A+TNQ T
Sbjct  125   LTPREKIAFGDCFELLNQTIVQINKVARKLHSYPSLKKSIAEHAEEFKILLSAALTNQET  184

Query  732   CLEGFP--YSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFR  559
             C++GF     +K VR   +     + R  SNAL+++  +       S      +SSSS R
Sbjct  185   CIDGFSSYEVDKKVRQLFLADERYVYRLCSNALALIKHMTDTDMVNSK--EEQHSSSSDR  242

Query  558   QEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDS  379
             +   +    +PKW+S +DR LL+A      R +   V VA DGSG++K++  A++AAP  
Sbjct  243   KLEEDNGIEWPKWMSTKDRRLLQA------RSLTPHVIVAADGSGNYKTVTEAVNAAPSR  296

Query  378   SDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVV  199
             S +RY+I IKAG Y E ++V   KT IMF GDG  KT I  N+NV DG  TF SATVA V
Sbjct  297   STSRYIIKIKAGVYRETLEVPNSKTNIMFFGDGSSKTIITYNKNVVDGSTTFNSATVAAV  356

Query  198   GTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDV  19
             G GF+A  ++F+NSAGP KHQAVALR  SD S FY C F+ +QDTLYVH+ RQF+ +C +
Sbjct  357   GDGFLARDLTFQNSAGPSKHQAVALRVGSDKSAFYRCSFIAFQDTLYVHTLRQFYVKCVI  416

Query  18    YGTVDF  1
              GT+DF
Sbjct  417   IGTIDF  422



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 164/403 (41%), Positives = 238/403 (59%), Gaps = 25/403 (6%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             ++L  ++L+ A +++ V   ++  ++ ++  H +  S+C  +LY +LC S +   P   +
Sbjct  35    VILASLLLVTAIIAI-VAGVNSHKSSKNEGTHAILKSSCSSTLYPELCYSAVATVPGATS  93

Query  996   K--SIPEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMESRALYVCLELFSDTLAD  829
                S  ++I  ++N+T    K    N   + +++    L   E  AL+ CLE+  +TL +
Sbjct  94    NLASQKDVIELSINLTT---KAVQHNFFTVEKLIATKKLTKREKTALHDCLEIIDETLDE  150

Query  828   LRTVLDGLENSPA----KRYAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVE  670
             L   L  L + P     K++AD L+TLLS+A+TNQ TCL+GF +  ++K VR  ++K   
Sbjct  151   LHEALVDLNDYPNNKSLKKHADDLKTLLSSAITNQETCLDGFSHDEADKKVRKALLKGQI  210

Query  669   QISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLE  490
              + +  SN L+M+    K             ++    QE    +  +P+W+S  DR LL+
Sbjct  211   HVEKMCSNVLAMI----KNMTDTDVANELKTTNRKLMQEKEGNESEWPEWMSVADRRLLQ  266

Query  489   APTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKK  310
             + +      +  DV VA DGSG++K+++AA++AAP  S  RY+I IKAG Y E VDV K 
Sbjct  267   SSS------VTPDVVVAADGSGNYKTVSAAVAAAPKKSSKRYIIRIKAGVYRENVDVPKD  320

Query  309   KTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
             KT IMF+GDG   T I  +RNV DG  TF SATVA VG GF+A GI+F+N+AGP KHQAV
Sbjct  321   KTNIMFMGDGRKTTIITASRNVVDGSTTFNSATVAAVGQGFLARGITFQNTAGPSKHQAV  380

Query  129   ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR  SD S FYDC  + YQDTLYVHS RQFF  C V GTVDF
Sbjct  381   ALRVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCLVAGTVDF  423



>ref|XP_002885033.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61292.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   280 bits (717),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 168/390 (43%), Positives = 235/390 (60%), Gaps = 32/390 (8%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             T S   H V  S+C  + Y +LC+S +  T  +   S  ++I A++N+T+  ++    N 
Sbjct  49    TLSPSSHAVLRSSCSSTRYPELCISAVANTGGVEITSQKDVIEASLNLTIIAVEHNYFNV  108

Query  921   SRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLS  757
              ++ +    L   E  AL+ CLE   +TL +L   ++ L   PA++       DL+TL+S
Sbjct  109   KKLIKKRKGLTPREKTALHDCLETIDETLDELHETVEDLHLYPARKTLREHAGDLKTLIS  168

Query  756   TAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGP  583
             +A+TNQ TCL+GF +  ++K VR  ++K    +    SNAL+M   IK   +   A F  
Sbjct  169   SAITNQETCLDGFSHDDADKQVRKALLKGQIHVEHMCSNALAM---IKNMTDTDIANFEQ  225

Query  582   SYSSSS----FRQEH-----------GEMK-DGFPKWLSRRDRALLEAPTGKKKRKIKAD  451
                 +S     ++E+           GE+  +G+P WLS  DR LL+  +      +KAD
Sbjct  226   KAKITSNNRKLKEENQETTVADIAGAGELDAEGWPTWLSAGDRRLLQGSS------VKAD  279

Query  450   VTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGK  271
              TVA DGSG FK++ AA++AAP++S+ RYVIHIKAG Y E V+V KKK  IMF+GDG  +
Sbjct  280   ATVAADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTR  339

Query  270   TRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYD  91
             T I G+RNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY+
Sbjct  340   TIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYN  399

Query  90    CRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  400   CDMLAYQDTLYVHSNRQFFIKCIIAGTVDF  429



>gb|KFK38797.1| hypothetical protein AALP_AA3G161500 [Arabis alpina]
Length=593

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 175/422 (41%), Positives = 248/422 (59%), Gaps = 44/422 (10%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSS---AMNATTSDD---------IHQVAHSACDRSLYRDLCVSTLV  1018
             +++L+A +SL +  S    A   + S+D          H V  SAC  +LY +LC+S L 
Sbjct  20    LIILSAVVSLLIVASVIGIAAGVSKSNDNGKRTLSPSSHAVLRSACSPTLYPELCISALA  79

Query  1017  KTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDT  838
              + D++  S  ++I A++N+T + ++       ++ +    L   E  AL+ CLE   +T
Sbjct  80    TSGDVKLTSQKDVIEASLNLTTTVVEHNYFTVKKLIKNRKGLTPREKTALHDCLETIDET  139

Query  837   LADLRTVLDGLENSPAKRY-----ADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIK  679
             L +L   ++ L   P K+       DL+TL+S+A+TNQ TCL+GF +  ++K VR  ++K
Sbjct  140   LDELHEAVEDLHVYPNKKTLREHAGDLKTLISSAITNQETCLDGFSHDEADKKVRKALLK  199

Query  678   RVEQISRHVSNALSMLTKIKKEKNKPSALFGP----SYSSSSFRQEH-----------GE  544
               + + R  SNAL+M   IK   +   A F      + ++   ++E            GE
Sbjct  200   GQKHVERMCSNALAM---IKNMTDTDIANFDLKAKLTTNNRKLKEEEETTVAVDIAGAGE  256

Query  543   M-KDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTR  367
             +  +G+P WLS  DR LL+  T      ++AD TVA DGSG FK+I AA++AAP +S+ R
Sbjct  257   LDSEGWPTWLSAGDRRLLQGST------VRADATVAADGSGQFKTIAAAVAAAPANSNKR  310

Query  366   YVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGF  187
             YVIHIKAG Y E V+V K K  IMF+GDG  +T I  +RNV DG  TF SATVA VG  F
Sbjct  311   YVIHIKAGVYRENVEVAKTKKNIMFMGDGRTRTIITASRNVVDGSTTFHSATVAAVGERF  370

Query  186   IAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTV  7
             +A  I+F+N+AGP KHQAVALR  SD+S FY C  + YQDTLYVHS RQFF +C + GTV
Sbjct  371   LARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTV  430

Query  6     DF  1
             DF
Sbjct  431   DF  432



>gb|EYU21270.1| hypothetical protein MIMGU_mgv1a003278mg [Erythranthe guttata]
Length=594

 Score =   279 bits (714),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 174/422 (41%), Positives = 247/422 (59%), Gaps = 46/422 (11%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVF--QSSAMNATTSDDI-----HQVAHSACDRSLYRDLCVSTLV  1018
             + L   +LLAA +   V   +S   N+  S DI     H +A S+C  +LY +LC S + 
Sbjct  28    LALFASILLAAAIVGVVVGVKSRKENSEDSSDIKLSRAHAIAKSSCSNTLYPELCYSAIA  87

Query  1017  KTPD---LRAKSIPEIISATVNVTVSEIK------TAAANCSRIRRVVPDLGTMESRALY  865
              + D    + KS  ++I  ++NVT + ++                    +L   E  AL+
Sbjct  88    DSLDGGKEKVKSKKDVIILSLNVTTAAVRRNYFAIEKLLAGGGGGAKSGNLTEREKSALH  147

Query  864   VCLELFSDTLADLRTVLDGLENSPA-----KRYAD-LQTLLSTAMTNQYTCLEGFPY--S  709
              CLE   +TL +L   ++ L+  P+     K +AD L+TL+S+A+TNQ TCL+GF +  +
Sbjct  148   DCLETIGETLDELHAAVEDLKEYPSLKKSVKNHADYLKTLISSAITNQETCLDGFSHGKT  207

Query  708   NKNVRPFIIK-RVEQISRHVSNALSML-----TKIKKEKNKPSALFGPSYSSSSFRQEHG  547
             +++ R  ++  +V ++ +  SN+L+M+     T I+ EK             +S R+   
Sbjct  208   DRHAREILVGGQVVRVEKLCSNSLAMICNMTDTDIENEKR----------GLTSGRKLVA  257

Query  546   EMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTR  367
             E   G+P+WLS  DR LL++ T      +  DV VA DGSGD ++++AA++AAP+ S+ R
Sbjct  258   EGGGGWPEWLSSGDRRLLQSST------VTPDVVVAADGSGDHRTVSAAVAAAPEKSNRR  311

Query  366   YVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGF  187
             YVI IKAG Y E VDV KKKT IMFVGDG   T I G++NV+DG  TF SATVAVVG  F
Sbjct  312   YVIRIKAGVYRENVDVGKKKTNIMFVGDGRSTTIITGSKNVQDGSTTFNSATVAVVGEKF  371

Query  186   IAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTV  7
             +A  I+F+N+AGP KHQAVALR  SD S FY C  + YQDTLYVHS R FF +C + GTV
Sbjct  372   LARDITFQNTAGPTKHQAVALRVGSDLSAFYRCDILAYQDTLYVHSNRHFFVQCLIAGTV  431

Query  6     DF  1
             DF
Sbjct  432   DF  433



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score =   279 bits (713),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 165/403 (41%), Positives = 237/403 (59%), Gaps = 24/403 (6%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             ++L  ++L+   +++    +S  N + ++  H +  S+C  +LY +LC S +   P   +
Sbjct  30    VILASLLLVTTIIAIATGVNSHRN-SKNEGTHAILKSSCSSTLYPELCYSAVATVPGATS  88

Query  996   K--SIPEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMESRALYVCLELFSDTLAD  829
                S  ++I  ++N+T    K    N   + +++    L   E  AL+ CLE+  +TL +
Sbjct  89    NLASQKDVIELSINLTT---KAVQHNFFTVEKLIATKKLSKREKTALHDCLEIIDETLDE  145

Query  828   LRTVLDGLENSPA----KRYAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVE  670
             L   L  L   P     K++AD L+TLLS+A+TNQ TCL+GF +  ++K VR  ++K   
Sbjct  146   LHEALVDLNEYPNNKSLKKHADDLKTLLSSAITNQETCLDGFSHDEADKKVRKALLKGQI  205

Query  669   QISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLE  490
              + +  SN L+M   IK   +   A      +    +QE    +  +P+W+S  DR LL+
Sbjct  206   HVEKMCSNVLAM---IKNMTDTDVANELKITNRKLMQQEKEGNESEWPEWMSVADRRLLQ  262

Query  489   APTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKK  310
             + +      +  DV VA DGSG++K+++AA++AAP  S  RY+I IKAG Y E VDV K 
Sbjct  263   SSS------VTPDVVVAADGSGNYKTVSAAVAAAPKKSSKRYIIRIKAGVYRENVDVPKD  316

Query  309   KTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
             KT IMF+GDG   T I  +RNV DG  TF SATVA VG GF+A GI+F+N+AGP KHQAV
Sbjct  317   KTNIMFMGDGRKTTIITASRNVVDGSTTFNSATVAAVGQGFLARGITFQNTAGPSKHQAV  376

Query  129   ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR  SD S FYDC  + YQDTLYVHS RQFF  C + GTVDF
Sbjct  377   ALRVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCFIAGTVDF  419



>ref|XP_011012638.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=573

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 164/405 (40%), Positives = 237/405 (59%), Gaps = 26/405 (6%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAH----SACDRSLYRDLCVSTLVKTPD  1006
             +   ++L+AA +S+    +S+ N+T S++ HQVA+    S+C  +LY  LC S++   PD
Sbjct  20    LFSSILLVAAIVSIVAGVTSSKNSTESNNDHQVAYTILKSSCSSTLYPHLCFSSISAVPD  79

Query  1005  L--RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLA  832
                + KS  ++I  ++N T+S  + +     ++          E+ AL+ CL + ++TL 
Sbjct  80    ATSKIKSKKDVIDLSLNRTMSATRHSYFKIQKLTFTRRSFTERENTALHDCLVMLNETLD  139

Query  831   DLRTVLDGLENSPAKRYA------DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKR  676
              L      L++ P+ + +      DL+ LLS  MTNQ TCL+GF +  ++K VR   I  
Sbjct  140   QLSKAYQELQDYPSLKKSLSVHADDLKILLSATMTNQETCLDGFSHEKADKKVRELFIDE  199

Query  675   VEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRAL  496
                +    S AL+++      KN          S SS R+   E    +P+WLS  DR L
Sbjct  200   EMHVYHMSSIALAII------KNVTDTDMAKEQSLSSGRKLEEENGTEWPEWLSAGDRRL  253

Query  495   LEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVD  316
             L+A T      +  +V VA DGSG++++++ A++AAP+SS +RY+I IKAG Y E VDV 
Sbjct  254   LQATT------VTPNVVVAADGSGNYRTVSEAVAAAPESSSSRYIIRIKAGVYRENVDVP  307

Query  315   KKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQ  136
              +KT IMF+GDG   T I  +RNV DG  TF SATVA VG GF+A  I+F+NSAGP KHQ
Sbjct  308   SRKTNIMFMGDGRTTTIITASRNVVDGSTTFNSATVAAVGGGFLARDITFQNSAGPSKHQ  367

Query  135   AVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVA+R  SD S FY C  + YQDTLYVHS RQF+  C + G+VDF
Sbjct  368   AVAIRVGSDLSAFYRCGMIAYQDTLYVHSLRQFYVSCIIIGSVDF  412



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score =   278 bits (711),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 156/368 (42%), Positives = 223/368 (61%), Gaps = 18/368 (5%)
 Frame = -3

Query  1068  SACDRSLYRDLCVSTLVKTPDLRA---KSIPEIISATVNVTVSEIKTAAANCSRIRRVVP  898
             S+C  +LY DLC+S L  +P L +   K+  ++++  +N+T++ ++       ++     
Sbjct  43    SSCSSTLYPDLCLSQLTSSPSLTSDAMKTPKDVVALALNLTITSVQHNYFTIKKVAATRS  102

Query  897   DLGTMESRALYVCLELFSDTLADLRTVL-------DGLENSPAKRYADLQTLLSTAMTNQ  739
              L   E  AL+ CLE+  +TL ++R  L       +G   S ++   D++TLLS AMTNQ
Sbjct  103   GLTVRERTALHDCLEMVDETLDEVRETLADLLAYPNGGSKSVSELAEDMKTLLSAAMTNQ  162

Query  738   YTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS  565
              +CL+GF +  ++K VR  ++     +    S+AL+M+  I         L   +     
Sbjct  163   ESCLDGFSHDSADKKVREALLGGQMHVFHLCSHALAMVKNITDADAANKRLPSSNRRLKE  222

Query  564   FRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAP  385
               +E G+    +P+WLS  DR LL++ T      +  DVTVA DGSGD+++++ A+ AAP
Sbjct  223   EIKEEGQEPIQWPQWLSAGDRRLLQSTT------VTPDVTVAADGSGDYRTVSEAVEAAP  276

Query  384   DSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVA  205
             + S+ RYVI IKAG Y E V+V  +KT +MFVGDG   T I G+RNV DG  TF SATVA
Sbjct  277   ERSERRYVIKIKAGVYRENVEVTSRKTNLMFVGDGRTTTIITGSRNVVDGSTTFNSATVA  336

Query  204   VVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFREC  25
             VVG GF+A  I+FEN+AGP KHQAVALR +SD+S FY C  + YQDTLYVHS RQF+  C
Sbjct  337   VVGEGFLARDITFENTAGPSKHQAVALRVNSDFSAFYRCCMLAYQDTLYVHSLRQFYFGC  396

Query  24    DVYGTVDF  1
              + GTVDF
Sbjct  397   FIAGTVDF  404



>ref|NP_188048.1| pectin methylesterase 3 [Arabidopsis thaliana]
 sp|O49006.2|PME3_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 3; Includes: 
RecName: Full=Pectinesterase inhibitor 3; AltName: Full=Pectin 
methylesterase inhibitor 3; Includes: RecName: Full=Pectinesterase 
3; Short=PE 3; AltName: Full=Pectin methylesterase 
27; Short=AtPME27; AltName: Full=Pectin methylesterase 
3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01037.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK59769.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAK97722.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAN28889.1| At3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AEE75500.1| pectin methylesterase 3 [Arabidopsis thaliana]
Length=592

 Score =   279 bits (713),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 168/391 (43%), Positives = 233/391 (60%), Gaps = 33/391 (8%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             T S   H V  S+C  + Y +LC+S +V    +   S  ++I A+VN+T++ ++      
Sbjct  50    TLSPSSHAVLRSSCSSTRYPELCISAVVTAGGVELTSQKDVIEASVNLTITAVEHNYFTV  109

Query  921   SRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLS  757
              ++ +    L   E  AL+ CLE   +TL +L   ++ L   P K+       DL+TL+S
Sbjct  110   KKLIKKRKGLTPREKTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLIS  169

Query  756   TAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGP  583
             +A+TNQ TCL+GF +  ++K VR  ++K    +    SNAL+M   IK   +   A F  
Sbjct  170   SAITNQETCLDGFSHDDADKQVRKALLKGQIHVEHMCSNALAM---IKNMTDTDIANFEQ  226

Query  582   SYSSSS----FRQEH------------GEM-KDGFPKWLSRRDRALLEAPTGKKKRKIKA  454
                 +S     ++E+            GE+  +G+P WLS  DR LL+         +KA
Sbjct  227   KAKITSNNRKLKEENQETTVAVDIAGAGELDSEGWPTWLSAGDRRLLQGS------GVKA  280

Query  453   DVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIG  274
             D TVA DGSG FK++ AA++AAP++S+ RYVIHIKAG Y E V+V KKK  IMF+GDG  
Sbjct  281   DATVAADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRT  340

Query  273   KTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFY  94
             +T I G+RNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY
Sbjct  341   RTIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFY  400

Query  93    DCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  401   NCDMLAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>ref|XP_006297218.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
 gb|EOA30116.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
Length=623

 Score =   279 bits (713),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 168/385 (44%), Positives = 231/385 (60%), Gaps = 33/385 (9%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             H V  S+C  +LY +LC+S +     +   S  ++I A++N+T + ++       ++ + 
Sbjct  87    HAVLRSSCSSTLYPELCISAVATAGGVELTSQKDVIEASLNLTKTAVEHNYFTVRKLIKK  146

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLSTAMTNQ  739
                L   E  AL+ CLE   +TL +L   ++ L   P K+       DL+TL+S+A+TNQ
Sbjct  147   RKGLTPREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLRQHAGDLKTLISSAITNQ  206

Query  738   YTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS  565
              TCL+GF +  ++K VR  ++K    +    SNAL+M   IK   +   A F      +S
Sbjct  207   ETCLDGFSHDGADKQVRKALLKGQIHVEHMCSNALAM---IKNMTDTDIANFEAKAKVTS  263

Query  564   ----FRQEH------------GEMK-DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAK  436
                  ++E+            GE+   G+P WLS  DR LL+  TG     ++AD TVA 
Sbjct  264   NNRKLKEENQETTVAVDIAGAGELDAQGWPTWLSAGDRRLLQG-TG-----VRADATVAA  317

Query  435   DGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKG  256
             DGSG FK++ AA++AAP++S+ RYVIHIKAG Y E VDV KKK  IMF+GDG  +T I G
Sbjct  318   DGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRTIITG  377

Query  255   NRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVG  76
             NRNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY+C  + 
Sbjct  378   NRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLA  437

Query  75    YQDTLYVHSRRQFFRECDVYGTVDF  1
             YQDTLYVHS RQFF +C + GTVDF
Sbjct  438   YQDTLYVHSNRQFFVKCLIAGTVDF  462



>ref|XP_007024771.1| Pectin methylesterase 3 isoform 2, partial [Theobroma cacao]
 gb|EOY27393.1| Pectin methylesterase 3 isoform 2, partial [Theobroma cacao]
Length=500

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 163/400 (41%), Positives = 239/400 (60%), Gaps = 26/400 (7%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATTSDDIHQ-VAHSACDRSLYRDLCVSTLVKTP---DLRAK  994
             +V++AA + +    +S  N+  +D  H  +  SAC  + Y DLC S +   P     + K
Sbjct  35    LVIVAAIIGIVAGVNSRNNSDETDTSHHAIVKSACSITRYPDLCFSEVAAAPAATSKKVK  94

Query  993   SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESR--ALYVCLELFSDTLADLRT  820
             S  ++I  ++N+T + ++    N  +I++++   G  E    AL+ CLE   +TL +L  
Sbjct  95    SKKDVIELSLNITTTAVE---HNYFKIKKLLAKKGLTEREKTALHDCLETIDETLDELHE  151

Query  819   VLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQIS  661
              ++ L   P K+       DL+TL+S AMTNQ TCL+GF +  ++K +R  +I   + + 
Sbjct  152   AVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHDAADKKIRKVLIDGEKYVE  211

Query  660   RHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPT  481
             R  SNAL+M+  +  + +  + +   S +     QE+G     +P+WLS  DR LL++ +
Sbjct  212   RMCSNALAMIKNMT-DTDIANEMLKTSSNRKLKEQENG---IAWPEWLSAGDRRLLQSSS  267

Query  480   GKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTM  301
                   +  DV VA DGSG++K+++ A++ AP  S  RYVI IKAG Y E V+V KKKT 
Sbjct  268   ------VTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYRENVEVPKKKTN  321

Query  300   IMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALR  121
             IMF+GDG  +T I G+RNV DG  TF SATVAVVG  F+A  I+F+N+AGP KHQAVALR
Sbjct  322   IMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQNTAGPSKHQAVALR  381

Query  120   ADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               +D S FY+C  + YQDTLY HS RQF+  C + GTVDF
Sbjct  382   VGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDF  421



>ref|XP_003559807.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=587

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 167/401 (42%), Positives = 229/401 (57%), Gaps = 49/401 (12%)
 Frame = -3

Query  1116  SAMNATTSDDIHQVAHSACDRSLYRDLCVSTL-VKTPDLRAKSIPEIISATVNVTVSEIK  940
             S+   T  DD   V        L+ D+C +TL    P L  K +PE+IS  V+     ++
Sbjct  43    SSGQPTFPDDAAAVERHCGGMLLHGDVCAATLSAMPPGLSKKPLPEVISYVVSRAADAVR  102

Query  939   TAAANCSRIRRVVPD----LGTMESRALYVCLELFSDTLADLRTVLDGLE-------NSP  793
              AA+NC+    + P+    L   +  AL  CLELFS TL  L T    LE        + 
Sbjct  103   AAASNCTSY--LAPERHSQLRVRDRLALADCLELFSHTLTQLATASSELELELSNSSRTA  160

Query  792   AKRYADLQTLLSTAMTNQYTCLEGFPYSNKN-----------------VRPFIIKRVEQI  664
              +R A +QT+LS AMTNQ+TCL+GF    +                  VRP+I  R+  +
Sbjct  161   EERVAGVQTVLSAAMTNQFTCLDGFSDPTQTPGGPSPGPGPSDSSPGRVRPYIQGRILHV  220

Query  663   SRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAP  484
             S  +SN+L++L ++     +      P+ +             GFP W+S  DR  LE  
Sbjct  221   SHLLSNSLALLRRLPSSSRRRRRRV-PNRAG------------GFPSWISAADRRRLE--  265

Query  483   TGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKT  304
                +++   AD TVAKDGSGD+ ++  A++AAP++S  R+VI +K G Y+E V+V  +KT
Sbjct  266   ---QQQVAAADATVAKDGSGDYATVGEAVAAAPNNSARRWVIRVKTGGYFENVEVGSEKT  322

Query  303   MIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVAL  124
              +M VGDG+ KT IK +RNV D + TFRSAT+AV GTGF+A  ++ EN AGP KHQAVAL
Sbjct  323   NLMLVGDGMWKTVIKASRNVVDNYTTFRSATLAVAGTGFLARDLTVENGAGPSKHQAVAL  382

Query  123   RADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             R ++D S FY C F GYQDTLY HS RQF+++CDVYGTVDF
Sbjct  383   RVNADLSAFYRCSFAGYQDTLYAHSLRQFYKDCDVYGTVDF  423



>ref|XP_011072691.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=551

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 231/376 (61%), Gaps = 30/376 (8%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKT--PDLRAKSIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +A S+C  +LY +LC S +  +   + +  S  ++I  ++NVT+S ++    N   I 
Sbjct  43    HAIALSSCSSTLYPELCYSAIADSLSDNKKVTSKKDVIILSLNVTISSVQR---NYFAIE  99

Query  909   RVV----PDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLS  757
             +++     +L   E  AL+ CLE   +TL +L T +  L+  P K+       DL+TLLS
Sbjct  100   KLLYAGKSNLTEREKTALHDCLETIDETLDELHTAVKDLKEYPLKKSIREHADDLKTLLS  159

Query  756   TAMTNQYTCLEGFPY--SNKNVRPFIIK-RVEQISRHVSNALSMLTKIKK-EKNKPSALF  589
             +A+TNQ TCL+GF Y  S+K+VR  ++  +V ++ +  SN+L+MLT +   +      L 
Sbjct  160   SAITNQETCLDGFSYGKSDKHVREVLVGGQVLRVEKLCSNSLAMLTNMTDTDMENERKLN  219

Query  588   GPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSI  409
             G        +    E   G+P+WLS  DR LL++ +      ++ DV VA DGSG+++++
Sbjct  220   GGR------KLVAAEDGSGWPEWLSAGDRRLLQSSS------VRPDVVVAADGSGNYRTV  267

Query  408   NAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWP  229
              AA++AAP+ S  RYVI IKAG Y E V+V KKKT IMF+GDG   T I G+ NV+DG  
Sbjct  268   GAAVAAAPERSSRRYVIRIKAGVYRENVEVPKKKTNIMFMGDGRSNTIITGSTNVRDGST  327

Query  228   TFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHS  49
             TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD S FY C  + YQDTLYVHS
Sbjct  328   TFNSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHS  387

Query  48    RRQFFRECDVYGTVDF  1
              RQFF +C + GTVDF
Sbjct  388   NRQFFVQCLISGTVDF  403



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 157/372 (42%), Positives = 224/372 (60%), Gaps = 25/372 (7%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  S+C  + Y DLC S +   P+   K  S  ++I  ++N+T + ++    N   I+
Sbjct  66    HAILKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVE---HNYFGIQ  122

Query  909   RVVP--DLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTA  751
             +++   +L   E  AL+ CLE   +TL +L   ++ LE  P K+       DL+TL+S A
Sbjct  123   KLLKRTNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAA  182

Query  750   MTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSY  577
             MTNQ TCL+GF +  +NK+VR  +      + +  SNAL+M+    K       +   + 
Sbjct  183   MTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMI----KNMTDTDMMIMRTS  238

Query  576   SSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAAL  397
             ++    +E   + DG+P WLS  DR LL++ +      +  +V VA DGSG+FK++ A++
Sbjct  239   NNRKLIEETSTV-DGWPAWLSTGDRRLLQSSS------VTPNVVVAADGSGNFKTVAASV  291

Query  396   SAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRS  217
             +AAP     RY+I IKAG Y E V+V KK   IMF+GDG  +T I G+RNV DG  TF+S
Sbjct  292   AAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKS  351

Query  216   ATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQF  37
             ATVAVVG GF+A  I+F+N+AGP KHQAVALR  +D S FY+C  + YQDTLYVHS RQF
Sbjct  352   ATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQF  411

Query  36    FRECDVYGTVDF  1
             F  C + GTVDF
Sbjct  412   FVNCLIAGTVDF  423



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score =   276 bits (706),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 163/406 (40%), Positives = 231/406 (57%), Gaps = 27/406 (7%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDI---HQVAHSACDRSLYRDLCVSTLVKTPDL  1003
             +   ++L+ A + +     S+ N +  + I   H +  S+C  +LY DLC STL   P+ 
Sbjct  31    LFATILLVGAVIGIVTGVKSSKNNSDDETIEASHAIVKSSCSSTLYPDLCFSTLALHPEA  90

Query  1002  RAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPD-LGTMESRALYVCLELFSDTLA  832
               K  S  ++I  ++N+T + ++       ++ +   + L   E  AL+ CLE   +TL 
Sbjct  91    SKKVSSQKDVIELSLNITTTAVQHIFFTVEKLLKSRKNKLTKREKGALHDCLETIDETLD  150

Query  831   DLRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRV  673
             +L   ++ L   P  +       DL+TL S+A+TNQ TCL GF +   +K VR  ++   
Sbjct  151   ELHEAVEDLHEYPNNKTLVQHADDLKTLJSSAITNQETCLNGFSHDGGDKKVRKVLLAGE  210

Query  672   EQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKD--GFPKWLSRRDRA  499
             E I +  SN L+M+      KN            +  R+    M D  G+P+WLS  DR 
Sbjct  211   EHIEKLCSNVLAMI------KNMTDTDIANEMKMNVNRKLKENMVDEHGWPEWLSVADRR  264

Query  498   LLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDV  319
             LL++ +      +  +V VA DG+G++K+++ A++AAP+ S +RYVI IKAG Y E VDV
Sbjct  265   LLQSSS------VTPNVVVAADGTGNYKTVSEAVAAAPEKSSSRYVIKIKAGIYRENVDV  318

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKH  139
              KKKT IMF+GDG   T I  +RNV DG  TF SATVA VG  F+A  I+F+N+AGP KH
Sbjct  319   PKKKTNIMFLGDGRVNTIITASRNVVDGSTTFNSATVAAVGEKFLARDITFQNTAGPSKH  378

Query  138   QAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR  SD S FY C  + YQD+LYVHS RQFF  C V GTVDF
Sbjct  379   QAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDF  424



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score =   276 bits (706),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 161/376 (43%), Positives = 219/376 (58%), Gaps = 33/376 (9%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSI---PEIISATVNVTVSEIKTAAANCSRI  913
             H +  S+C  +LY DLC STL   P   ++ I    ++I   +N T + ++        +
Sbjct  69    HAIVKSSCSNTLYPDLCFSTLANLPQAVSQKITSQKDVIELVLNHTTTTVEHNYFAVEHL  128

Query  912   RRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTAM  748
                  +L   E  AL+ CLE   +TL +L   +  LE  P+K+       DL+TL+S AM
Sbjct  129   IATHHNLTEREKTALHDCLETIDETLDELHQTVKDLELYPSKKSLKQHADDLKTLMSAAM  188

Query  747   TNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSML-----TKIKKEKNKPSALF  589
             TNQ TCL+GF +  ++K+VR  +      + +  SNAL+M+     T +++E        
Sbjct  189   TNQETCLDGFSHDDADKHVRQELSNGQVHVEKLCSNALAMIKNMTDTDMERE--------  240

Query  588   GPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSI  409
                 S +  R+   E  +G+P WLS  DR LL++ T      + ADV VA DGSGDFK++
Sbjct  241   ----SEAGGRKLEEEETNGWPNWLSAGDRRLLQSST------VTADVVVAADGSGDFKTV  290

Query  408   NAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWP  229
             +AA+ AAP+ S  RYVI IKAG Y E V+V KKKT IMF+GDG  KT I  +RNV DG  
Sbjct  291   SAAVEAAPEKSSRRYVIRIKAGVYRENVEVPKKKTNIMFLGDGRTKTIITASRNVVDGST  350

Query  228   TFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHS  49
             TF SATVA VG  F+A  ++F+N+AG  KHQAVALR  SD S FY C  + +QDTLY HS
Sbjct  351   TFHSATVAAVGERFLARDLTFQNTAGSSKHQAVALRVGSDLSAFYQCDILAHQDTLYAHS  410

Query  48    RRQFFRECDVYGTVDF  1
              RQF+  C + GTVDF
Sbjct  411   NRQFYINCLIAGTVDF  426



>ref|XP_009135376.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=591

 Score =   276 bits (705),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 169/410 (41%), Positives = 236/410 (58%), Gaps = 27/410 (7%)
 Frame = -3

Query  1167  VPVVLLAAFLSLTVFQSSAMNA---TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             V ++L+ A   +TV  S A      T +   H V  SAC  + Y +LC+S +  +  +  
Sbjct  27    VALLLVTAIAGITVGASKANENGKRTLTPSSHAVLTSACISTRYPELCISAVATSGGVEL  86

Query  996   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTV  817
              S  ++I A++N+T + ++       ++ +    L   E  AL+ CLE   +TL +L   
Sbjct  87    TSQKDVIEASLNLTKTVVEHNYFTVKKLIKKRKGLTPREKTALHDCLETIDETLDELHEA  146

Query  816   LDGLENSPAKR-----YADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISR  658
             ++ L   P K+       DL+TL+S+A+TNQ TCL+GF +  ++K VR  + K    +  
Sbjct  147   VEDLHLYPNKKSLREHAGDLKTLISSAITNQETCLDGFSHDGADKKVRKALFKGQMHVEH  206

Query  657   HVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH----------GEMK-DGFPKWLSR  511
               SNAL+M+  +         L     S++   +E           G++  +G+P WLS 
Sbjct  207   MCSNALAMIKNMTDTDITNFELKAKFTSNNRKLKEETTVAVDMASVGDLDAEGWPTWLSA  266

Query  510   RDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYE  331
              DR LL+  T      ++AD TVA DGSG F ++ AA++AAP++S+ RYVIHIKAG Y E
Sbjct  267   GDRRLLQGST------VEADATVAADGSGTFTTVAAAVAAAPENSNKRYVIHIKAGVYRE  320

Query  330   YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAG  151
              VDV KKK  IMF+GDG   T I  +RN  DGWPTF SATVAVVG  F+A  I+F+N+AG
Sbjct  321   NVDVAKKKKNIMFMGDGRTTTIITASRNAVDGWPTFSSATVAVVGERFLARDITFQNTAG  380

Query  150   PEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             P K QAVALR  SD+S FY C  + YQDTLYVHS RQFF  C + GTVDF
Sbjct  381   PSKEQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVNCLIVGTVDF  430



>ref|NP_001233857.1| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
 sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score =   275 bits (703),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 163/408 (40%), Positives = 233/408 (57%), Gaps = 27/408 (7%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTV-FQSSAMNATTSDDI-------HQVAHSACDRSLYRDLCVSTLV  1018
             ++  V+L+AA + +    +S + N+    DI       H +  SAC  +L+ +LC S +V
Sbjct  25    IVASVLLVAAVIGVVAGVKSHSKNSDDHADIMAISSSAHAIVKSACSNTLHPELCYSAIV  84

Query  1017  KTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFS  844
                D   K  S  ++I  ++N+TV  ++        + +    L   E  AL+ CLE   
Sbjct  85    NVSDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGLTPREKVALHDCLETMD  144

Query  843   DTLADLRTVLDGLENSPAKR-----YADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFI  685
             +TL +L T ++ LE  P K+       DL+TL+S+A+TNQ TCL+GF +  ++K VR  +
Sbjct  145   ETLDELHTAVEDLELYPNKKSLKEHVEDLKTLISSAITNQETCLDGFSHDEADKKVRKVL  204

Query  684   IKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRD  505
             +K  + + +  SNAL+M+  +               ++    +++GE    +P+WLS  D
Sbjct  205   LKGQKHVEKMCSNALAMICNMTDTDIANEMKLSAPANNRKLVEDNGE----WPEWLSAGD  260

Query  504   RALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYV  325
             R LL++ T      +  DV VA DGSGD+K+++ A+  AP+ S  RYVI IKAG Y E V
Sbjct  261   RRLLQSST------VTPDVVVAADGSGDYKTVSEAVRKAPEKSSKRYVIRIKAGVYRENV  314

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPE  145
             DV KKKT IMF+GDG   T I  +RNV+DG  TF SATV  V    +A  I+F+N+AG  
Sbjct  315   DVPKKKTNIMFMGDGKSNTIITASRNVQDGSTTFHSATVVRVAGKVLARDITFQNTAGAS  374

Query  144   KHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KHQAVAL   SD S FY C  + YQDTLYVHS RQFF +C V GTVDF
Sbjct  375   KHQAVALCVGSDLSAFYRCDMLAYQDTLYVHSNRQFFVQCLVAGTVDF  422



>ref|XP_006396439.1| hypothetical protein EUTSA_v10029374mg [Eutrema salsugineum]
 gb|ESQ37892.1| hypothetical protein EUTSA_v10029374mg [Eutrema salsugineum]
Length=534

 Score =   273 bits (699),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 157/358 (44%), Positives = 221/358 (62%), Gaps = 36/358 (10%)
 Frame = -3

Query  1029  STLVKTPDL-RAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMESRALYVCL  856
             STL KT     + +I E++ AT+N T+S++  +++N S ++ R+  ++   +  A   CL
Sbjct  37    STLHKTQRFASSDNITELVVATLNQTISKVNLSSSNFSHLQNRLGSNISHRDRCAFQDCL  96

Query  855   ELFSDTLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYS------NKN--  700
             EL  DT+ DL T +  L + P   + ++  LLS  MTN  TCL+GF  S      N N  
Sbjct  97    ELLDDTVYDLTTAISELRSLPPVLH-NVNMLLSAVMTNTRTCLDGFYSSDDEDDENSNND  155

Query  699   -----VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKD  535
                  V   + + +  ISR+V  +L+ML     ++N P  + G             E   
Sbjct  156   NKIYGVAESMKESLLNISRNVRESLAML-----DENIPGNIPGKL-----------EKDV  199

Query  534   GFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIH  355
              FP W+S  DR LL+ P  + K    A++ VA++G+G+F +I AA+SAAP+SS+TR+VI+
Sbjct  200   KFPMWVSGSDRKLLQDPVNETK----ANIVVAQNGTGNFTTIGAAVSAAPNSSETRFVIY  255

Query  354   IKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIG  175
             I  G Y+E +++ ++KTMIMFVGDGIG+T +K NR+  DGW  F SATV V G+GFIA  
Sbjct  256   ITCGVYFENIEIPREKTMIMFVGDGIGRTILKANRSSADGWTAFNSATVGVRGSGFIAKD  315

Query  174   ISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ISF N AGP KHQAVALR+ SD S +Y C F  YQDT+YVHS +QF+RECD+YGTVDF
Sbjct  316   ISFVNDAGPTKHQAVALRSSSDLSAYYRCSFESYQDTIYVHSHKQFYRECDIYGTVDF  373



>ref|XP_006355852.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=264

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 179/262 (68%), Gaps = 15/262 (6%)
 Frame = -3

Query  954  VSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLAD-LRTVL-----DGLENSP  793
            ++E+K++A NCS I   V  L  +E RAL  C+EL  DT  D L+T L       + NSP
Sbjct  1    MNEVKSSAENCSNILHHVSKLDPIEKRALDDCIELLGDTTIDELQTTLYDLSTKNISNSP  60

Query  792  AKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKE  613
             K Y DLQTLLS AMTNQ TCL G   S  N+  +I K +  IS+HVSN+L+ML K+K  
Sbjct  61   LKHYYDLQTLLSGAMTNQDTCLNGIYNSKHNLSQYIEKNLHTISQHVSNSLAMLKKLKTG  120

Query  612  KNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKD  433
              +     G   +S+    E+  MK+G+PKWL +++R LL+AP      +IK D+ VAKD
Sbjct  121  STQ-----GSLSNSNEVFPEYRTMKNGYPKWLEKKERTLLQAPV----NQIKFDLVVAKD  171

Query  432  GSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGN  253
            GSG+F +INAALSAAP+SS TR+VI+IKAG Y+EY+DV++KK+MIMFVGDGIGKT IKGN
Sbjct  172  GSGNFTTINAALSAAPNSSSTRFVIYIKAGMYFEYIDVERKKSMIMFVGDGIGKTTIKGN  231

Query  252  RNVKDGWPTFRSATVAVVGTGF  187
            RNV DGW TFRSATV    T +
Sbjct  232  RNVVDGWTTFRSATVGKFKTPY  253



>gb|AAC72288.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=592

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 167/391 (43%), Positives = 231/391 (59%), Gaps = 33/391 (8%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  922
             T S   H V  S+C  + Y +LC+S +V        S  ++I A+VN+T++ ++      
Sbjct  50    TLSPSSHAVLRSSCSSTRYPELCISAVVTAGACELTSQKDVIEASVNLTITAVEHNYFTV  109

Query  921   SRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLS  757
              ++ +    L   E  AL+ CLE   +TL +L   ++ L   P K+       DL+TL+S
Sbjct  110   KKLIKKRKGLTPREKTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLIS  169

Query  756   TAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGP  583
             +A+TNQ TCL+GF +  ++K VR  ++K    +    SNAL+M   IK   +   A F  
Sbjct  170   SAITNQETCLDGFSHDDADKQVRKALLKGQIHVEHMCSNALAM---IKNMTDTDIANFEQ  226

Query  582   SYSSSS----FRQEH------------GEM-KDGFPKWLSRRDRALLEAPTGKKKRKIKA  454
                 +S     ++E+            GE+  +G+P WLS  DR LL+         +K 
Sbjct  227   KAKITSNNRKLKEENQETTVAVDIAGAGELDSEGWPTWLSAGDRRLLQGS------GVKR  280

Query  453   DVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIG  274
             D TVA DGSG FK++ AA++AAP++S+ RYVIHIKAG Y E V+V KKK  IMF+GDG  
Sbjct  281   DATVAADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRT  340

Query  273   KTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFY  94
             +T I G+RNV DG  TF SATVA VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY
Sbjct  341   RTIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFY  400

Query  93    DCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  401   NCDMLAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>ref|XP_007139063.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
 gb|ESW11057.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
Length=580

 Score =   274 bits (701),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 162/399 (41%), Positives = 232/399 (58%), Gaps = 27/399 (7%)
 Frame = -3

Query  1158  VLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDL--RAKSIP  985
             + LA    ++  ++SA NA+++   H +  SAC  +LY +LC+S++   P    +  +  
Sbjct  35    IALAVVAGVSSRKNSAHNASSTSS-HAIIKSACSSTLYPELCLSSIASEPGKADKVSTHK  93

Query  984   EIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL  805
              +I  ++N+TV  ++       ++ R    L   +  AL+ CLE   +TL +L   +D L
Sbjct  94    NVIEQSLNITVGIVERNYFTVEKLLRK-KGLTKRQKTALHDCLETIDETLDELHKAIDEL  152

Query  804   ENSPAKR-----YADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSN  646
             +  P+K+       DL+TL+S+A+TNQ TCL+GF +  ++K +R  +           SN
Sbjct  153   KEYPSKKSLSHHAEDLKTLMSSAITNQETCLDGFSHDQADKRLRQHLQAGQVHAEHLCSN  212

Query  645   ALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDG----FPKWLSRRDRALLEAPTG  478
             AL+M       KN        + S++   +    M+D     +P W+S  DR LL+  T 
Sbjct  213   ALAMT------KNLTDNDMAMAMSNNVENERRKTMEDPHEIVWPHWISAADRRLLQTGT-  265

Query  477   KKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMI  298
                  +K DV VA DGSG+F++++AA++AAP+ S  RYVI IKAG Y E VDV KKKT I
Sbjct  266   -----VKPDVVVAADGSGNFRTVSAAVAAAPEKSSKRYVIRIKAGVYRENVDVSKKKTNI  320

Query  297   MFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRA  118
             MF+GDG   T I  +RNV DG  TF SATV VVG  F+   I+F+N+AGP KHQAVALR 
Sbjct  321   MFLGDGRTNTIITASRNVVDGSTTFNSATVVVVGERFLGRDITFQNTAGPSKHQAVALRV  380

Query  117   DSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              +D S FY C F+ YQDTLYVHS RQFF  C + G+VDF
Sbjct  381   GADLSAFYRCDFLAYQDTLYVHSNRQFFSNCYIAGSVDF  419



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   274 bits (701),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 157/372 (42%), Positives = 225/372 (60%), Gaps = 23/372 (6%)
 Frame = -3

Query  1077  VAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             +  SAC  +LY +LC S +   P++  K  +  ++IS ++N+T   ++       ++  +
Sbjct  67    ILKSACTTTLYPELCFSAISSEPNITHKITNHKDVISLSLNITTRAVEHNYFTVEKLL-L  125

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQ  739
                L   E  AL+ CLE   +TL +L+   + L   P+K+       DL+TL+S+A+TNQ
Sbjct  126   RKSLTKREKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISSAITNQ  185

Query  738   YTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKK----EKNKPSALFGPSY  577
              TCL+GF +  ++K VR  + +    +    SNAL+M   +      E  + + + G + 
Sbjct  186   VTCLDGFSHDDADKEVRKVLQEGQIHVEHMCSNALAMTKNMTDKDIAEFEQTNMVLGSNK  245

Query  576   SSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAAL  397
             +     +E+G    G+P+W+S  DR LL+  T      +KADV VA DGSG+FK+++ A+
Sbjct  246   NRKLLEEENGV---GWPEWISAGDRRLLQGST------VKADVVVAADGSGNFKTVSEAV  296

Query  396   SAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRS  217
             +AAP  S  RYVI IKAG Y E V+V KKKT IMF+GDG   T I G+RNV DG  TF S
Sbjct  297   AAAPLKSSKRYVIKIKAGVYKENVEVPKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFHS  356

Query  216   ATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQF  37
             ATVA+VG  F+A  I+F+N+AGP KHQAVALR  +D S FY+C  + YQDTLYVH+ RQF
Sbjct  357   ATVAIVGGNFLARDITFQNTAGPAKHQAVALRVGADLSAFYNCDIIAYQDTLYVHNNRQF  416

Query  36    FRECDVYGTVDF  1
             F  C + GTVDF
Sbjct  417   FVNCFISGTVDF  428



>gb|KDP40627.1| hypothetical protein JCGZ_24626 [Jatropha curcas]
Length=581

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 155/372 (42%), Positives = 218/372 (59%), Gaps = 21/372 (6%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  S+C  + + +LC S +   P   A   S  ++I  ++N+T + ++    N   + 
Sbjct  59    HAILKSSCSSTRFPELCFSAVASVPGATANLASQKDVIELSINLTTTAVQ---HNFFTVE  115

Query  909   RVVP--DLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTA  751
             +++    L   E  AL+ CLE   +TL +L    + LE  P K+       DL+TLLS+A
Sbjct  116   KLIATRKLTKREKTALHDCLETIDETLDELHKAAEDLEEYPNKKSLSQHADDLKTLLSSA  175

Query  750   MTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSY  577
             +TNQ TCL+GF +  ++K +R  ++     + +  SNAL+M+  +  + +    L   + 
Sbjct  176   ITNQETCLDGFSHDEADKRIREALLDGQVHVEKMCSNALAMIKNMT-DTDIADELKLAAT  234

Query  576   SSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAAL  397
             ++   ++E    + G+P+WLS  DR LL++ +      +  DV VA DGSG +K I  A+
Sbjct  235   TNRKLKEEGKNQESGWPEWLSAGDRRLLQSSS------VTPDVVVAADGSGKYKKIQDAV  288

Query  396   SAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRS  217
             +AAP  S  RY+I IKAG Y E V+V K KT IMF+GDG   T I  +RNV DG  TF S
Sbjct  289   NAAPSKSSKRYIIRIKAGVYRENVEVPKSKTNIMFLGDGRKTTIITASRNVADGSTTFNS  348

Query  216   ATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQF  37
             ATVA VG GF+A  I+FEN+AGP KHQAVALR  SD S FY C  + YQDTLYVHS RQF
Sbjct  349   ATVAAVGQGFLAKDITFENTAGPSKHQAVALRVGSDLSAFYQCDMLAYQDTLYVHSNRQF  408

Query  36    FRECDVYGTVDF  1
             F  C V GTVDF
Sbjct  409   FINCLVAGTVDF  420



>gb|AFQ23194.1| pectin methylesterase [Theobroma cacao]
Length=582

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 163/400 (41%), Positives = 239/400 (60%), Gaps = 26/400 (7%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATTSDDIHQ-VAHSACDRSLYRDLCVSTLVKTP---DLRAK  994
             +V++AA + +    +S  N+  +D  H  +  SAC  + Y DLC S +   P     + K
Sbjct  35    LVIVAAIIGIVAGVNSRNNSDETDTSHHAIVKSACSITRYPDLCFSEVAAAPAATSKKVK  94

Query  993   SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESR--ALYVCLELFSDTLADLRT  820
             S  ++I  ++N+T + ++    N  +I++++   G  E    AL+ CLE   +TL +L  
Sbjct  95    SKKDVIELSLNITTTAVE---HNYFKIKKLLAKKGLTEREKTALHDCLETIDETLDELHE  151

Query  819   VLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQIS  661
              ++ L   P K+       DL+TL+S AMTNQ TCL+GF +  ++K +R  +I   + + 
Sbjct  152   AVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHDAADKKIRKVLIDGEKYVE  211

Query  660   RHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPT  481
             R  SNAL+M+  +  + +  + +   S +     QE+G     +P+WLS  DR LL++ +
Sbjct  212   RMCSNALAMIKNMT-DTDIANEMLKTSSNRKLKEQENG---IAWPEWLSAGDRRLLQSSS  267

Query  480   GKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTM  301
                   +  DV VA DGSG++K+++ A++ AP  S  RYVI IKAG Y E V+V KKKT 
Sbjct  268   ------VTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYRENVEVPKKKTN  321

Query  300   IMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALR  121
             IMF+GDG  +T I G+RNV DG  TF SATVAVVG  F+A  I+F+N+AGP KHQAVALR
Sbjct  322   IMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARSITFQNTAGPSKHQAVALR  381

Query  120   ADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               +D S FY+C  + YQDTLY HS RQF+  C + GTVDF
Sbjct  382   VGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDF  421



>ref|NP_192141.1| probable pectinesterase/pectinesterase inhibitor 40 [Arabidopsis 
thaliana]
 sp|O81301.1|PME40_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
40; Includes: RecName: Full=Pectinesterase inhibitor 40; AltName: 
Full=Pectin methylesterase inhibitor 40; Includes: RecName: 
Full=Pectinesterase 40; Short=PE 40; AltName: Full=Pectin 
methylesterase 40; Short=AtPME40; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC19272.1| T14P8.1 [Arabidopsis thaliana]
 emb|CAB80725.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AAY78786.1| pectinesterase family protein [Arabidopsis thaliana]
 gb|AEE82154.1| probable pectinesterase/pectinesterase inhibitor 40 [Arabidopsis 
thaliana]
Length=518

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/343 (43%), Positives = 212/343 (62%), Gaps = 35/343 (10%)
 Frame = -3

Query  990  IPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMESRALYVCLELFSDTLADLRTVL  814
            I E++   +N T+S +  +++N S + +R+  +L   +  A   CLEL  DT+ DL T +
Sbjct  37   ITELVVTALNQTISNVNLSSSNFSDLLQRLGSNLSHRDLCAFDDCLELLDDTVFDLTTAI  96

Query  813  DGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNK------------NVRPFIIKRVE  670
              L  S +    +++ LLS AMTN  TCL+GF  S+              V   + + + 
Sbjct  97   SKLR-SHSPELHNVKMLLSAAMTNTRTCLDGFASSDNDENLNNNDNKTYGVAESLKESLF  155

Query  669  QISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLE  490
             IS HVS++L+ML  I            P +     +++ G     FP W+S  DR LL+
Sbjct  156  NISSHVSDSLAMLENI------------PGHIPGKVKEDVG-----FPMWVSGSDRNLLQ  198

Query  489  APTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKK  310
             P  + K     ++ VA++G+G++ +I  A+SAAP+SS+TR+VI+IK G Y+E +++ ++
Sbjct  199  DPVDETK----VNLVVAQNGTGNYTTIGEAISAAPNSSETRFVIYIKCGEYFENIEIPRE  254

Query  309  KTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
            KTMIMF+GDGIG+T IK NR+  DGW  F SATV V G+GFIA  +SF N AGPEKHQAV
Sbjct  255  KTMIMFIGDGIGRTVIKANRSYADGWTAFHSATVGVRGSGFIAKDLSFVNYAGPEKHQAV  314

Query  129  ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            ALR+ SD S +Y C F  YQDT+YVHS +QF+RECD+YGTVDF
Sbjct  315  ALRSSSDLSAYYRCSFESYQDTIYVHSHKQFYRECDIYGTVDF  357



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   273 bits (699),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 163/400 (41%), Positives = 239/400 (60%), Gaps = 26/400 (7%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATTSDDIHQ-VAHSACDRSLYRDLCVSTLVKTP---DLRAK  994
             +V++AA + +    +S  N+  +D  H  +  SAC  + Y DLC S +   P     + K
Sbjct  35    LVIVAAIIGIVAGVNSRNNSDETDTSHHAIVKSACSITRYPDLCFSEVAAAPAATSKKVK  94

Query  993   SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESR--ALYVCLELFSDTLADLRT  820
             S  ++I  ++N+T + ++    N  +I++++   G  E    AL+ CLE   +TL +L  
Sbjct  95    SKKDVIELSLNITTTAVE---HNYFKIKKLLAKKGLTEREKTALHDCLETIDETLDELHE  151

Query  819   VLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQIS  661
              ++ L   P K+       DL+TL+S AMTNQ TCL+GF +  ++K +R  +I   + + 
Sbjct  152   AVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHDAADKKIRKVLIDGEKYVE  211

Query  660   RHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPT  481
             R  SNAL+M+  +  + +  + +   S +     QE+G     +P+WLS  DR LL++ +
Sbjct  212   RMCSNALAMIKNMT-DTDIANEMLKTSSNRKLKEQENG---IAWPEWLSAGDRRLLQSSS  267

Query  480   GKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTM  301
                   +  DV VA DGSG++K+++ A++ AP  S  RYVI IKAG Y E V+V KKKT 
Sbjct  268   ------VTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYRENVEVPKKKTN  321

Query  300   IMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALR  121
             IMF+GDG  +T I G+RNV DG  TF SATVAVVG  F+A  I+F+N+AGP KHQAVALR
Sbjct  322   IMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQNTAGPSKHQAVALR  381

Query  120   ADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               +D S FY+C  + YQDTLY HS RQF+  C + GTVDF
Sbjct  382   VGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDF  421



>ref|XP_010047425.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=585

 Score =   273 bits (697),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 159/382 (42%), Positives = 232/382 (61%), Gaps = 24/382 (6%)
 Frame = -3

Query  1092  DDIHQVAHS----ACDRSLYRDLCVSTLVKTPDLRAKSIP---EIISATVNVTVSEIKTA  934
             DD H+ A S    +C  +LY DLC+S L  +P L + ++    ++I+ ++N+T++ ++  
Sbjct  50    DDHHREARSLIKSSCSSTLYPDLCLSQLTSSPSLASNAVKTPKDVIALSLNLTIAYVQHN  109

Query  933   AANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVL-------DGLENSPAKRYAD  775
               +  ++  V P L   E  AL+ CLE+  +TL ++R  L       +G   S ++   D
Sbjct  110   YFSIKKVAAVRPGLTARERTALHDCLEMVDETLDEVRETLAELLAYPNGGNKSASELAED  169

Query  774   LQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKP  601
             ++TLLS AMTNQ TCL+GF +  ++K VR  ++     +    SNAL+M+  +       
Sbjct  170   MKTLLSAAMTNQETCLDGFSHDSADKKVREALLGGQMHVFHLCSNALAMVKNMTDADVAN  229

Query  600   SALFGPSYSSSSFRQEHGEMKDG--FPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGS  427
                   S +     +   E +D   +P+WLS  DR LL++ T      +  DVTVA DG+
Sbjct  230   ERRLSSSSNRRLKEETKEEEEDPVRWPEWLSAGDRRLLQSTT------VTPDVTVAADGT  283

Query  426   GDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRN  247
             G++++++AA++AAP+ S  RYVI IKAG Y E V+V KKK  +MF+GD    T I G+RN
Sbjct  284   GNYRTVSAAVAAAPEGSARRYVIKIKAGVYRENVEVPKKKVNLMFMGDDRKTTIITGSRN  343

Query  246   VKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQD  67
             V DG  TF+SATVAVVG GF+A  I+F+N+AGP KHQAVALR  +D+S F+ C  + YQD
Sbjct  344   VVDGSTTFKSATVAVVGDGFLARDITFQNTAGPSKHQAVALRVGADFSAFHRCDMLAYQD  403

Query  66    TLYVHSRRQFFRECDVYGTVDF  1
             TLYVHS RQF+  C V GTVDF
Sbjct  404   TLYVHSLRQFYVGCLVAGTVDF  425



>ref|XP_006828588.1| hypothetical protein AMTR_s00129p00047530 [Amborella trichopoda]
 gb|ERM96004.1| hypothetical protein AMTR_s00129p00047530 [Amborella trichopoda]
Length=535

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/347 (43%), Positives = 205/347 (59%), Gaps = 22/347 (6%)
 Frame = -3

Query  1011  PDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLA  832
             PD     + +  + T+  T+SEI+ A +  S+    +P+    +  A+  C++L   +  
Sbjct  39    PDCTTSQL-DTFATTLKTTLSEIQKALSLLSKFTEFIPNF--RQRTAIQDCVDLLDLSSD  95

Query  831   DLRTVLDGLENS-------PA--KRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIK  679
             +L   L    NS       PA  +R  D+ T LS A+ NQ TCL+GF  ++  V+  I+ 
Sbjct  96    ELTWTLSQTPNSGVSRPVFPATGRRKNDVATWLSAALGNQDTCLDGFEGTDGVVKELILG  155

Query  678   RVEQISRHVSNALSMLTKIKK-EKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDR  502
              + Q++  V   L M+ +I      KP +  G   ++   R     +  GFP W   +DR
Sbjct  156   SLVQVTGLVGEILGMVKQIATVPLGKPLSGAGKQLATEGRR-----LMGGFPSWFPSKDR  210

Query  501   ALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVD  322
              LL+ P G     +  + TVA DG+G++ ++  A++AAPD S+ RYVI++K G Y E V+
Sbjct  211   RLLQIPVGG----VAVNATVAADGTGNYTTVTDAITAAPDHSEQRYVIYVKKGVYNENVE  266

Query  321   VDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEK  142
             V KKKT IM +GDG   T I GNRN  DGW TFRSAT AV G GFIA GI+FENSAGPEK
Sbjct  267   VKKKKTNIMLLGDGKDVTVITGNRNFVDGWTTFRSATFAVSGNGFIARGITFENSAGPEK  326

Query  141   HQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             HQAVA R DSD S FY C F G+QDTLY HS RQF+R+CD++GTVDF
Sbjct  327   HQAVAARVDSDLSAFYQCSFKGFQDTLYAHSLRQFYRDCDIFGTVDF  373



>emb|CAC01624.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=579

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 165/416 (40%), Positives = 236/416 (57%), Gaps = 37/416 (9%)
 Frame = -3

Query  1191  LGRNPIMLVP---VVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTL  1021
             L +N  +L+     + L A ++  V   ++     ++  H V  SAC  +LY +LC S +
Sbjct  21    LKKNKRLLLASFAALFLVATIAAVVAGVNSHKNGENEGAHAVLKSACSSTLYPELCYSAI  80

Query  1020  VKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPD--LGTMESRALYVCLE  853
                P +     S+ ++I  ++N+T    KT   N   + +++    L   E  AL+ CLE
Sbjct  81    ATVPGVTGNLASLKDVIELSINLTT---KTVQQNYFTVEKLIAKTKLTKREKTALHDCLE  137

Query  852   LFSDTLADLRTVLDGLENSPAKR----YAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVR  694
                +TL +L      +   P K+     AD L TLLS+A+TNQ TCL+GF +  ++K VR
Sbjct  138   TIDETLDELHEAQVDISGYPNKKSLKEQADNLITLLSSAITNQETCLDGFSHDGADKKVR  197

Query  693   PFIIKRVEQISRHVSNALSML-----TKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGF  529
               ++K    + +  SNAL+M+     T I  E            ++   ++E    +  +
Sbjct  198   KALLKGQTHVEKMCSNALAMIKNMTDTDIANELQN---------TNRKLKEEKEGNERVW  248

Query  528   PKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIK  349
             P+W+S  DR LL++ +      +  +V VA DGSGD+K+++ A++AAP  S  RY+I IK
Sbjct  249   PEWMSVADRRLLQSSS------VTPNVVVAADGSGDYKTVSEAVAAAPKKSSKRYIIQIK  302

Query  348   AGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGIS  169
             AG Y E V+V K K  IMF+GDG   T I  +RNV DG  TF+SATVA VG GF+A G++
Sbjct  303   AGVYRENVEVPKDKHNIMFLGDGRKTTIITASRNVVDGSTTFKSATVAAVGQGFLARGVT  362

Query  168   FENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FEN+AGP KHQAVALR  SD S FY+C  + YQDTLYVHS RQFF  C V GTVDF
Sbjct  363   FENTAGPSKHQAVALRVGSDLSAFYECDMLAYQDTLYVHSNRQFFINCFVAGTVDF  418



>ref|XP_006388348.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
 gb|ERP47262.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
Length=579

 Score =   271 bits (692),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 157/381 (41%), Positives = 225/381 (59%), Gaps = 34/381 (9%)
 Frame = -3

Query  1095  SDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANC  922
             ++  H +  SAC  +LY +LC S +   P + +   S+ ++I  ++N+T    KT   N 
Sbjct  56    NEGAHAILKSACSSTLYPELCYSAIATVPGVTSNLASLKDVIELSINLTT---KTVQQNY  112

Query  921   SRIRRVVPD--LGTMESRALYVCLELFSDTLADLRTV---LDGLENSPA-KRYAD-LQTL  763
               + +++    L   E  AL+ CLE   +TL +L      ++G  N  + K  AD L+TL
Sbjct  113   FTVEKLIAKTKLTKREKTALHDCLETIDETLDELHEAQVDINGYPNKKSLKEQADNLKTL  172

Query  762   LSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSML-----TKIKKEKNK  604
             LS+A+TNQ TCL+GF +  ++K VR  ++K    + +  SNAL+M+     T I  E   
Sbjct  173   LSSAITNQETCLDGFSHDGADKKVRKALLKGQTHVEKMCSNALAMIRNMTDTDIANELQN  232

Query  603   PSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSG  424
                      ++   ++E    +  +P+W+S  DR LL++ +      +  +V VA DGSG
Sbjct  233   ---------TNRKLKEEKEGNERVWPEWMSVADRRLLQSSS------VTPNVVVAADGSG  277

Query  423   DFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNV  244
             D+K+++ A++A P  S TRYVI IKAG Y E V+V K K  +MF+GDG   T I  +RNV
Sbjct  278   DYKTVSEAVAAVPKKSSTRYVIQIKAGVYRENVEVPKDKHNVMFLGDGRKTTIITASRNV  337

Query  243   KDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDT  64
              DG  TF+SATVA VG GF+A G++FEN+AGP KHQAVALR  SD S FY+C  + YQDT
Sbjct  338   VDGSTTFKSATVAAVGQGFLARGVTFENTAGPSKHQAVALRVGSDLSAFYECDMLAYQDT  397

Query  63    LYVHSRRQFFRECDVYGTVDF  1
             LY HS RQFF  C + GTVDF
Sbjct  398   LYAHSNRQFFINCLIAGTVDF  418



>ref|XP_009776000.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nicotiana sylvestris]
Length=598

 Score =   271 bits (693),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 159/408 (39%), Positives = 229/408 (56%), Gaps = 26/408 (6%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTS-DDIHQVAHSACDRSLYRDLCVSTLVKTPDLR  1000
             I++  V+L+A+ +S+ V      N+    D   Q     C R+LY  LC+++L+  P  +
Sbjct  38    IIVATVLLIASVISVAVLVGVRKNSGNRIDKPSQAMARTCSRTLYPSLCLNSLINYPGAK  97

Query  999   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRT  820
             + S  +++  +VN+T+     A    S I  +  ++ T    A   CLEL  +++  L  
Sbjct  98    SASDSDLVHISVNLTLQRFGKALYISSDINNL--EMNTHIRSAYDDCLELLEESVDLLSH  155

Query  819   VL------DGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISR  658
              L      DG  NSPA    D+ T LS A+TNQ TC + F     NV+  + + ++ +S 
Sbjct  156   SLNSVFPGDGGGNSPAGSTQDVMTWLSAALTNQDTCTDSFADVTGNVKDQMSENLKDLSE  215

Query  657   HVSNALSMLTKIKKE--------KNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDR  502
              VSNAL++      +        +N+   L    ++      EH    D FPKWLSRRDR
Sbjct  216   LVSNALAIYAAANGDDDFSGIPIQNRRRRLMELEHNDVPTTNEH----DDFPKWLSRRDR  271

Query  501   ALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYV-  325
              LL     K    I+AD+ VAKDGSG  K+I  A+   P+ S+ R +I++KAG Y E + 
Sbjct  272   KLLN----KSVSAIQADIIVAKDGSGTVKTIAEAIKKVPEKSNRRTIIYVKAGRYEENIL  327

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPE  145
              V +KK  +MF+GDG GKT I G ++V     TF +A+ A  G GF+A  ++FEN AGP 
Sbjct  328   KVGRKKMNVMFIGDGKGKTVITGGKSVSQNITTFHTASFAATGAGFVARDMTFENYAGPS  387

Query  144   KHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KHQAVALR   D++V + C  +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  388   KHQAVALRIGGDHAVVFRCNIIGYQDTLYVHSQRQFYRECDIYGTVDF  435



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score =   270 bits (691),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 173/408 (42%), Positives = 233/408 (57%), Gaps = 27/408 (7%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDI------HQVAHSACDRSLYRDLCVSTLVK  1015
             I LV  +LL   L        + N  + DD       H +  S+C  +LY DLC STL  
Sbjct  30    IALVAAILLVGALIGIATGVKSQNKNSGDDSEASAASHAILKSSCSSTLYPDLCFSTLA-  88

Query  1014  TPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSD  841
              P    K  S  ++I  ++N+T + ++       ++ +    L   E  AL+ CLE   +
Sbjct  89    APGAAKKVSSQKDVIELSLNITTTAVEHNFFAVKKLLKSRKKLTKREKVALHDCLENIDE  148

Query  840   TLADLRTVLDGLENSPAKR-----YAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVRPFI  685
             TL +L   +  L   P K+     YAD L+TL+S+A+TNQ TCL+GF +  ++K VR  +
Sbjct  149   TLDELHAAVADLHEYPNKKKSLTQYADDLKTLISSAITNQETCLDGFSHDDADKKVRKVL  208

Query  684   IKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRD  505
              K    + +  SNAL+M   I+   +   A       +   ++E  E K G+P+WLS  D
Sbjct  209   EKGQVHVEQLCSNALAM---IRNMTDNDIANASKMNVNRKLKEEVVEEK-GWPEWLSVAD  264

Query  504   RALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYV  325
             R LL++ T      +  +V VA DGSG++K+++ A++AAP+ S TRYVI IKAG Y E V
Sbjct  265   RRLLQSST------VTPNVVVAADGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGVYRENV  318

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPE  145
             DV KKKT IMF+GDG   T I  +RNV DG  TF SATVA VG  FIA  I+F+N+AGP 
Sbjct  319   DVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFNSATVAAVGEKFIARDITFQNTAGPS  378

Query  144   KHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KHQAVALR  SD S FY    + YQD+LYVHS RQFF  C V GTVDF
Sbjct  379   KHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDF  426



>emb|CDX75765.1| BnaC03g38480D [Brassica napus]
Length=479

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 159/378 (42%), Positives = 222/378 (59%), Gaps = 31/378 (8%)
 Frame = -3

Query  1068  SACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLG  889
             SAC  + Y +LC+STL  +  ++  S  ++I A++N+T + ++       ++ +    L 
Sbjct  52    SACSSTRYPELCISTLATSGGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  111

Query  888   TMESRALYVCLELFSDTLADLRTVLDGLENSPAKR-----YADLQTLLSTAMTNQYTCLE  724
               E  AL+ CLE   +TL +L   ++ L+  P K+       DL+TL+S+A+TNQ TCL+
Sbjct  112   PREKTALHDCLETIDETLDELHEAVEDLQLYPNKKSLREHAGDLKTLISSAITNQETCLD  171

Query  723   GFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH  550
             GF +  ++K +R  ++K    +    SNAL+M   IK   +   A F      +S  ++ 
Sbjct  172   GFSHDRADKKIRKALLKGQMHVEYMCSNALAM---IKNMTDTDIANFELKAKLTSNNRKL  228

Query  549   GEMK---------------DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFK  415
              E +               +G+P WLS  DR LL+  T      ++AD TVA DGSG F 
Sbjct  229   KEEETTVAVDIAGTRELDAEGWPTWLSAGDRGLLQGST------VEADATVAADGSGTFT  282

Query  414   SINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDG  235
             ++ AA+ AAP++S+ RYVIHIKAG Y E V+V KKK  IMF+GDG   T I  +RNV DG
Sbjct  283   TVAAAVVAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTTTIITASRNVVDG  342

Query  234   WPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYV  55
               TF SATVA V   F+A  I+F+N+AGP KHQAVALR  SD+S FY C  + YQDTLYV
Sbjct  343   STTFHSATVAAVDERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYV  402

Query  54    HSRRQFFRECDVYGTVDF  1
             HS RQFF  C + GTVDF
Sbjct  403   HSNRQFFVNCLIAGTVDF  420



>ref|XP_011048630.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=579

 Score =   269 bits (687),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 163/418 (39%), Positives = 240/418 (57%), Gaps = 41/418 (10%)
 Frame = -3

Query  1191  LGRNPIMLVPVVLLAAFLSLTVFQSSAMNATT-----SDDIHQVAHSACDRSLYRDLCVS  1027
             L +N  +L+  V  AAF  +    + A    +     ++  H +  SAC  +LY +LC S
Sbjct  21    LKKNKRLLL--VSFAAFFLVATIAAVATGVNSHKNGKNEGAHAILKSACSSTLYPELCYS  78

Query  1026  TLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPD--LGTMESRALYVC  859
              +   P + +   S+ ++I  ++N+T    KT   N   + +++    L   E  AL+ C
Sbjct  79    AIATVPGVTSNLASLRDVIELSINLTT---KTVQQNFFTVEKLIAKTKLTKREKTALHDC  135

Query  858   LELFSDTLADLRTVLDGLENSPAKR----YAD-LQTLLSTAMTNQYTCLEGFPY--SNKN  700
             LE   +TL +L      +   P K+     AD L TLLS+A+TNQ TCL+GF +  ++K 
Sbjct  136   LETIDETLDELHEAQVDIIGYPNKKSLKEQADNLITLLSSAITNQETCLDGFSHDGADKK  195

Query  699   VRPFIIKRVEQISRHVSNALSML-----TKIKKEKNKPSALFGPSYSSSSFRQEHGEMKD  535
             VR  ++K    + +  SNAL+M+     T I  +  K         ++   ++E    + 
Sbjct  196   VREALLKGQTHVEKMCSNALAMIKNMTDTDIANKLQK---------TNRKLKEEKEGNER  246

Query  534   GFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIH  355
              +P+W+S  DR LL++ +      +  +V VA DGSGD+++++ A++AAP+ S TRY+I 
Sbjct  247   VWPEWMSVADRRLLQSSS------VTPNVVVAADGSGDYETVSEAVAAAPNKSSTRYIIQ  300

Query  354   IKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIG  175
             IKAG Y E V+V K K  IMF+G+G   T I  +RNV DG  TF+SATVA VG GF+A G
Sbjct  301   IKAGVYRENVEVPKNKHNIMFLGEGRNTTIITASRNVVDGSTTFKSATVAAVGQGFLARG  360

Query  174   ISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ++F+N+AGP KHQAVALR  SD S FY+C  + YQDTLYVHS RQFF  C + GTVDF
Sbjct  361   VTFQNTAGPSKHQAVALRVGSDLSAFYECDMLAYQDTLYVHSNRQFFINCLIAGTVDF  418



>emb|CDY39109.1| BnaA01g29470D [Brassica napus]
Length=558

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 214/368 (58%), Gaps = 35/368 (10%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             H V  SAC  +LY +LC+S +  +  ++  S  ++I A++N+T   ++       ++ + 
Sbjct  58    HAVLRSACSSTLYPELCISAVATSGGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKN  117

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLSTAMTNQ  739
                L   E  AL+ CLE   +TL +L   L+ L+  P K+       DL+TL+S+A+TNQ
Sbjct  118   RKGLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQ  177

Query  738   YTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSS  565
              TCL+GF +  ++K VR  ++K    +    SNAL+M   IK   +   A F     + S
Sbjct  178   ETCLDGFSHDDADKKVRKVLLKGQVHVEHMCSNALAM---IKNMTDTDIANF--ELKAKS  232

Query  564   FRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAP  385
             F   H E   G+P WLS  DR LL+                     G FK+I AA++AAP
Sbjct  233   FSNNHAE---GWPTWLSAGDRRLLQG--------------------GKFKTIAAAVAAAP  269

Query  384   DSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVA  205
             D+   RYVIHIKAG Y E V+V KKK  IMF+GDG  +T I GNRNV DG  TF SATVA
Sbjct  270   DNGKRRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVA  329

Query  204   VVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFREC  25
              VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C  + YQDTLYVHS RQ+F +C
Sbjct  330   AVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQYFVKC  389

Query  24    DVYGTVDF  1
              + GTVDF
Sbjct  390   LIAGTVDF  397



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score =   268 bits (686),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 171/408 (42%), Positives = 234/408 (57%), Gaps = 27/408 (7%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDI------HQVAHSACDRSLYRDLCVSTLVK  1015
             I LV  +LL   +   V    + N  + +D       H +  S+C  +LY DLC STL  
Sbjct  30    IALVAAILLVGAVIGIVTGVKSQNKNSGEDSEASAASHAILKSSCSSTLYPDLCFSTLA-  88

Query  1014  TPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSD  841
              P    K  S  ++I  ++N+T + +        ++ +    L   E  AL+ CLE   +
Sbjct  89    APGAAKKVSSQKDVIELSLNITTTAVGHNFFAVKKLLKSRKKLTKREKVALHDCLENIDE  148

Query  840   TLADLRTVLDGL-----ENSPAKRYAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVRPFI  685
             TL +L   +  L     +N P  +YAD L+TL+S+A+TNQ TCL+GF +  ++K VR  +
Sbjct  149   TLDELHAAVADLHEYPNKNKPLTQYADDLKTLISSAITNQETCLDGFSHDDADKKVRKVL  208

Query  684   IKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRD  505
              K    + +  SNAL+M   I+   +   A       +   ++E  E K G+P+WLS  D
Sbjct  209   EKGQVHVEQLCSNALAM---IRNMTDNDIANASKMNVNRKLKEEVVEEK-GWPEWLSVAD  264

Query  504   RALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYV  325
             R LL++ T      +  +V VA DGSG++K+++ A++AAP+ S TRYVI IKAG Y E V
Sbjct  265   RRLLQSST------VTPNVVVAADGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGVYRENV  318

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPE  145
             DV KKKT IMF+GDG   T I  +RNV DG  TF SATVA VG  F+A  I+F+N+AGP 
Sbjct  319   DVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFNSATVAAVGEKFLARDITFQNTAGPS  378

Query  144   KHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KHQAVALR  SD S FY    + YQD+LYVHS RQFF  C V GTVDF
Sbjct  379   KHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDF  426



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   268 bits (684),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 162/370 (44%), Positives = 218/370 (59%), Gaps = 16/370 (4%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  S+C  +LY +LC S +       AK     ++I A +N T++ ++        I 
Sbjct  55    HPIVKSSCSATLYPELCFSAVSSREGEEAKITKPKDVIEAVLNFTITTVQHNYFTLQHII  114

Query  909   RVVPDLGTMESRALYVCLELFSDTLADL-RTVLD----GLENSPAKRYADLQTLLSTAMT  745
             +    L   E  AL+ CLE+  DTL +L ++ LD     L  S +++  DL TLLS AMT
Sbjct  115   KTRLGLSPREKAALHDCLEMVDDTLDELHKSALDLQDYSLNKSISQQADDLITLLSAAMT  174

Query  744   NQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSS  571
             NQ TC++GF +  ++K +R  ++    Q  R  SN L+M+  +  + +  +A        
Sbjct  175   NQETCIDGFSHDGADKKIRKGLMDGQMQAFRLCSNVLAMIKNLT-DTDMAAAASAAGRQL  233

Query  570   SSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
                 +E       +P+WLS  DR LL+A T      + ADVTVA DGSG++K++  A+++
Sbjct  234   REEEEEATATAIEWPEWLSAGDRRLLQAST------VTADVTVAADGSGNYKTVGEAVAS  287

Query  390   APDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSAT  211
             AP+ S  RY+I IKAG Y E V+V KKKT IMFVGDG   T I  +RNV DG  TF SAT
Sbjct  288   APERSSKRYIIRIKAGVYKENVEVPKKKTNIMFVGDGRTNTIITASRNVVDGSTTFHSAT  347

Query  210   VAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFR  31
             VAVVG GF+A  I+F+N+AGP KHQAVALR  SD S FY C  + YQDTLYVHS RQFF 
Sbjct  348   VAVVGDGFLARDITFQNTAGPSKHQAVALRVGSDLSAFYRCDVLAYQDTLYVHSLRQFFV  407

Query  30    ECDVYGTVDF  1
              C V GTVDF
Sbjct  408   GCLVAGTVDF  417



>emb|CDY60700.1| BnaA01g37100D [Brassica napus]
Length=556

 Score =   267 bits (682),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 162/369 (44%), Positives = 219/369 (59%), Gaps = 39/369 (11%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             H V  SAC  +LY +LC+S +  +  ++  S  ++I A++N+T + ++       ++ + 
Sbjct  58    HAVLRSACSSTLYPELCISAVATSGGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKN  117

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLSTAMTNQ  739
             +  L   E  AL+ CLE   +TL +L   L+ L+  P K+       DL+TL+S+A+TNQ
Sbjct  118   MKGLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQ  177

Query  738   YTCLEGFPY--SNKNVRPFIIKRVEQISRHV-SNALSMLTKIKKEKNKPSALFGPSYSSS  568
              TCL+GF +  ++K VR F++K      +H+ SNAL+M   IK   +   A F      S
Sbjct  178   ETCLDGFSHDDADKKVRKFLLK-----GQHMCSNALAM---IKNMTDTDIANFELKAKLS  229

Query  567   SFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAA  388
             S  Q   +   G+P WLS  DR LL+                     G FK+I AA++AA
Sbjct  230   SNNQLDAK---GWPTWLSAGDRRLLQG--------------------GKFKTIAAAVAAA  266

Query  387   PDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATV  208
             PD+S  RYVIHIKAG Y E V+V KKK  IMF+GDG  +T I GNRNV DG  TF SATV
Sbjct  267   PDNSKRRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATV  326

Query  207   AVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRE  28
             A VG  F+A  I+F+N+AGP KHQAVALR  SD+S FY C  + YQDTLYVHS RQFF +
Sbjct  327   AAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVK  386

Query  27    CDVYGTVDF  1
             C + GTVDF
Sbjct  387   CLIAGTVDF  395



>ref|XP_010910828.1| PREDICTED: pectinesterase 3-like [Elaeis guineensis]
Length=338

 Score =   259 bits (663),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 194/300 (65%), Gaps = 25/300 (8%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSR-IRRV  904
             Q A   CD +LY DLCVSTL   P+L +KS+P++I+A VN T ++++ +A+NCS  +RR 
Sbjct  48    QAAARHCDGTLYPDLCVSTLADIPNLTSKSLPDVIAAVVNRTANDVRFSASNCSSYLRR-  106

Query  903   VPDLGTMESR---ALYVCLELFSDTLADLRTVLDGLENSPAKRY-ADLQTLLSTAMTNQY  736
                 G M+SR   AL  CLEL   TL DLRT    L    A  + +D+QT+LS AMTNQY
Sbjct  107   ---RGYMDSRQRLALNDCLELLDQTLDDLRTAAADLTCGNASVHVSDIQTVLSAAMTNQY  163

Query  735   TCLEGFPYSNKN-VRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFR  559
             TCL+GF Y N   VRP I  R+  +S  VSN+L+M+ KI++      A  G         
Sbjct  164   TCLDGFAYVNGGGVRPSIEGRLNHVSHLVSNSLAMVKKIRRRWRGREAFEG---------  214

Query  558   QEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDS  379
               +GE+  GFP W+SR+DR LL+A           ++ VAKDGSG+F +I  A++AAP++
Sbjct  215   --YGEVAGGFPTWVSRKDRRLLQAAANA----TSPNLVVAKDGSGNFTTIGPAVAAAPNN  268

Query  378   SDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVV  199
             S TR+VI+IKAG+Y+E VDV K K  +MF+GDGIGKT +K +RNV DGW TFRSATV  +
Sbjct  269   SATRFVIYIKAGAYFENVDVAKNKKNLMFIGDGIGKTVVKASRNVVDGWTTFRSATVGTL  328



>ref|XP_011084508.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Sesamum indicum]
Length=593

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/373 (41%), Positives = 219/373 (59%), Gaps = 30/373 (8%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             Q    AC R+LY  LC+++L+  P     S  E++  +VN+T+ ++  A  + S IR + 
Sbjct  75    QAMSRACSRTLYPSLCLNSLLDFPGAITASDGELVHISVNMTLQKVGRALFSASEIRNL-  133

Query  900   PDLGTMESRALYVCLELFSDTL----ADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYT  733
              D+      A   CLEL  D++      L +V+ G   +PA    D+ T LS ++TNQ T
Sbjct  134   -DMDPRVRSAYMDCLELLDDSVDLLSRSLTSVVPG--GAPAGSTQDVLTWLSASLTNQDT  190

Query  732   CLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEK--------NKPSALFGPSY  577
             C EGF   N  V+  +  R++ +S  VSN L++      ++        N+   L     
Sbjct  191   CNEGFDELNGFVKSQMSDRLKDLSELVSNCLAIYAAAGGDRDFSGIPIQNRRRRLL----  246

Query  576   SSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAAL  397
                S ++EH       P WLSRR+R LL+ P       I AD+ V+KDG+G +K+I  A+
Sbjct  247   ---SHKKEHEPFP--LPIWLSRRERVLLDMPVSA----INADIIVSKDGNGSYKTIAEAI  297

Query  396   SAAPDSSDTRYVIHIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFR  220
               AP+ S+ R++I+++AG Y E  + V +KKT IMF+GDG GKT I G ++V+D   TF 
Sbjct  298   KKAPEHSNRRFIIYVRAGRYEEDNLKVGRKKTNIMFIGDGKGKTVISGGKSVQDKLTTFH  357

Query  219   SATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQ  40
             +A+ A  G GFIA  I+FEN AGP KHQAVALR  +D++V Y C  +GYQDTLY HS+RQ
Sbjct  358   TASFAATGAGFIARDITFENWAGPSKHQAVALRVGADHAVVYRCNVIGYQDTLYTHSQRQ  417

Query  39    FFRECDVYGTVDF  1
             F+RECD+YGTVDF
Sbjct  418   FYRECDIYGTVDF  430



>ref|NP_001042866.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAD45460.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04780.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAG97493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 182/268 (68%), Gaps = 16/268 (6%)
 Frame = -3

Query  768  TLLSTAMTNQYTCLEGFPYSN-KNVRPFIIKRVEQISRHVSNALSMLTKIKK--------  616
            T LS AMTNQYTCL+GF Y + + VR ++   +  +SR VSN+L+M  K+          
Sbjct  2    TELSAAMTNQYTCLDGFDYKDGERVRHYMESSIHHVSRMVSNSLAMAKKLPGAGGGGMTP  61

Query  615  EKNKPSALFGPSYSSSSFRQE---HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVT  445
              + P        S ++ RQ    +G+M +GFPKW+   DR LL+AP       I  D  
Sbjct  62   SSSSPDTATQSESSETTQRQPFMGYGQMANGFPKWVRPGDRRLLQAPA----SSITPDAV  117

Query  444  VAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTR  265
            VAKDGSG + +++AA++AAP +S+ RYVIHIKAG+Y E V+V K K  +MF+GDGIGKT 
Sbjct  118  VAKDGSGGYTTVSAAVAAAPANSNKRYVIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTV  177

Query  264  IKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCR  85
            IK +RNV DG  TFRSATVAVVG  F+A  ++ ENSAGP KHQAVALR  +D S FY C 
Sbjct  178  IKASRNVVDGSTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCS  237

Query  84   FVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            FVGYQDTLYVHS RQFFRECD+YGT+DF
Sbjct  238  FVGYQDTLYVHSLRQFFRECDIYGTIDF  265



>ref|XP_002532944.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF29428.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=577

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 161/405 (40%), Positives = 237/405 (59%), Gaps = 28/405 (7%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAK  994
             +   V+++A   ++    +S    TT+   H +  S+C  + Y DLC S +   P   +K
Sbjct  31    LFASVLIIATVTAIVTGVNSNKKDTTASPSHSILKSSCSTTRYPDLCFSAVASAPGATSK  90

Query  993   --SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRT  820
               S+ ++I  ++N+T + ++       ++ +    L   E  AL+ CLE   +TL +L  
Sbjct  91    LVSLKDVIEVSLNLTTTAVEHNFFTVEKLAKR-KGLTKREKTALHDCLETIDETLDELHK  149

Query  819   VLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQIS  661
              +D L+  P K+       DL+TLLS+A+TNQ TCL+GF +  ++K++R  ++     + 
Sbjct  150   AMDDLKEYPNKKSLSQHADDLKTLLSSAITNQETCLDGFSHDGADKHIREALLAGQVHVE  209

Query  660   RHVSNALSML-----TKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRAL  496
             +  SNAL+M+     T I  E          S S +   +E  + +  +P+WLS  DR L
Sbjct  210   KMCSNALAMIKNMTDTDIANE-------LKLSGSKNRKLKEEKDQESVWPEWLSAGDRRL  262

Query  495   LEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVD  316
             L++ +      +  +V VA DGSGD+K+++AA++AAP  S  RY+I IKAG Y E V+V 
Sbjct  263   LQSSS------VTPNVVVAADGSGDYKTVSAAVAAAPSKSSKRYIIRIKAGVYKENVEVP  316

Query  315   KKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQ  136
             K KT +MF+GDG   T I G+RNV DG  TF SATVA VG GF+A G++FEN AGP KHQ
Sbjct  317   KGKTNLMFLGDGRKTTIITGSRNVVDGSTTFNSATVAAVGQGFLARGVTFENKAGPSKHQ  376

Query  135   AVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR  +D + FY+C  + YQDTLYVHS RQFF  C + GTVDF
Sbjct  377   AVALRVGADLAAFYECDMIAYQDTLYVHSNRQFFINCYIAGTVDF  421



>ref|XP_010422610.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40 
[Camelina sativa]
Length=523

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 207/343 (60%), Gaps = 37/343 (11%)
 Frame = -3

Query  984  EIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMESRALYVCLELFSDTLADLRTVLDG  808
            E++ A +N T+S++  +++N S +  R+  +L   +  A   CL+L  DT+ DL   +  
Sbjct  42   ELLVAALNQTISKVNLSSSNFSDLLNRLGSNLSHRDRCAFDDCLQLLDDTVFDLTAAISE  101

Query  807  LENSPAKRYADLQTLLSTAMTNQYTCLEGFPYS----------NKNVRPFIIKRVEQ---  667
            L  S +    +++ LLS  MTN  TCL+GF  S          N N    + + +++   
Sbjct  102  LR-SHSPEIHNVKMLLSATMTNTRTCLDGFASSDDEEEDDLNYNNNKTYGVAESLKESLF  160

Query  666  -ISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLE  490
             IS HV N+L ML  I    N P  L               E   GFP W+S  DR LL+
Sbjct  161  DISSHVRNSLDMLEDIPG--NIPGKL---------------EEDVGFPMWVSGSDRNLLQ  203

Query  489  APTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKK  310
             P  +     K D+ VA++G+G++ +I  A+SAAP+SSDTR+VI+IK+G Y+E +++ ++
Sbjct  204  DPVDE----TKVDLVVAQNGTGNYTTIGEAVSAAPNSSDTRFVIYIKSGVYFENIEILRE  259

Query  309  KTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
            KTMIMFVGDGIG T IK NR+  DGW  + SATV V G+GFIA  +SF N AGP KHQAV
Sbjct  260  KTMIMFVGDGIGLTVIKANRSYGDGWTAYFSATVGVRGSGFIAKDLSFVNDAGPAKHQAV  319

Query  129  ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            ALR+ SD S FY C F  YQDT+Y HS +QF+RECD+YGTVDF
Sbjct  320  ALRSSSDLSAFYRCSFESYQDTIYAHSHKQFYRECDIYGTVDF  362



>ref|XP_003528739.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=598

 Score =   266 bits (681),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 158/376 (42%), Positives = 219/376 (58%), Gaps = 23/376 (6%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  SAC  + Y +LC S +   P++  K  +  ++I  ++ +T   ++       ++ 
Sbjct  70    HTIVKSACSSTFYPELCYSAIASEPNVTHKITTNRDVIQLSLKITFRAVEQNYFTVKKLF  129

Query  909   RVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTAMT  745
                 DL   E  AL+ CLE   +TL +LR     LE  P K+       DL+TL+S A+T
Sbjct  130   TEHDDLTKREKTALHDCLETIDETLDELREAQHNLELYPNKKTLYQHADDLKTLISAAIT  189

Query  744   NQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKK------EKNKPSALF  589
             NQ TCL+GF +  ++K+VR  + K    +    SNAL+M   +        E N      
Sbjct  190   NQVTCLDGFSHDDADKHVRKALEKGQVHVEHMCSNALAMTKNMTDSDIANYEYNMRVENN  249

Query  588   GPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSI  409
             G + +S+  R+   E    +P+W+S  DR LL+A T      +KADVTVA DGSGDFK++
Sbjct  250   GQNGNSN--RKLLVENDVEWPEWISAADRRLLQAST------VKADVTVAADGSGDFKTV  301

Query  408   NAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWP  229
               A+ AAP  S  R+VI IKAG Y E V+V KKK  IMF+GDG   T I  +RNV DG  
Sbjct  302   TEAVDAAPLKSSKRFVIRIKAGVYRENVEVPKKKNNIMFLGDGRTNTIITASRNVVDGST  361

Query  228   TFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHS  49
             TF SATVAVVG+ F+A  ++F+N+AGP KHQAVALR   D S F++C  + +QDTLYVH+
Sbjct  362   TFHSATVAVVGSNFLARDLTFQNTAGPSKHQAVALRVGGDLSAFFNCDILAFQDTLYVHN  421

Query  48    RRQFFRECDVYGTVDF  1
              RQFF +C + GTVDF
Sbjct  422   NRQFFVKCLIAGTVDF  437



>ref|NP_001275859.1| pectinesterase 1 precursor [Citrus sinensis]
 ref|XP_006426800.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
 gb|AAB57670.1| pectinesterase [Citrus sinensis]
 gb|ESR40040.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
Length=584

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 157/372 (42%), Positives = 223/372 (60%), Gaps = 25/372 (7%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  S+C  + Y DLC S +   P+   K  S  ++I  ++N+T + ++    N   I+
Sbjct  66    HAILKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVE---HNYFGIQ  122

Query  909   RVVP--DLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTA  751
             +++   +L   E  AL+ CLE   +TL +L   ++ LE  P K+       DL+TL+S A
Sbjct  123   KLLKRTNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAA  182

Query  750   MTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSY  577
             MTNQ TCL+GF +  +NK+VR  +      + +  SNAL+M+    K       +   + 
Sbjct  183   MTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMI----KNMTDTDMMIMRTS  238

Query  576   SSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAAL  397
             ++    +E   + DG+P WLS  DR LL++ +      +  +  VA DGSG+FK++ AA+
Sbjct  239   NNRKLTEETSTV-DGWPAWLSPGDRRLLQSSS------VTPNAVVAADGSGNFKTVAAAV  291

Query  396   SAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRS  217
             +AAP     RY+I IKAG Y E V+V KK   IMF+GDG  +T I G+RNV DG  TF+S
Sbjct  292   AAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKS  351

Query  216   ATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQF  37
             ATVAVVG GF+A  I+F+N+AGP KHQAVALR  +D S FY+C  + YQDTLYVHS RQF
Sbjct  352   ATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQF  411

Query  36    FRECDVYGTVDF  1
             F  C + GTVDF
Sbjct  412   FVNCLIAGTVDF  423



>ref|XP_010466998.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39 
[Camelina sativa]
Length=413

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 182/263 (69%), Gaps = 20/263 (8%)
 Frame = -3

Query  765  LLSTAMTNQYTCLEGFP----YSNKNVRPFIIKRVEQ----ISRHVSNALSMLTKIKKEK  610
            LLS AMTNQ TCL+GF      +N ++   + K +++    IS ++SN+L ML ++   K
Sbjct  2    LLSNAMTNQDTCLDGFSKCGNETNNDMSVELPKNLKESILNISNNLSNSLYML-QVMSRK  60

Query  609  NKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDG  430
            N       PS  SS    E+         W+S  D+ LL+AP     ++I  +++VAKDG
Sbjct  61   N-------PSRESSDVHVEYPGCTTRKQCWVSEFDQRLLQAPV----QEISFNLSVAKDG  109

Query  429  SGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNR  250
            +GDF +I+AA+SAAP+SS+TR++I+IK G Y+E V+V KK TMIMFVGDGIGKT IK NR
Sbjct  110  TGDFTTISAAVSAAPNSSETRFIIYIKGGEYFENVEVPKKTTMIMFVGDGIGKTVIKANR  169

Query  249  NVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQ  70
            N  DGWPTF++ATV V G GFIA  I+F N AGP+K QAVA R+ SD+S FY C F GYQ
Sbjct  170  NCVDGWPTFQTATVGVKGKGFIAKDITFVNFAGPDKKQAVAFRSGSDHSAFYRCAFYGYQ  229

Query  69   DTLYVHSRRQFFRECDVYGTVDF  1
            DTLYVH+ RQF+RECD+YGT+DF
Sbjct  230  DTLYVHTARQFYRECDIYGTIDF  252



>ref|XP_011078159.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
Length=567

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 172/408 (42%), Positives = 232/408 (57%), Gaps = 37/408 (9%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATTSDDIH------QVAHSACDRSLYRDLCVSTL---VKTP  1009
             + LL AF SL V    ++    S   H       V  + C  +LY  LCVST+       
Sbjct  15    IFLLTAFASLLVVAVISIAVVQSHKNHPNHGGDAVVKTTCAATLYPKLCVSTINAAATAA  74

Query  1008  DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLAD  829
              +  KS  +++   +N T+S ++       ++ R    L T E  AL+ CLE+  DTL +
Sbjct  75    SVAIKSSKDVLITALNYTISTVERNYFTVKKLGRSRKSLTTREKGALHDCLEMIDDTLDE  134

Query  828   LRTVLDGLENSPAKRYA------DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRV  673
             LR     L++   K Y+      +L  LLS A TNQ +CL+GF +  ++K VR  ++   
Sbjct  135   LRRSAAELKDFGFKNYSLADHKENLMILLSAAQTNQESCLDGFSHDKADKVVRRALVVGQ  194

Query  672   EQISRHVSNALSM---LTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDG-FPKWLSRRD  505
               + R VSN +++   LT  +  KN        SYSS   R   GE  +  +P+WLS  D
Sbjct  195   MHVFRLVSNVMAIIKNLTDTEMAKN--------SYSSPERRL--GENTNSEWPEWLSAGD  244

Query  504   RALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYV  325
             R LL+A T      +  DVTVA DGSG+F++++AA++AAP  S  RYVI IKAG Y E V
Sbjct  245   RRLLQAST------VTPDVTVAADGSGNFRTVSAAVAAAPGGSSRRYVIRIKAGVYRENV  298

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPE  145
             ++ + KT +MFVGDG   T I GNRNV DG  TF SATVAVVG  F+A  I+F+N+AGP 
Sbjct  299   EIPRSKTNLMFVGDGRTTTIITGNRNVVDGSTTFNSATVAVVGDRFLARDITFQNTAGPS  358

Query  144   KHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KHQAVALR ++D   FY C  + YQDTLYVHS RQF+  C + GTVDF
Sbjct  359   KHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDF  406



>ref|XP_006360163.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Solanum tuberosum]
Length=595

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 158/406 (39%), Positives = 227/406 (56%), Gaps = 31/406 (8%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSD-DIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             +L+    ++A + +TV  ++   AT       Q     C R+ +  LC+++L + P    
Sbjct  43    ILIIASAISAAVVVTVRSTTKTGATVRHIKPSQAISRTCSRTRFPTLCLNSLHEFPGALT  102

Query  996   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALY-VCLELFSDTL----A  832
              S  E++  +VN T+     A    S I  +V D     +R+ Y  CLEL  D++     
Sbjct  103   ASDAELVHISVNATLQRFGRAFYMASDINSLVMD---KRTRSAYESCLELLEDSVYLLSR  159

Query  831   DLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHV  652
              L +V  G   SP     D+QT LS A+TNQ TC EGF   + NV+  +   ++ +S+ V
Sbjct  160   SLTSVAPGAGKSPPGNNNDVQTWLSAALTNQDTCTEGFADVSGNVKDQMATNLKDLSQLV  219

Query  651   SNALSMLTKIKKE--------KNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRAL  496
             SN L++   +            N+   L     S+ +         + FPKWLSR+DR L
Sbjct  220   SNCLAIFAAVNGNDDFAGVPIHNRRRRLMSTVASAKN---------ENFPKWLSRKDRKL  270

Query  495   LEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYE-YVDV  319
             L+AP       I+AD+ V+KDG+G FK+I  A+   PD S  R +I++KAG Y E  + V
Sbjct  271   LDAPVST----IQADMIVSKDGNGTFKTIAEAIKKLPDYSSRRIIIYVKAGRYEEDILKV  326

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKH  139
              +KKT +MF+GDG G+T I G ++V     TF +A+ A  G GFIA  I+F+N AGP KH
Sbjct  327   GRKKTNVMFIGDGKGQTMISGGKSVSQNLTTFHTASFAATGAGFIARDITFQNWAGPGKH  386

Query  138   QAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR  +D++V Y C  +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  387   QAVALRIGADHAVIYRCNIIGYQDTLYVHSQRQFYRECDIYGTVDF  432



>ref|XP_011093902.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Sesamum indicum]
Length=510

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 180/299 (60%), Gaps = 22/299 (7%)
 Frame = -3

Query  879  SRALYVCLELFSDTLADLRTVL------DGLENSPAKRYADLQTLLSTAMTNQYTCLEGF  718
            + A+  CL+L   ++  L   L       G +NS     AD+ T LS AM NQ TC EGF
Sbjct  70   NNAVADCLDLMDFSVDQLSWTLAASQNPKGKDNSTGNVIADMNTWLSGAMANQETCKEGF  129

Query  717  PYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMK  538
              +N  VR  +   ++Q++  V N LSM+      K  P+    PS   S  R+     +
Sbjct  130  DGTNSPVRGLVFGSLDQLTSLVHNLLSMV------KPNPTT---PSKGGSGGRKLITSAQ  180

Query  537  DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVI  358
              FP WL   DR LL+A +G+      AD  VA DG+G+F SI  A+ A PD S  RYVI
Sbjct  181  --FPDWLKSHDRKLLQASSGEV-----ADAVVAADGTGNFTSIEEAVRAVPDYSSRRYVI  233

Query  357  HIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAI  178
            HIK G Y EYV++ KKK  IM +GDG+  T I G+RN  DGW T+RSAT AV G GFIA 
Sbjct  234  HIKKGVYKEYVEISKKKWNIMLIGDGMDATVISGDRNFVDGWTTYRSATFAVRGQGFIAR  293

Query  177  GISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             I+FEN+AGPEKHQAVA R+DSD SV Y C F GYQDTLY HS RQF+REC + GTVDF
Sbjct  294  DITFENTAGPEKHQAVAFRSDSDLSVLYRCAFRGYQDTLYAHSMRQFYRECKITGTVDF  352



>ref|XP_004234960.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Solanum lycopersicum]
Length=583

 Score =   265 bits (678),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 155/400 (39%), Positives = 222/400 (56%), Gaps = 17/400 (4%)
 Frame = -3

Query  1176  IMLVP--VVLLAAFLSLTVFQSSAMNATTS-DDIHQVAHSACDRSLYRDLCVSTLVKTPD  1006
             IML+   V+L+A+ +S+ V       A    D   Q     C R+LY  LC+++L+  P 
Sbjct  30    IMLISATVLLIASAISVAVLIGVRHKAGNRIDKPSQAMARTCSRTLYPSLCLNSLINYPG  89

Query  1005  LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTL---  835
               + S  +++  +VN+T+          S I  +   + T    A   CLEL  +++   
Sbjct  90    ANSASDSDLVHISVNLTLQRFGKGLYKASDINNL--QMNTQVRSAYDDCLELLEESVDLL  147

Query  834   -ADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISR  658
                L +V  G  +SP     D+ T LS A+TNQ TC +GF     NV+  + + ++ +S 
Sbjct  148   SHSLDSVFSGDGDSPTGSTQDVMTWLSAALTNQDTCTDGFADVTGNVKDHMSENLKDLSE  207

Query  657   HVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTG  478
              VSNAL++ T    + +       P  +      E     D FPKW+SRRDR L+     
Sbjct  208   LVSNALAIYTAANGDDDFSGI---PIQNRRRRLMEFETYHDEFPKWMSRRDRKLMN----  260

Query  477   KKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY-VDVDKKKTM  301
             K    I+AD+ VAKDGSG  K+I  A+   P+ S+ R +I++KAG Y E  + V +KK  
Sbjct  261   KSVSTIQADIIVAKDGSGTVKTIAEAIKKVPEKSNHRTIIYVKAGRYEENNLKVGRKKMN  320

Query  300   IMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALR  121
             +MF+GDG GKT I G ++V     TF +A+ A  G GFIA  ++FEN AGP  HQAVALR
Sbjct  321   VMFIGDGKGKTVITGGKSVSQHLTTFHTASFAATGAGFIARDMTFENYAGPNNHQAVALR  380

Query  120   ADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
                D++V + C  +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  381   IGGDHAVVFRCNVIGYQDTLYVHSQRQFYRECDIYGTVDF  420



>ref|XP_010266532.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Nelumbo nucifera]
Length=602

 Score =   266 bits (679),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 148/371 (40%), Positives = 213/371 (57%), Gaps = 22/371 (6%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             Q     C R+ YR +CV++L+  P   + +  +++  TVN+T+  +  A    S I  V 
Sbjct  80    QAISQTCSRTRYRSICVNSLLDFPGALSANDRDLVHITVNMTLQRVGKALYGVSEIANVA  139

Query  900   PDLGTMESRALYVCLELFSDTLADLRTVLDGL------ENSPAKRYADLQTLLSTAMTNQ  739
              D  ++   A   C EL  D++  L   L+ +         P     D+ T LS A+TNQ
Sbjct  140   MD--SLSRSAYEDCFELLEDSMDQLSLSLNSIAPPGQRSGKPVGTTQDVLTWLSAALTNQ  197

Query  738   YTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSY----SS  571
              TC+EG   +N  VR  +  R++ ++  VSN L++      +++              SS
Sbjct  198   DTCVEGLSGANGYVRSQMENRLKDLTELVSNCLAIFAYSGGDQDFSGVPIQNRRRLMESS  257

Query  570   SSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSA  391
             S F     +M+DG P WL+RR+R LLE P       I+AD+ V+KDG+G +K I+ A+ +
Sbjct  258   SDF-----QMEDGMPAWLTRRERRLLEMPVSS----IQADIVVSKDGNGTYKKISDAIKS  308

Query  390   APDSSDTRYVIHIKAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSA  214
              PD +  R +I++KAG Y E  + V +KKT +MF+GDG  KT I G +N  D   TF +A
Sbjct  309   VPDYNSRRTIIYVKAGVYEEKNLKVGRKKTNLMFIGDGKSKTIITGGKNFFDNITTFHTA  368

Query  213   TVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFF  34
             + A  G GFIA  I+FEN AGP KHQAVALR  +D++V Y C  +GYQD+LYVHS+RQF+
Sbjct  369   SFAASGAGFIARDITFENYAGPAKHQAVALRVGADHAVVYRCNVIGYQDSLYVHSQRQFY  428

Query  33    RECDVYGTVDF  1
             RECD+YGTVDF
Sbjct  429   RECDIYGTVDF  439



>gb|KFK35693.1| hypothetical protein AALP_AA4G024900 [Arabis alpina]
Length=588

 Score =   265 bits (677),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 164/413 (40%), Positives = 232/413 (56%), Gaps = 32/413 (8%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMN----ATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPD  1006
             +++ ++L +A + +   +S+        T S   H V  S C  +LY +LC S  V T  
Sbjct  25    VILALLLFSAVVGIVAGKSNQTKNQKIKTLSTTSHVVIKSFCSSTLYPELCFSA-VSTTG  83

Query  1005  LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADL  826
              +  S  ++I A++N+T + +     +  +       L   E  AL+ CLE   +TL +L
Sbjct  84    KKLTSQKDVIEASLNLTRNAVTNNYLDVKKQLAKRKGLTVREVTALHDCLETMDETLDEL  143

Query  825   RTVLDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQ  667
                +  L   P      K   DL+TL+S+A+TNQ TCL+G  Y  +++ VR  ++K    
Sbjct  144   YKAVKDLHIYPNGKSLRKHSDDLKTLISSAITNQETCLDGLSYNDADRKVRKVLLKGQVH  203

Query  666   ISRHVSNALSMLTKIKKEKNKPSALF----GPSYSSSSFRQ------EHGEMK-DGFPKW  520
             +    SNAL+M    K   ++  A+F     P+ ++ + R+        G++  +G+P W
Sbjct  204   VEHMCSNALAM---TKNMTDRDIAIFELNAKPTTTTKNNRKLTEVTLAGGDLDGEGWPNW  260

Query  519   LSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGS  340
             L   DR LL+  T      +K D TVA DGSGDF          P+ S  R+VI+IKAG 
Sbjct  261   LPAGDRRLLQDST------VKPDATVAADGSGDFTXXXXXXXXXPEKSAKRFVIYIKAGV  314

Query  339   YYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFEN  160
             Y E V+V KKKT +MF+GDG GKT I G+RNV DG  TF SATVA VG  F+A  I+F+N
Sbjct  315   YSENVEVTKKKTNLMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQN  374

Query  159   SAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +AGP KHQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  375   TAGPSKHQAVALRVGSDFSAFYNCEMLAYQDTLYVHSNRQFFVKCLITGTVDF  427



>emb|CDY52779.1| BnaCnng23240D [Brassica napus]
Length=556

 Score =   264 bits (675),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 211/343 (62%), Gaps = 31/343 (9%)
 Frame = -3

Query  996  KSIPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMESRALYVCLELFSDTLADLRT  820
             SI E+I AT+N T+  +  +  +   + +R+ P++      A   CL L  DT+++L T
Sbjct  73   NSITELIVATLNQTILNVNVSYTSFFNLQKRLGPNIAHRYRCAFEDCLGLLDDTISNLET  132

Query  819  VLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFP----YSNKNVRPF----IIK-RVEQ  667
             +  L+ S    + D+  LLS AMTNQ TCLEGF     + N N   +    I+K  + +
Sbjct  133  AIFKLQTSSVGTH-DVNMLLSDAMTNQDTCLEGFTTSGIHENNNDNTYKLTDILKDSILK  191

Query  666  ISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA  487
            IS ++S++L ML KI + K+   A                E+   FP W+   D+  L A
Sbjct  192  ISSNLSDSLGMLQKIPRHKHSKEAY---------------EVDVEFPSWVLENDKRRLHA  236

Query  486  PTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKK  307
            P     ++IK ++ VA+DG+G+F +INAA+SAAP+SS TR+VI+IK G Y+E V++  KK
Sbjct  237  PV----KEIKFNLMVAQDGTGNFTTINAAVSAAPNSSATRFVIYIKRGVYFENVEIPNKK  292

Query  306  TMIMFVGDGIGKTRIKGNR-NVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAV  130
            TMIMFVGDG G+T IK NR +   G  T+++ATV V G GFIA  ISF N AGP K QAV
Sbjct  293  TMIMFVGDGTGRTVIKANRYSTPHGRTTYQTATVGVKGEGFIAKDISFVNFAGPFKGQAV  352

Query  129  ALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            A R+ S++S FY C F GYQDTLYVHS  QF+RECD+YGT+DF
Sbjct  353  AFRSGSNHSAFYRCSFEGYQDTLYVHSAEQFYRECDIYGTIDF  395



>ref|XP_004240956.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Solanum lycopersicum]
Length=595

 Score =   265 bits (677),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 153/373 (41%), Positives = 212/373 (57%), Gaps = 28/373 (8%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             Q     C R+ ++ LC+++L + P     S  E++  +VN T+     A    S I  +V
Sbjct  75    QAISRTCSRTRFKTLCLNSLHEFPGALTASDAELVHISVNATLQRFGRAFYMASDINSLV  134

Query  900   PDLGTMESRALYVCLELFSDTL----ADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYT  733
              D  T    A   C+EL  D++      L +V  G   SP     D+QT LS A+TNQ T
Sbjct  135   MDKHTRS--AYESCIELLEDSVYLLSRSLTSVAPGAGESPPGNNNDVQTWLSAALTNQDT  192

Query  732   CLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKE--------KNKPSALFGPSY  577
             C EGF     NV+  +   ++ +S+ VSN L++   +            N+   L     
Sbjct  193   CTEGFADVRGNVKDQMATNLKDLSQLVSNCLAIFAAVNGNDDFAGVPIHNRRRRLMS---  249

Query  576   SSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAAL  397
             + SS + E+      FPKWLSR+DR LL AP       I+AD+ V+KDG+G FK+I  A+
Sbjct  250   TVSSAKNEN------FPKWLSRKDRKLLNAPVST----IQADMIVSKDGNGTFKTIAEAI  299

Query  396   SAAPDSSDTRYVIHIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFR  220
                PD S  R +I++KAG Y E  + V +KKT +MF+GDG G+T I G ++V     TF 
Sbjct  300   KKLPDYSSRRIIIYVKAGRYEEDILKVGRKKTNVMFIGDGKGQTVISGGKSVSQNLTTFH  359

Query  219   SATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQ  40
             +A+ A  G GFIA  I+F+N AGP KHQAVALR  +D++V Y C  +GYQDTLYVHS+RQ
Sbjct  360   TASFAATGAGFIARDITFQNWAGPGKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSQRQ  419

Query  39    FFRECDVYGTVDF  1
             F+RECD+YGTVDF
Sbjct  420   FYRECDIYGTVDF  432



>sp|O04886.1|PME1_CITSI RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57667.1| pectinesterase [Citrus sinensis]
Length=584

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 221/372 (59%), Gaps = 25/372 (7%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  S+C  + Y DLC S +   P+   K  S  ++I  ++N+T + ++    N   I+
Sbjct  66    HAILKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVE---HNYFGIQ  122

Query  909   RVVP--DLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTA  751
             +++   +L   E  AL+ CLE   +TL +L   ++ LE  P K+       DL+TL+S A
Sbjct  123   KLLKRTNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAA  182

Query  750   MTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSY  577
             MTNQ TCL+GF +  +NK+VR  +      + +  SNAL+M+  +       + +     
Sbjct  183   MTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTD-----TDMMIMRT  237

Query  576   SSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAAL  397
             S++    E     DG+P WLS  DR LL++ +      +  +  VA DGSG+FK++ AA+
Sbjct  238   SNNRKLTEETSTVDGWPAWLSPGDRRLLQSSS------VTPNAVVAADGSGNFKTVAAAV  291

Query  396   SAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRS  217
             +AAP     RY+I IKAG Y E V+V KK   IMF+GDG  +T I G+RNV DG  TF+S
Sbjct  292   AAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKS  351

Query  216   ATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQF  37
             AT AVVG GF+A  I+F+N+AGP KHQAVALR  +D S FY+C  + YQDTLYVHS RQF
Sbjct  352   ATAAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQF  411

Query  36    FRECDVYGTVDF  1
             F  C + GTVDF
Sbjct  412   FVNCLIAGTVDF  423



>gb|AAG17110.1|AF188895_1 putative pectin methylesterase 3 [Linum usitatissimum]
Length=555

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 159/364 (44%), Positives = 211/364 (58%), Gaps = 22/364 (6%)
 Frame = -3

Query  1068  SACDRSLYRDLCVSTLVKTP-DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDL  892
             S+C  + + DLC S+L   P  +   +  ++I A++NVT + +    A  ++      DL
Sbjct  45    SSCSNTRHPDLCFSSLASAPVHVSLNTQMDVIKASINVTCTSVLRNIAAVNKALSTRTDL  104

Query  891   GTMESRALYVCLELFSDTLADLRTVLDGLENSPAK----RYAD-LQTLLSTAMTNQYTCL  727
                   AL  C+E  S +L +L   L  L+  P K    R+AD L+TLLS A TNQ TCL
Sbjct  105   TPRSRSALKDCVETMSTSLDELHVALAELDEYPNKKSITRHADDLKTLLSAATTNQETCL  164

Query  726   EGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQE  553
             +GF +  S K VR  +     ++ +   NAL M+  +  E +  SA       +++   E
Sbjct  165   DGFSHDDSEKKVRKTLETGPVRVEKMCGNALGMIVNMT-ETDMASA-------TNAVNTE  216

Query  552   HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSD  373
              G     +P W+   DR LL+A T      +  +V VA DGSG ++ ++ A++AAP  S 
Sbjct  217   GGS-SGSWPIWMKGGDRRLLQAGT-----TVTPNVVVAADGSGKYRRVSEAVAAAPSKSS  270

Query  372   TRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGT  193
              RYVI IKAG Y E V+V K KT IMFVGDG   T I GN+NV DG  TF SATVAVVG 
Sbjct  271   KRYVIRIKAGIYRENVEVPKDKTNIMFVGDGRSNTIITGNKNVVDGSTTFNSATVAVVGQ  330

Query  192   GFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYG  13
             GF+A  I+F+N+AGP KHQAVALR  +D + FY C F+ YQDTLYVHS RQFF  C V G
Sbjct  331   GFLARDITFQNTAGPSKHQAVALRVGADLAAFYRCDFLAYQDTLYVHSNRQFFINCLVVG  390

Query  12    TVDF  1
             TVDF
Sbjct  391   TVDF  394



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 217/373 (58%), Gaps = 29/373 (8%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDL--RAKSIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  S+C  +LY DLC S +   P       +  +II  ++N+T + ++    N   I 
Sbjct  60    HAILKSSCRSTLYPDLCYSAIATVPGAMDNLSTQKDIIEMSLNITTTAVE---HNYFTIE  116

Query  909   RVV--PDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA------DLQTLLST  754
             +++   +L   E  AL+ CLE+  +TL +L    D L++ P+ + +      DL+ L+S 
Sbjct  117   KIIGSKNLTKREKTALHDCLEMVDETLDELHKTADDLKDYPSSKKSIFQHADDLKILVSA  176

Query  753   AMTNQYTCLEGFPYSN--KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPS  580
             AMTNQ +C++GF + N  K+VR  ++   E + R  SNAL+M+      KN         
Sbjct  177   AMTNQESCIDGFSHDNADKDVRKKLLAGQEHVYRMCSNALAMI------KNMTDTDMAQE  230

Query  579   YSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAA  400
                +  R E  E  + FP WLS  DR LL+A        +  DVTVA DGSG + +++ A
Sbjct  231   QYKAKRRVE--ESSEEFPAWLSWGDRKLLQASM------LVPDVTVAADGSGHYTTVSEA  282

Query  399   LSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFR  220
             ++AAP+ S  RY+I IKAG Y E V+V KKKT IM VGDG   T I G R+V DG  TFR
Sbjct  283   VAAAPEKSHKRYIIRIKAGVYRENVNVPKKKTNIMMVGDGRINTIITGRRSVVDGSTTFR  342

Query  219   SATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQ  40
             SA+VA VG GF+A  I+F+N+AGP K QAVALR  SD S FY C  + YQDTLYVHS RQ
Sbjct  343   SASVAAVGEGFLARDITFQNTAGPSKDQAVALRVGSDKSAFYRCNIIAYQDTLYVHSLRQ  402

Query  39    FFRECDVYGTVDF  1
             F+ +  + GTVDF
Sbjct  403   FYVDSLIVGTVDF  415



>ref|XP_008450600.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
isoform X1 [Cucumis melo]
Length=543

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/400 (37%), Positives = 230/400 (58%), Gaps = 31/400 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             ++ +PV+ ++  + + V      N  T   I Q+     DR    + C+S +        
Sbjct  13    LIFIPVLQVSC-IDVNVIYPDEQNNVTQSMISQICADIEDR----NSCISNIQLEMGRSV  67

Query  996   KSIPE-IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELF-------SD  841
              S P  ++SA +  T++E + A  + ++           E  A+  C EL        + 
Sbjct  68    NSNPSSVLSAAIRATINEARQAIESITKFSTF--SFSYREEMAIEDCKELLDFSVAELAW  125

Query  840   TLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQIS  661
             +LA+++ +  G   +P +   +L+  LS A++NQ TCLEGF  +++++  FI   ++Q++
Sbjct  126   SLAEMKRIRAGKNEAPDE--GNLKAWLSAALSNQDTCLEGFEGTDRHIVGFIRGSLKQVT  183

Query  660   RHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPT  481
               +SN L++ T++       S  F P  + +  + +  E    FP W+   +  L+++  
Sbjct  184   LLISNVLALYTQLH------SLPFQPPRNETMEKTKSSE----FPDWMMDSEHKLVKS--  231

Query  480   GKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTM  301
                 R +  D  VA DGSGDF+SI  A++ AP  S+ RY+I++K G Y E +D+ +KKT 
Sbjct  232   --HPRNVHVDAIVALDGSGDFRSITEAVNEAPSYSNRRYIIYVKKGVYKENIDMKRKKTN  289

Query  300   IMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALR  121
             IMF+GDGIG+T + G+RN   GW TFR+ATVAV G GFIA  ++F N+AGPE HQAVALR
Sbjct  290   IMFIGDGIGETIVTGSRNFLQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQAVALR  349

Query  120   ADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              DSD S F+ C F G+QDTLYVHS RQF+REC++YGT+D+
Sbjct  350   VDSDQSAFFRCSFEGHQDTLYVHSLRQFYRECNIYGTIDY  389



>ref|XP_003554631.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Glycine max]
Length=544

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/401 (38%), Positives = 234/401 (58%), Gaps = 26/401 (6%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNAT--TSDDIHQVAHSACDRSLYRDLCVSTL-VKTPDL  1003
              L  ++LL +F ++   +   +N +   + D+  +   AC     ++ C++ +  +   +
Sbjct  6     FLFILMLLPSFEAIPSDEEVFINPSEVQTQDMQALIAQACMDIENQNSCLTNIHNELTKI  65

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELF-------S  844
                S   ++SA +  T++E + A  N ++I      +   E +A+  C EL        +
Sbjct  66    GPPSPTSVVSAALKHTLNEARVAIDNITKITTF--SVSYREQQAIEDCRELLDFSVSELA  123

Query  843   DTLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQI  664
              ++ ++R +  G  N  A+   +L+  LS A++NQ TCLEGF  +++ +  +I   + Q+
Sbjct  124   WSMGEMRRIRSGDTN--AQYEGNLEAWLSAALSNQDTCLEGFEGTDRRLESYISGSLTQV  181

Query  663   SRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAP  484
             ++ +SN LS+ T++       S  F P  ++++    H  ++  FP+W+S  D+ LL+A 
Sbjct  182   TQLISNVLSLYTQLH------SLPFKPPRNTTTPLTSHETLE--FPEWMSEGDQELLKA-  232

Query  483   TGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKT  304
                K   ++AD  VA DGSG ++SI  A++AAP  S  RYVI++K G Y E VD+ +K T
Sbjct  233   ---KPHGVRADAVVALDGSGHYRSITDAVNAAPSYSQRRYVIYVKKGLYKENVDMKRKMT  289

Query  303   MIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVAL  124
              IM VGDGIG+T I  NRN   GW TFR+AT+AV G GFIA  +SF N+AGP  HQAVAL
Sbjct  290   NIMLVGDGIGQTIITSNRNFMQGWTTFRTATLAVSGKGFIAKDMSFRNTAGPVNHQAVAL  349

Query  123   RADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             R DSD S FY C   G+QDTLY HS RQF+REC++YGT+DF
Sbjct  350   RVDSDQSAFYRCSVEGHQDTLYAHSLRQFYRECEIYGTIDF  390



>ref|XP_004157240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Cucumis sativus]
Length=543

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/400 (37%), Positives = 230/400 (58%), Gaps = 31/400 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             ++ +PV+ ++ F  + V      N  T   I Q+     DR    + C+S +        
Sbjct  13    LIFLPVLQVSCF-DVNVIYPDEQNNVTQSMISQICADIEDR----NSCISNIQLEMGRNV  67

Query  996   KSIPE-IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELF-------SD  841
              S P  ++SA +  T++E + A  + ++           E  A+  C EL        + 
Sbjct  68    NSNPNSVLSAAIRATINEARRAIESITKFSTF--SFSYREEMAIEDCKELLDFSVAELAW  125

Query  840   TLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQIS  661
             +LA+++ +  G   +P +   +L+  LS A++NQ TCLEGF  +++++  FI   ++Q++
Sbjct  126   SLAEMKRIRAGKNEAPDE--GNLKAWLSAALSNQDTCLEGFEGTDRHIVGFIRGSLKQVT  183

Query  660   RHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPT  481
               +SN L++ T++       S  F P  + +  + +  E    FP W+   +  ++++  
Sbjct  184   LLISNVLALYTQLH------SLPFQPPRNETMEKTKSSE----FPDWMMDSEHKIVKS--  231

Query  480   GKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTM  301
                 R +  D  VA DGSGDF+SI  A++ AP  S+ RY+I++K G Y E +D+ +KKT 
Sbjct  232   --HPRNVHVDAIVALDGSGDFRSITEAVNEAPSYSNRRYIIYVKKGVYKENIDMKRKKTN  289

Query  300   IMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALR  121
             IMF+GDGIG+T + G+RN   GW TFR+ATVAV G GFIA  ++F N+AGPE HQAVALR
Sbjct  290   IMFIGDGIGETIVTGSRNFLQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQAVALR  349

Query  120   ADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              DSD S F+ C F G+QDTLYVHS RQF+REC++YGT+D+
Sbjct  350   VDSDQSAFFRCSFEGHQDTLYVHSLRQFYRECNIYGTIDY  389



>ref|XP_006287480.1| hypothetical protein CARUB_v10000691mg [Capsella rubella]
 gb|EOA20378.1| hypothetical protein CARUB_v10000691mg [Capsella rubella]
Length=530

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/345 (43%), Positives = 205/345 (59%), Gaps = 37/345 (11%)
 Frame = -3

Query  990  IPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMESRALYVCLELFSDTLADLRTVL  814
            I +++ A +N T+S++  +++N S +  R+   L   E  A   CLEL  DT+ DL T +
Sbjct  47   ITDLVVAAINQTISKVNLSSSNFSYLLNRLGSSLSHRERCAFDDCLELLDDTVFDLTTAI  106

Query  813  DGLENSPAKRYADLQTLLSTAMTNQYTCLEGFP-----------YSNK---NVRPFIIKR  676
              L  S +    +++  LS  +TN  TCL+GF            Y+N     V   + + 
Sbjct  107  SELR-SHSPEIHNVKMFLSATLTNTRTCLDGFASNDEVEDENWNYNNNKTYGVAESLKES  165

Query  675  VEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRAL  496
            +  IS HV N+L+ML  I    N P  L               E    FP W+S  DR L
Sbjct  166  LFNISSHVKNSLAMLEDIPG--NIPGKL---------------EEDVAFPMWVSGSDRNL  208

Query  495  LEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVD  316
            L+ P  + K     D+ VA++G+G++ +I  ALSAAP+SS+TR+VI+IK G Y E +++ 
Sbjct  209  LQDPVDESK----VDLVVAQNGTGNYTTIGEALSAAPNSSETRFVIYIKCGVYLENIEIA  264

Query  315  KKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQ  136
            ++KTMIMFVGDGIG+T IK NR+  DGW  F SATV V G+GFIA  +SF N AG  ++Q
Sbjct  265  REKTMIMFVGDGIGQTVIKANRSYADGWTAFHSATVGVRGSGFIAKDLSFVNDAGRTRYQ  324

Query  135  AVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            AVALR+ SD+S FY C F  YQDT+Y HS +QF+RECD+YGTVDF
Sbjct  325  AVALRSSSDHSAFYRCSFESYQDTIYAHSHKQFYRECDIYGTVDF  369



>ref|XP_009614734.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nicotiana tomentosiformis]
Length=585

 Score =   263 bits (673),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 157/408 (38%), Positives = 226/408 (55%), Gaps = 33/408 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTS-DDIHQVAHSACDRSLYRDLCVSTLVKTPDLR  1000
             I+   V+L+A+ +S+ V      N+    D   Q     C R+LY  LC+++L+  P  +
Sbjct  32    IIFATVLLIASAISVAVLVGVRKNSGNRIDKPSQAMARTCSRTLYPSLCLNSLINYPGAK  91

Query  999   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTL----A  832
             + S  +++  +VN+T+     A    S I  +   + T    A   CLEL  +++     
Sbjct  92    SASDNDLVHISVNLTLQRFGKALYISSDINNL--QMNTQIRSAYDDCLELLEESVDLLSH  149

Query  831   DLRTVLDGLE--NSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISR  658
              L +V  G +  NSP     D+ T LS A+TNQ TC +GF     NV+  + + ++ +S 
Sbjct  150   SLNSVFPGGDGSNSPTGSTHDVMTWLSAALTNQDTCTDGFADVTGNVKDQMSENLKDLSE  209

Query  657   HVSNALSMLTKIKKE--------KNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDR  502
              VSNAL++      +        +N+   L         F + H    D FPKWLSRRDR
Sbjct  210   LVSNALAIYAAANGDDDFSGIPIQNRRRRLM-------KFEKHH----DDFPKWLSRRDR  258

Query  501   ALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYE-YV  325
              LL     K    I+AD+ VAKDGSG  K+I  A+   P+ S+ R +I++KAG Y E  +
Sbjct  259   KLLN----KSVSAIQADIIVAKDGSGTVKTIAEAIKKVPEKSNRRTIIYVKAGRYEEDNL  314

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPE  145
              V +KK  +MF+GDG GKT I G ++V     TF +A+ A  G GF+A  ++FEN AGP 
Sbjct  315   KVGRKKMNVMFIGDGKGKTVITGGKSVAQHITTFHTASFAATGAGFVARDMTFENYAGPS  374

Query  144   KHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              HQAVALR   D++V + C  +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  375   NHQAVALRIGGDHAVVFRCNIIGYQDTLYVHSQRQFYRECDIYGTVDF  422



>ref|XP_004135600.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Cucumis sativus]
 gb|KGN66043.1| hypothetical protein Csa_1G569210 [Cucumis sativus]
Length=543

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 147/400 (37%), Positives = 230/400 (58%), Gaps = 31/400 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             ++ +PV+ ++ F  + V      N  T   I Q+     DR    + C+S +        
Sbjct  13    LIFLPVLQVSCF-DVNVIYPDEQNNVTQSMISQICADIEDR----NSCISNIQLEMGRSV  67

Query  996   KSIPE-IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELF-------SD  841
              S P  ++SA +  T++E + A  + ++           E  A+  C EL        + 
Sbjct  68    NSNPNSVLSAAIRATINEARRAIESITKFSTF--SFSYREEMAIEDCKELLDFSVAELAW  125

Query  840   TLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQIS  661
             +LA+++ +  G   +P +   +L+  LS A++NQ TCLEGF  +++++  FI   ++Q++
Sbjct  126   SLAEMKRIRAGKNEAPDE--GNLKAWLSAALSNQDTCLEGFEGTDRHIVGFIRGSLKQVT  183

Query  660   RHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPT  481
               +SN L++ T++       S  F P  + +  + +  E    FP W+   +  ++++  
Sbjct  184   LLISNVLALYTQLH------SLPFQPPRNETMEKTKSSE----FPDWMMDSEHKIVKS--  231

Query  480   GKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTM  301
                 R +  D  VA DGSGDF+SI  A++ AP  S+ RY+I++K G Y E +D+ +KKT 
Sbjct  232   --HPRNVHVDAIVALDGSGDFRSITEAVNEAPSYSNRRYIIYVKKGVYKENIDMKRKKTN  289

Query  300   IMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALR  121
             IMF+GDGIG+T + G+RN   GW TFR+ATVAV G GFIA  ++F N+AGPE HQAVALR
Sbjct  290   IMFIGDGIGETIVTGSRNFLQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQAVALR  349

Query  120   ADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              DSD S F+ C F G+QDTLYVHS RQF+REC++YGT+D+
Sbjct  350   VDSDQSAFFRCSFEGHQDTLYVHSLRQFYRECNIYGTIDY  389



>ref|XP_004168887.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN58477.1| hypothetical protein Csa_3G646640 [Cucumis sativus]
Length=561

 Score =   263 bits (671),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 157/377 (42%), Positives = 219/377 (58%), Gaps = 19/377 (5%)
 Frame = -3

Query  1104  ATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAAN  925
             A  S D H    S C  +LY +LC +T+       +K   E I A+VN+T+S +K     
Sbjct  34    AVVSSDDH--VGSKCAMTLYPELCETTISTAVGSSSK---EAIEASVNITISAVKDNYKR  88

Query  924   CSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAK----RYAD-LQTLL  760
               ++ + V +L   +  A + CLE   +TL +L  V++ +   P K    RYAD L+TLL
Sbjct  89    VQKLLKTVKNLTKRQKIAFHDCLETGEETLRELYEVVEDVNEYPKKKSLSRYADDLKTLL  148

Query  759   STAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFG  586
             S+ +TNQ TC++GF +   +K VR  + + +  I +  S AL+++  +            
Sbjct  149   SSTITNQETCVDGFSHDKGDKKVRESLKEGLIHIEKLCSIALALIKNLTDTDIANLNNNN  208

Query  585   PSYSSSSFRQEHGEMKDG--FPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKS  412
              +   +  + E  +M+DG  +P W+S +DR LL+A +         DV VA DGSGDF++
Sbjct  209   NNNHLNRKQLEEKKMEDGIKWPDWMSPKDRRLLQASS-----TATPDVVVAADGSGDFRT  263

Query  411   INAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGW  232
             I+ A++AAP  S  RY+I IKAG Y E V+V   K  IMF GDG   T I GNRNV DG 
Sbjct  264   ISEAVAAAPSRSSRRYIIRIKAGVYRENVNVASSKRNIMFWGDGRVNTIITGNRNVVDGS  323

Query  231   PTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVH  52
              TF SATVA VG  F+A  ++F+N+AGP KHQAVALR  SD S FY C  + YQDTLYVH
Sbjct  324   TTFNSATVAAVGERFLARDVTFQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVH  383

Query  51    SRRQFFRECDVYGTVDF  1
             S RQF+ +C + GT+DF
Sbjct  384   SNRQFYVQCIIVGTIDF  400



>gb|KHN43320.1| Putative pectinesterase/pectinesterase inhibitor 22 [Glycine 
soja]
Length=508

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/334 (42%), Positives = 206/334 (62%), Gaps = 23/334 (7%)
 Frame = -3

Query  981  IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELF-------SDTLADLR  823
            ++SA +  T++E + A  N ++I      +   E +A+  C EL        + ++ ++R
Sbjct  37   VVSAALKHTLNEARVAIDNITKITTF--SVSYREQQAIEDCRELLDFSVSELAWSMGEMR  94

Query  822  TVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNA  643
             +  G  N  A+   +L+  LS A++NQ TCLEGF  +++ +  +I   + Q+++ +SN 
Sbjct  95   RIRSGDTN--AQYEGNLEAWLSAALSNQDTCLEGFEGTDRRLESYISGSLTQVTQLISNV  152

Query  642  LSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRK  463
            LS+ T++       S  F P  ++++    H  ++  FP+W+S  D+ LL+A    K   
Sbjct  153  LSLYTQLH------SLPFKPPRNTTTPLTSHETLE--FPEWMSEGDQELLKA----KPHG  200

Query  462  IKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGD  283
            ++AD  VA DGSG ++SI  A++AAP  S  RYVI++K G Y E VD+ +K T IM VGD
Sbjct  201  VRADAVVALDGSGHYRSITDAVNAAPSYSQRRYVIYVKKGLYKENVDMKRKMTNIMLVGD  260

Query  282  GIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYS  103
            GIG+T I  NRN   GW TFR+AT+AV G GFIA  +SF N+AGP  HQAVALR DSD S
Sbjct  261  GIGQTIITSNRNFMQGWTTFRTATLAVSGKGFIAKDMSFRNTAGPVNHQAVALRVDSDQS  320

Query  102  VFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FY C   G+QDTLY HS RQF+REC++YGT+DF
Sbjct  321  AFYRCSVEGHQDTLYAHSLRQFYRECEIYGTIDF  354



>ref|XP_006841646.1| hypothetical protein AMTR_s00003p00238240 [Amborella trichopoda]
 gb|ERN03321.1| hypothetical protein AMTR_s00003p00238240 [Amborella trichopoda]
Length=566

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 213/365 (58%), Gaps = 21/365 (6%)
 Frame = -3

Query  1065  ACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGT  886
             AC +++  + C  T ++T  +    I  I+S+T  +T +E+K A    S  R    D   
Sbjct  50    ACSKTINPEACFET-IQTECIECSPI-AILSSTARLTRNEVKKAMEFLSEFRAQSVD--R  105

Query  885   MESRALYVCLELFSDTLADLRTVLDGLEN------SPAKRYADLQTLLSTAMTNQYTCLE  724
              E  A   C+EL   T  +L   L  + N      +   R  D++  LS A+ NQ TC+E
Sbjct  106   REVIATKDCMELLDFTSEELSWSLSIMNNPNFSEETMLHRQGDVRAWLSAALGNQDTCIE  165

Query  723   GFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQE-HG  547
             GF  +  +VR +I   ++Q+S+ VSN L+M+ +I    N  S +   + ++     E HG
Sbjct  166   GFEGTKGHVRDYIQGSLQQVSQLVSNMLAMVQRI----NDFSVVIPLNNATMEVSNESHG  221

Query  546   EMKDG---FPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSS  376
              +++G   FP W+S  ++  +     K    ++A+V VA DGSG+F+SI  A+ AAPD  
Sbjct  222   RLEEGNGEFPMWMSSEEQKGI---FRKGAGGVRANVVVASDGSGNFRSITEAIRAAPDYR  278

Query  375   DTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVG  196
               RYVIH++AG Y E V+V KKKT IM VGDG   T I G+R+   GW TF +AT AV G
Sbjct  279   KQRYVIHVRAGVYRENVEVKKKKTNIMLVGDGKDVTVISGSRSFLQGWTTFHTATFAVSG  338

Query  195   TGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVY  16
              GFIA  I+FEN+AGP  HQAVALR DSD S FY C   GYQDTLY HS RQF+RECD+Y
Sbjct  339   RGFIARDITFENTAGPSMHQAVALRVDSDQSAFYHCAIKGYQDTLYAHSLRQFYRECDIY  398

Query  15    GTVDF  1
             GT+DF
Sbjct  399   GTIDF  403



>ref|XP_010267633.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nelumbo nucifera]
Length=604

 Score =   263 bits (673),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 150/375 (40%), Positives = 214/375 (57%), Gaps = 31/375 (8%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  901
             Q     C ++ Y DLC+++LV+ P   A    +++  + N+T+  +  A    S I  V 
Sbjct  83    QAISRTCSKTRYPDLCINSLVEFPGALAAGDRDLVHISFNMTLQRVGKALYGVSEIANVA  142

Query  900   PDLGTMESRALYVCLELFSDTLADLRTVLDGL---ENSPAKRYA---DLQTLLSTAMTNQ  739
              D   +   A   CLEL  D++  L   L+ +   E    K      D+ T LS A+TNQ
Sbjct  143   MD--ALARSAYEDCLELLEDSMDQLSLSLNSVAPPEQGGGKGVGSTEDVMTWLSAALTNQ  200

Query  738   YTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKE--------KNKPSALFGP  583
              TC EG    + NV+  +  R+  IS  VSN L++               +NK   +   
Sbjct  201   DTCNEGLSDVSGNVKDQMQNRLSDISELVSNCLAIFASSSGNEDFSGIPIQNKRRLM---  257

Query  582   SYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINA  403
               + SSF+ E     +  P WL+RR+R LLE P       I+AD+ V+KDG+G +K+I  
Sbjct  258   --TESSFQTE-----EELPAWLTRRERRLLEMPV----SSIQADIVVSKDGTGTYKTITE  306

Query  402   ALSAAPDSSDTRYVIHIKAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPT  226
             A+ A P+ S+ R +I++KAG+Y E  + V +KKT +MF+GDG GKT I G +NV + + T
Sbjct  307   AIKAVPEHSNRRTIIYVKAGTYEESNLKVGRKKTNLMFIGDGRGKTVITGGKNVFEKYTT  366

Query  225   FRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSR  46
             F +A+ A  G GFIA  ++FEN AGP  HQAVALR  +D++V Y C  +GYQDTLYVHS+
Sbjct  367   FHTASFAATGAGFIARDMTFENYAGPSNHQAVALRVGADHAVVYRCNIIGYQDTLYVHSQ  426

Query  45    RQFFRECDVYGTVDF  1
             RQF+RECD+YGTVDF
Sbjct  427   RQFYRECDIYGTVDF  441



>ref|XP_006350555.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61-like 
[Solanum tuberosum]
Length=585

 Score =   262 bits (670),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 153/400 (38%), Positives = 220/400 (55%), Gaps = 17/400 (4%)
 Frame = -3

Query  1176  IMLVP--VVLLAAFLSLTVFQSSAMNATTS-DDIHQVAHSACDRSLYRDLCVSTLVKTPD  1006
             IML+   V+L+A+ +++ V       A    D   Q     C R+LY  LC+++L+  P 
Sbjct  32    IMLISATVLLIASAIAVAVLIGVRHKAGNRIDKPSQAMARTCSRTLYPSLCLNSLINYPG  91

Query  1005  LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTL---  835
               + S  +++  +VN+T+          S I  +   + T    A   CLEL  +++   
Sbjct  92    ANSASDSDLVHISVNLTLQRFGKGLYKASDINNL--QMNTQIRSAYDDCLELLEESVDLL  149

Query  834   -ADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISR  658
                L +V  G  +SP     D+ T LS A+TN  TC +GF     NV+  I + ++ +S 
Sbjct  150   SHSLNSVFSGDGDSPTGSTQDVMTWLSAALTNHDTCTDGFANVTGNVKDHISENLKDLSE  209

Query  657   HVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTG  478
              VSNAL++      + +       P  +      E     D FPKW+SRRDR L+     
Sbjct  210   LVSNALAIYAAANGDDDFSRI---PIQNRRRRLMEFETHHDEFPKWMSRRDRKLMN----  262

Query  477   KKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY-VDVDKKKTM  301
             K    I+AD+ VAKDGSG  K+I  A+   P+ S+ R +I++KAG Y E  + V +KK  
Sbjct  263   KSVSAIQADIIVAKDGSGTVKTIAEAIKKVPEKSNHRTIIYVKAGRYEENNLKVGRKKMN  322

Query  300   IMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALR  121
             +MF+GDG GKT I G ++V     TF +A+ A  G GFIA  ++FEN AGP  HQAVALR
Sbjct  323   VMFIGDGKGKTVITGGKSVSQHLTTFHTASFAATGAGFIARDMTFENYAGPNNHQAVALR  382

Query  120   ADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
                D++V + C  +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  383   IGGDHAVVFRCNVIGYQDTLYVHSQRQFYRECDIYGTVDF  422



>ref|XP_006433467.1| hypothetical protein CICLE_v10000816mg [Citrus clementina]
 ref|XP_006472137.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Citrus sinensis]
 gb|ESR46707.1| hypothetical protein CICLE_v10000816mg [Citrus clementina]
Length=536

 Score =   261 bits (666),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 149/397 (38%), Positives = 223/397 (56%), Gaps = 30/397 (8%)
 Frame = -3

Query  1152  LAAFLSLTVFQSS--AMNATTSDDIHQVAHSA-----CDRSLYRDLCVSTLVKTPDLRAK  994
             LA F  + +F  S  A++   S D   ++  A     C     +D C+  L    + +  
Sbjct  3     LAYFFLILIFSPSLAALSNAASLDKQNLSPQALMTLACSSIQNQDSCLLNLQSALENKIP  62

Query  993   SIPE-IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTV  817
               P  I+ A +  +++E K A  + ++   +   + + E  A+  C EL   ++++L   
Sbjct  63    QTPNSILHAALRASLNEAKLAIQSITKFNSL--SISSREQMAIEDCKELLDFSVSELAWS  120

Query  816   LDGLENSPA-----KRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHV  652
             LD ++   A         +L+  LS A++NQ TCLEGF  +++ +  FI   ++Q+++ +
Sbjct  121   LDEMKRIRAGDKNVHYEGNLKAWLSAALSNQDTCLEGFEGTDRRLENFINGSLQQVTQLI  180

Query  651   SNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKK  472
             +N LS+ T++     KP  +      S  F           PKW++  D+  ++     K
Sbjct  181   TNVLSLYTQLHSLPFKPPRINDTQSESPKF-----------PKWMTEGDKGHMDM----K  225

Query  471   KRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMF  292
               ++ AD  VA DG+G +++I  A++AAP  S  RYVI++K G Y E VD+ KKKT IM 
Sbjct  226   PTRMHADAVVALDGTGHYRTITEAINAAPSYSKRRYVIYVKKGVYRENVDMKKKKTNIML  285

Query  291   VGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADS  112
             VGDGIG T + GNRN   GW TFR+ATVAV G GFIA  ++F N+AGP+ HQAVALR DS
Sbjct  286   VGDGIGATVVTGNRNFMQGWTTFRTATVAVSGKGFIARDMTFRNTAGPQNHQAVALRVDS  345

Query  111   DYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             D S F+ C   GYQDTLY HS RQF+REC++YGT+DF
Sbjct  346   DQSAFFRCSVEGYQDTLYAHSLRQFYRECNIYGTIDF  382



>ref|XP_010261669.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 12 
[Nelumbo nucifera]
Length=574

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 165/416 (40%), Positives = 236/416 (57%), Gaps = 41/416 (10%)
 Frame = -3

Query  1197  QNLGRNPIMLVPVVLLAAFLSL-TVF--------QSSAMNAT-TSDDIHQVA-HSACDRS  1051
             Q L +   + +   LL  FL L T+F         SS  +AT T+ D H  +  S C  +
Sbjct  23    QKLPKLLAIFMASTLLRTFLLLSTIFIVRPWAVNSSSFSSATDTTLDAHLASIRSFCKST  82

Query  1050  LYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM----  883
              Y D C  +L   P +     P II       +  ++TA     ++  +  ++G++    
Sbjct  83    PYPDACFDSL--KPSISINIKPNIIG----YALQSLQTAIFEADKLLDLFLNIGSLGVVE  136

Query  882   -ESRALYVCLELFSDTLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSN  706
              +  A+  C EL   T++ L+  L  + +  A++ +D +  LS ++TN+ TCLEG   + 
Sbjct  137   KQKGAIQDCKELHQITMSSLQRSLSRIRSGDARKLSDARAFLSASLTNKNTCLEGLDSAT  196

Query  705   KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFP  526
               ++  I++ +  + RH+SN+LSML K +  K           +  S R+  G     FP
Sbjct  197   GPLKSVIVQSITSVYRHISNSLSMLPKQELRK----------VTEGSNRRLMG-----FP  241

Query  525   KWLSRRDRALLEAPTGKKKRKIKADV-TVAKDGSGDFKSINAALSAAPDSSDTRYVIHIK  349
              W+SR+DR +L++  G        DV TVAKDGSG+F +I  A++ AP++S  R +I+I+
Sbjct  242   AWVSRKDRRILQSFDGDYNPN---DVLTVAKDGSGNFTTITDAVNFAPNTSYDRTIIYIR  298

Query  348   AGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGIS  169
             AG Y E +D+   KT I+ +GDG   T I GNR+V DGW TFRSATVAV G GF+A  I 
Sbjct  299   AGIYQENLDIPSYKTNIVLLGDGADVTIITGNRSVGDGWTTFRSATVAVSGDGFLARDIK  358

Query  168   FENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FEN+AGPEKHQAVALR ++D S  Y C   GYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  359   FENTAGPEKHQAVALRVNADLSAVYRCAIDGYQDTLYVHSFRQFYRECDIYGTVDF  414



>ref|XP_004141734.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN45437.1| hypothetical protein Csa_7G447990 [Cucumis sativus]
Length=595

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 163/410 (40%), Positives = 238/410 (58%), Gaps = 30/410 (7%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPD--L  1003
             + L   +L+   +   V  ++  ++  S + H +  S C  +LY D+C S + ++    L
Sbjct  37    VTLCSTLLIVGAVIGIVAGTTKSSSKYSGESHAIVKSTCSSTLYPDMCYSAISRSEGAML  96

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRV--VPDLGTMESRALYVCLELFSDTLAD  829
             + K+  ++I  ++N+TV   K    N  R++++  + ++   E  AL+ CLE   +TL +
Sbjct  97    KVKNQKDVIEISINITV---KAVEENYFRVKKLCGLKNISHRERIALHDCLETIDETLDE  153

Query  828   LRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVE  670
             L   +  L   P K+       DL+TLLS+A+TNQ TCL+GF +  ++KN+R  + +   
Sbjct  154   LHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITNQETCLDGFSHDDADKNLRDKLKEGQM  213

Query  669   QISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDG-------FPKWLSR  511
             ++    SNAL+M   IK   +   A +      +  R+   E  D        +P+WLS 
Sbjct  214   EVEHMCSNALAM---IKNMTDTDIANYEAKMGITKNRKLMAEEDDNNNDDGIQWPEWLSA  270

Query  510   RDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYE  331
              DR LL++ +      +  +V VA DGSG+F+++ AA++AAP  S  RYVI IKAG Y E
Sbjct  271   GDRRLLQSSS------VTPNVVVAADGSGNFRTVAAAVAAAPVRSSKRYVIRIKAGVYRE  324

Query  330   YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAG  151
              V+V KKKT IMF+GDG   T I G+RNV DG  TF SAT+A VG GF+A  I+F+N+AG
Sbjct  325   NVEVPKKKTNIMFIGDGRRNTIITGSRNVVDGSTTFNSATMAAVGEGFLARDITFQNTAG  384

Query  150   PEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             P KHQAVALR  +D S FY C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  385   PSKHQAVALRVGADLSAFYQCDMLAYQDTLYVHSNRQFYINCLVSGTVDF  434



>ref|XP_008460358.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=559

 Score =   261 bits (666),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 161/392 (41%), Positives = 224/392 (57%), Gaps = 22/392 (6%)
 Frame = -3

Query  1155  LLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEII  976
             LL   LS T+     + A +SDD H    S C  +LY +LC +T+       +K   E I
Sbjct  22    LLVFALSTTLL----LAAVSSDD-H--VRSKCAMTLYPELCETTISTAVGSSSK---EAI  71

Query  975   SATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENS  796
              A+VN+T+  +        ++ +    L   E  AL+ CLE   +TL +L  V++ +   
Sbjct  72    EASVNITIGAVGDNYRRVKKLLKTENSLTKREKIALHDCLETGEETLRELYEVVEDVNEY  131

Query  795   PAK----RYAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALS  637
             P K    RYAD L+TLLS+A+TNQ TCL+GF +  ++K VR  + + +  I +  S AL+
Sbjct  132   PNKKSLSRYADDLKTLLSSAITNQETCLDGFSHDKADKKVRESLKEGLIHIEKLCSIALA  191

Query  636   MLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIK  457
             ++  +               S    ++++ + +  +P W+S  DR LL+A +        
Sbjct  192   LIKNLTDTDIANLNNNNNHLSRKQLKEKNTDDRINWPDWMSPNDRRLLQASS-----TAT  246

Query  456   ADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGI  277
              DV VA DGSGDF++I+ A++AAP  S  RY+I IKAG Y E V+V   K  IMF GDG 
Sbjct  247   PDVVVAADGSGDFRTISEAVAAAPSRSSQRYIIRIKAGVYRENVNVASSKRNIMFWGDGR  306

Query  276   GKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVF  97
               T I GNRNV DG  TF SATVA VG  F+A  ++F+N+AGP KHQAVALR  SD S F
Sbjct  307   VNTIITGNRNVVDGSTTFNSATVAAVGERFLARDVTFQNTAGPSKHQAVALRVGSDLSAF  366

Query  96    YDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             Y C  + YQDTLYVHS RQF+ +C + GT+DF
Sbjct  367   YRCDMLAYQDTLYVHSNRQFYVQCIIVGTIDF  398



>ref|XP_006599763.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=492

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 147/306 (48%), Positives = 190/306 (62%), Gaps = 13/306 (4%)
 Frame = -3

Query  897  DLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQYT  733
            DL   E+ AL+ CLE   +TL +LR     LE  P K+       DL+TL+S A+TNQ T
Sbjct  32   DLTKRETTALHDCLETIDETLDELREAQHDLELYPNKKTLYQHADDLKTLISAAITNQVT  91

Query  732  CLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFR  559
            CL+GF +  ++K+VR  + K    +    SNAL+M   +               +++S R
Sbjct  92   CLDGFSHDDADKHVRKELEKGQVHVEHMCSNALAMTKNMTDGDIANYEYKMKVENTNSNR  151

Query  558  QEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDS  379
            +   E    +P+W+S  DR LL+A T      +KADVTVA DGSGDFK++  A+ AAP  
Sbjct  152  KLLVENGVEWPEWISAADRRLLQAAT------VKADVTVAADGSGDFKTVTEAVKAAPLK  205

Query  378  SDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVV  199
            S  RYVI IK G Y E V+VDKKKT IMF+GDG   T I  +RNV DG  TF SATVAVV
Sbjct  206  SSKRYVIRIKGGVYRENVEVDKKKTNIMFLGDGRTNTIITASRNVVDGSTTFHSATVAVV  265

Query  198  GTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDV  19
            G  F+A  I+F+N+AGP KHQAVALR   D S F++C F+ +QDTLYVH+ RQFF +C +
Sbjct  266  GANFLARDITFQNTAGPSKHQAVALRVGGDLSAFFNCDFLAFQDTLYVHNNRQFFVKCLI  325

Query  18   YGTVDF  1
             GTVDF
Sbjct  326  TGTVDF  331



>ref|XP_004172115.1| PREDICTED: pectinesterase 3-like, partial [Cucumis sativus]
Length=592

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 163/410 (40%), Positives = 238/410 (58%), Gaps = 30/410 (7%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPD--L  1003
             + L   +L+   +   V  ++  ++  S + H +  S C  +LY D+C S + ++    L
Sbjct  34    VTLCSTLLIVGAVIGIVAGTTKSSSKYSGESHAIVKSTCSSTLYPDMCYSAISRSEGAML  93

Query  1002  RAKSIPEIISATVNVTVSEIKTAAANCSRIRRV--VPDLGTMESRALYVCLELFSDTLAD  829
             + K+  ++I  ++N+TV   K    N  R++++  + ++   E  AL+ CLE   +TL +
Sbjct  94    KVKNQKDVIEISINITV---KAVEENYFRVKKLCGLKNISHRERIALHDCLETIDETLDE  150

Query  828   LRTVLDGLENSPAKRYA-----DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVE  670
             L   +  L   P K+       DL+TLLS+A+TNQ TCL+GF +  ++KN+R  + +   
Sbjct  151   LHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITNQETCLDGFSHDDADKNLRDKLKEGQM  210

Query  669   QISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDG-------FPKWLSR  511
             ++    SNAL+M   IK   +   A +      +  R+   E  D        +P+WLS 
Sbjct  211   EVEHMCSNALAM---IKNMTDTDIANYEAKMGITKNRKLMAEEDDNNNDDGIQWPEWLSA  267

Query  510   RDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYE  331
              DR LL++ +      +  +V VA DGSG+F+++ AA++AAP  S  RYVI IKAG Y E
Sbjct  268   GDRRLLQSSS------VTPNVVVAADGSGNFRTVAAAVAAAPVRSSKRYVIRIKAGVYRE  321

Query  330   YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAG  151
              V+V KKKT IMF+GDG   T I G+RNV DG  TF SAT+A VG GF+A  I+F+N+AG
Sbjct  322   NVEVPKKKTNIMFIGDGRRNTIITGSRNVVDGSTTFNSATMAAVGEGFLARDITFQNTAG  381

Query  150   PEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             P KHQAVALR  +D S FY C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  382   PSKHQAVALRVGADLSAFYQCDMLAYQDTLYVHSNRQFYINCLVSGTVDF  431



>ref|XP_008245555.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Prunus mume]
Length=545

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 145/401 (36%), Positives = 226/401 (56%), Gaps = 21/401 (5%)
 Frame = -3

Query  1179  PIMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTL---VKTP  1009
             P  L  +++L+AF   +   +S  +   S  I  +    C     ++ C++ +   +KT 
Sbjct  4     PSFLSVLIILSAFSCFSYGVTSTKDPNPS--IQSMVMQTCTEIEDQNSCLTNVQAELKTM  61

Query  1008  DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLAD  829
                 ++   I++A +  T++E + A    ++   +   +   E  A+  C EL   ++++
Sbjct  62    APDNQNSASILTAAIRHTLNEARAAIQKITKFSSL--SISYREQLAIEDCKELLDFSVSE  119

Query  828   LRTVLDGLE-----NSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQI  664
             L   L  +      ++      +L+  LS A++NQ TCLEGF  +++ +  F+   ++Q+
Sbjct  120   LAWSLGEMNKIRGGDNNEHYEGNLKAWLSAALSNQDTCLEGFEGTDRRLEDFVRGSLKQV  179

Query  663   SRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAP  484
             ++ + N L++ T++     KP    G   + SS   +H       P W++  D+ LL + 
Sbjct  180   TQLIGNVLALYTQLHSLPFKPPRDHGTPVNKSSSSDDH------LPAWITEGDQELLRS-  232

Query  483   TGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKT  304
                 +  + AD  VA DGSG +++I  A++AAP+ S  RYVI++K G Y E +D+ KKKT
Sbjct  233   --NPQSGVHADAIVAADGSGKYRTITEAVNAAPNYSSKRYVIYVKKGVYKENIDMKKKKT  290

Query  303   MIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVAL  124
              IMFVGDGIG+T + G RN   GW TFR+ATVAV G GFIA  ++F N+AGPE HQ VAL
Sbjct  291   NIMFVGDGIGQTVVTGRRNFMQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQGVAL  350

Query  123   RADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             R DSD S F+ C   GYQDTLY HS RQF+REC +YGT+DF
Sbjct  351   RVDSDQSAFFRCSMEGYQDTLYAHSLRQFYRECSIYGTIDF  391



>ref|XP_004303758.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1-like [Fragaria 
vesca subsp. vesca]
Length=578

 Score =   260 bits (664),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 157/359 (44%), Positives = 217/359 (60%), Gaps = 19/359 (5%)
 Frame = -3

Query  1047  YRDLCVSTLVKTPDL-RAKSIPEIISATVNVTVSEIK-TAAANCSRIRRVVPDLGTMESR  874
             Y +LC STL          S  ++I  ++N+T++ ++         I+++V  L   E  
Sbjct  68    YPELCFSTLATXAATTNVTSFKDVIGLSLNITITAVEHNFFTIKKLIKKLVKSLTKRERC  127

Query  873   ALYVCLELFSDTLADLRTVLDGLENSPA------KRYADLQTLLSTAMTNQYTCLEGFPY  712
             AL+ CLE   +TL +L   +  L   P+          DL+TL+S+A+TNQ TCL+GF +
Sbjct  128   ALHDCLETIDETLDELHEAVKDLFQYPSINKTLTAHADDLKTLISSAITNQETCLDGFSH  187

Query  711   S--NKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMK  538
             +  +K VR  + K  + + +  SNAL+M   IK   +   A    + SS++ R+   E  
Sbjct  188   AEADKIVRKSLEKGQKYVEKLCSNALAM---IKNMTDNDIANEMKAMSSTTNRKLKEERS  244

Query  537   DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVI  358
             +G+P+WLS  DR LL++ T      +  +V VA DGSG++K+++ A++AAP  S +RYVI
Sbjct  245   EGWPEWLSAADRHLLQSST------VTPNVIVAADGSGNYKTVSEAVAAAPSKSTSRYVI  298

Query  357   HIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAI  178
              IKAG Y E VDV K KT IMF+GDG   T I G+RNV DG  TF SATVA VG GF+A 
Sbjct  299   RIKAGVYRENVDVPKAKTNIMFLGDGRTTTIITGSRNVVDGDTTFNSATVAAVGAGFLAR  358

Query  177   GISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              I+F+N+AGP KHQAVALR  SD S FY C  + YQD+LYVHS RQFF  C + GTVDF
Sbjct  359   DITFQNTAGPSKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCFIAGTVDF  417



>ref|XP_004971511.1| PREDICTED: pectinesterase 1-like [Setaria italica]
Length=428

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 175/262 (67%), Gaps = 25/262 (10%)
 Frame = -3

Query  744  NQYTCLEGFPYSNKN-VRPFIIKRVEQISRHVSNALSMLTKIK----------KEKNKPS  598
            N+YTCL+GF Y N   +R +I   +  +SR VSN+L+M  K+           + + K  
Sbjct  17   NKYTCLDGFAYQNGGRMRRYIEPTLYHVSRMVSNSLAMAKKLPGAPSPSPSSAQAETKTE  76

Query  597  ALFGPSYSSSSFRQE---HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGS  427
            A   P       RQ    +G+M  GFP+W+   DR LL+AP       IKAD  VAKDGS
Sbjct  77   ATAAP-------RQPFVGYGQMVKGFPRWVRPGDRRLLQAPA----SGIKADAVVAKDGS  125

Query  426  GDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRN  247
            G+F ++ AA++AAP +S  RYVI+IKAG+Y E VDV KK   +MFVGDGIGKT IKG+RN
Sbjct  126  GNFTTVAAAVAAAPTNSRRRYVIYIKAGAYIENVDVGKKHVNLMFVGDGIGKTVIKGSRN  185

Query  246  VKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQD  67
            V DG  TFRSATVA+VG  F+   ++ ENSAGP KHQAVALR  +D S FY C FVGYQD
Sbjct  186  VIDGSTTFRSATVALVGNNFLGRDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQD  245

Query  66   TLYVHSRRQFFRECDVYGTVDF  1
            TLYVHS RQFFR+CD+YGT+DF
Sbjct  246  TLYVHSLRQFFRDCDIYGTIDF  267



>ref|XP_004494573.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Cicer arietinum]
Length=543

 Score =   259 bits (661),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 150/401 (37%), Positives = 224/401 (56%), Gaps = 30/401 (7%)
 Frame = -3

Query  1170  LVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKS  991
             L  ++LL +F  +  FQ    +   + D+  +   AC     ++ C++ +          
Sbjct  8     LFILILLPSFDKVLSFQDEIPSEIQTQDMQALIAQACMDIENQNSCLTNIQNELTKTGPP  67

Query  990   IP-EIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLEL-------FSDTL  835
              P  +ISA +  T++E   A  N ++I      +   E  A+  C EL        + +L
Sbjct  68    SPTSVISAALRTTINEAIGAINNMTKISTF--SVNNREQLAIEDCKELIDFSVSELAWSL  125

Query  834   ADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRH  655
              ++R +  G  N  A+   +L+  LS A++NQ TC+EGF  +++ +  FI   + Q+++ 
Sbjct  126   GEMRRIRAGDRN--AQYEGNLEAWLSAALSNQDTCIEGFEGTDRRLESFISGSLTQVTQL  183

Query  654   VSNALSMLTKIKK---EKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAP  484
             +SN LS+ T++ +      + + L G S  SS F           P+W++  D+ LL++ 
Sbjct  184   ISNVLSLYTQLHRLPFRSPRNTTLLGTSDVSSEF-----------PEWMTDADQELLKS-  231

Query  483   TGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKT  304
                +     A+  VA DGSG +++IN A++AAP  S+ RYVI++K G Y E VD+ KK T
Sbjct  232   ---RPHGAVANAIVALDGSGHYRTINEAVNAAPSHSNRRYVIYVKKGLYKENVDMKKKMT  288

Query  303   MIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVAL  124
              IM VGDGIG+T I  NRN   GW TFR+AT AV G GFIA  ++F N+AGP  HQAVAL
Sbjct  289   NIMIVGDGIGQTIITSNRNFMQGWTTFRTATFAVSGKGFIAKDVTFRNTAGPVNHQAVAL  348

Query  123   RADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             R DSD S F+ C   G QDTLY HS RQF+REC++YGT+DF
Sbjct  349   RVDSDQSAFFRCSIEGNQDTLYAHSLRQFYRECEIYGTIDF  389



>emb|CDP05068.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   260 bits (664),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 160/424 (38%), Positives = 237/424 (56%), Gaps = 43/424 (10%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSA----CDRSLYRDLCVSTLVKTP  1009
             I+L  ++++A+ +S  V  +    A++   +H+    A    C ++ Y  LCV +L+  P
Sbjct  40    IILAAILIVASAISAAVVVALRNKASSDAALHRKPSRAISRTCSKTRYPALCVDSLLDFP  99

Query  1008  DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYV-CLELFSDTLA  832
                  S  +++  TVN+T+  +  A  + S I  V  D+G   SR+ Y  CLEL +D++ 
Sbjct  100   GALTASDKDLVHITVNMTLQRLGKALYDVSDIGYVAMDVG---SRSAYDDCLELLADSVD  156

Query  831   DLRTVLDGLENSPAKRYA----------------DLQTLLSTAMTNQYTCLEGF-PYSNK  703
              L   L  +  SPA                    D+ T LS A+TNQ TC EGF      
Sbjct  157   LLARSLTTM--SPASTEGEGDGSGSSSSYVGSTQDVLTWLSAALTNQDTCTEGFGEVGGG  214

Query  702   NVRPFIIKRVEQISRHVSNALSMLTKIKKEK---------NKPSALFGPSYSSSSFRQEH  550
             +V+  + ++++ ++  VSN L++ +    +          N+   L G       +   H
Sbjct  215   SVKDQMSEKLKDLTELVSNCLAIYSAAGGDGDDFSGIPIGNRRRRLMGDD--EEGYGGNH  272

Query  549   GEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDT  370
              + ++ FPKWL R+DR LL+ P       I+AD+ V+KDG+G  K++  A+  AP+ S  
Sbjct  273   KQQEEEFPKWLPRKDRRLLQVPA----TSIQADIIVSKDGNGTVKTVGEAIKKAPEHSTR  328

Query  369   RYVIHIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGT  193
             R +I++KAG Y E  + V +KKT +MF+GDG GKT I G +++ D   TF +A+ A  G 
Sbjct  329   RIIIYVKAGKYEEDNLKVGRKKTNLMFIGDGKGKTVISGGKSIFDKVTTFHTASFAATGA  388

Query  192   GFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYG  13
             GFIA  ++FEN AGP KHQAVALR  +D++V Y C  VGYQDTLYVHS+RQFFRECDVYG
Sbjct  389   GFIARDMTFENWAGPSKHQAVALRVGADHAVVYRCSIVGYQDTLYVHSQRQFFRECDVYG  448

Query  12    TVDF  1
             TVDF
Sbjct  449   TVDF  452



>ref|XP_007146997.1| hypothetical protein PHAVU_006G088000g [Phaseolus vulgaris]
 gb|ESW18991.1| hypothetical protein PHAVU_006G088000g [Phaseolus vulgaris]
Length=543

 Score =   258 bits (659),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 152/398 (38%), Positives = 230/398 (58%), Gaps = 23/398 (6%)
 Frame = -3

Query  1170  LVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTL-VKTPDLRAK  994
             L  ++LL +F +L+ +Q       T  D+  +   AC     ++ C++ +  +   +   
Sbjct  7     LFILMLLPSFQALS-YQPIPSEIQT-QDMQALIAQACMDIENQNSCLTNIHNELTKIGPP  64

Query  993   SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLEL-------FSDTL  835
             S   ++SA +  T++E   A  N ++I      +   E +A+  C EL        + +L
Sbjct  65    SPTSVMSAALKATLNEAVMAIDNMTKITTF--SVSYREQQAIEDCKELVDFSVSELAWSL  122

Query  834   ADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRH  655
              ++R +  G  +S  +   +L+  LS A++NQ TCLEGF  +++ +  +I   + Q+++ 
Sbjct  123   GEMRRIRAG--DSNVQYEGNLEAWLSAALSNQDTCLEGFEGTDRRLESYISGSLTQVTQL  180

Query  654   VSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGK  475
             +SN LS+ T++     KP     P  ++++      +    FP+W+S  D+ LL A    
Sbjct  181   ISNVLSLYTQLHTLPFKP-----PRNTTAATSTTQSDGTSEFPQWMSEDDQELLRA----  231

Query  474   KKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIM  295
             K + ++AD  VA DG+G ++SI  A++AAP  S  RYVI++K G Y E VD+ KK T IM
Sbjct  232   KPQGVRADAVVALDGTGHYRSIAEAVNAAPSHSPRRYVIYVKKGLYKENVDMKKKMTNIM  291

Query  294   FVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRAD  115
              VGDGIG+T I  NRN   GW TFR+AT+AV G GFIA  +SF N+AGP  HQAVALR D
Sbjct  292   LVGDGIGQTIITSNRNFMQGWTTFRTATLAVSGKGFIARDMSFRNTAGPVNHQAVALRVD  351

Query  114   SDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             SD S FY C   G+QDTLY HS RQF+REC++YGT+DF
Sbjct  352   SDQSAFYRCSVEGHQDTLYAHSLRQFYRECEIYGTIDF  389



>gb|KHN03710.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=415

 Score =   254 bits (649),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 189/319 (59%), Gaps = 69/319 (22%)
 Frame = -3

Query  948  EIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLE---NSPAKRYA  778
            EI++ + NCS +++++ +L  ++ RAL  CL+LF DT  +L+  +D L       +KR+ 
Sbjct  3    EIRSTSYNCSGLKKMLKNLNPLDQRALDYCLKLFEDTSVELKATIDDLSIKSTIGSKRHH  62

Query  777  DLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPS  598
            DLQTLLS AMTN YT L+GF YS   V   I K++ QIS HVSN+L+ML K+        
Sbjct  63   DLQTLLSGAMTNLYTYLDGFAYSKGRVGDRIEKKLLQISHHVSNSLAMLNKVP-------  115

Query  597  ALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDF  418
                                 G  K  +  D               + ++ VAKDG+G+F
Sbjct  116  ---------------------GVEKLTTSSDSD-------------EFNLVVAKDGTGNF  141

Query  417  KSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKD  238
             +I  ALS AP+SS TR+VIH+ AG+Y+E V+V +KKT +MFVGDGIGKT +KG+RNV+D
Sbjct  142  TTIGEALSVAPNSSTTRFVIHVTAGAYFENVEVIRKKTNLMFVGDGIGKTVVKGSRNVED  201

Query  237  GWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLY  58
            GW  F+SATVAVVG GFIA GI+FEN                         FVGYQDTLY
Sbjct  202  GWTIFQSATVAVVGAGFIAKGITFEN-------------------------FVGYQDTLY  236

Query  57   VHSRRQFFRECDVYGTVDF  1
            VHS RQF+RE D+YGTVDF
Sbjct  237  VHSLRQFYRERDIYGTVDF  255



>ref|XP_002512462.1| Pectinesterase PPE8B precursor, putative [Ricinus communis]
 gb|EEF49914.1| Pectinesterase PPE8B precursor, putative [Ricinus communis]
Length=535

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/396 (36%), Positives = 226/396 (57%), Gaps = 32/396 (8%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA-KSIP  985
             ++ L    SL VF   ++   +S D   +   AC     +D C+S ++     +  ++  
Sbjct  9     IIFLLLPSSLQVF---SIVIPSSLDTQTLIMQACTGVGNQDSCLSNMLAELGKKGTRNAT  65

Query  984   EIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL  805
              ++SA +  +++E + A    ++   +   +   E  A+  C EL   ++++L   L  +
Sbjct  66    SVLSAAMQASLNEARLAIDTITKFNAL--SVSYREQLAIEDCKELLDFSVSELAWSLAEM  123

Query  804   E-----NSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNAL  640
             E     ++      +L+  LS A++NQ TCLEGF  +++++  F+   ++Q+++ + N L
Sbjct  124   EKIRAGDNNVAYEGNLKAWLSAALSNQDTCLEGFEGTDRHLENFVKGSLKQVTQLIGNVL  183

Query  639   SMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDG---FPKWLSRRDRALLEAPTGKKK  469
             ++ T++     KPS               +G + +    FP+W++  D+ LL+  T    
Sbjct  184   ALYTQLHSMPFKPS--------------RNGTITNTSPEFPQWMTEGDQELLKFGT----  225

Query  468   RKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFV  289
               +  D  V+ DGSG + +I  AL+ AP+ S+ RY+I++K G Y E +D+ KKKT IM V
Sbjct  226   LGVHVDAIVSLDGSGHYNTITQALNEAPNHSNRRYIIYVKQGIYRENIDMKKKKTNIMLV  285

Query  288   GDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSD  109
             GDGIGKT + GNRN   GW TFR+ATVAV G GFIA  ++F N+AGPE HQAVALR DSD
Sbjct  286   GDGIGKTVVTGNRNFMQGWTTFRTATVAVSGRGFIARDMTFRNTAGPENHQAVALRVDSD  345

Query  108   YSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              S FY C   GYQDTLY HS RQF+REC++YGT+D+
Sbjct  346   QSAFYRCSMEGYQDTLYAHSLRQFYRECNIYGTIDY  381



>ref|XP_010445741.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Camelina sativa]
Length=589

 Score =   259 bits (661),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 157/405 (39%), Positives = 222/405 (55%), Gaps = 32/405 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             +++V V+    F  +    S+      +    Q     C +SLY +LC+ TL+  P    
Sbjct  41    VLVVGVICFGIFAGIRAVDSNKTEPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  996   KSIPEIISATVNVTVSEIKTAAANCSRIR--RVVPDLGTMESRALY-VCLELFSDTLADL  826
                 E+I  + N T+     A  + S I   ++ P +     R+ Y  CLEL  D++  L
Sbjct  101   ADENELIHISFNATLQRFSKALYSSSTITYTQMPPRV-----RSAYDSCLELLDDSVDAL  155

Query  825   RTVLDGLEN-SPAKRYADLQTLLSTAMTNQYTCLEGFPYSNK---NVRPFIIKRVEQISR  658
                L  +   S  + ++D+ TLLS+AMTN  TC +GF  +      V+  +I  V+ +S 
Sbjct  156   SRALSSVVVVSGDESHSDVMTLLSSAMTNHDTCTDGFDETGGQGGGVKDQVIGAVKDLSE  215

Query  657   HVSNALSMLT-KIKKEKNKPSA----LFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALL  493
              VSN L++   K+K     P      L G         +E  E++   P WL R DR LL
Sbjct  216   MVSNCLAIFAGKVKDLSGVPVVNNRRLLG--------TEETEELQ--LPNWLKREDRELL  265

Query  492   EAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY-VDVD  316
               PT      I+AD+TV+KDG+G FK+I  A+  AP+ S  R+VI++KAG Y E  + V 
Sbjct  266   GTPT----SAIQADITVSKDGTGTFKTITEAIKKAPEHSGRRFVIYVKAGRYEEENLKVG  321

Query  315   KKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQ  136
             +KKT +MF+GDG GKT I G +++ D   TF +AT A  G GFI   ++FEN AGP KHQ
Sbjct  322   RKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDMTFENYAGPAKHQ  381

Query  135   AVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR   D++V Y C  +GYQD LYVHS RQF+REC++YGTVDF
Sbjct  382   AVALRVGGDHAVVYRCNIIGYQDALYVHSNRQFYRECEIYGTVDF  426



>ref|XP_010047423.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=578

 Score =   258 bits (660),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 169/412 (41%), Positives = 238/412 (58%), Gaps = 46/412 (11%)
 Frame = -3

Query  1158  VLLAAFLSLTVFQSSAMNATTS-DDIHQVAHS----ACDRSLYRDLCVSTL---------  1021
             VL+ A +++    S A   +++ DD H+ A S    +C  +LY DLC+S L         
Sbjct  27    VLVLALVAVCRLASQAPPRSSAIDDRHREARSLIKSSCSSTLYPDLCLSQLTSSPSSTSL  86

Query  1020  -VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFS  844
              VKTP        ++I+  +N+T++ ++       ++    P L   +  AL+ CLE+  
Sbjct  87    AVKTPK-------DVIALALNLTIAYVQHNYFTIKKVAAARPGLTARDRTALHDCLEMVD  139

Query  843   DTLADLRTVL-------DGLENSPAKRYADLQTLLSTAMTNQYTCLEGF--PYSNKNVRP  691
             +TL ++   L       +G   S ++   D++TLLS AMTNQ TC+ G     ++K VR 
Sbjct  140   ETLDEVHKTLVELLVYPNGGNKSVSELAEDMKTLLSAAMTNQDTCVNGLSDESADKEVRE  199

Query  690   FIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFR--QEHGEMKDGFPKWL  517
              ++     +    SNAL+M+      KN   A       SSS R  +E G+    +P+WL
Sbjct  200   ALLGGQMHVFHLCSNALAMV------KNMTDADVANERLSSSNRRLKEEGDPIR-WPEWL  252

Query  516   SRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSY  337
             S  DR LL++ T      +  DVTVA DG+GD+++++AA++AAP+ S  RYVI IKAG Y
Sbjct  253   SVGDRRLLQSTT------VTPDVTVAADGTGDYRTVSAAVAAAPEGSARRYVIKIKAGVY  306

Query  336   YEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENS  157
              E V+V KKK  +MFVGD    T I G+RNV DG  TF SATVAVVG GF+A  I+F+N+
Sbjct  307   KENVEVPKKKVNLMFVGDDRTTTIITGSRNVVDGSTTFHSATVAVVGEGFLARDITFQNT  366

Query  156   AGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AGP KHQAVALR  +D+S F+ C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  367   AGPSKHQAVALRVGADFSAFHRCDMLAYQDTLYVHSLRQFYVGCLVAGTVDF  418



>ref|XP_010029512.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=587

 Score =   259 bits (661),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 156/378 (41%), Positives = 222/378 (59%), Gaps = 29/378 (8%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPE--IISATVNVTVSEIKTAAANCSRI-  913
             H +  S+C  + Y DLC S +   P   A    +  +I A++N+T   ++       ++ 
Sbjct  61    HAILKSSCSSTRYPDLCYSAVAAFPGAAAGLATQKDVIEASLNITTVAVEHNFFAVEKLL  120

Query  912   RRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPA-----KRYAD-LQTLLSTA  751
              +    L   E RAL+ CLE   +TL +LR     L + P+     K++AD L+TL+S+A
Sbjct  121   SKRSKSLTKREKRALHDCLETIDETLDELREAERDLSSYPSAAKSLKQHADDLKTLMSSA  180

Query  750   MTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSY  577
             +TNQ TCL+GF +  +++ VR  + K    + +  SNAL+M+      KN   A      
Sbjct  181   ITNQETCLDGFSHEDADRQVRKALAKGQVHVEKMCSNALAMI------KNMTDADMEAER  234

Query  576   SSSSFRQEHGEM------KDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFK  415
              +++ R+   E       K G+P+WLS  DR LL++        +  DV VA DG+G +K
Sbjct  235   KAAANRKMLKEEDLVQGDKSGWPEWLSAGDRRLLQSTA------VIPDVVVAADGTGKYK  288

Query  414   SINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDG  235
             +I+ A++AAP+ S  RYVI I AG Y E V V KKKT +MF+GDG   T I G+R+VK G
Sbjct  289   TISEAVAAAPEKSSKRYVIKINAGVYRENVQVPKKKTNLMFIGDGRTTTIITGDRSVKGG  348

Query  234   WPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYV  55
             + TF SATVAVVG  F+A  I+F+N+AGP  HQAVALR  +D S FY+C  + YQDTLYV
Sbjct  349   FTTFESATVAVVGERFLAKSITFQNTAGPSNHQAVALRVGADLSAFYECDILAYQDTLYV  408

Query  54    HSRRQFFRECDVYGTVDF  1
             H+ RQFF +C + GTVDF
Sbjct  409   HNNRQFFVKCLIAGTVDF  426



>ref|XP_010482728.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Camelina sativa]
Length=589

 Score =   259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 158/405 (39%), Positives = 222/405 (55%), Gaps = 32/405 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             +++V V+    F  +    S+      +    Q     C +SLY +LC+ TL+  P    
Sbjct  41    VLVVGVICFGIFAGIRAVGSNKTEPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  996   KSIPEIISATVNVTVSEIKTAAANCSRIR--RVVPDLGTMESRALY-VCLELFSDTLADL  826
                 E+I  + N T+     A  + S I   ++ P +     R+ Y  CLEL  D++  L
Sbjct  101   ADENELIHISFNATLQRFSKALYSSSTITYTQMPPRV-----RSAYDSCLELLDDSVDAL  155

Query  825   RTVLDGLEN-SPAKRYADLQTLLSTAMTNQYTCLEGFPYSNK---NVRPFIIKRVEQISR  658
                L  +   S  + ++D+ TLLS+AMTN  TC +GF  +      V+  +I  V+ +S 
Sbjct  156   SRALSSVVVVSGDESHSDVMTLLSSAMTNHDTCTDGFDETGGQGGGVKDQVIGAVKDLSE  215

Query  657   HVSNALSMLT-KIKKEKNKPSA----LFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALL  493
              VSN L++   K+K     P      L G         +E  E++   P WL R DR LL
Sbjct  216   MVSNCLAIFAGKVKDLSGVPVVNNRRLLGI--------EETEELQS--PNWLKREDRELL  265

Query  492   EAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY-VDVD  316
               PT      I+AD+TV+KDG+G FK+I  A+  AP+ S  R+VI++KAG Y E  + V 
Sbjct  266   GTPT----SAIQADITVSKDGTGTFKTITEAIKKAPEHSGRRFVIYVKAGRYEEENLKVG  321

Query  315   KKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQ  136
             +KKT +MF+GDG GKT I G +++ D   TF +AT A  G GFI   ++FEN AGP KHQ
Sbjct  322   RKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDMTFENYAGPAKHQ  381

Query  135   AVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR   D++V Y C  +GYQD LYVHS RQFFREC++YGTVDF
Sbjct  382   AVALRVGGDHAVVYRCNIIGYQDALYVHSNRQFFRECEIYGTVDF  426



>ref|XP_008450601.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
isoform X2 [Cucumis melo]
Length=481

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 205/334 (61%), Gaps = 25/334 (7%)
 Frame = -3

Query  981  IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELF-------SDTLADLR  823
            ++SA +  T++E + A  + ++           E  A+  C EL        + +LA+++
Sbjct  12   VLSAAIRATINEARQAIESITKFSTF--SFSYREEMAIEDCKELLDFSVAELAWSLAEMK  69

Query  822  TVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNA  643
             +  G   +P +   +L+  LS A++NQ TCLEGF  +++++  FI   ++Q++  +SN 
Sbjct  70   RIRAGKNEAPDE--GNLKAWLSAALSNQDTCLEGFEGTDRHIVGFIRGSLKQVTLLISNV  127

Query  642  LSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRK  463
            L++ T++       S  F P  + +  + +  E    FP W+   +  L+++      R 
Sbjct  128  LALYTQLH------SLPFQPPRNETMEKTKSSE----FPDWMMDSEHKLVKS----HPRN  173

Query  462  IKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGD  283
            +  D  VA DGSGDF+SI  A++ AP  S+ RY+I++K G Y E +D+ +KKT IMF+GD
Sbjct  174  VHVDAIVALDGSGDFRSITEAVNEAPSYSNRRYIIYVKKGVYKENIDMKRKKTNIMFIGD  233

Query  282  GIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYS  103
            GIG+T + G+RN   GW TFR+ATVAV G GFIA  ++F N+AGPE HQAVALR DSD S
Sbjct  234  GIGETIVTGSRNFLQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQAVALRVDSDQS  293

Query  102  VFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             F+ C F G+QDTLYVHS RQF+REC++YGT+D+
Sbjct  294  AFFRCSFEGHQDTLYVHSLRQFYRECNIYGTIDY  327



>ref|XP_006385198.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP62995.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/405 (37%), Positives = 233/405 (58%), Gaps = 28/405 (7%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAK  994
             +    +L+A  +++ +  +S  N+T ++  H +  ++C+ + Y DLC S     PD  + 
Sbjct  21    IFASFLLVATIIAIAIGVNSRKNSTKNEAAHALLMASCNSTRYPDLCYSAATSFPDQASG  80

Query  993   SIPE-IISATVNVTVSEIKTAAANCSRIRR----VVPDLGTMESRALYVCLELFSDTLAD  829
               P+ +I   +N T+  I     N  +IR        DL   +  AL  C + +  +LAD
Sbjct  81    DDPKTVILNNINKTIDAI-----NSKKIRDDKILSTEDLTAQQKTALKDCRQNYDSSLAD  135

Query  828   LRTVLDGLENSPAKR-------YADLQTLLSTAMTNQYTCLEGFPYS--NKNVRPFIIKR  676
             L  V   L  +P K+        A+LQT +S+ ++ Q +CL+GF +S  ++  R  +   
Sbjct  136   LDNVWGELNRNPNKKKLQQKSYAAELQTKVSSCISGQQSCLDGFSHSWLSRLFRKALGPS  195

Query  675   VEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRAL  496
              +   +  SNAL+++ K+ ++ +   A+     ++S    E  +  +G+P+WLS  DR L
Sbjct  196   EDNAGKMCSNALALINKLIEDTD---AIANRLKTTSRKLMEEDDSDEGWPEWLSVTDRRL  252

Query  495   LEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVD  316
              ++        +  DV VA DGSG +++++AA++AAP  S  RY+I IKAG Y E V+V 
Sbjct  253   FQSSL------LTPDVVVAADGSGKYRTVSAAVAAAPKHSAKRYIIKIKAGVYRENVEVP  306

Query  315   KKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQ  136
              +KT IMF+GDG  KT I  +RNV DG  T+ SATVAVVG GF+A  I+F+N+AG  K+Q
Sbjct  307   SEKTNIMFLGDGRKKTIITASRNVVDGGTTYHSATVAVVGQGFLARDITFQNTAGASKYQ  366

Query  135   AVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR +SD++ FY C  + YQ+TLYVHS RQFF  C + GTVDF
Sbjct  367   AVALRVESDFAAFYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDF  411



>gb|KFK26958.1| hypothetical protein AALP_AA8G315400 [Arabis alpina]
Length=584

 Score =   258 bits (659),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 147/362 (41%), Positives = 212/362 (59%), Gaps = 24/362 (7%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI---RRVVPDL  892
             C +S Y++LC+ TL+  P     +  E+I  + N T+     A  + S I    ++ P +
Sbjct  76    CSKSQYQNLCIDTLLDFPGALTANEQELIHISFNATLQGFSKALYSSSSISYTNKMPPRV  135

Query  891   GTMESRALY-VCLELFSDTLADLRTVLDGL---ENSPAKRYADLQTLLSTAMTNQYTCLE  724
                  R+ Y  CLEL  D++  L   L  +        + ++D+ T LS+AMTN  TC +
Sbjct  136   -----RSAYDSCLELLDDSVDALSRALSLVAIASEDNGEHHSDVVTWLSSAMTNHDTCTD  190

Query  723   GFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGE  544
             GF   +  V+  II+ V+ +S  VSN L++ +   K+ +    +       ++ +  + E
Sbjct  191   GFEEISSGVKDQIIEAVKDLSEMVSNCLAIFSGNVKDLSGVPVV-------NNRKLLNTE  243

Query  543   MKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRY  364
               + FPKWL+R DR LL  P       I+AD+TV+KDG+G FK+I  A+  AP+ S  R+
Sbjct  244   ETEEFPKWLNRGDRELLGTPA----TTIQADITVSKDGNGTFKTIAEAIKKAPEHSSRRF  299

Query  363   VIHIKAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGF  187
             VI++K+G Y E  + V +KKT IMF+GDG GKT I G +++ +   TF +AT A  G GF
Sbjct  300   VIYVKSGRYEEENLKVGRKKTNIMFIGDGKGKTVITGGKSIANDLTTFHTATFAATGAGF  359

Query  186   IAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTV  7
             I   ++FEN AGP KHQAVALR   D++V Y C  +GYQD LYVHS RQFFRECD+YGTV
Sbjct  360   IVRDMTFENYAGPAKHQAVALRVGGDHAVVYRCNVIGYQDALYVHSNRQFFRECDIYGTV  419

Query  6     DF  1
             DF
Sbjct  420   DF  421



>ref|NP_200149.1| pectin methylesterase PCR fragment F [Arabidopsis thaliana]
 sp|Q9FK05.1|PME61_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
61; Includes: RecName: Full=Pectinesterase inhibitor 61; AltName: 
Full=Pectin methylesterase inhibitor 61; Includes: RecName: 
Full=Pectinesterase 61; Short=PE 61; AltName: Full=AtPMEpcrF; 
AltName: Full=Pectin methylesterase 61; Short=AtPME61 
[Arabidopsis thaliana]
 gb|AAK28637.1|AF360340_1 putative pectinesterase [Arabidopsis thaliana]
 dbj|BAB09799.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK93754.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AED96345.1| putative pectinesterase/pectinesterase inhibitor 61 [Arabidopsis 
thaliana]
Length=587

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 158/402 (39%), Positives = 218/402 (54%), Gaps = 28/402 (7%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             +++V VV    F  +    S       +    Q     C +SLY +LC+ TL+  P    
Sbjct  41    VLVVGVVCFGIFAGIRAVDSGKTEPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  996   KSIPEIISATVNVTVSEIKTAAANCSRIR--RVVPDLGTMESRALY-VCLELFSDTLADL  826
                 E+I  + N T+ +   A    S I   ++ P +     R+ Y  CLEL  D++  L
Sbjct  101   ADENELIHISFNATLQKFSKALYTSSTITYTQMPPRV-----RSAYDSCLELLDDSVDAL  155

Query  825   RTVLDGLEN-SPAKRYADLQTLLSTAMTNQYTCLEGFPY---SNKNVRPFIIKRVEQISR  658
                L  +   S  + ++D+ T LS+AMTN  TC +GF         V+  +I  V+ +S 
Sbjct  156   TRALSSVVVVSGDESHSDVMTWLSSAMTNHDTCTDGFDEIEGQGGEVKDQVIGAVKDLSE  215

Query  657   HVSNALSMLT-KIKKEKNKPSALFGPSYSSSSFRQEHG-EMKDGFPKWLSRRDRALLEAP  484
              VSN L++   K+K     P           + R+  G E  +  P WL R DR LL  P
Sbjct  216   MVSNCLAIFAGKVKDLSGVPVV---------NNRKLLGTEETEELPNWLKREDRELLGTP  266

Query  483   TGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY-VDVDKKK  307
             T      I+AD+TV+KDGSG FK+I  A+  AP+ S  R+VI++KAG Y E  + V +KK
Sbjct  267   T----SAIQADITVSKDGSGTFKTIAEAIKKAPEHSSRRFVIYVKAGRYEEENLKVGRKK  322

Query  306   TMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVA  127
             T +MF+GDG GKT I G +++ D   TF +AT A  G GFI   ++FEN AGP KHQAVA
Sbjct  323   TNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDMTFENYAGPAKHQAVA  382

Query  126   LRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             LR   D++V Y C  +GYQD LYVHS RQFFREC++YGTVDF
Sbjct  383   LRVGGDHAVVYRCNIIGYQDALYVHSNRQFFRECEIYGTVDF  424



>ref|XP_008783207.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Phoenix dactylifera]
Length=588

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 160/395 (41%), Positives = 222/395 (56%), Gaps = 23/395 (6%)
 Frame = -3

Query  1167  VPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSI  988
             V V LL  F + T    S  N T +  I Q     C  + Y  LCVS+L+  P       
Sbjct  48    VSVGLLVRFRART--SGSGTNRTPTQAISQT----CALTRYPALCVSSLLDFPGALEAGD  101

Query  987   PEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLR---TV  817
              +++  ++N+TV  +  A    S +  V  D   +   A   C+EL  D+L  L     V
Sbjct  102   RDLVHISLNMTVQRVGKALYQASAVAGVSMDF--LARSAYDDCMELLDDSLDQLSQSLAV  159

Query  816   LDGLENSPAKRY-ADLQTLLSTAMTNQYTCLEGFP-YSNKNVRPFIIKRVEQISRHVSNA  643
             +    + PA     D+ T LS+A+TNQ TC EG    +N  VR  +   ++ ++  VSN 
Sbjct  160   IAPTGSHPAGASDEDVLTWLSSAVTNQDTCTEGLADVANGYVRAQMESNLKDLAELVSNC  219

Query  642   LSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDG-FPKWLSRRDRALLEAPTGKKKR  466
             L++ +   + K+     F      +  R+      DG FP+W+ RRDR LL+ P  K   
Sbjct  220   LAIFSAASRNKD-----FSGIPIQNKKRRLLSSAGDGEFPEWVGRRDRRLLQVPAAK---  271

Query  465   KIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVG  286
              I+AD+ VAKDG+G  KSI AA+ AAP+ S  R +I++KAG Y E + V +KKT +MF+G
Sbjct  272   -IQADMVVAKDGNGTHKSIAAAVKAAPELSARRIIIYVKAGRYVENIKVGRKKTNLMFIG  330

Query  285   DGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDY  106
             DG G T + G+R+V D + TF +AT A  G GFI   ++ EN AGP KHQAVALR  +D 
Sbjct  331   DGKGMTIVAGSRSVADKYTTFSTATFASTGNGFIMKDMTIENWAGPAKHQAVALRVGADQ  390

Query  105   SVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +V Y C  +GYQDTLYVHS+RQFFRECD++GTVDF
Sbjct  391   AVVYRCNIIGYQDTLYVHSQRQFFRECDIFGTVDF  425



>ref|XP_009338231.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Pyrus x bretschneideri]
Length=536

 Score =   256 bits (655),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 148/377 (39%), Positives = 217/377 (58%), Gaps = 26/377 (7%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVST----LVKTPDLRAKSIPEIISATVNVTVSEIKTA  934
             T+S  I  +    C     R+LC++     L KT      S+  II+A +  T++E K A
Sbjct  22    TSSHSIQSMVTQTCTDIDDRNLCLANVQAELQKTGPQIQDSV-SIITAALRHTLNETKNA  80

Query  933   AANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL-----ENSPAKRYADLQ  769
                 ++   +   +   ES A+  C EL   ++++L   L  +      ++      DL+
Sbjct  81    IQMITKFNSL--SISYRESVAIEDCKELLDYSVSELAWSLGEMIKIRGGDTNVHYEGDLK  138

Query  768   TLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALF  589
             + LS A++NQ TCLEGF  +++ +  F+   ++Q+++ + N L++ T++    + P    
Sbjct  139   SWLSAALSNQDTCLEGFEGTDRRLESFVRGSLKQVTQLIGNVLALYTQLYSLPSPPGDHG  198

Query  588   GPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA-PTGKKKRKIKADVTVAKDGSGDFKS  412
              P   SSS         D FP W+S  D+AL+++ P    K  +     VA DGSG +++
Sbjct  199   PPMNKSSS--------GDDFPAWMSEDDKALVKSNPKSGAKHAV-----VAADGSGQYRT  245

Query  411   INAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGW  232
             I  A++ AP+ S +RYVI++K G Y E +D+ KKKT IMFVGDGIG+T I GNRN   GW
Sbjct  246   ITEAVNEAPNYSPSRYVIYVKKGIYKENIDLKKKKTNIMFVGDGIGQTIITGNRNFMQGW  305

Query  231   PTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVH  52
              TFR+ATVAV G GFIA  ++  N+AGP+ HQ VALR DSD S F+ C   G QDTLY H
Sbjct  306   TTFRTATVAVSGKGFIAREMTIRNTAGPQNHQGVALRVDSDQSAFFRCSIEGNQDTLYAH  365

Query  51    SRRQFFRECDVYGTVDF  1
             S RQF+REC +YGT+DF
Sbjct  366   SLRQFYRECSIYGTIDF  382



>ref|XP_008462453.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=598

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 162/379 (43%), Positives = 225/379 (59%), Gaps = 30/379 (8%)
 Frame = -3

Query  1083  HQVAHSACDRSLYRDLCVSTLVKTPD--LRAKSIPEIISATVNVTVSEIKTAAANCSRIR  910
             H +  S C  +LY D+C S + K+    L+ KS  ++I  ++N+TV   K    N  R++
Sbjct  71    HAIVKSTCSSTLYPDMCYSAISKSEGAMLKVKSQKDVIEVSINITV---KAVEENYFRVK  127

Query  909   RV--VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRYA-----DLQTLLSTA  751
             ++  + ++   E  AL+ CLE   +TL +L   +  L   P K+       DL+TLLS+A
Sbjct  128   KLCGLKNISHREKIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSA  187

Query  750   MTNQYTCLEGFPYSN--KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSY  577
             +TNQ TCL+GF + N  K +R  +     ++    SNAL+M   IK   +   A +    
Sbjct  188   ITNQETCLDGFSHDNADKTLRDKLKAGQMEVEHMCSNALAM---IKNMTDTDIANYEAKM  244

Query  576   SSSSFRQEHGEMKDG-------FPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDF  418
               +  R+   E +D        +P+WLS  DR LL++ +      +  +V VA DGSG+F
Sbjct  245   GITKNRKLMAEEEDNNNNDEIQWPEWLSAGDRRLLQSSS------VTPNVVVAADGSGNF  298

Query  417   KSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKD  238
             +++ AA++AAP+ S  RYVI IKAG Y E V+V KKKT IMF+GDG   T I G+RNV D
Sbjct  299   RTVAAAVAAAPEKSSKRYVIRIKAGVYRENVEVPKKKTNIMFMGDGRRNTIITGSRNVVD  358

Query  237   GWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLY  58
             G  TF+SATVA VG GF+A  I+F+N+AGP KHQAVALR  +D S FY C  + YQDTLY
Sbjct  359   GSTTFKSATVAAVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYQCDMLAYQDTLY  418

Query  57    VHSRRQFFRECDVYGTVDF  1
             VHS RQF+  C V GTVDF
Sbjct  419   VHSNRQFYINCLVSGTVDF  437



>ref|XP_010925933.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Elaeis guineensis]
Length=587

 Score =   258 bits (658),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 152/392 (39%), Positives = 225/392 (57%), Gaps = 26/392 (7%)
 Frame = -3

Query  1146  AFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISAT  967
             +F  L  F++ +  +  +    Q     C  +LY  LC+S+L+  P        +++  +
Sbjct  49    SFGLLVGFRAGSSGSGRNRSPTQAISQTCGLTLYPALCISSLLDFPGAFDARDRDLVHIS  108

Query  966   VNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYV-CLELFSDTLADLR---TVLDGLEN  799
             +N+T+  +  A    S I  V  D     +RA Y  C+EL  D+L  L     V+    +
Sbjct  109   LNMTMQRVSKALYGASAIAGVSMD---ALARAAYEDCMELLEDSLDQLSESLAVVSPSAS  165

Query  798   SPA-KRYADLQTLLSTAMTNQYTCLEGFP-YSNKNVRPFIIKRVEQISRHVSNALSMLTK  625
              PA     D+ T LS A+TNQ TC EG    ++  VR  +  +++ ++  VSN L++ + 
Sbjct  166   GPAGASNEDVLTWLSAALTNQDTCTEGLTDVADGYVRAQMQSKLKDLAELVSNCLAIFSA  225

Query  624   IKKEKNKPSALFGPSYSSSSFRQEHGEM---KDG-FPKWLSRRDRALLEAPTGKKKRKIK  457
             + + K+         +S    + +   +    DG FP+WL RRDR LL+ P  +    I+
Sbjct  226   VSRNKD---------FSGIPIKNKKRRLLSSGDGDFPEWLGRRDRKLLQVPVAQ----IQ  272

Query  456   ADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGI  277
             AD+ V+KDG+G +KSI  A+ AAP+ S  R +I++KAG Y E + V +KKT +MF+GDG 
Sbjct  273   ADMVVSKDGNGTYKSIADAVKAAPERSTRRIIIYVKAGRYDENIKVSRKKTNLMFIGDGK  332

Query  276   GKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVF  97
             GKT +  +R+V + + TF +AT A  G GFI   ++ EN AGP KHQAVALR  +D++V 
Sbjct  333   GKTIVAASRSVAENYTTFHTATFASTGNGFIMRDMTIENWAGPAKHQAVALRVGADHAVV  392

Query  96    YDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             Y C  +GYQDTLYVHS+RQFFRECDVYGTVDF
Sbjct  393   YRCNIIGYQDTLYVHSQRQFFRECDVYGTVDF  424



>ref|XP_011078160.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=567

 Score =   257 bits (657),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 169/408 (41%), Positives = 229/408 (56%), Gaps = 37/408 (9%)
 Frame = -3

Query  1161  VVLLAAFLSLTVFQSSAMNATTSDDIH------QVAHSACDRSLYRDLCVSTL---VKTP  1009
             + LL AF SL V    ++    S   H       V  + C  +LY  LCVST+       
Sbjct  15    IFLLTAFASLLVVAVISIAVVQSHKNHPNHGGDAVVKTTCAATLYPKLCVSTINAAATAA  74

Query  1008  DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLAD  829
              +  KS  +++   +N T+S ++       ++ R    L T E  AL+ CLE+  DTL +
Sbjct  75    SVAIKSSKDVLITALNYTISTVERNYFTVKKLVRSRKSLTTREKGALHDCLEMIDDTLDE  134

Query  828   LRTVLDGLENSPAKRYA------DLQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRV  673
             LR     L++   K Y+      +L  LLS A TNQ +CL+GF +  ++K VR  ++   
Sbjct  135   LRRSAAELKDFGFKNYSLADHKENLMILLSAAQTNQESCLDGFSHDKADKVVRRALVVGQ  194

Query  672   EQISRHVSNALSM---LTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDG-FPKWLSRRD  505
               + R VSN +++   LT  +  KN        SYSS   R   GE  +  +P+WLS  D
Sbjct  195   MHVFRLVSNVMAIIKNLTDTEMAKN--------SYSSPERRL--GENTNSEWPEWLSAGD  244

Query  504   RALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYV  325
             R LL+A T      +  DVTVA DGSG+F++++AA++AAP  S  RYVI IKAG Y E V
Sbjct  245   RRLLQAST------VTPDVTVAADGSGNFRTVSAAVAAAPGGSSRRYVIRIKAGVYRENV  298

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPE  145
             ++ + KT +MFVGDG   T I GNRN      TF SATVAVVG  F+A  I+F+N+AGP 
Sbjct  299   EIPRSKTNLMFVGDGRTTTIITGNRNGTSCSTTFNSATVAVVGDRFLARDITFQNTAGPS  358

Query  144   KHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KHQAVALR ++D   FY C  + YQDTLYVHS RQF+  C + GTVDF
Sbjct  359   KHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDF  406



>gb|EYU19641.1| hypothetical protein MIMGU_mgv1a003247mg [Erythranthe guttata]
Length=597

 Score =   258 bits (658),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 151/363 (42%), Positives = 219/363 (60%), Gaps = 19/363 (5%)
 Frame = -3

Query  1065  ACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGT  886
             AC R+ Y  LCV++L+  P   A S  +++  +VN+T+ +I  A +  + I  +  D+  
Sbjct  82    ACSRTRYPTLCVNSLLDFPGALAASDKDLVHISVNMTLQKIGRALSFAAEINNL--DMDP  139

Query  885   MESRALYVCLELFSDTLAD----LRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGF  718
                 A   CLEL   ++      L +V  G E  PA    D+ T LS A+TNQ TC EGF
Sbjct  140   HVRSAYDDCLELLDHSVDQFSRSLTSVAPGGE--PAGSTQDVITWLSAALTNQDTCTEGF  197

Query  717   PYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPS---YSSSSFRQEHG  547
                N +V+  +  R++ +S  VSN+L++        +  S +   +    +SSS R+EH 
Sbjct  198   DELNGDVKNQMSHRLKDLSELVSNSLAIYAAADGGGDDFSNIPIQNRRLLTSSSRRREHE  257

Query  546   EMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTR  367
                  FP +LS+R+R LL+ P       I AD+ V+KDG+G +K+I  A+  AP+ S+ R
Sbjct  258   HQ---FPMFLSKRERRLLDMPV----TAINADIIVSKDGNGTYKTIAEAIKKAPEHSNRR  310

Query  366   YVIHIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTG  190
             ++I+++AG Y E  + V +KKT IMF+GDG GKT I G ++V+D   TF +A+ A  G G
Sbjct  311   FIIYVRAGRYEENKLKVGRKKTNIMFIGDGKGKTVISGGKSVQDKLTTFHTASFAATGAG  370

Query  189   FIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGT  10
             FIA  I+FEN AG  KHQAVALR  +D++V Y C  +GYQDTLY HS+RQF+R+CD+YGT
Sbjct  371   FIARDITFENWAGASKHQAVALRVGADHAVVYRCNIIGYQDTLYTHSQRQFYRDCDIYGT  430

Query  9     VDF  1
             VDF
Sbjct  431   VDF  433



>ref|XP_010049073.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Eucalyptus grandis]
Length=589

 Score =   257 bits (657),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 151/363 (42%), Positives = 203/363 (56%), Gaps = 23/363 (6%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             C  + Y  LC+  L   PD    S  +++  + NVT+     A    S I  +      M
Sbjct  78    CGLTRYPALCLDALAAFPDAEGASQQDLVHISFNVTLQRFSKALYVSSTIGHL-----QM  132

Query  882   ESR---ALYVCLELFSDTLADLRTVLD----GLENSPAKRYADLQTLLSTAMTNQYTCLE  724
             E R   A   CLEL  D +  LR  L+    G   S +    D+ T LS AMTNQ TC E
Sbjct  133   EPRVRSAFDDCLELLDDAVDALRRSLNYVTPGGAKSASWSAQDVVTWLSAAMTNQDTCAE  192

Query  723   GFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGE  544
             GF   +  V+  + +R+  +S  VSN L++ +    E        G    +   R+  G 
Sbjct  193   GFADVSGGVKQLMAERMRDLSELVSNCLAIFSATAGED-----FDGVPIQNRRRRRLMGS  247

Query  543   MK-DGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTR  367
                DG P+WL R++R LL+ P       I+ADVTV+KDG+G  K+I+ A+  APD    R
Sbjct  248   SDGDGMPRWLRRKERRLLQMPV----TAIQADVTVSKDGNGTCKTISEAIKKAPDYGTRR  303

Query  366   YVIHIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTG  190
             ++I+++AG Y E  + V +KKT +MFVGDG   T I G +++ D   TF +A+ A  G G
Sbjct  304   FIIYVRAGRYEEDNLKVGRKKTNVMFVGDGKSNTIISGGKSIFDNMTTFHTASFAATGAG  363

Query  189   FIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGT  10
             FIA  I+FEN AGP KHQAVALR  +D++V Y C  +GYQDTLYVHS RQFFRECD+YGT
Sbjct  364   FIARDITFENWAGPAKHQAVALRVGADHAVVYRCNIIGYQDTLYVHSNRQFFRECDIYGT  423

Query  9     VDF  1
             VDF
Sbjct  424   VDF  426



>ref|XP_009421463.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Musa acuminata subsp. malaccensis]
Length=591

 Score =   257 bits (656),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 150/367 (41%), Positives = 216/367 (59%), Gaps = 16/367 (4%)
 Frame = -3

Query  1080  QVAHSACDRSLYRDLCVSTLVKTPD-LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  904
             Q    AC R+ Y  LCVS+L+  P  L A    +++  +VN+T+  +  A    S I   
Sbjct  71    QAISRACGRTRYPALCVSSLLDFPGALEAAGERDLVHVSVNMTLHRVGAAIHGASAIAGA  130

Query  903   VPDLGTMESRALYVCLELFSDTLADLRTVLDGLENSPAKRY-----ADLQTLLSTAMTNQ  739
               D  T+   A   C+EL   +L  L   L  +  S   R       D+ T LS A+TNQ
Sbjct  131   AMD--TLARSAYDDCMELLDHSLDLLSNSLLVVSPSSQARVKAVSGEDVLTWLSGALTNQ  188

Query  738   YTCLEGF-PYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSF  562
              TC EG  P  +  V+  +  +++ ++  VSN L++ + + + ++       P ++    
Sbjct  189   DTCNEGLQPVKDLYVKKHMANQLKDLTELVSNCLAIFSGVSRNEDFTGI---PIHNKKRK  245

Query  561   RQEHGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPD  382
                  ++ DGFP W++++DR LL+ P       I+AD+ V+KDG+G + SI  A+ AAP+
Sbjct  246   LLNAIDVDDGFPAWVAKKDRRLLQVPAAD----IQADMVVSKDGNGTYTSIVDAVKAAPE  301

Query  381   SSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAV  202
              S  R +I+IKAG YYE + V +KKT +MF+GDG  +T I G+R+V D + TF +AT A 
Sbjct  302   YSSRRIIIYIKAGRYYENIKVGRKKTNLMFIGDGKNQTIIAGSRSVYDNFTTFHTATFAA  361

Query  201   VGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECD  22
              GTGFI   I+ +N AGPEKHQAVALR  +D++V Y C  +GYQDTLYVHS+RQFFRECD
Sbjct  362   TGTGFIMRDITIQNWAGPEKHQAVALRVGADHAVVYRCNVIGYQDTLYVHSQRQFFRECD  421

Query  21    VYGTVDF  1
             +YGTVDF
Sbjct  422   IYGTVDF  428



>ref|XP_010685210.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=592

 Score =   257 bits (656),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 154/395 (39%), Positives = 212/395 (54%), Gaps = 33/395 (8%)
 Frame = -3

Query  1107  NATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSI---PEIISATVNVTVSEIKT  937
             N   S + H +  ++C  + Y DLC S +   P      I    ++I+A++N+T   ++ 
Sbjct  44    NPKLSHETHTILKASCSNTKYPDLCYSAIASAPSSTTTKISTQKDVIAASLNLTTLAVEH  103

Query  936   AAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL----------------  805
                   ++     +L   E  AL+ CLE   +TL +LR  L  L                
Sbjct  104   NFFTVEKLIETRKNLTVRERNALHDCLESIDETLDELRRTLQDLLSYTHTNNNNNNNNNN  163

Query  804   -ENSPAKRYAD-LQTLLSTAMTNQYTCLEGFPY--SNKNVRPFIIKRVEQISRHVSNALS  637
                   K YAD ++TL+S AMT+Q TCL+GF +  ++++VR  +      +    SNAL+
Sbjct  164   KRGKSLKDYADDMKTLVSAAMTDQETCLDGFSHNRADRHVRETLQSGQVHVEHMCSNALA  223

Query  636   MLTKIKKEKNKPSALFGPS--YSSSSFRQEHGEMKDGFPKWLSRRDRALL-EAPTGKKKR  466
             M+  +        A       Y+           K G+P+W+S  D+ +L E P      
Sbjct  224   MIKNMTDIDMAAEAATKKRQLYTDDDDDGGDHFYKFGWPRWMSSGDKRMLQEGPE-----  278

Query  465   KIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVG  286
               KAD  VA DGSGDF+SI  A+ AAPD S  RYVI IKAG Y E V+V KKK  +MF+G
Sbjct  279   --KADAVVAADGSGDFRSIAEAVKAAPDKSKKRYVIRIKAGVYQENVEVGKKKMNLMFIG  336

Query  285   DGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDY  106
             +G  KT I G +NV DG  TF SATVA+ G  F+A  ++FEN+AGP KHQAVALR  +D 
Sbjct  337   EGRTKTIITGKKNVVDGSTTFDSATVAITGDNFLARDLTFENTAGPSKHQAVALRVGADL  396

Query  105   SVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + FY C  + YQDTLYVH  RQFF +C + GTVDF
Sbjct  397   AAFYQCDILAYQDTLYVHKNRQFFVKCLIAGTVDF  431



>ref|XP_002865971.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42230.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=587

 Score =   256 bits (655),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 156/402 (39%), Positives = 217/402 (54%), Gaps = 28/402 (7%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             +++V V+    F  +    S       +    Q     C +SLY +LC+ TL+  P    
Sbjct  41    VLVVGVICFGIFAGIRAVDSGKTEPKQTSKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  996   KSIPEIISATVNVTVSEIKTAAANCSRIR--RVVPDLGTMESRALY-VCLELFSDTLADL  826
                 E+I  + N T+     A    S I   ++ P +     R+ Y  CLEL  D++  L
Sbjct  101   ADENELIHISFNATLQRFSKALYTSSTITYTQMPPRV-----RSAYDSCLELLDDSVDAL  155

Query  825   RTVLDGLEN-SPAKRYADLQTLLSTAMTNQYTCLEGF---PYSNKNVRPFIIKRVEQISR  658
                L  +   S  + ++D+ T LS+AMTN  TC +GF         V+  +I  V+ +S 
Sbjct  156   TRALSSVVVVSGDESHSDVMTWLSSAMTNHDTCTDGFDEIEGQGGEVKDQVIGAVKDLSE  215

Query  657   HVSNALSMLT-KIKKEKNKPSALFGPSYSSSSFRQEHG-EMKDGFPKWLSRRDRALLEAP  484
              VSN L++   K+K     P           + R+  G E  +  P WL R DR LL  P
Sbjct  216   MVSNCLAIFAGKVKDLSGVPVV---------NNRKLLGTEETEELPNWLKREDRELLGTP  266

Query  483   TGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY-VDVDKKK  307
             T      ++AD+TV+KDGSG FK+I  A+  AP+ S  R+VI++K+G Y E  + V +KK
Sbjct  267   T----SAVQADITVSKDGSGTFKTIAEAIKKAPEHSSRRFVIYVKSGRYEEENLKVGRKK  322

Query  306   TMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVA  127
             T +MF+GDG GKT I G +++ D   TF +AT A  G GFI   I+FEN AGP KHQAVA
Sbjct  323   TNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDITFENYAGPAKHQAVA  382

Query  126   LRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             LR   D++V Y C  +GYQD LYVHS RQFFREC++YGTVDF
Sbjct  383   LRVGGDHAVVYRCSIIGYQDALYVHSNRQFFRECEIYGTVDF  424



>ref|XP_008380988.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Malus domestica]
Length=613

 Score =   257 bits (657),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 160/415 (39%), Positives = 237/415 (57%), Gaps = 35/415 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLS---LTVFQSSAMNATTSDDIH----QVAHSACDRSLYRDLCVSTLV  1018
              +L   ++LA+ +S   L V +S A N   S  +     Q   +AC ++ +  LCV +L+
Sbjct  48    FLLAVALILASAVSAVVLIVGKSKASNPAASSALRRKPTQAISNACAKTRFPSLCVDSLL  107

Query  1017  KTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI--RRVVPDLGTMESRALYV-CLELF  847
               P   A S  +++  + N+T+  +  A    S +  R++ P      SR+ Y  CLEL 
Sbjct  108   DFPGSNAASEQDLVHISFNMTLQRLSKALYLSSSLSYRQMDP-----HSRSAYDDCLELL  162

Query  846   SDTLADLR----TVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPY-SNKNVRPFII  682
              D++  L     +V  G+E+S  +   D++T LS A+TNQ TC EGF      +V+  + 
Sbjct  163   DDSVDALSRALTSVAPGVESSSTQ---DVRTWLSAALTNQDTCGEGFAQIKGGDVKNEMD  219

Query  681   KRVEQISRHVSNALSMLTKIKKE-------KNKPSALFGPSYSSSSFRQEHGEMKDGFPK  523
             +R++ +S  VSN L++ + +  +       +NK   L G S        ++ ++   FPK
Sbjct  220   QRLKDLSELVSNCLAIYSAVAGDDFSGVPIQNKRRRLLGNSEMERDIMGDNADVSRDFPK  279

Query  522   WLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAG  343
             WL RR+R LL  P      +I+AD+ V+KDG+G +K+I  A+  AP+ S  R +I+++AG
Sbjct  280   WLGRRERRLLSVPV----WQIQADIIVSKDGNGTYKTIAEAIKKAPEYSSRRTIIYVRAG  335

Query  342   SYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISF  166
              Y E  + V +KKT +MFVGDG GKT I G ++V     TF +A+ A  G GFIA  I+F
Sbjct  336   RYEEKNLKVGRKKTNLMFVGDGKGKTVITGGKSVSQNLTTFHTASFAATGAGFIARDITF  395

Query  165   ENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             EN AGP KHQAVALR  +D++V Y C  +GYQDT YVHS RQF RE D+YGTVDF
Sbjct  396   ENYAGPAKHQAVALRIGADHAVVYLCNIIGYQDTFYVHSNRQFIRETDIYGTVDF  450



>ref|XP_002872845.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49104.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=453

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/296 (47%), Positives = 184/296 (62%), Gaps = 31/296 (10%)
 Frame = -3

Query  861  CLELFSDTLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNK-------  703
            CLEL  DT+ DL T +  L  S +    +++  LS AMTN  TCL+GF  SN        
Sbjct  19   CLELLDDTVFDLTTAVSELR-SHSPELHNVKMFLSAAMTNTRTCLDGFASSNNDENNNNK  77

Query  702  --NVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGF  529
               V   + + +  IS HVS++L+ML +I    N P  L               E   GF
Sbjct  78   TYGVAESLKESLFNISSHVSDSLAMLEEIPG--NIPGKL---------------EEDVGF  120

Query  528  PKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIK  349
            P W+S  DR LL+ P      + K ++ VA++G+ ++ +I  A+SAAP+SS+TR+VI+IK
Sbjct  121  PMWVSGSDRNLLQDPV----DETKVNLVVAQNGTSNYTTIGEAVSAAPNSSETRFVIYIK  176

Query  348  AGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGIS  169
             G Y+E +++ ++KTMIMF+GDGIG+T IK NR+  DGW  F SATV V G+GFIA  +S
Sbjct  177  CGEYFENIEIPREKTMIMFIGDGIGRTVIKANRSYADGWTAFHSATVGVRGSGFIAKDLS  236

Query  168  FENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            F N AG   HQAVALR+ SD S FY C F  +QDTLYVHS +QF+RECD+YGTVDF
Sbjct  237  FVNYAGLASHQAVALRSSSDLSAFYRCSFESFQDTLYVHSHKQFYRECDIYGTVDF  292



>ref|XP_009763675.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Nicotiana sylvestris]
Length=602

 Score =   257 bits (656),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 210/364 (58%), Gaps = 16/364 (4%)
 Frame = -3

Query  1062  CDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  883
             C R+ +  LC+S+L + P   + S  +++  +VN+T+     A    S I  +  D  T 
Sbjct  82    CSRTRFTTLCLSSLHEFPGALSASDDDLVHISVNLTLQRFGKALYMASDISNLYMD--TR  139

Query  882   ESRALYVCLELFSDTLADLRTVLDGLENSPAK-RYADLQTLLSTAMTNQYTCLEGFPYSN  706
                A   CLEL  +++  L   L  + +   K    D+ T LS A+TNQ TC EGF   N
Sbjct  140   IRSAYEDCLELLEESIDLLARSLTSVSHGAGKSNNHDVLTWLSAALTNQDTCTEGFADVN  199

Query  705   KNVRPFIIKRVEQISRHVSNALSMLTKIKKE--------KNKPSALFGPSYSSSSFRQEH  550
              NV+  + +++  +S  VSN L++   +  +        +N+   L G +  + +     
Sbjct  200   GNVKDQMTEKLRNLSELVSNCLAIFAAMNGDDDFSGVPIQNRRRRLMGSTDDAGTVVSAK  259

Query  549   GEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDT  370
              E    FPKWL+R++R LL+ P       I+AD+ V+KDG+G FK+I  A+   P  S+ 
Sbjct  260   DEDFAPFPKWLNRKERMLLDTPVSA----IQADIIVSKDGNGTFKTIADAIKKVPQYSNR  315

Query  369   RYVIHIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGT  193
             R +I++KAG Y E  + + +KKT +MF+GDG GKT I G ++V     TF +A+ A  G 
Sbjct  316   RIIIYVKAGRYEEDNLKIGRKKTNVMFIGDGKGKTVITGGKSVSQNLTTFHTASFAATGA  375

Query  192   GFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYG  13
             GFI   I+FEN AGP KHQAVALR  +D++V Y C  +GYQDTLYVHS+RQF+RECD+YG
Sbjct  376   GFIVRDITFENYAGPSKHQAVALRIGADHAVVYRCNIIGYQDTLYVHSQRQFYRECDIYG  435

Query  12    TVDF  1
             TVDF
Sbjct  436   TVDF  439



>ref|XP_010915944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Elaeis guineensis]
Length=587

 Score =   256 bits (655),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 155/378 (41%), Positives = 216/378 (57%), Gaps = 21/378 (6%)
 Frame = -3

Query  1116  SAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKT  937
             S  N T +  I Q     C  + Y +LCVS+L+  P        +++  ++N+T   +  
Sbjct  62    SGPNRTPTQAISQT----CALTRYPELCVSSLLDFPGALDAGDRDLVHISLNMTTQRVGK  117

Query  936   AAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLR---TVLDGLENSPAKRY-ADLQ  769
             A    S I  V  D  ++   A   C+EL  D+L  L     V+   E  PA     D+ 
Sbjct  118   ALYGASAIAGVSMD--SLARSAYDDCMELLDDSLDQLSQSLAVIAPTELRPASASDEDVL  175

Query  768   TLLSTAMTNQYTCLEGFP-YSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSAL  592
             T LS A++NQ TC +G    +N  VR  +   ++ ++  VSN L++ +   + K+     
Sbjct  176   TWLSAALSNQDTCTDGLADVANGYVRAQMESNLKDLAELVSNCLAIFSAASRNKD-----  230

Query  591   FGPSYSSSSFRQEHGEMKDG-FPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFK  415
             F      +  R+      DG FP+WL  RDR LL+ P  K    I+AD+ VAKDG+G  K
Sbjct  231   FSGIPIQNKKRRLLSSAGDGEFPEWLGWRDRRLLQVPAAK----IQADMVVAKDGTGTHK  286

Query  414   SINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDG  235
             SI  A+ AAP++S  R +I++KAG Y E + V +KKT +MF+GDG G T + G+R+V D 
Sbjct  287   SIADAVKAAPENSARRIIIYVKAGRYNENIKVTRKKTNLMFIGDGKGITTVAGSRSVADK  346

Query  234   WPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYV  55
             + TF +AT A  G GFI   ++ EN AGPEKHQAVALR  +D++V Y C  VGYQDTLYV
Sbjct  347   YTTFHTATFASTGNGFIMRDMTIENWAGPEKHQAVALRVGADHAVVYRCNIVGYQDTLYV  406

Query  54    HSRRQFFRECDVYGTVDF  1
             HS+RQFFRECD+YGTVDF
Sbjct  407   HSQRQFFRECDIYGTVDF  424



>ref|XP_010442899.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Camelina sativa]
Length=589

 Score =   256 bits (655),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 157/405 (39%), Positives = 219/405 (54%), Gaps = 32/405 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRA  997
             +++V V+    F  +    S       +    Q     C +SLY +LC+ TL+  P    
Sbjct  41    VLVVGVICFGIFAGIRAVGSDKTEPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  996   KSIPEIISATVNVTVSEIKTAAANCSRIR--RVVPDLGTMESRALY-VCLELFSDTLADL  826
                 E+I  + N T+     A  + S I   ++ P +     R+ Y  CLEL  D++  L
Sbjct  101   ADENELIHISFNATLQRFSKALYSSSTITYTQMPPRV-----RSAYDSCLELLDDSVDAL  155

Query  825   RTVLDGLENSPA-KRYADLQTLLSTAMTNQYTCLEGFPYSNK---NVRPFIIKRVEQISR  658
                L  +      + ++D+ TLLS+AMTN  TC +GF  +      V+  +I  V+ +S 
Sbjct  156   SRALSSVVVVFGDESHSDVMTLLSSAMTNHDTCTDGFDETGGQGGGVKDQVIGAVKDLSE  215

Query  657   HVSNALSMLT-KIKKEKNKPSA----LFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALL  493
              VSN L++   K+K     P      L G         +E  E+    P WL R DR LL
Sbjct  216   MVSNCLAIFAGKVKDLSGVPVVNNRRLLGA--------EETEELH--LPNWLKREDRELL  265

Query  492   EAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEY-VDVD  316
               PT      I+AD+TV+KDG+G FK+I  A+  AP+ S  R+VI++KAG Y E  + V 
Sbjct  266   GTPT----SAIQADITVSKDGTGTFKTITEAIKKAPEHSGRRFVIYVKAGRYEEENLKVG  321

Query  315   KKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQ  136
             +KKT +MF+GDG GKT I G +++ D   TF +AT A  G GFI   ++FEN AGP KHQ
Sbjct  322   RKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDMTFENYAGPAKHQ  381

Query  135   AVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR   D++V Y C  +GYQD LYVHS RQFFREC++YGTVDF
Sbjct  382   AVALRVGGDHAVVYRCNIIGYQDALYVHSNRQFFRECEIYGTVDF  426



>gb|KDP23440.1| hypothetical protein JCGZ_23273 [Jatropha curcas]
Length=538

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 212/361 (59%), Gaps = 23/361 (6%)
 Frame = -3

Query  1065  ACDRSLYRDLC-VSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLG  889
             AC     +D C +S  V+     + S   ++SA +  ++SE + A    ++   +   + 
Sbjct  41    ACTGVENQDSCMLSMQVELEKAGSPSGHSVLSAALRASLSEARLAVDTITKFNSL--SIS  98

Query  888   TMESRALYVCLELFSDTLADLRTVLDGLENSPAK----RY-ADLQTLLSTAMTNQYTCLE  724
               E  A+  C EL   ++++L   L+ +E   A     RY  +L+  LS A++NQ TCLE
Sbjct  99    YREQVAIEDCKELLDFSVSELAWSLEEMEKIRAGDMNVRYEGNLKAWLSAALSNQDTCLE  158

Query  723   GFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGE  544
             GF  +++ +  F+   + Q+++ + N L++ T++     KPS        + +      E
Sbjct  159   GFEGTDRRLENFMRGSLNQVTQLIGNVLALYTQLHSMPFKPS-------RNGTVTNRSPE  211

Query  543   MKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRY  364
                 FP+W++  D+ LL+A +      I  D  V+ DGSG +++I  A++ AP  S+ RY
Sbjct  212   ----FPEWMTEGDQELLKASS----VGIHIDAIVSLDGSGHYRTITEAINEAPSHSNRRY  263

Query  363   VIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFI  184
             +I++K G Y E +D+ KKKT IM VGDGIGKT + GNRN   GW TFR+ATVAV G GFI
Sbjct  264   IIYVKQGVYRENIDMKKKKTNIMLVGDGIGKTVVTGNRNFLQGWTTFRTATVAVSGRGFI  323

Query  183   AIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVD  4
             A  ++F N+AGP+ HQAVALR DSD S FY C   GYQDTLY HS RQF+REC++YGT+D
Sbjct  324   ARDMTFRNTAGPQNHQAVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECNIYGTID  383

Query  3     F  1
             +
Sbjct  384   Y  384



>ref|XP_009351999.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Pyrus x bretschneideri]
Length=613

 Score =   256 bits (655),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 159/415 (38%), Positives = 238/415 (57%), Gaps = 35/415 (8%)
 Frame = -3

Query  1176  IMLVPVVLLAAFLS---LTVFQSSAMNATTSDDIH----QVAHSACDRSLYRDLCVSTLV  1018
              +L   ++LA+ +S   L V +S A N+  S  +H    Q   +AC ++ +  LCV +L+
Sbjct  48    FLLAVALILASAVSAVVLIVGKSKASNSAVSSALHRKPTQAISNACAKTRFPSLCVDSLL  107

Query  1017  KTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI--RRVVPDLGTMESRALYV-CLELF  847
               P   A S  +++  + N+T+  +  A    S +  R++ P      SR+ Y  CLEL 
Sbjct  108   DFPGSNAASELDLVHISFNMTLQRLSKALYLSSSLSYRQMDP-----HSRSAYDDCLELL  162

Query  846   SDTLADLR----TVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPY-SNKNVRPFII  682
              D++  L     +V  G+ +S  +   D++T LS A+TNQ TC EGF      +V+  + 
Sbjct  163   DDSVDALSRALTSVAPGVGSSSTQ---DVRTWLSGALTNQDTCGEGFAQIKGGDVKNEMD  219

Query  681   KRVEQISRHVSNALSMLTKIKKE-------KNKPSALFGPSYSSSSFRQEHGEMKDGFPK  523
             +R++ +S  VSN L++ + +  +       +NK   L G S        ++ ++   FP+
Sbjct  220   QRLKDLSELVSNCLAIYSAVAGDDFSGVPIQNKRRRLLGNSEMERDIMGDNADVSRDFPR  279

Query  522   WLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAG  343
             WL RR+R LL  P  +    I+AD+ V+KDG+G +K+I  A+  AP+ S  R +I+++AG
Sbjct  280   WLGRRERRLLSVPVSQ----IQADIIVSKDGNGTYKTIAEAIKKAPEYSSRRTIIYVRAG  335

Query  342   SYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISF  166
              Y E  + V +KKT +MFVGDG GKT I G ++V     TF +A+ A  G GFIA  I+F
Sbjct  336   RYEEKNLKVGRKKTNLMFVGDGKGKTVITGGKSVSQNLTTFHTASFAATGAGFIARDITF  395

Query  165   ENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             EN AGP KHQAVALR  +D++V Y C  +GYQDT YVHS RQF RE D+YGTVDF
Sbjct  396   ENYAGPAKHQAVALRIGADHAVVYLCNIIGYQDTFYVHSNRQFIRETDIYGTVDF  450



>ref|XP_003588521.1| Pectinesterase [Medicago truncatula]
 gb|AES58772.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=609

 Score =   256 bits (654),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 157/417 (38%), Positives = 239/417 (57%), Gaps = 39/417 (9%)
 Frame = -3

Query  1173  MLVPVVLLAAFLS---LTVFQSSAMNATTSDDIH----QVAHSACDRSLYRDLCVSTLVK  1015
             +L  V+++A+ +S   +TV +S A ++  S+ +H    Q     C ++ Y  LC+++L+ 
Sbjct  43    ILAAVLIIASAISAALITVVRSRA-SSNNSNLLHSKPTQAISRTCSKTRYPSLCINSLLD  101

Query  1014  TPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYV-CLELFSDT  838
              P   + S  E++  + N+T   I  A    S +   V +      RA Y  CLEL  ++
Sbjct  102   FPGSTSASEQELVHISFNMTHRHISKALFASSGLSYTVAN---PRVRAAYEDCLELMDES  158

Query  837   LADLRTVLDGL---------ENSPAKRYA-------DLQTLLSTAMTNQYTCLEGFPYSN  706
             +  +R+ +D L         ++  +++++       D+ T LS A+TNQ TCLEGF  ++
Sbjct  159   MDAIRSSMDSLMTTSSTLSNDDGESRQFSNVAGSTEDVMTWLSAALTNQDTCLEGFEDTS  218

Query  705   KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFP  526
               V+  ++  ++ +S  VSN+L++ +      +  +   G    +        ++   FP
Sbjct  219   GTVKDQMVGNLKDLSELVSNSLAIFSA-----SGDNDFTGVPIQNKRRLMGMSDISREFP  273

Query  525   KWLSRRDRALLEAPTGKKKRKIKADVTVAKDG-SGDFKSINAALSAAPDSSDTRYVIHIK  349
             KWL +RDR LL  P  +    I+AD+ V+K G +G  K+I  A+  AP+ S  R++I+++
Sbjct  274   KWLEKRDRRLLSLPVSE----IQADIIVSKSGGNGTVKTITEAIKKAPEHSRRRFIIYVR  329

Query  348   AGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGI  172
             AG Y E  + V KKKT IMF+GDG GKT I G R+V DG  TF +A+ A  G GF+A  I
Sbjct  330   AGRYEENNLKVGKKKTNIMFIGDGRGKTVITGKRSVGDGMTTFHTASFAASGPGFMARDI  389

Query  171   SFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +FEN AGPEKHQAVALR  SD++V Y C  VGYQD  YVHS RQFFREC++YGTVDF
Sbjct  390   TFENYAGPEKHQAVALRVGSDHAVVYRCNIVGYQDACYVHSNRQFFRECNIYGTVDF  446



>ref|XP_009111300.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40 
isoform X2 [Brassica rapa]
Length=525

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 160/398 (40%), Positives = 224/398 (56%), Gaps = 70/398 (18%)
 Frame = -3

Query  1152  LAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIIS  973
             L  FLS  V       ++ S  +H+  H            +++   T DL        + 
Sbjct  23    LLIFLSTVV-------SSHSPTLHKTQH------------LTSSGNTTDL--------LV  55

Query  972   ATVNVTVSEIKTAAANCSRIRRVVPDLGTMESR-ALYVCLELFSDTLADLRTVLDGLENS  796
             AT+N T+S++  +++N S ++  +    T   R A   CLEL  DT+ DL   +  L+ S
Sbjct  56    ATLNQTISKVNLSSSNFSELQTSLGSNLTHRDRCAFGDCLELLDDTVLDLIAAVSELQ-S  114

Query  795   PAKRYADLQTLLSTAMTNQYTCLEGFPYSNK--------NVRPFII-----KRVEQISRH  655
             P   +  +  LLS AMTN  TCL+GF  S+         N + + +     + +  ISRH
Sbjct  115   PYPVFNSVSMLLSAAMTNTRTCLDGFASSDDDEDENTYGNSKTYGLAESMRESLYNISRH  174

Query  654   VSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGK  475
             V  +L+ML      +N P  L               E   GFP W+   DR LL+ PT +
Sbjct  175   VRESLAML------ENIPGKL---------------ENDVGFPTWV---DRKLLQDPTDE  210

Query  474   KKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIM  295
                  K D+ V+++G+G+F +I  A+SAAP+ S+TR+VI+IK G Y+E +++ ++KT IM
Sbjct  211   T----KIDLVVSRNGTGNFTTIGEAVSAAPNLSETRFVIYIKCGVYFENIEIPREKTTIM  266

Query  294   FVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRAD  115
             F+GDGIG+T IK NR+  DGW  F SATV V G+GFIA  ISF N AGP KHQAVALR+ 
Sbjct  267   FLGDGIGQTVIKANRSGADGWTAFNSATVGVRGSGFIAKDISFVNDAGPTKHQAVALRSG  326

Query  114   SDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             SD S FY C F  YQDT+YVHS +QF+REC++YGTVDF
Sbjct  327   SDLSAFYRCSFESYQDTIYVHSHKQFYRECNIYGTVDF  364



>emb|CDP17209.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 159/436 (36%), Positives = 239/436 (55%), Gaps = 35/436 (8%)
 Frame = -3

Query  1269  ATYIYFPPVSSVWLSYHSTIDSEMQNLGRNPIMLVPVVLLAAFLSLTVFQSSAMNATTSD  1090
             A YI   PV     +   T+    + +  + ++L  ++LL     +   QS   +A   D
Sbjct  3     AYYIADLPVKQAMPATFFTMQHPSKTMAFSNVVLFLLILLPCGSKV---QSQETSAYPKD  59

Query  1089  DIHQ----VAHSACDRSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAAN  925
               HQ    +   AC     +  C++ L    D  ++  P  ++ A +  T++E + A  +
Sbjct  60    QNHQGFETMMTQACQHVDDQTSCLANLQSRLDTWSQQNPISVLKAALENTLNEARLAVDS  119

Query  924   CSRIRRVVPDLGTMESRALYVCLELF-------SDTLADLRTVLDGLENSPAKRYADLQT  766
              ++   +   +   E  A+  C EL        + +LA++  +  G++NS  +   +L+ 
Sbjct  120   LTKFSTL--SVSYREQIAIDDCKELLDFSVSELAWSLAEMNRIRSGVKNSHYE--GNLKA  175

Query  765   LLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFG  586
              LS A++NQ TCLEGF  +++ +  F+   + Q+++ +SN LS+ T++     KP     
Sbjct  176   WLSAALSNQDTCLEGFEGTDRRLERFVRGSLTQVTQLISNVLSLYTRLHSLPFKPPRN-S  234

Query  585   PSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA-PTGKKKRKIKADVTVAKDGSGDFKSI  409
             P+ +S S           FP+W++  D+ ++ A P G     +  D  VA DGSG ++SI
Sbjct  235   PNDTSESV---------DFPEWMTEGDQEIVSASPKG-----MHVDSVVALDGSGHYRSI  280

Query  408   NAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWP  229
               A+  AP  S  RY+I++K G Y+E +D  KKKT IM VGDGIG+T I GNRN   GW 
Sbjct  281   AQAIYEAPSYSIRRYIIYVKRGVYHENIDTRKKKTNIMLVGDGIGQTVITGNRNFMQGWT  340

Query  228   TFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHS  49
             TFR+ATVAV G GFIA  ISF N+AGPE HQ VALR DSD S F+ C   G+QDTLY+HS
Sbjct  341   TFRTATVAVSGKGFIARDISFRNTAGPENHQGVALRVDSDQSAFFRCSMEGHQDTLYIHS  400

Query  48    RRQFFRECDVYGTVDF  1
              RQF+REC +YGT+DF
Sbjct  401   LRQFYRECSIYGTIDF  416



>ref|XP_010043041.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Eucalyptus grandis]
Length=535

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/335 (42%), Positives = 203/335 (61%), Gaps = 29/335 (9%)
 Frame = -3

Query  981  IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELF-------SDTLADLR  823
            ++SA +  T++E + A  + SR   +   +   E  A+  C EL        + ++ +++
Sbjct  68   VLSAALQATLNEARAAVESISRFTAL--SVSYREQVAIEDCKELLDYSISEIAWSMGEMK  125

Query  822  TVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNA  643
             +  G +NS      +L+  LS A++NQ TCLEGF  ++  +  F+   ++Q+++ + N 
Sbjct  126  RIQAGSKNS--HYGGNLKAWLSAALSNQDTCLEGFEGTDGRLENFVRGSLKQVTQLIGNV  183

Query  642  LSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA-PTGKKKR  466
            L+M  ++       S  F P  ++SS    HG  +  FP W++  D+ LL+A P G    
Sbjct  184  LTMYCQLH------SLPFPPPRTNSS----HGASE--FPAWMTEGDQELLKASPVG----  227

Query  465  KIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVG  286
             +  D  VA DGSG +++I+ A+  AP  S+ RYVI+IK G Y E +D+ +KKT IMFVG
Sbjct  228  -MHVDAVVASDGSGRYRTISEAVIDAPSYSNRRYVIYIKKGVYSENIDLKRKKTNIMFVG  286

Query  285  DGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDY  106
            DGIG T I GNR+   GW TFR+ATVAV G GFIA  ++F N+AGP  HQAVALR DSD 
Sbjct  287  DGIGATIITGNRHFMQGWTTFRTATVAVSGKGFIARDMTFRNTAGPRNHQAVALRVDSDQ  346

Query  105  SVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            S FY C   GYQDTLY HS RQF+RECDV+GT+DF
Sbjct  347  SAFYRCSMEGYQDTLYAHSLRQFYRECDVHGTIDF  381



>ref|XP_007031047.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY11549.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=536

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/401 (37%), Positives = 232/401 (58%), Gaps = 34/401 (8%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLT-VFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTL-VKTPDLR  1000
              L+ +++L +F ++  V  S+  N TT   I Q    AC      DLC+S +  +   L 
Sbjct  6     FLLILLMLPSFEAIPDVTPSTKQNLTTQPLIIQ----ACTDVDNHDLCLSNIQAELQSLG  61

Query  999   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELF-------SD  841
              ++   ++ A +  +++E + A    ++   +   +   E  A+  C EL        + 
Sbjct  62    PQTPSSVLHAALRASLNEARQAIETMTKFTGL--SVSYREQIAIEDCKELLDFSVSELAW  119

Query  840   TLADLRTVLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQIS  661
             +LA+++ + DG  N  A+   +L+  LS A++NQ TCLEGF  ++ ++  FI   ++Q++
Sbjct  120   SLAEMKKIRDGDRN--AEYEGNLKAWLSAALSNQDTCLEGFEGTDHHLESFIRGSLKQVT  177

Query  660   RHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA-P  484
             + + N L+M T++     +P     P  S+S+           FP+W++  D+ LL   P
Sbjct  178   QLIGNVLAMYTQLHSLPFRP-----PRNSTST------NTSSEFPEWITDGDQELLRTNP  226

Query  483   TGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKT  304
             +G     +  D  V+ D +G +++I  A++AAP  S+ RY+I++K G Y E +D+ KKKT
Sbjct  227   SG-----MHVDAVVSLDRNGHYRTITDAINAAPSYSNRRYIIYVKKGVYKENIDMKKKKT  281

Query  303   MIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVAL  124
              IM VGDGIG+T + GNRN   GW TFR+ATVAV G GFIA  ++F N+A P+ HQAVAL
Sbjct  282   NIMLVGDGIGQTVVTGNRNFMQGWTTFRTATVAVSGKGFIARDMTFRNTAEPQNHQAVAL  341

Query  123   RADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             R DSD S FY C   G+QDTLY+HS RQF+REC +YGT+DF
Sbjct  342   RVDSDQSAFYRCSMEGHQDTLYIHSLRQFYRECHIYGTIDF  382



>ref|XP_009111299.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40 
isoform X1 [Brassica rapa]
Length=525

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 160/398 (40%), Positives = 224/398 (56%), Gaps = 70/398 (18%)
 Frame = -3

Query  1152  LAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAKSIPEIIS  973
             L  FLS  V       ++ S  +H+  H            +++   T DL        + 
Sbjct  23    LLIFLSTVV-------SSHSPTLHKTQH------------LTSSGNTTDL--------LV  55

Query  972   ATVNVTVSEIKTAAANCSRIRRVVPDLGTMESR-ALYVCLELFSDTLADLRTVLDGLENS  796
             AT+N T+S++  +++N S ++  +    T   R A   CLEL  DT+ DL   +  L+ S
Sbjct  56    ATLNQTISKVNLSSSNFSELQTSLGSNLTHRDRCAFGDCLELLDDTVLDLIAAVSELQ-S  114

Query  795   PAKRYADLQTLLSTAMTNQYTCLEGFPYSNK--------NVRPFII-----KRVEQISRH  655
             P   +  +  LLS AMTN  TCL+GF  S+         N + + +     + +  ISRH
Sbjct  115   PYPVFNSVSMLLSAAMTNTRTCLDGFASSDDDEDENTYGNSKTYGLAESMRESLYNISRH  174

Query  654   VSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGK  475
             V  +L+ML      +N P  L               E   GFP W+   DR LL+ PT  
Sbjct  175   VRESLAML------ENIPGKL---------------ENDVGFPTWV---DRKLLQDPT--  208

Query  474   KKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIM  295
                + K D+ V+++G+G+F +I  A+SAAP+ S+TR+VI+IK G Y+E +++ ++KT IM
Sbjct  209   --DETKIDLVVSRNGTGNFTTIGEAVSAAPNLSETRFVIYIKCGVYFENIEIPREKTTIM  266

Query  294   FVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRAD  115
             F+GDGIG+T IK NR+  DGW  F SATV V G+GFIA  ISF N AGP KHQAVALR+ 
Sbjct  267   FLGDGIGQTVIKANRSGADGWTAFNSATVGVRGSGFIAKDISFVNDAGPTKHQAVALRSG  326

Query  114   SDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             SD S FY C F  YQDT+YVHS +QF+REC++YGTVDF
Sbjct  327   SDLSAFYRCSFESYQDTIYVHSHKQFYRECNIYGTVDF  364



>ref|XP_010273802.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Nelumbo 
nucifera]
Length=502

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 144/335 (43%), Positives = 190/335 (57%), Gaps = 27/335 (8%)
 Frame = -3

Query  987  PEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDG  808
            P    AT+  T+ E++   +  S+      D     S AL  C++L   +  +L   L  
Sbjct  26   PSDFVATLKSTIDEVQGVISLVSKFANQFDDF--RLSNALNDCVDLLDYSADELGWTLSA  83

Query  807  LEN------SPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSN  646
             EN      S   R +DL+  LS A+ NQ TCL+GF  +N  V+  +   ++ ++  VS 
Sbjct  84   TENPNSNDNSTGNRNSDLKAWLSAALGNQDTCLDGFEGTNSFVKGLVAGSLDTVTSLVSE  143

Query  645  ALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKR  466
             L  +    +   K  ++            E G    GFP W+   DR LL+AP G    
Sbjct  144  VLGQIPSGGRLGRKLKSV-----------SEGG----GFPAWMKGSDRRLLQAPAGG---  185

Query  465  KIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVG  286
             + AD  VA+DG+G F S+  A+ AAPD S+ RYVI++K G Y E V++ KKK  +M VG
Sbjct  186  -VSADAVVAQDGTGQFTSVMDAVLAAPDYSERRYVIYVKRGVYKENVEIKKKKWNLMIVG  244

Query  285  DGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDY  106
            DG+  T I G+RN  DGW TFRSAT AV G GFIA  I+FEN+AGPEKHQAVALR+DSD 
Sbjct  245  DGMDVTIISGSRNFVDGWTTFRSATFAVSGKGFIARDITFENTAGPEKHQAVALRSDSDL  304

Query  105  SVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            S +Y C   GYQDTLY HS RQF+REC + GTVDF
Sbjct  305  SAYYRCAIKGYQDTLYAHSLRQFYRECRISGTVDF  339



>ref|XP_003626198.1| Pectinesterase [Medicago truncatula]
 gb|AES82416.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=544

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 143/398 (36%), Positives = 224/398 (56%), Gaps = 21/398 (5%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAK  994
              L  ++LL +F  +  F     +   + D+  +   AC     ++ C++ +         
Sbjct  7     FLFILILLPSFDQVLSFPDEIPSDIQTQDMQALIAQACMDIENQNSCLTNIHNELTRTGP  66

Query  993   SIP-EIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTV  817
               P  +I+A +  T++E   A  N ++I      +   E  A+  C EL   ++++L   
Sbjct  67    PSPTSVINAALRTTINEAIGAINNMTKISTF--SVNNREQLAIEDCKELLDFSVSELAWS  124

Query  816   LDGLE-----NSPAKRYADLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHV  652
             L  +      +  A+   +L+  LS A++NQ TC+EGF  +++ +  +I   V Q+++ +
Sbjct  125   LGEMRRIRAGDRTAQYEGNLEAWLSAALSNQDTCIEGFEGTDRRLESYISGSVTQVTQLI  184

Query  651   SNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA-PTGK  475
             SN LS+ T++ +   +P         +++  +   +    FP+W++  D+ LL++ P GK
Sbjct  185   SNVLSLYTQLNRLPFRPP-------RNTTLHETSTDESLEFPEWMTEADQELLKSKPHGK  237

Query  474   KKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIM  295
                   AD  VA DGSG +++IN A++AAP  S+ R+VI++K G Y E +D+ KK T IM
Sbjct  238   I-----ADAVVALDGSGQYRTINEAVNAAPSHSNRRHVIYVKKGLYKENIDMKKKMTNIM  292

Query  294   FVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRAD  115
              VGDGIG+T +  NRN   GW TFR+AT AV G GFIA  ++F N+AGP  HQAVALR D
Sbjct  293   MVGDGIGQTIVTSNRNFMQGWTTFRTATFAVSGKGFIAKDMTFRNTAGPVNHQAVALRVD  352

Query  114   SDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             SD S F+ C   G QDTLY HS RQF+REC++YGT+DF
Sbjct  353   SDQSAFFRCSIEGNQDTLYAHSLRQFYRECEIYGTIDF  390



>ref|XP_007012504.1| Pectinesterase/pectinesterase inhibitor PPE8B [Theobroma cacao]
 gb|EOY30123.1| Pectinesterase/pectinesterase inhibitor PPE8B [Theobroma cacao]
Length=541

 Score =   254 bits (648),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 143/335 (43%), Positives = 195/335 (58%), Gaps = 23/335 (7%)
 Frame = -3

Query  954  VSEIKTAAANCSRIRRVVPDLGTM-----ESRALYVCLELFSDTLADLRTVLDGLENSPA  790
            V  ++T      ++  +V  LG        S A+  CL+L   +  +L   L   +N  A
Sbjct  50   VGSLRTTIDAVRKVTSIVSQLGGFFGDFRLSNAISDCLDLLDFSADELSWTLSASQNPKA  109

Query  789  KRYA------DLQTLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLT  628
            K  +      +L+T LS AM NQ TC++GF  ++  ++P +   + Q++  VS+ L+M+ 
Sbjct  110  KNNSTGDLSSNLRTWLSAAMANQATCIDGFEGTSSVIKPVVAGSLNQVTSLVSDLLTMVH  169

Query  627  KIKKEK------NKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAPTGKKKR  466
                 K      N  +   G + +     Q+    K+ FP W+ R DR LLE        
Sbjct  170  PGPSSKSNGGTSNGGNKEGGGAAAGGHPGQKLANNKNQFPSWVKREDRKLLEV------N  223

Query  465  KIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVG  286
             + ADV VA DG+G+F SI  A++A PD S +RYVI+IK G Y E V++ KKK  +M VG
Sbjct  224  GVSADVVVAADGTGNFTSIMDAVAAVPDYSMSRYVIYIKKGLYKENVEIKKKKWNLMMVG  283

Query  285  DGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDY  106
            DG+  T I GNR+  DGW TFRSAT AV G GFIA  I+FEN+AGP+KHQAVALR+DSD 
Sbjct  284  DGMDVTVISGNRSFIDGWTTFRSATFAVSGRGFIARDITFENTAGPQKHQAVALRSDSDL  343

Query  105  SVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            SVF+ C   GYQD+LY H+ RQFFREC + GTVDF
Sbjct  344  SVFFRCAIRGYQDSLYTHTMRQFFRECKITGTVDF  378



>ref|XP_006385197.1| hypothetical protein POPTR_0003s00980g [Populus trichocarpa]
 gb|ERP62994.1| hypothetical protein POPTR_0003s00980g [Populus trichocarpa]
Length=572

 Score =   254 bits (650),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 147/401 (37%), Positives = 226/401 (56%), Gaps = 20/401 (5%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAK  994
             +    +L+A  +++ +  +S  N T +D  H +  ++C+ + Y DLC S     PD    
Sbjct  21    IFASFLLVATIIAIAIGVNSRKNPTKNDAAHALLMASCNSTRYPDLCYSAATSFPDASGG  80

Query  993   SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVL  814
                 +I   +N T+  I +     +RI     DL   +  AL  C + + ++LADL  V 
Sbjct  81    DPKAVILKNINATIDAINSKKIKANRILST-EDLTKQQKTALEDCRKNYDNSLADLENVW  139

Query  813   DGLENSPAKRY-------ADLQTLLSTAMTNQYTCLEGFPYS--NKNVRPFIIKRVEQ-I  664
               LE +P   +        +L T +S+  +N+ +C +GF +S  ++ +R  +    E   
Sbjct  140   GALERNPNNHFLQQQSYAENLTTKVSSCKSNEDSCFDGFSHSWLSRKLRDIVRDPSEDDA  199

Query  663   SRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAP  484
              +  SN L+++ K+ ++     A+     ++S   +E  +  +G+P+WLS  DR L  + 
Sbjct  200   GKMCSNTLALIKKLIED---TKAIANRLKTTSRKLKEEDDSDEGWPEWLSVTDRRLFLSS  256

Query  483   TGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKT  304
                    +  DV VA DGSG +++++AA++AAP  S  RY+I IKAG Y E V+V  +KT
Sbjct  257   L------LTPDVVVAADGSGKYRTVSAAVAAAPKHSAKRYIIKIKAGVYRENVEVPSEKT  310

Query  303   MIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVAL  124
              IMF+GDG  KT I  +RNV DG  T+ SATVAVVG GF+A  I+F+N+AG  K+QAVAL
Sbjct  311   NIMFLGDGRKKTIITASRNVVDGGTTYHSATVAVVGQGFLARDITFQNTAGASKYQAVAL  370

Query  123   RADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             R +SD++ FY C  + YQ+TLYVHS RQFF  C + GTVDF
Sbjct  371   RVESDFAAFYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDF  411



>ref|XP_009414355.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Musa acuminata subsp. malaccensis]
Length=540

 Score =   253 bits (647),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 153/366 (42%), Positives = 208/366 (57%), Gaps = 29/366 (8%)
 Frame = -3

Query  1071  HSACDRSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAANCSRIRRVVPD  895
             H AC  +   + C S +      + ++ P  I+   V  T+ E   A    S +  V  D
Sbjct  40    HQACLNTTDHEACTSRISIECHRQGRTGPISILHGAVRGTIDEALRAVGTLSGLAAVSSD  99

Query  894   LGTMESRALYVCLELFSDTLADLRTVLDG-----LENSPAKRYADLQTLLSTAMTNQYTC  730
             L   E  A++ C+EL   ++ +L   L+      LEN      A+L+  LS A++NQ TC
Sbjct  100   L--REEMAIHDCVELLGYSIDELGWSLEEISRLVLENRNIHHEANLRAWLSAALSNQDTC  157

Query  729   LEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEH  550
             LEGF  ++  +R +I  RV ++++ VSN L M  K++     P A   P          +
Sbjct  158   LEGFDGTDGRIRHYIHSRVAEVTQLVSNLLVMYRKMRSII--PHA---PP--------RN  204

Query  549   GEMKDG---FPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDS  379
             G   DG    P W+   D+ LL A      + ++AD  VA DGSG ++SIN A++ AP  
Sbjct  205   GTKSDGNRDSPPWVVV-DQELLHA----DPKALRADAVVASDGSGRYRSINEAVNRAPIH  259

Query  378   SDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVV  199
             S  RYVI++K G Y E V++ KKKT IM VGDG+G T I G+RN   GW TFR+AT AV 
Sbjct  260   SSRRYVIYVKKGVYEENVELKKKKTNIMIVGDGMGITVISGSRNFMQGWTTFRTATFAVS  319

Query  198   GTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDV  19
             G GFIA  I+F N+AGP+ HQAVALR DSD S F+ C   GYQDTLY HS RQF+REC++
Sbjct  320   GQGFIARDITFRNTAGPQNHQAVALRVDSDRSAFFRCSIEGYQDTLYAHSLRQFYRECNI  379

Query  18    YGTVDF  1
             YGT+DF
Sbjct  380   YGTIDF  385



>ref|XP_006389479.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP48393.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   254 bits (649),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 149/401 (37%), Positives = 228/401 (57%), Gaps = 20/401 (5%)
 Frame = -3

Query  1173  MLVPVVLLAAFLSLTVFQSSAMNATTSDDIHQVAHSACDRSLYRDLCVSTLVKTPDLRAK  994
             +    +L+A  +++ +  +S  N T +D  H +  ++C+ + Y DLC S     PD    
Sbjct  21    IFASFLLVATIIAIAIGVNSRKNPTKNDAAHALLMASCNSTRYPDLCYSAATSFPDASRG  80

Query  993   SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVL  814
                 +I   +N T+  I +      +I      L   +  AL  C + +  +LADL  V 
Sbjct  81    DPKAVILNNINATIDAINSKKIEADKILST-KQLTQQQKTALEDCRQNYDSSLADLEKVW  139

Query  813   DGLENSP------AKRYA-DLQTLLSTAMTNQYTCLEGFPYS--NKNVRP-FIIKRVEQI  664
              GL+ +P       K YA DL T +S+  +N+ +C++GF +S  ++ +R  F     +  
Sbjct  140   GGLKRNPNNGLLQQKSYAEDLTTKVSSCKSNEDSCIDGFSHSWLSRKLRDIFRDPSEDDA  199

Query  663   SRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEAP  484
              +  SN L+++ K+ ++     A+     ++S   +E  +  +G+P+WLS  DR L ++ 
Sbjct  200   GKMCSNTLALIKKLIEDTK---AIANRLKTTSRKLKEEDDSDEGWPEWLSVTDRRLFQSS  256

Query  483   TGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKT  304
                    +  DV VA DGSG +++++AA++AAP  S  RY+I IKAG Y E V+V  +KT
Sbjct  257   L------LTPDVVVAADGSGKYRTVSAAVAAAPKHSGKRYIIKIKAGVYRENVEVPSEKT  310

Query  303   MIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVAL  124
              IMF+GDG  KT I  +RNV DG  T+ SATVAVVG GF+A  I+F+N+AG  K+QAVAL
Sbjct  311   NIMFLGDGRKKTIITASRNVVDGGTTYHSATVAVVGQGFLARDITFQNTAGASKYQAVAL  370

Query  123   RADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             R +SD++ FY C  + YQ+TLYVHS RQFF  C + GTVDF
Sbjct  371   RVESDFAAFYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDF  411



>ref|XP_011092101.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Sesamum indicum]
Length=537

 Score =   253 bits (647),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 141/362 (39%), Positives = 208/362 (57%), Gaps = 21/362 (6%)
 Frame = -3

Query  1065  ACDRSLYRDLCVSTL-VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLG  889
             ACDR   +  C   L  +      +S   ++ A +  T++E  +A+   ++   +   + 
Sbjct  36    ACDRIQNQASCFLNLQFQIKSYGRRSPDSVLRAALQHTLNEASSASEALTKFTTL--SIS  93

Query  888   TMESRALYVCLELFSDTLADLRTVLDGLE------NSPAKRYADLQTLLSTAMTNQYTCL  727
               E  A+  C EL   ++++L   +D +        SP     +L+  LS A++NQ TCL
Sbjct  94    PREQMAIDDCKELLDFSVSELAWSVDEMNRIHAGLKSPHSE-GNLKAWLSAALSNQDTCL  152

Query  726   EGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHG  547
             EGF  +++ +  FI   + Q+++ + N L++ T++     +P     P  +S++   E+ 
Sbjct  153   EGFEGTDRRLEHFIRGSLSQVNQLIGNVLTLYTQMHSLPFRP-----PRNNSTAADNEN-  206

Query  546   EMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTR  367
                 GFP+W++  D+ LL +     +  +  D  VA DGSG ++SI  A+  AP  S+ R
Sbjct  207   -RNKGFPQWMTEGDKELLVS----SQNGMHVDAVVAVDGSGQYRSIAQAIYEAPSYSNRR  261

Query  366   YVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGF  187
             YVI++K G Y E +D+ KKKT IM VGDGIG+T + GNRN   GW TFR+ATVAV G GF
Sbjct  262   YVIYVKKGVYKENIDMKKKKTNIMLVGDGIGQTIVTGNRNFMQGWTTFRTATVAVSGKGF  321

Query  186   IAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTV  7
             +A  I+F N+AGPE HQ VALR DSD S FY C   GYQDTLY HS RQF+REC + GT+
Sbjct  322   LARDITFRNTAGPESHQGVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECSISGTI  381

Query  6     DF  1
             DF
Sbjct  382   DF  383



>ref|XP_009111301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39 
[Brassica rapa]
Length=522

 Score =   253 bits (646),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 153/342 (45%), Positives = 203/342 (59%), Gaps = 32/342 (9%)
 Frame = -3

Query  996  KSIPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMESRALYVCLELFSDTLADLRT  820
             +I E+I AT+N T+  +  +      + +R+ P++      A   CL L  DT+ DL T
Sbjct  42   NNITELIVATLNQTILNVNVSYTTFYNLQKRLGPNIARRYRCAFEDCLGLLDDTIFDLET  101

Query  819  VLDGLENSPAKRYADLQTLLSTAMTNQYTCLEGFPYSN---KN------VRPFIIKRVEQ  667
             +  L+ S    + D+  LLS AMTNQ TCLEGF  S    KN      +   +   + +
Sbjct  102  AISKLQTSSLGAH-DVNMLLSDAMTNQDTCLEGFKTSGIHEKNSDNTYKLTDSLKDSILK  160

Query  666  ISRHVSNALSMLTKIKKEKNKPSALFGPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA  487
            IS ++SN+L ML KI   +  P A                E+   FP W+   D+  L A
Sbjct  161  ISSNLSNSLGMLQKIPGHELSPEAY---------------EVDVEFPSWVLENDKRRLHA  205

Query  486  PTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKK  307
            P      K K ++ VA+DG+G+F +IN A+SAAP SS TR++I+IK G Y+E V++ K K
Sbjct  206  PV----EKTKFNLMVAQDGTGNFTTINDAVSAAPTSSVTRFMIYIKRGVYFENVEIPKNK  261

Query  306  TMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVA  127
            T+IMFVGDGIG+T IK NR  K    TF++ATV V G GFIA  ISF N AGP   QAVA
Sbjct  262  TIIMFVGDGIGRTVIKANRR-KGNLGTFQTATVGVKGEGFIAKDISFVNFAGPSP-QAVA  319

Query  126  LRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            LR+ SD+S FY C F GYQDTLYV+S +QF+RECD+YGTVDF
Sbjct  320  LRSGSDHSAFYRCSFEGYQDTLYVYSGKQFYRECDIYGTVDF  361



>ref|XP_004242901.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Solanum 
lycopersicum]
Length=541

 Score =   253 bits (646),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 182/304 (60%), Gaps = 13/304 (4%)
 Frame = -3

Query  879  SRALYVCLELFSDTLADLRTVL------DGLENSPAKRYADLQTLLSTAMTNQYTCLEGF  718
            S A+  CL+L   +  +L   L       G  NS     ADL+  LS A+ NQ TC+EGF
Sbjct  77   SNAISDCLDLLDLSADELTWTLTATQNPKGKNNSTGNLSADLKNYLSGALINQDTCIEGF  136

Query  717  PYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPS---ALFGPSYSSSSFRQ--E  553
              +N  V+  +   + Q+S  V N L M+  + ++   PS   A  G  +  S  R+   
Sbjct  137  EGTNGLVKNLVAGNLNQVSSLVRNILLMVRPVSRKNVFPSEANAKRGKPWQFSRERKLTS  196

Query  552  HGEMKDGFPKWLSRRDRALLEAPTGKKKRKIKADVTVAKDGSGDFKSINAALSAAPDSSD  373
            + E  + FP W+ R+DR LL+A    K   +  DV VA DG+G+F  I  A+ AAP  S 
Sbjct  197  NEEDHNLFPSWIKRKDRRLLQASNSTKG--VITDVVVALDGTGNFTRIKDAIDAAPQLST  254

Query  372  TRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGWPTFRSATVAVVGT  193
             R+VI+IK G Y EYV++ KKK  IM +GDGI  T I GNRN  DGW T+RSAT AV G 
Sbjct  255  KRFVIYIKKGIYKEYVEISKKKWNIMMIGDGIDVTIISGNRNFIDGWTTYRSATFAVKGQ  314

Query  192  GFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVHSRRQFFRECDVYG  13
            GFIA  I+FEN++GPEKHQAVA R+DSD SV + C   GYQDTLY HS RQF+R+C + G
Sbjct  315  GFIARDITFENTSGPEKHQAVAFRSDSDLSVLFRCAVRGYQDTLYAHSMRQFYRDCTITG  374

Query  12   TVDF  1
            TVDF
Sbjct  375  TVDF  378



>ref|XP_008370416.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Malus domestica]
Length=535

 Score =   253 bits (645),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 146/377 (39%), Positives = 216/377 (57%), Gaps = 26/377 (7%)
 Frame = -3

Query  1101  TTSDDIHQVAHSACDRSLYRDLCVST----LVKTPDLRAKSIPEIISATVNVTVSEIKTA  934
             T+S  I  +    C     R+ C++     L KT      S+  II+A +  T++E K A
Sbjct  21    TSSHSIQSMVTQTCTDIEDRNSCLANVQAELQKTGPQIQDSV-SIITAALRHTLNETKNA  79

Query  933   AANCSRIRRVVPDLGTMESRALYVCLELFSDTLADLRTVLDGL-----ENSPAKRYADLQ  769
                 ++   +   +   ES A+  C EL   ++++L   L  +      ++      DL+
Sbjct  80    IQMITKFNSL--SISYRESVAIEDCKELLDYSVSELAWSLGEMIKIRGGDTNVHYEGDLK  137

Query  768   TLLSTAMTNQYTCLEGFPYSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKNKPSALF  589
             + LS A++NQ TCLEGF  +++ +  F+   ++Q+++ + N L++ T++    + P    
Sbjct  138   SWLSAALSNQDTCLEGFEGTDRRLESFVRGSLKQVTQLIGNVLALYTQLYSLPSPPRDHG  197

Query  588   GPSYSSSSFRQEHGEMKDGFPKWLSRRDRALLEA-PTGKKKRKIKADVTVAKDGSGDFKS  412
              P   SSS         D FP W+S  D+AL+++ P    K  +     VA DGSG +++
Sbjct  198   PPMNKSSS--------GDDFPAWMSEDDQALVKSNPKSGAKHAV-----VAADGSGQYRT  244

Query  411   INAALSAAPDSSDTRYVIHIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNVKDGW  232
             I  A++ AP+ S +RYVI++K G Y E +D+ KKKT IMFVGDGIG+T + GNRN   GW
Sbjct  245   ITEAVNEAPNYSPSRYVIYVKKGIYKENIDLKKKKTNIMFVGDGIGQTIVTGNRNFMQGW  304

Query  231   PTFRSATVAVVGTGFIAIGISFENSAGPEKHQAVALRADSDYSVFYDCRFVGYQDTLYVH  52
              TFR+ATVAV G GFIA  ++  N+AGP+ HQ VALR DSD S F+ C   G QDTLY H
Sbjct  305   TTFRTATVAVSGKGFIAKEMTIRNTAGPQNHQGVALRVDSDQSAFFRCSIEGNQDTLYAH  364

Query  51    SRRQFFRECDVYGTVDF  1
             S RQF+REC +YGT+DF
Sbjct  365   SLRQFYRECSIYGTIDF  381



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3595941013084