BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25235_g2_i1 len=1340 path=[1:0-74 18293:75-84 86:85-140
17967:141-218 220:219-242 244:243-245 247:246-355 18528:356-364
366:365-443 8112:444-484 483:485-509 508:510-624 623:625-668
8233:669-702 701:703-740 739:741-768 767:769-817 6938:818-855
854:856-1019 17677:1020-1033 1032:1034-1069 1068:1070-1071
1070:1072-1111 18628:1112-1124 1123:1125-1339]

Length=1340
                                                                      Score     E

ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     431   4e-142   
gb|AHB84678.1|  pectin methylesterase                                   429   2e-141   
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     428   5e-141   
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     426   1e-140   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          426   1e-140   
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            426   2e-140   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    425   6e-140   
emb|CDP15270.1|  unnamed protein product                                422   9e-139   
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     420   5e-138   
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     419   1e-137   
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     416   9e-137   
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     415   4e-136   
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     414   1e-135   
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     413   2e-135   
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    413   2e-135   
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     413   2e-135   
gb|EPS62329.1|  pectinesterase                                          410   2e-134   
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             409   4e-134   
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    407   3e-133   
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     407   3e-133   
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             407   3e-133   Populus trichocarpa [western balsam poplar]
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    405   2e-132   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     405   3e-132   
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     404   6e-132   Vitis vinifera
emb|CBI36883.3|  unnamed protein product                                402   2e-131   
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             400   2e-130   
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               399   4e-130   Ricinus communis
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     397   3e-129   
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             397   2e-128   
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    392   2e-126   
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    386   7e-125   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 384   2e-124   
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                     382   1e-123   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     379   2e-123   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    381   3e-123   
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     376   6e-121   
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     372   2e-119   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     363   6e-116   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     352   5e-113   
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    355   1e-112   
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    355   1e-112   
gb|KGN44975.1|  Pectinesterase                                          354   8e-112   
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     353   1e-111   
gb|EPS67066.1|  pectinesterase                                          362   2e-111   
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     346   2e-109   
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     343   4e-109   
gb|AGG23325.1|  pectin methylesterase 1                                 343   3e-108   
gb|ACQ85264.1|  pectin methylesterase                                   343   3e-108   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     343   4e-108   
ref|XP_010056842.1|  PREDICTED: pectinesterase-like                     342   6e-108   
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     341   3e-107   
ref|XP_010058840.1|  PREDICTED: pectinesterase-like                     328   8e-102   
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         321   2e-101   
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     319   4e-99    
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          318   5e-99    
ref|XP_010058837.1|  PREDICTED: uncharacterized protein LOC104446716    333   4e-98    
ref|XP_010456049.1|  PREDICTED: probable pectinesterase/pectinest...    316   4e-98    
gb|ACN40984.1|  unknown                                                 317   1e-97    Picea sitchensis
gb|EEC82670.1|  hypothetical protein OsI_27314                          313   2e-96    Oryza sativa Indica Group [Indian rice]
ref|NP_001060620.1|  Os07g0675100                                       312   3e-96    Oryza sativa Japonica Group [Japonica rice]
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   306   6e-96    
gb|ABG46324.1|  putative pectin methylesterase                          305   1e-95    Picea abies
ref|XP_002872846.1|  predicted protein                                  308   3e-95    
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          305   2e-93    Sorghum bicolor [broomcorn]
emb|CDP15269.1|  unnamed protein product                                298   3e-93    
dbj|BAJ96804.1|  predicted protein                                      302   2e-92    
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                   303   3e-92    
ref|XP_006396438.1|  hypothetical protein EUTSA_v10029453mg             300   4e-92    
ref|XP_006289196.1|  hypothetical protein CARUB_v10002644mg             297   9e-91    
ref|XP_002463382.1|  hypothetical protein SORBIDRAFT_02g042780          298   1e-90    Sorghum bicolor [broomcorn]
ref|NP_192139.1|  Probable pectinesterase/pectinesterase inhibito...    296   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   297   2e-90    
gb|EEC70505.1|  hypothetical protein OsI_01594                          294   2e-89    Oryza sativa Indica Group [Indian rice]
gb|ABQ42392.1|  pectin methylesterase-like protein                      295   3e-89    Taiwania cryptomerioides
gb|ABZ89800.1|  pectin methylesterase-like protein                      293   6e-89    Taiwania cryptomerioides
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                     290   1e-87    
ref|XP_008653464.1|  PREDICTED: pectinesterase-like                     290   2e-87    
ref|NP_001146685.1|  pectinesterase precursor                           289   2e-87    Zea mays [maize]
ref|XP_006396439.1|  hypothetical protein EUTSA_v10029374mg             288   3e-87    
ref|NP_192141.1|  probable pectinesterase/pectinesterase inhibito...    287   4e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AFW03475.1|  pectin methylesterase 1                                 288   8e-87    
ref|XP_002265171.1|  PREDICTED: pectinesterase                          288   1e-86    Vitis vinifera
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        287   1e-86    
gb|EEE54425.1|  hypothetical protein OsJ_01485                          287   1e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     287   2e-86    
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          287   2e-86    
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   287   3e-86    
gb|AFB77929.1|  pectin methylesterase                                   286   3e-86    
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   286   3e-86    
gb|AFI23415.1|  pectin methylesterase                                   278   3e-86    
gb|KHG08631.1|  Pectinesterase 3                                        286   4e-86    
gb|AFW03480.1|  pectin methylesterase 1                                 286   4e-86    
emb|CDX98441.1|  BnaC05g39340D                                          285   7e-86    
gb|AAC50023.1|  ATPME2 precursor                                        285   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             284   3e-85    
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          281   1e-84    
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    282   2e-84    
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...    281   3e-84    
emb|CDX97564.1|  BnaA05g25150D                                          281   3e-84    
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    281   3e-84    
ref|NP_175786.1|  pectin methylesterase 2                               280   1e-83    Arabidopsis thaliana [mouse-ear cress]
emb|CAB95025.1|  pectin methylesterase                                  280   1e-83    Nicotiana tabacum [American tobacco]
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    280   1e-83    
ref|XP_004240956.1|  PREDICTED: probable pectinesterase/pectinest...    280   1e-83    
emb|CDY52779.1|  BnaCnng23240D                                          278   2e-83    
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     279   2e-83    
ref|XP_010273801.1|  PREDICTED: pectinesterase                          279   2e-83    
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    278   3e-83    
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    278   3e-83    
ref|XP_002304257.2|  pectinesterase family protein                      278   3e-83    Populus trichocarpa [western balsam poplar]
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     278   4e-83    
ref|XP_002891774.1|  ATPME2                                             278   5e-83    
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    278   6e-83    
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    278   7e-83    
gb|AAO85706.1|  pectin methyl-esterase                                  277   7e-83    Nicotiana benthamiana
ref|XP_010422610.1|  PREDICTED: probable pectinesterase/pectinest...    276   8e-83    
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    278   9e-83    
ref|XP_006828588.1|  hypothetical protein AMTR_s00129p00047530          276   9e-83    
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    277   1e-82    Citrus sinensis [apfelsine]
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     277   1e-82    
emb|CDY33229.1|  BnaC01g37020D                                          276   1e-82    
ref|XP_010266532.1|  PREDICTED: probable pectinesterase/pectinest...    277   2e-82    
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    277   2e-82    
ref|NP_001274969.1|  pectin methyl esterase                             276   2e-82    
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    276   3e-82    
ref|XP_010466998.1|  PREDICTED: probable pectinesterase/pectinest...    271   3e-82    
ref|XP_003559807.1|  PREDICTED: pectinesterase-like                     276   3e-82    
ref|XP_009117000.1|  PREDICTED: pectinesterase/pectinesterase inh...    276   4e-82    
ref|XP_006355852.1|  PREDICTED: probable pectinesterase/pectinest...    266   4e-82    
ref|XP_007012502.1|  Pectin methylesterase 3                            275   5e-82    
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    275   5e-82    
ref|XP_006287480.1|  hypothetical protein CARUB_v10000691mg             274   5e-82    
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...    276   6e-82    
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    275   9e-82    
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                  272   1e-81    
emb|CDY08206.1|  BnaA05g14130D                                          275   1e-81    
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    275   1e-81    
ref|XP_004494573.1|  PREDICTED: putative pectinesterase/pectinest...    273   1e-81    
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         274   2e-81    
ref|XP_002872845.1|  pectinesterase family protein                      270   2e-81    
ref|XP_003554631.1|  PREDICTED: putative pectinesterase/pectinest...    273   2e-81    
ref|XP_009111300.1|  PREDICTED: probable pectinesterase/pectinest...    272   3e-81    
emb|CDY33228.1|  BnaC01g37010D                                          273   3e-81    
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     272   3e-81    
gb|KHN43320.1|  Putative pectinesterase/pectinesterase inhibitor 22     271   3e-81    
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         273   3e-81    
ref|XP_009111299.1|  PREDICTED: probable pectinesterase/pectinest...    271   4e-81    
ref|XP_011084508.1|  PREDICTED: probable pectinesterase/pectinest...    273   4e-81    
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                273   5e-81    
gb|AFQ23194.1|  pectin methylesterase                                   272   1e-80    
emb|CAC01624.1|  putative pectin methylesterase                         271   1e-80    Populus tremula x Populus tremuloides
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  271   2e-80    
ref|XP_010261669.1|  PREDICTED: probable pectinesterase/pectinest...    271   2e-80    
gb|AFI23411.1|  pectin methylesterase                                   271   2e-80    
ref|XP_002885033.1|  ATPME3                                             271   3e-80    
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg             271   4e-80    
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             270   4e-80    
ref|XP_009338231.1|  PREDICTED: putative pectinesterase/pectinest...    269   4e-80    
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     270   5e-80    
gb|AFW03476.1|  pectin methylesterase 2                                 268   5e-80    
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             270   5e-80    
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                    270   5e-80    
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         270   6e-80    
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    270   6e-80    
ref|XP_009116991.1|  PREDICTED: pectinesterase/pectinesterase inh...    270   6e-80    
emb|CDY51798.1|  BnaC06g41940D                                          270   8e-80    
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g             270   9e-80    
ref|NP_188048.1|  pectin methylesterase 3                               270   1e-79    Arabidopsis thaliana [mouse-ear cress]
gb|KFK26958.1|  hypothetical protein AALP_AA8G315400                    269   1e-79    
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             269   1e-79    
gb|AER38243.1|  PME2                                                    267   1e-79    
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              268   1e-79    
gb|AFB77928.1|  pectin methylesterase                                   268   1e-79    
gb|AFW03481.1|  pectin methylesterase 2                                 267   2e-79    
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     268   2e-79    
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         268   2e-79    Linum usitatissimum
ref|XP_007146997.1|  hypothetical protein PHAVU_006G088000g             267   2e-79    
ref|XP_008370416.1|  PREDICTED: putative pectinesterase/pectinest...    267   3e-79    
ref|XP_010482728.1|  PREDICTED: probable pectinesterase/pectinest...    268   4e-79    
ref|XP_002512462.1|  Pectinesterase PPE8B precursor, putative           266   4e-79    Ricinus communis
ref|XP_006297218.1|  hypothetical protein CARUB_v10013226mg             269   4e-79    
ref|XP_006433467.1|  hypothetical protein CICLE_v10000816mg             266   4e-79    
ref|XP_008450600.1|  PREDICTED: putative pectinesterase/pectinest...    266   4e-79    
ref|NP_200149.1|  pectin methylesterase PCR fragment F                  268   4e-79    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001275859.1|  pectinesterase 1 precursor                         268   4e-79    
ref|XP_009414355.1|  PREDICTED: putative pectinesterase/pectinest...    266   4e-79    
ref|XP_002865971.1|  pectinesterase family protein                      268   5e-79    
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...    268   5e-79    
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                        268   6e-79    
ref|XP_009111301.1|  PREDICTED: probable pectinesterase/pectinest...    266   6e-79    
ref|XP_003588521.1|  Pectinesterase                                     268   6e-79    
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     266   7e-79    
ref|XP_004157240.1|  PREDICTED: putative pectinesterase/pectinest...    266   7e-79    
ref|XP_004135600.1|  PREDICTED: putative pectinesterase/pectinest...    266   8e-79    
ref|XP_010910828.1|  PREDICTED: pectinesterase 3-like                   259   1e-78    
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     266   2e-78    
ref|XP_009421463.1|  PREDICTED: probable pectinesterase/pectinest...    266   2e-78    
ref|XP_002532944.1|  Pectinesterase-3 precursor, putative               266   2e-78    Ricinus communis
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    266   2e-78    Citrus sinensis [apfelsine]
gb|ACJ68111.1|  pectinesterase                                          264   2e-78    Brassica napus [oilseed rape]
gb|AAC72288.1|  putative pectin methylesterase                          266   2e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003627458.1|  Pectinesterase                                     266   3e-78    
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    266   3e-78    
ref|XP_003626198.1|  Pectinesterase                                     265   3e-78    
ref|XP_011076457.1|  PREDICTED: probable pectinesterase/pectinest...    266   3e-78    
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    265   3e-78    
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              265   3e-78    Linum usitatissimum
gb|KHG26122.1|  putative pectinesterase/pectinesterase inhibitor ...    264   4e-78    
gb|EPS73427.1|  pectinesterase                                          265   4e-78    
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...    265   5e-78    
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             265   5e-78    
ref|XP_010049073.1|  PREDICTED: probable pectinesterase/pectinest...    265   8e-78    
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     264   1e-77    
ref|XP_009135376.1|  PREDICTED: pectinesterase/pectinesterase inh...    264   1e-77    
gb|KDP23440.1|  hypothetical protein JCGZ_23273                         263   1e-77    
ref|XP_008228105.1|  PREDICTED: pectinesterase                          264   1e-77    
gb|ABJ99594.1|  pectinesterase inhibitor                                264   1e-77    Lycoris aurea [golden hurricane-lily]
emb|CDP17209.1|  unnamed protein product                                263   2e-77    
ref|XP_008450601.1|  PREDICTED: putative pectinesterase/pectinest...    261   2e-77    
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    263   4e-77    
emb|CDP05068.1|  unnamed protein product                                263   4e-77    
ref|XP_009127175.1|  PREDICTED: probable pectinesterase/pectinest...    262   4e-77    
ref|XP_008437596.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    263   5e-77    
ref|XP_008245555.1|  PREDICTED: putative pectinesterase/pectinest...    261   5e-77    
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...    261   7e-77    
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             262   8e-77    
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     261   1e-76    
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    261   1e-76    
emb|CDY22044.1|  BnaA09g00730D                                          256   1e-76    
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    261   2e-76    
ref|XP_011023723.1|  PREDICTED: putative pectinesterase/pectinest...    259   2e-76    
emb|CDY60700.1|  BnaA01g37100D                                          259   2e-76    
ref|XP_007031047.1|  Plant invertase/pectin methylesterase inhibi...    259   3e-76    
ref|XP_002278061.1|  PREDICTED: probable pectinesterase/pectinest...    261   3e-76    Vitis vinifera
ref|XP_010043041.1|  PREDICTED: putative pectinesterase/pectinest...    259   4e-76    
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                260   4e-76    
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             260   4e-76    
emb|CDY52778.1|  BnaCnng23230D                                          258   4e-76    
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     259   4e-76    
ref|XP_002317777.2|  hypothetical protein POPTR_0012s02170g             260   4e-76    Populus trichocarpa [western balsam poplar]
emb|CDX75765.1|  BnaC03g38480D                                          256   5e-76    
gb|KHN10485.1|  Putative pectinesterase/pectinesterase inhibitor 12     258   5e-76    
ref|XP_002875955.1|  pectinesterase family protein                      259   7e-76    
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     259   7e-76    
ref|XP_011092101.1|  PREDICTED: putative pectinesterase/pectinest...    258   8e-76    
ref|XP_004302271.1|  PREDICTED: putative pectinesterase/pectinest...    258   9e-76    
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     259   9e-76    
ref|XP_006441080.1|  hypothetical protein CICLE_v10019376mg             259   9e-76    
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   259   1e-75    
ref|XP_010424662.1|  PREDICTED: probable pectinesterase/pectinest...    253   1e-75    
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...    258   1e-75    
ref|XP_010273802.1|  PREDICTED: pectinesterase/pectinesterase inh...    256   2e-75    
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     258   2e-75    
ref|XP_003595381.1|  hypothetical protein MTR_2g044810                  257   2e-75    
gb|KFK35693.1|  hypothetical protein AALP_AA4G024900                    258   2e-75    
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   258   2e-75    
ref|XP_006587077.1|  PREDICTED: probable pectinesterase/pectinest...    257   2e-75    
gb|ABJ99595.1|  pectinesterase inhibitor                                258   2e-75    Lycoris aurea [golden hurricane-lily]
ref|XP_004145986.1|  PREDICTED: probable pectinesterase/pectinest...    256   5e-75    
ref|XP_009594432.1|  PREDICTED: putative pectinesterase/pectinest...    256   7e-75    
emb|CDY39109.1|  BnaA01g29470D                                          256   7e-75    
ref|XP_010546740.1|  PREDICTED: putative pectinesterase/pectinest...    256   7e-75    
ref|XP_006841646.1|  hypothetical protein AMTR_s00003p00238240          256   7e-75    
emb|CDX96216.1|  BnaC02g14350D                                          253   8e-75    
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    257   1e-74    
ref|XP_009150156.1|  PREDICTED: probable pectinesterase/pectinest...    256   1e-74    
emb|CDY22045.1|  BnaA09g00740D                                          254   1e-74    
ref|NP_190491.1|  putative pectinesterase/pectinesterase inhibito...    256   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546531.1|  PREDICTED: probable pectinesterase/pectinest...    255   1e-74    
ref|XP_007207382.1|  hypothetical protein PRUPE_ppa004437mg             254   1e-74    
ref|XP_006382445.1|  pectinesterase family protein                      253   2e-74    
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...    256   2e-74    
ref|XP_010271168.1|  PREDICTED: probable pectinesterase/pectinest...    254   2e-74    
ref|XP_002318977.1|  pectinesterase family protein                      254   2e-74    Populus trichocarpa [western balsam poplar]
ref|XP_011036906.1|  PREDICTED: putative pectinesterase/pectinest...    254   2e-74    
gb|KGN49865.1|  hypothetical protein Csa_5G139430                       256   2e-74    
ref|XP_004172937.1|  PREDICTED: probable pectinesterase/pectinest...    256   2e-74    
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...    255   2e-74    
ref|XP_002321999.2|  pectin methylesterase family protein               256   3e-74    Populus trichocarpa [western balsam poplar]
ref|XP_006374102.1|  hypothetical protein POPTR_0015s01610g             255   3e-74    
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     255   3e-74    
ref|XP_010035249.1|  PREDICTED: probable pectinesterase/pectinest...    255   3e-74    
ref|XP_007012504.1|  Pectinesterase/pectinesterase inhibitor PPE8B      253   4e-74    
ref|XP_006828579.1|  hypothetical protein AMTR_s00129p00033080          254   4e-74    
emb|CDY49170.1|  BnaA02g10290D                                          251   4e-74    
ref|XP_004230262.1|  PREDICTED: putative pectinesterase/pectinest...    253   4e-74    
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    254   5e-74    
ref|XP_011093902.1|  PREDICTED: pectinesterase/pectinesterase inh...    253   5e-74    
ref|XP_011006351.1|  PREDICTED: probable pectinesterase/pectinest...    255   5e-74    
ref|XP_010503572.1|  PREDICTED: probable pectinesterase/pectinest...    254   7e-74    
gb|EPS63648.1|  pectinesterase                                          252   7e-74    
ref|XP_006493306.1|  PREDICTED: probable pectinesterase/pectinest...    254   8e-74    
ref|XP_006404164.1|  hypothetical protein EUTSA_v10010220mg             254   9e-74    
ref|XP_009796151.1|  PREDICTED: putative pectinesterase/pectinest...    252   1e-73    
ref|XP_004159762.1|  PREDICTED: pectinesterase/pectinesterase inh...    249   2e-73    
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...    252   2e-73    
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          252   2e-73    
ref|XP_006344697.1|  PREDICTED: putative pectinesterase/pectinest...    250   3e-73    
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     251   4e-73    
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             253   4e-73    
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                   251   4e-73    
gb|KHG13374.1|  Pectinesterase/pectinesterase inhibitor PPE8B           248   4e-73    
emb|CDP19933.1|  unnamed protein product                                250   6e-73    
ref|XP_010426432.1|  PREDICTED: probable pectinesterase/pectinest...    252   7e-73    
ref|XP_008388514.1|  PREDICTED: putative pectinesterase/pectinest...    250   7e-73    
ref|XP_003602238.1|  Pectinesterase                                     251   7e-73    
ref|XP_009768722.1|  PREDICTED: probable pectinesterase/pectinest...    251   8e-73    
emb|CBI27756.3|  unnamed protein product                                249   9e-73    
gb|AGR44473.1|  pectin methylesterase 4                                 246   1e-72    
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     249   1e-72    
ref|XP_009119880.1|  PREDICTED: probable pectinesterase/pectinest...    251   1e-72    
ref|XP_009404434.1|  PREDICTED: probable pectinesterase/pectinest...    251   1e-72    
ref|XP_008380988.1|  PREDICTED: probable pectinesterase/pectinest...    251   2e-72    
ref|XP_010659655.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    249   2e-72    
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     249   2e-72    
gb|EYU42198.1|  hypothetical protein MIMGU_mgv1a019879mg                248   2e-72    
gb|KFK32510.1|  hypothetical protein AALP_AA6G251900                    249   2e-72    
gb|AFW03477.1|  pectin methylesterase 3                                 248   2e-72    
emb|CBI39536.3|  unnamed protein product                                250   2e-72    
ref|XP_007012505.1|  Plant invertase/pectin methylesterase inhibi...    249   2e-72    
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    250   2e-72    
ref|XP_010671450.1|  PREDICTED: probable pectinesterase/pectinest...    250   2e-72    
ref|XP_010674080.1|  PREDICTED: putative pectinesterase/pectinest...    248   2e-72    
gb|AER38246.1|  PME3                                                    248   2e-72    
ref|XP_004146188.1|  PREDICTED: pectinesterase/pectinesterase inh...    248   2e-72    
emb|CDY35644.1|  BnaC09g29660D                                          246   3e-72    
ref|XP_009351999.1|  PREDICTED: probable pectinesterase/pectinest...    250   3e-72    
ref|XP_011093901.1|  PREDICTED: probable pectinesterase/pectinest...    248   3e-72    
ref|XP_009604014.1|  PREDICTED: probable pectinesterase/pectinest...    249   3e-72    
ref|XP_002277473.1|  PREDICTED: pectinesterase                          249   3e-72    
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    247   3e-72    
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     250   3e-72    
dbj|BAF42041.1|  pectin methylesterase 4                                248   4e-72    
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...    249   5e-72    
ref|NP_001289259.1|  probable pectinesterase/pectinesterase inhib...    249   6e-72    
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     248   6e-72    
gb|KGN55582.1|  hypothetical protein Csa_3G000060                       248   7e-72    
ref|XP_008448427.1|  PREDICTED: pectinesterase/pectinesterase inh...    248   7e-72    
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...    249   7e-72    
ref|XP_006290776.1|  hypothetical protein CARUB_v10016881mg             249   7e-72    
sp|P85076.1|PME_ACTDE  RecName: Full=Pectinesterase; Short=PE; Al...    241   7e-72    
ref|XP_009401623.1|  PREDICTED: pectinesterase 3-like                   242   8e-72    
ref|XP_010259726.1|  PREDICTED: pectinesterase-like                     248   8e-72    
ref|XP_009359674.1|  PREDICTED: pectinesterase/pectinesterase inh...    246   9e-72    
emb|CDP00815.1|  unnamed protein product                                247   1e-71    
ref|XP_010515266.1|  PREDICTED: probable pectinesterase/pectinest...    248   1e-71    
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     248   1e-71    
gb|KHF97563.1|  Pectinesterase/pectinesterase inhibitor PPE8B           246   2e-71    
ref|XP_002516192.1|  Pectinesterase PPE8B precursor, putative           246   2e-71    
ref|XP_010671449.1|  PREDICTED: probable pectinesterase/pectinest...    248   2e-71    
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     247   3e-71    
ref|XP_009357300.1|  PREDICTED: probable pectinesterase/pectinest...    248   3e-71    
ref|XP_004146219.1|  PREDICTED: probable pectinesterase/pectinest...    247   3e-71    
ref|XP_006419127.1|  hypothetical protein EUTSA_v10002482mg             245   4e-71    
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               247   4e-71    
dbj|BAF42038.1|  pectin methylesterase 1                                247   4e-71    
gb|EYU40533.1|  hypothetical protein MIMGU_mgv1a019770mg                244   4e-71    
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     246   5e-71    
ref|XP_008337790.1|  PREDICTED: pectinesterase/pectinesterase inh...    244   5e-71    
ref|XP_002884519.1|  pectinesterase family protein                      248   5e-71    
gb|ACN40878.1|  unknown                                                 248   5e-71    
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          246   6e-71    
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...    246   6e-71    
gb|EYU28290.1|  hypothetical protein MIMGU_mgv1a004392mg                244   6e-71    
ref|XP_003595386.1|  Pectinesterase                                     244   7e-71    
ref|XP_011101135.1|  PREDICTED: probable pectinesterase/pectinest...    245   7e-71    
ref|XP_004510571.1|  PREDICTED: pectinesterase 3-like                   246   8e-71    
ref|XP_010273808.1|  PREDICTED: pectinesterase 3                        246   8e-71    
ref|XP_009614349.1|  PREDICTED: probable pectinesterase/pectinest...    245   9e-71    
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   243   1e-70    
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    247   2e-70    
gb|AFW03478.1|  pectin methylesterase 4                                 243   2e-70    
ref|NP_001265901.1|  pectinesterase 3-like                              245   2e-70    
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     243   2e-70    
ref|XP_004242901.1|  PREDICTED: pectinesterase/pectinesterase inh...    244   2e-70    
ref|NP_001042866.1|  Os01g0312500                                       241   2e-70    
emb|CDY12333.1|  BnaA06g20110D                                          243   2e-70    
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g             244   2e-70    
ref|XP_010100757.1|  putative pectinesterase/pectinesterase inhib...    245   2e-70    
ref|XP_007138600.1|  hypothetical protein PHAVU_009G222500g             243   2e-70    
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   240   2e-70    
ref|XP_008795812.1|  PREDICTED: putative pectinesterase/pectinest...    243   2e-70    
gb|AFW03482.1|  pectin methylesterase 3                                 243   2e-70    
ref|XP_006385197.1|  hypothetical protein POPTR_0003s00980g             244   2e-70    
gb|KDP33983.1|  hypothetical protein JCGZ_07554                         243   3e-70    
gb|EYU25793.1|  hypothetical protein MIMGU_mgv1a020083mg                243   3e-70    
ref|XP_004307984.1|  PREDICTED: probable pectinesterase/pectinest...    244   3e-70    
gb|AFW03483.1|  pectin methylesterase 4                                 243   3e-70    
ref|XP_006573891.1|  PREDICTED: pectinesterase/pectinesterase inh...    243   4e-70    
emb|CDY38524.1|  BnaC03g26730D                                          243   4e-70    
ref|XP_004287682.1|  PREDICTED: pectinesterase/pectinesterase inh...    242   4e-70    
ref|XP_010520512.1|  PREDICTED: probable pectinesterase/pectinest...    242   4e-70    
ref|XP_010472673.1|  PREDICTED: probable pectinesterase/pectinest...    243   5e-70    
gb|AAQ21124.1|  pectinesterase                                          242   5e-70    
ref|XP_006389479.1|  putative pectin methylesterase LuPME5 family...    243   5e-70    
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         243   5e-70    
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...    243   5e-70    
ref|XP_008337791.1|  PREDICTED: probable pectinesterase/pectinest...    242   6e-70    
gb|KFK34211.1|  hypothetical protein AALP_AA5G115200                    244   6e-70    
ref|NP_189913.3|  probable pectinesterase/pectinesterase inhibito...    242   7e-70    
ref|XP_008234745.1|  PREDICTED: probable pectinesterase/pectinest...    244   7e-70    
emb|CDY05190.1|  BnaC05g46130D                                          242   7e-70    
ref|XP_006452917.1|  hypothetical protein CICLE_v10007993mg             242   8e-70    
ref|XP_010269595.1|  PREDICTED: putative pectinesterase/pectinest...    242   8e-70    
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    243   9e-70    
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    245   1e-69    
ref|XP_009359675.1|  PREDICTED: probable pectinesterase/pectinest...    242   1e-69    
gb|KDP27467.1|  hypothetical protein JCGZ_20123                         243   1e-69    
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    243   1e-69    
gb|AER38245.1|  PME4                                                    241   1e-69    
ref|XP_009369733.1|  PREDICTED: pectinesterase/pectinesterase inh...    241   1e-69    
ref|XP_006474555.1|  PREDICTED: pectinesterase/pectinesterase inh...    241   1e-69    
ref|XP_006593974.1|  PREDICTED: probable pectinesterase/pectinest...    241   1e-69    
ref|XP_006344555.1|  PREDICTED: pectinesterase/pectinesterase inh...    241   1e-69    
ref|XP_002890570.1|  predicted protein                                  242   1e-69    
gb|KHN45040.1|  Putative pectinesterase/pectinesterase inhibitor 12     241   1e-69    
ref|XP_007154533.1|  hypothetical protein PHAVU_003G126600g             241   1e-69    
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   241   2e-69    
gb|KDP25318.1|  hypothetical protein JCGZ_20474                         241   2e-69    
ref|XP_004144447.1|  PREDICTED: pectinesterase 3-like                   241   2e-69    
ref|XP_008242145.1|  PREDICTED: probable pectinesterase/pectinest...    241   2e-69    
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   241   2e-69    
ref|XP_011078158.1|  PREDICTED: pectinesterase/pectinesterase inh...    241   2e-69    
gb|KFK37971.1|  hypothetical protein AALP_AA3G053500                    241   2e-69    
ref|XP_002877272.1|  pectinesterase family protein                      241   2e-69    
ref|XP_010541676.1|  PREDICTED: probable pectinesterase/pectinest...    240   2e-69    
ref|XP_010921646.1|  PREDICTED: putative pectinesterase/pectinest...    241   2e-69    
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    242   2e-69    
ref|XP_007220895.1|  hypothetical protein PRUPE_ppa003047mg             242   3e-69    
ref|XP_002314796.1|  pectin methylesterase 6 family protein             240   3e-69    
emb|CDY38712.1|  BnaC01g27850D                                          241   3e-69    
ref|XP_006293870.1|  hypothetical protein CARUB_v10022851mg             242   3e-69    
ref|XP_010261671.1|  PREDICTED: pectinesterase-like                     241   3e-69    
ref|XP_010047426.1|  PREDICTED: probable pectinesterase/pectinest...    241   3e-69    
ref|XP_010429665.1|  PREDICTED: probable pectinesterase/pectinest...    240   3e-69    
emb|CDY00192.1|  BnaA06g20930D                                          239   4e-69    
ref|XP_011005054.1|  PREDICTED: probable pectinesterase/pectinest...    240   4e-69    
ref|XP_006381542.1|  pectinesterase family protein                      240   4e-69    
ref|XP_008242144.1|  PREDICTED: pectinesterase/pectinesterase inh...    239   4e-69    
ref|XP_010656075.1|  PREDICTED: probable pectinesterase/pectinest...    240   4e-69    
dbj|BAC42986.1|  putative pectinesterase                                243   4e-69    
ref|XP_009149756.1|  PREDICTED: probable pectinesterase/pectinest...    242   4e-69    
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    241   4e-69    
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                242   4e-69    
gb|KFK33850.1|  hypothetical protein AALP_AA5G068300                    240   4e-69    
ref|XP_011047860.1|  PREDICTED: pectinesterase-like                     241   5e-69    
ref|XP_006367330.1|  PREDICTED: probable pectinesterase/pectinest...    241   5e-69    
ref|NP_187213.1|  putative pectinesterase/pectinesterase inhibito...    240   5e-69    
ref|XP_010049304.1|  PREDICTED: pectinesterase/pectinesterase inh...    240   5e-69    
ref|XP_004499740.1|  PREDICTED: putative pectinesterase/pectinest...    241   5e-69    
ref|XP_010654104.1|  PREDICTED: pectinesterase                          239   5e-69    
ref|XP_010417436.1|  PREDICTED: probable pectinesterase/pectinest...    240   5e-69    
ref|NP_180212.1|  Probable pectinesterase/pectinesterase inhibito...    240   6e-69    
emb|CBI29628.3|  unnamed protein product                                239   6e-69    
ref|NP_001268091.1|  pectin methylesterase PME1 precursor               239   6e-69    
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          239   6e-69    
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     239   6e-69    
ref|XP_010271283.1|  PREDICTED: pectinesterase                          239   6e-69    
ref|XP_007204326.1|  hypothetical protein PRUPE_ppa004300mg             239   6e-69    
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    241   7e-69    
sp|Q43062.1|PME_PRUPE  RecName: Full=Pectinesterase/pectinesteras...    239   7e-69    
ref|XP_010464091.1|  PREDICTED: putative pectinesterase/pectinest...    239   7e-69    
gb|KDO73735.1|  hypothetical protein CISIN_1g010718mg                   239   7e-69    
ref|XP_004287681.1|  PREDICTED: probable pectinesterase/pectinest...    239   8e-69    
emb|CDY27749.1|  BnaA05g31580D                                          239   9e-69    
ref|XP_011039647.1|  PREDICTED: pectinesterase-like                     240   9e-69    
gb|KDO73736.1|  hypothetical protein CISIN_1g010718mg                   238   9e-69    
ref|XP_010552690.1|  PREDICTED: probable pectinesterase/pectinest...    239   9e-69    
emb|CAN60612.1|  hypothetical protein VITISV_003251                     239   9e-69    
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     240   1e-68    
ref|XP_010273804.1|  PREDICTED: probable pectinesterase/pectinest...    239   1e-68    
emb|CDY14384.1|  BnaA10g06710D                                          237   1e-68    
gb|EPS61512.1|  pectinesterase                                          237   1e-68    
ref|XP_007204565.1|  hypothetical protein PRUPE_ppa003852mg             239   1e-68    
ref|XP_009413991.1|  PREDICTED: pectinesterase-like                     239   1e-68    
dbj|BAH56489.1|  pectin methylesterase 1                                239   1e-68    
ref|XP_006296700.1|  hypothetical protein CARUB_v10013399mg             239   2e-68    
ref|XP_010107092.1|  Pectinesterase/pectinesterase inhibitor PPE8B      246   2e-68    
ref|XP_004488157.1|  PREDICTED: probable pectinesterase/pectinest...    238   2e-68    
ref|XP_009389951.1|  PREDICTED: probable pectinesterase/pectinest...    239   2e-68    
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   238   2e-68    
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     238   2e-68    
gb|KEH19215.1|  pectinesterase/pectinesterase inhibitor                 239   2e-68    
ref|XP_007135363.1|  hypothetical protein PHAVU_010G123100g             246   3e-68    
ref|XP_010486018.1|  PREDICTED: putative pectinesterase/pectinest...    238   3e-68    
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                   239   3e-68    
ref|XP_009147217.1|  PREDICTED: putative pectinesterase/pectinest...    238   3e-68    
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                237   3e-68    
ref|XP_007154532.1|  hypothetical protein PHAVU_003G126500g             237   3e-68    
ref|XP_010526020.1|  PREDICTED: probable pectinesterase/pectinest...    238   3e-68    
gb|KDP42887.1|  hypothetical protein JCGZ_23829                         239   3e-68    
ref|XP_002884521.1|  pectinesterase family protein                      238   4e-68    
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             241   4e-68    
ref|XP_010519424.1|  PREDICTED: probable pectinesterase/pectinest...    239   5e-68    
ref|XP_010692197.1|  PREDICTED: pectinesterase 2                        237   5e-68    
gb|EEE68789.1|  hypothetical protein OsJ_27519                          234   6e-68    
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     237   6e-68    
ref|XP_009151913.1|  PREDICTED: probable pectinesterase/pectinest...    238   7e-68    
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               236   7e-68    
ref|XP_008386148.1|  PREDICTED: pectinesterase-like                     237   8e-68    



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   431 bits (1107),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 220/410 (54%), Positives = 285/410 (70%), Gaps = 23/410 (6%)
 Frame = -3

Query  1179  MQNLGRNPIMLVPVVLLAPFLSLTVF---------QSSAMNATTSHDIH-----QVAHSA  1042
             M N+   P +++ ++     + LT F          S A   T +  IH     Q+A S 
Sbjct  1     MYNIRHKPSLILTILASTALILLTFFVLLSNPKSSSSRAAEKTMTPHIHVHKNIQIAQSH  60

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             C+ +L+ +LCVSTL   P+L  KSI EIIS+TV + V E++ +A NCS +RR VP L  +
Sbjct  61    CEGTLHPELCVSTLSSFPNLHRKSIAEIISSTVKIAVGEVRASAHNCSDLRRHVPKLEPI  120

Query  861   ERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQYTCLDG-FPN  691
             E+RAL  C+EL  + +A+LRT L  L  + S +K + D+QTLLS AMTN+ TCLDG F +
Sbjct  121   EKRALQDCVELLGETIAELRTALSDLSPKKSASKHYNDIQTLLSAAMTNEDTCLDGLFYS  180

Query  690   SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRR  511
             +  N+  ++   +  I+ HVSN+L+ML KIK+   +     F  E   +K+GFPKWL RR
Sbjct  181   TKNNLTRYVEDNLHTIAHHVSNSLAMLNKIKRTSVSSSDEVFP-EYGAMKNGFPKWLKRR  239

Query  510   DRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYE  331
             +RALL+ P+     ++ K D+ VAKDGSG+F +IN ALSAAP+S++TRFVIYIK GSY+E
Sbjct  240   ERALLQVPV-----NETKFDLAVAKDGSGNFTTINEALSAAPNSTNTRFVIYIKEGSYFE  294

Query  330   YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAG  151
             YV+VDKKK MIMFVGDG+GKT+IKGNRN  DGW TFR+ATVAV G GF+AKGI+FENYAG
Sbjct  295   YVEVDKKKNMIMFVGDGVGKTKIKGNRNHVDGWTTFRSATVAVVGKGFLAKGITFENYAG  354

Query  150   PENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             P  HQAV LR+ SD S FY CSFV YQDTLYVHS RQF+RECD+YGTVDF
Sbjct  355   PSKHQAVTLRSSSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDIYGTVDF  404



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/360 (59%), Positives = 267/360 (74%), Gaps = 10/360 (3%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  892
             H   QVAHSAC+ +LY +LCVSTL+  PDL +K +PE+IS T+N T+SE++ +++NCS I
Sbjct  54    HKHFQVAHSACEGTLYPELCVSTLLSVPDLASKRVPELISVTINRTLSELRASSSNCSSI  113

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQ  718
              +  P+  T+E+RA++ CLELF D + +L++ L+ L  + SP+K + DLQTL S AMTNQ
Sbjct  114   GQSYPNFNTLEKRAINDCLELFHDTIVELKSALNDLSPKKSPSKHYHDLQTLFSGAMTNQ  173

Query  717   YTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRG-LK  541
             YTCLDGF  S+ NVR  I   +  ISRHVSN+L ML KI    DN  S        G +K
Sbjct  174   YTCLDGFAYSDGNVREVIKSSLYNISRHVSNSLVMLKKI--PGDNMSSKYEVFPEYGRIK  231

Query  540   DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
              GFP WLS  DR LL+  +     +  K D++VAKDGSG+F +I  A+ AAP+ S+TRFV
Sbjct  232   RGFPTWLSLNDRKLLQKSV-----NLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFV  286

Query  360   IYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIA  181
             IYIKAG+Y+E V+VDKKKTM+MFVGDGIGKT +K NR++ DGW TFR+ATVAV G+GFIA
Sbjct  287   IYIKAGAYFENVEVDKKKTMLMFVGDGIGKTLVKANRSVVDGWTTFRSATVAVVGTGFIA  346

Query  180   KGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KGI+ EN AGP  HQAVALR+ SD S FY CSFVGYQDTLYVHS RQF+RECDVYGTVDF
Sbjct  347   KGITVENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDF  406



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   428 bits (1100),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 220/374 (59%), Positives = 272/374 (73%), Gaps = 14/374 (4%)
 Frame = -3

Query  1098  SSAMNATTSHDIH-----QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVT  934
             SS   AT +  IH     Q+A S C+ +L+ +LCVSTL   P+L  KSI EIIS+TV V 
Sbjct  36    SSTAVATRTPHIHVHKNIQIAQSHCEGTLHPELCVSTLSSFPNLHRKSIAEIISSTVKVA  95

Query  933   VSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRH  760
             V E++ +A NCS +RR VP L  +E+RAL  C+EL  + +A+LRT L  L  + S +K +
Sbjct  96    VGEVRDSAHNCSDLRRNVPKLEPIEKRALQDCVELLGETIAELRTALTDLSPKKSASKHY  155

Query  759   ADLQTLLSTAMTNQYTCLDG-FPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDN  583
              D+QTLLS AMTN+ TCLDG F  +  N+  ++   +  I+ HVSN+L+ML KIK+   +
Sbjct  156   NDIQTLLSAAMTNEDTCLDGLFYCTKNNLTRYVEDNLHTIAHHVSNSLAMLNKIKRTSVS  215

Query  582   rfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINA  403
                  F  E   +K+GFP WL RR+RALL+ P+ +      K D+VVAKDGSG+F +IN 
Sbjct  216   SSEEVFP-EYGAVKNGFPNWLKRRERALLQTPVSQ-----TKLDLVVAKDGSGNFTTINE  269

Query  402   ALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTF  223
             ALSAAP+SS TRFVIYIK GSY+EYV+VDKKKTMIMFVGDGIGKT+IKGNRN  DGW TF
Sbjct  270   ALSAAPNSSSTRFVIYIKEGSYFEYVEVDKKKTMIMFVGDGIGKTKIKGNRNHVDGWTTF  329

Query  222   RTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRR  43
             R+ATVAV G GF+AKGI+FENYAGP  HQAVALR+ SD S FY CSFV YQDTLYVHS R
Sbjct  330   RSATVAVVGKGFLAKGITFENYAGPSKHQAVALRSSSDLSAFYQCSFVAYQDTLYVHSLR  389

Query  42    QFFRECDVYGTVDF  1
             QF+R+CDVYGTVDF
Sbjct  390   QFYRDCDVYGTVDF  403



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   426 bits (1096),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/365 (58%), Positives = 268/365 (73%), Gaps = 17/365 (5%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  880
             ++AHS C  +LY  LC+STL   P+L  K+IPEIIS+TVN T+ E+K +  NC++I   +
Sbjct  37    EIAHSHCQDTLYPQLCISTLSLIPNLHQKTIPEIISSTVNATIDEVKGSTENCTKILHKM  96

Query  879   PDLGTMERRALHVCLELFSDA-LADLRTVLDGL----ENSPAKRHADLQTLLSTAMTNQY  715
               L  +E+RAL  C+EL  D+ +++L T L  L     NSP K + DLQTLLS AMTNQ 
Sbjct  97    SKLDPIEKRALDDCIELLGDSTISELNTTLYDLSTKNHNSPYKHYNDLQTLLSAAMTNQD  156

Query  714   TCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrR-------E  556
             TCL GF +S  N+R ++   +  I +HVSN+L+ML K+K E     S S          E
Sbjct  157   TCLSGFDDSKHNLRHYVEHNLHTIEQHVSNSLAMLKKLKPESAPGSSISSSSNSKEVFPE  216

Query  555   NRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSS  376
                +K+G+PKWL ++DR LL+AP+ +     IK D+VVAKDGSG+F++IN ALSAAP SS
Sbjct  217   YGAMKNGYPKWLKKKDRTLLQAPINQ-----IKFDLVVAKDGSGNFRTINEALSAAPTSS  271

Query  375   DTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGG  196
              TRFVIYIKAG+Y EY+DV++KK+MIMFVGDGIGKT+IKGNRN+ DGW TFR+ATVAV G
Sbjct  272   STRFVIYIKAGTYSEYIDVERKKSMIMFVGDGIGKTQIKGNRNVVDGWTTFRSATVAVVG  331

Query  195   SGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVY  16
             +GFIA+GI+FEN+AGP  HQAVALR+ SD S FY CSFV YQDTLYVHS RQF+RECDVY
Sbjct  332   NGFIARGITFENFAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDVY  391

Query  15    GTVDF  1
             GTVDF
Sbjct  392   GTVDF  396



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   426 bits (1096),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 217/388 (56%), Positives = 278/388 (72%), Gaps = 19/388 (5%)
 Frame = -3

Query  1122  FLSLTVFQSSAMNATTSHDIH-----QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEI  958
             FL    F   ++  +++  IH     Q+A+S C  +LY  LC+STL   P+L  KSIPEI
Sbjct  18    FLLTFFFPPKSLLVSSTQQIHVHKNIQIANSHCQDTLYPKLCISTLSLIPNLHKKSIPEI  77

Query  957   ISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALAD-LRTVLDGLE  781
             IS+ VNVT++E+K++A NCS I   +  L  +E+RAL  C+EL  D   D L+T L+ L 
Sbjct  78    ISSNVNVTMNEVKSSAENCSNILHHMSKLDPIEKRALDDCIELLGDTTIDELQTTLNDLS  137

Query  780   -----NSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALS  616
                  NSP K + DLQTLLS AMTNQ TCL+G   S   +  +I K +  IS HVSN+L+
Sbjct  138   TKNSSNSPLKHYNDLQTLLSGAMTNQDTCLEGIHKSKHKLSQYIEKNLHTISHHVSNSLA  197

Query  615   MLTKIKKEKDNrfsssfrR---ENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMV  445
             ML K+K       SS+      E   +K+G+PKWL ++DR LL+AP+ +     IK ++V
Sbjct  198   MLKKLKTGSSQGSSSNSNEVFPEYGTMKNGYPKWLQKKDRTLLQAPLNQ-----IKFNLV  252

Query  444   VAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTR  265
             VAKDGSG+F +INAALSAAP+SS TRFVIYIKAG+Y+EY+DV++KK+MIMF+GDGIGKT 
Sbjct  253   VAKDGSGNFTTINAALSAAPNSSSTRFVIYIKAGTYFEYIDVERKKSMIMFIGDGIGKTV  312

Query  264   IKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCS  85
             IKGNRN+ DGW TFR+ATVAV G+GF+A+GI+FENYAGP  HQAVALR+ SD S FY CS
Sbjct  313   IKGNRNVVDGWTTFRSATVAVVGNGFLARGITFENYAGPSKHQAVALRSGSDLSAFYQCS  372

Query  84    FVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             F+ YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  373   FIAYQDTLYVHSLRQFYRDCDVYGTVDF  400



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   426 bits (1094),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/360 (59%), Positives = 266/360 (74%), Gaps = 10/360 (3%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  892
             H   QVAHSAC+ +LY +LCVSTL+  PDL +K +PE+IS T+N T+SE++ +++NCS I
Sbjct  33    HKHFQVAHSACEGTLYPELCVSTLLSVPDLASKRVPELISVTINRTLSELRASSSNCSSI  92

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQ  718
              +  P+  T+E+RA++ CLELF D + +L++ L+ L  +  P+K + DLQTL S AMTNQ
Sbjct  93    GQSYPNFNTLEKRAINDCLELFHDTIVELKSALNDLSPKKLPSKHYHDLQTLFSGAMTNQ  152

Query  717   YTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRG-LK  541
             YTCLDGF  S+ NVR  I   +  ISRHVSN+L ML KI    DN  S        G +K
Sbjct  153   YTCLDGFAYSDGNVRDVIKSSLYNISRHVSNSLVMLKKI--PGDNMSSKYEVFPEYGRIK  210

Query  540   DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
              GFP WLS  DR LL+  +     +  K D++VAKDGSG+F +I  A+ AAP+ S+TRFV
Sbjct  211   RGFPTWLSLNDRKLLQKSV-----NLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFV  265

Query  360   IYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIA  181
             IYIKAG+Y+E V+VDKKKTM+MFVGDGIGKT +K NR++ DGW TFR+ATVAV G+GFIA
Sbjct  266   IYIKAGAYFENVEVDKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGTGFIA  325

Query  180   KGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KGI+ EN AGP  HQAVALR+ SD S FY CSFVGYQDTLYVHS RQF+RECDVYGTVDF
Sbjct  326   KGITVENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDF  385



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   425 bits (1092),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 212/360 (59%), Positives = 266/360 (74%), Gaps = 10/360 (3%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  892
             H   QVAHSAC+ +LY +LCVSTL+  PDL +K +PE+IS T+N T+SE++ +++NCS I
Sbjct  54    HKHFQVAHSACEGTLYPELCVSTLLSVPDLASKRVPELISVTINRTLSELRASSSNCSSI  113

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQ  718
              +  P+  T+E+RA++ CLELF D + +L++ L+ L  +  P+K + DLQTL S AMTNQ
Sbjct  114   GQSYPNFNTLEKRAINDCLELFHDTIVELKSALNDLSPKKLPSKHYHDLQTLFSGAMTNQ  173

Query  717   YTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRG-LK  541
             YTCLDGF  S+ NVR  I   +  ISRHVSN+L ML KI    DN  S        G +K
Sbjct  174   YTCLDGFAYSDGNVRDVIKSSLYNISRHVSNSLVMLKKI--PGDNMSSKYEVFPEYGRIK  231

Query  540   DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
              GFP WLS  DR LL+  +     +  K D++VAKDGSG+F +I  A+ AAP+ S+TRFV
Sbjct  232   RGFPTWLSLNDRKLLQKSV-----NLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFV  286

Query  360   IYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIA  181
             IYIKAG+Y+E V+VDKKKTM+MFVGDGIGKT +K NR++ DGW TFR+ATVAV G+GFIA
Sbjct  287   IYIKAGAYFENVEVDKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGTGFIA  346

Query  180   KGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KGI+ EN AGP  HQAVALR+ SD S FY CSFVGYQDTLYVHS RQF+RECDVYGTVDF
Sbjct  347   KGITVENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDF  406



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   422 bits (1086),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 207/365 (57%), Positives = 262/365 (72%), Gaps = 13/365 (4%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  892
             H   Q+AHS C  + Y DLCVSTL   PDLR +++PEIIS  VN TV E++ +  NC+RI
Sbjct  64    HQHLQIAHSTCQDTFYPDLCVSTLATFPDLRQRTLPEIISGMVNSTVFEVRDSKQNCTRI  123

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLEN--SPAKRHADLQTLLSTAMTNQ  718
             RR + +L  ++RRAL  CL+L  D  A L+  +  L +  S  + + DLQTL S AMTNQ
Sbjct  124   RRKLQNLDPLDRRALEDCLQLLDDTFAQLKAAISDLSSNKSALQHYMDLQTLFSAAMTNQ  183

Query  717   YTCLDGFPNSN-KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENR---  550
              TCLDGF  S  K +R FI  R+ +IS HVSN+L+ML ++KK++    +     E     
Sbjct  184   DTCLDGFAFSGRKYIRKFIEGRLRKISHHVSNSLAMLKRVKKQQAAAGAVFPEEEGEFGT  243

Query  549   --GLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSS  376
                  DGFP WL ++DRALL+AP+     +  K ++ VAKDGSG+F +IN AL AAP+SS
Sbjct  244   PVKSGDGFPTWLKKKDRALLQAPL-----NQTKVNLTVAKDGSGNFTTINDALQAAPNSS  298

Query  375   DTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGG  196
              TRFVIYIKAG+YYEY++V+++KTMIMF+GDGIGKT IKGNR++  GW TFR++TVAV G
Sbjct  299   TTRFVIYIKAGAYYEYIEVERRKTMIMFMGDGIGKTVIKGNRSVGAGWTTFRSSTVAVVG  358

Query  195   SGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVY  16
              GFIA+GI+ ENYAGP  HQAVALR+ SD S FY CSF+GYQDTLYVHS RQF+RECDVY
Sbjct  359   DGFIARGITVENYAGPSQHQAVALRSGSDLSAFYQCSFIGYQDTLYVHSLRQFYRECDVY  418

Query  15    GTVDF  1
             GTVDF
Sbjct  419   GTVDF  423



>ref|XP_009628637.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=567

 Score =   420 bits (1080),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 227/408 (56%), Positives = 289/408 (71%), Gaps = 20/408 (5%)
 Frame = -3

Query  1179  MQNLGRNPIMLVPVVLLAPFLSLTVF-------QSSAMNATTSHDIH-----QVAHSACD  1036
             M NL R   +L+ +  L+  +SLT F        SS    TT+  IH     Q+AHS C 
Sbjct  1     MYNLRRKTSLLLTLFALSAIVSLTFFTLSNNPKSSSKTVLTTTPHIHVHKNIQIAHSHCQ  60

Query  1035  HSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMER  856
              + Y  LCVSTL   PDL  KSI +IIS+T+NVTV+E+K +A NC+ IR  +P L   E+
Sbjct  61    DTRYPKLCVSTLSLIPDLAQKSISQIISSTINVTVAEVKASARNCTDIREDLPQLEPYEK  120

Query  855   RALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNK  682
             RAL  C++L  + + +LRT L  L  +  P++ + DLQTLLS AMTNQ TCLDG   S K
Sbjct  121   RALEDCVQLLDNTIIELRTTLSDLNPKKPPSQNYNDLQTLLSAAMTNQATCLDGLARSKK  180

Query  681   NVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRG-LKDGFPKWLSRRDR  505
             N+R ++   +  I+ HVSN LSML K+KK   +   S       G +K+GFPKWL +RDR
Sbjct  181   NLRRYVQHNLHTIAHHVSNCLSMLKKMKKSSFSSSKSQEIYPEYGAVKNGFPKWLKKRDR  240

Query  504   ALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYV  325
             ALL+AP+     ++ K D+VVAKDGSG+F +IN ALSAAP++S TRFVIYIKAG+Y+EY+
Sbjct  241   ALLQAPI-----NETKIDLVVAKDGSGNFSTINEALSAAPNASTTRFVIYIKAGAYFEYI  295

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPE  145
             +V +KK MIMF+GDGIGKT IKGNR++ DGW TFR+ATVAV G+GF+AKGI+FENYAGP 
Sbjct  296   EVVRKKPMIMFLGDGIGKTLIKGNRSVVDGWTTFRSATVAVVGNGFLAKGITFENYAGPS  355

Query  144   NHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              HQAVA+R+ SD+S FY CSFV YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  356   KHQAVAVRSGSDFSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDF  403



>ref|XP_011079629.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=566

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/357 (57%), Positives = 269/357 (75%), Gaps = 9/357 (3%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRR-V  883
             Q+A S C+ +LY DLCVST+   P+LR K++PEIIS T+NVT+ E++ +A+NCS +RR +
Sbjct  48    QIAKSTCEGTLYPDLCVSTVAAFPELRRKTLPEIISGTINVTMKEVRASASNCSSLRRKL  107

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLE--NSPAKRHADLQTLLSTAMTNQYTC  709
             +  L  ++ +AL  CLELFSD + +L+ +L  L   NSP K + DLQTLLS AMTNQ TC
Sbjct  108   MKKLAPLDLQALDDCLELFSDTVGELKRILAELSAGNSPEKYYDDLQTLLSGAMTNQDTC  167

Query  708   LDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRG-LKDGF  532
             LDGF  S  N R  I  R+++I++H+SN+L+M+ K+KK    +          G +KDG+
Sbjct  168   LDGFAYSKNNTRQLIQGRLKRITKHMSNSLAMVKKLKKRSKKKPGHGEEFPEYGQMKDGY  227

Query  531   PKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYI  352
             P WL + DR LL+        ++ K D+VVA+DGSG+F +IN AL AAP++SDTRFVIYI
Sbjct  228   PTWLKKNDRRLLQT-----AANETKYDLVVAQDGSGNFTTINEALDAAPNNSDTRFVIYI  282

Query  351   KAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGI  172
             K G+YYEY++V +KKTMIMF+GDGIGKT IKGNR++ DGW TFR++TVAV G+GFIAKGI
Sbjct  283   KGGAYYEYIEVVRKKTMIMFLGDGIGKTLIKGNRSVVDGWTTFRSSTVAVLGNGFIAKGI  342

Query  171   SFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +FENYAGP  HQAVALR+ +D+S FY CSFV YQDTLYVHS RQF+RECD+YGT+DF
Sbjct  343   TFENYAGPSKHQAVALRSGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDIYGTIDF  399



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   416 bits (1070),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 218/391 (56%), Positives = 276/391 (71%), Gaps = 15/391 (4%)
 Frame = -3

Query  1158  PIMLVPVVLLAPFLSLTVFQSSAMNATTSHDIH---QVAHSACDHSLYRDLCVSTLVKTP  988
             PI ++ V LL+ F     F S  +     H IH   Q+AHSAC  +LY +LCVSTLV  P
Sbjct  16    PISILVVTLLS-FKRPAKFSSKTIEIPRLH-IHKHIQIAHSACKGTLYPELCVSTLVSLP  73

Query  987   DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALAD  808
             DL +KS+PE ISAT+N T+ E++ ++ANC+ IR  +  LG +E+ AL  C+ELF D +A+
Sbjct  74    DLASKSLPEFISATLNKTMDEVRASSANCNAIRNKI-KLGPLEKVALKDCIELFDDTIAE  132

Query  807   LRTVLDGL--ENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRH  634
             L++ +  L    S +K + DLQTLLS AMTNQYTCLDGF  S   VR  I K +  IS H
Sbjct  133   LKSAISDLAPRKSTSKHYHDLQTLLSGAMTNQYTCLDGFARSKGKVRKAIKKGLYNISHH  192

Query  633   VSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKA  454
             VSN+L+ML KI     N   S    E   +K GFP WLS +DR LL+A       +  K 
Sbjct  193   VSNSLAMLKKIPGV--NTSKSEVFPEYGNVKHGFPSWLSSKDRKLLQA-----SANATKF  245

Query  453   DMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIG  274
             D++VAKDG+G+F +I+ A+ AAP+SSDTRFVIYIKAG+Y+E V+V++KK M++F+GDGIG
Sbjct  246   DLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIYIKAGAYFENVEVERKKKMLVFIGDGIG  305

Query  273   KTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFY  94
             KT +K  R++ DGW TFR+ATVAV G GFIAKGI+FEN AGP  HQAVALR+ SD S FY
Sbjct  306   KTVVKAKRSVVDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDLSAFY  365

Query  93    DCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              CSFVGYQDTLYVHS RQF+RECDVYGT+DF
Sbjct  366   QCSFVGYQDTLYVHSLRQFYRECDVYGTIDF  396



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 222/405 (55%), Positives = 286/405 (71%), Gaps = 21/405 (5%)
 Frame = -3

Query  1179  MQNLGRNPIMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTL  1000
             M N  R P +L+ +  +     L +F S  ++  T +   ++AHS C  +LY  LC+STL
Sbjct  1     MYNQRRKPSLLLTLSAII----LLIFFSLPISLQTQNIQLEIAHSHCQDTLYPQLCISTL  56

Query  999   VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSD  820
                P+L  K+IPEIIS+TVN TV E+K +  NC+ I   +  L  +E+RAL  C+EL  D
Sbjct  57    SLIPNLHQKTIPEIISSTVNTTVDEVKASTENCTNILHKMSKLDPIEKRALDDCIELLGD  116

Query  819   A-LADLRTVLDGL----ENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKR  655
             + +++L T L  L     NSP K + DLQTLLS AMTNQ TCL GF +S  N+R +I   
Sbjct  117   STISELNTTLYDLSTKNHNSPYKHYNDLQTLLSAAMTNQDTCLGGFDDSKHNLRHYIEHN  176

Query  654   VEQISRHVSNALSMLTKIK-------KEKDNrfsssfrRENRGLKDGFPKWLSRRDRALL  496
             +  I +HVSN+L+ML K+K           +  S+    E   +K+G+PKWL ++DRALL
Sbjct  177   LHTIEQHVSNSLAMLKKLKTGTAPGSSIPSSSNSNEVFPEYGAMKNGYPKWLKKKDRALL  236

Query  495   EAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVD  316
             +AP+ +     IK D+VVAKDGSG+F++IN ALSAAP SS TRFVIYIKAG+Y+EY+DV+
Sbjct  237   QAPINQ-----IKFDLVVAKDGSGNFRTINEALSAAPSSSSTRFVIYIKAGTYFEYIDVE  291

Query  315   KKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQ  136
             +KK+MIMFVGDGIGKT+IKGNRN+ DGW TFR+ATVAV G+GFIA+GI+FEN+AGP  HQ
Sbjct  292   RKKSMIMFVGDGIGKTQIKGNRNVVDGWTTFRSATVAVVGNGFIARGITFENFAGPSKHQ  351

Query  135   AVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR+ SD S FY CSFV YQDTLYVHS RQF+RECDVYGTVDF
Sbjct  352   AVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDF  396



>ref|XP_004247400.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=562

 Score =   414 bits (1063),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 225/400 (56%), Positives = 287/400 (72%), Gaps = 20/400 (5%)
 Frame = -3

Query  1164  RNPIMLVPVVLLAPFL--SLTVFQSSAMNATTSHDIH-----QVAHSACDHSLYRDLCVS  1006
             + P++L    LLA F+  SLT F S + N++    IH     Q+AHS C+ +LY+ LCVS
Sbjct  7     KTPLLLS---LLAIFIIVSLTFFTSLSKNSSEIVHIHVHKNIQIAHSHCEDALYKQLCVS  63

Query  1005  TLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELF  826
             TL   PDL  KSI +IIS+T+NVTV E+K +A NC+ IR  +P L   E+RAL  C++L 
Sbjct  64    TLASIPDLPQKSISQIISSTINVTVVEVKASAKNCTDIREDLPKLEPYEKRALEDCIQLL  123

Query  825   SDALADLRTVLDGLE--NSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRV  652
              D + +L++ L  L    S ++ + DLQTLLS AMTNQ TCLDG   S KN+R F+ +R+
Sbjct  124   DDTIIELKSSLVALHPNRSLSQNYNDLQTLLSAAMTNQATCLDGLGRSTKNLRRFVQRRL  183

Query  651   EQISRHVSNALSMLTKIKKEKDNrfsssfrR---ENRGLKDGFPKWLSRRDRALLEAPMG  481
               IS HVSN L+ML K+KK   +  +        E   + DGFP W+ RRDRALL+ P+ 
Sbjct  184   HTISHHVSNCLAMLKKLKKSSSSLKTRKSLEIYPEYGVVHDGFPNWIKRRDRALLQTPIN  243

Query  480   KGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTM  301
             +      K D++VAKDG+G+F +IN ALSAAP+SS TRFVIYIKAG+Y+EYV+V KKK+M
Sbjct  244   Q-----TKIDLIVAKDGTGNFSTINDALSAAPNSSKTRFVIYIKAGAYFEYVEVVKKKSM  298

Query  300   IMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALR  121
             IMF+GDGIGKT IKGNR++ DGW TFR+ATVAV G+GF+AKGI+FENYAGP  HQAVA+R
Sbjct  299   IMFLGDGIGKTLIKGNRSVVDGWTTFRSATVAVVGNGFLAKGITFENYAGPSKHQAVAVR  358

Query  120   ADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + SD S FY CSFV YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  359   SGSDLSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDF  398



>ref|XP_009765668.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=566

 Score =   413 bits (1062),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 222/407 (55%), Positives = 288/407 (71%), Gaps = 19/407 (5%)
 Frame = -3

Query  1179  MQNLGRNPIMLVPVVLLAPFLSLTVF------QSSAMNATTSHDIH-----QVAHSACDH  1033
             M NL R   +L+ +  L+  +S+T F      +SS+    T+  IH     Q+AHS C  
Sbjct  1     MYNLRRKTPLLLTLFALSAIVSVTFFGLSNNPKSSSKTVQTTPHIHVHKNIQIAHSHCQD  60

Query  1032  SLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERR  853
             + Y  LCVSTL   PDL  KSI +IIS+T+NVTV+E+K +A NC+ IR  +P L   E+R
Sbjct  61    TRYPKLCVSTLSLIPDLAQKSISQIISSTINVTVAEVKASAKNCTEIREDLPRLEPYEKR  120

Query  852   ALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKN  679
             AL  C++L  + + +L+T L  L  + SP++ + DLQTLLS AMTNQ TCLDG     KN
Sbjct  121   ALEDCVQLLDNTIIELKTTLSDLHPKKSPSQNYNDLQTLLSAAMTNQATCLDGLARCKKN  180

Query  678   VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRG-LKDGFPKWLSRRDRA  502
             +R ++   +  I+ HVSN L+ML K+KK       S       G +K+GFPKWL +RDRA
Sbjct  181   LRRYVQHNLHTIAHHVSNCLAMLKKMKKSSFASSKSQEIYPEYGAVKNGFPKWLKKRDRA  240

Query  501   LLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVD  322
             LL+AP+     ++ K D+VVAKDGSG+F +IN ALSAAP++S TRFVI+IKAG+YYEY++
Sbjct  241   LLQAPI-----NETKIDLVVAKDGSGNFSTINEALSAAPNASRTRFVIHIKAGAYYEYIE  295

Query  321   VDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPEN  142
             V ++K MIMF+GDGIGKT IKGNR++ DGW TFR+ATVAV G+GFIAKGI+FEN+AGP  
Sbjct  296   VVRRKPMIMFLGDGIGKTLIKGNRSVVDGWTTFRSATVAVVGNGFIAKGITFENFAGPSK  355

Query  141   HQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             HQAVA+R+ SD S FY CSFV YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  356   HQAVAVRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDF  402



>ref|XP_006359860.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=562

 Score =   413 bits (1062),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 220/383 (57%), Positives = 281/383 (73%), Gaps = 15/383 (4%)
 Frame = -3

Query  1119  LSLTVFQSSAMNATTSHDIH-----QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEII  955
             + LT F S + N++ +  IH     Q+AHS C+ +LY+ LCVSTL   PDL  KSI +II
Sbjct  21    VCLTFFTSLSKNSSETVHIHVHKNIQIAHSHCEDALYKQLCVSTLSSIPDLPQKSISQII  80

Query  954   SATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL--E  781
             S+T+NVTV E+K +A NC+ IR  +P L   E+RAL  C++L  + + DL++ L  L   
Sbjct  81    SSTINVTVVEVKASAKNCTDIREDLPKLEPYEKRALEDCIQLLDNTIIDLKSSLLALSPN  140

Query  780   NSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKI  601
              S ++ + DLQTLLS AMTNQ TCLDG   S KN+R F+ +R+  IS HVSN L+ML K+
Sbjct  141   RSLSQNYNDLQTLLSAAMTNQATCLDGLGRSKKNLRRFVQRRLHTISHHVSNCLAMLKKL  200

Query  600   KKEKDNrfsssfrR---ENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDG  430
             KK   +  +        E   + DGFPKW+ RRDRALL+AP+ +      K D+VVAKDG
Sbjct  201   KKSSSSLKTRKSLEIYPEYGVVHDGFPKWIKRRDRALLQAPINQ-----TKIDLVVAKDG  255

Query  429   SGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNR  250
             +G+F +IN ALSAAP+SS TRFVIYIKAG+Y+EYV+V KK++MIMF+GDGIGKT IKGNR
Sbjct  256   TGNFSTINEALSAAPNSSRTRFVIYIKAGAYFEYVEVVKKQSMIMFLGDGIGKTLIKGNR  315

Query  249   NMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQ  70
             ++ DGW TFR+ATVAV G+GF+AKGI+FENYAGP  HQAVA+R+ SD+S FY CSFV YQ
Sbjct  316   SVVDGWTTFRSATVAVVGNGFLAKGITFENYAGPSKHQAVAVRSGSDFSAFYQCSFVAYQ  375

Query  69    DTLYVHSRRQFFRECDVYGTVDF  1
             DTLYVHS RQF+R+CDVYGTVDF
Sbjct  376   DTLYVHSLRQFYRDCDVYGTVDF  398



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   413 bits (1061),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 217/391 (55%), Positives = 275/391 (70%), Gaps = 15/391 (4%)
 Frame = -3

Query  1158  PIMLVPVVLLAPFLSLTVFQSSAMNATTSHDIH---QVAHSACDHSLYRDLCVSTLVKTP  988
             PI ++ V LL+ F     F S  +     H IH   Q+AHSAC  +LY +LCVSTLV   
Sbjct  16    PISILVVTLLS-FKRPAKFSSKTIEIPRLH-IHKHIQIAHSACKGTLYPELCVSTLVSLS  73

Query  987   DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALAD  808
             DL +KS+PE ISAT+N T+ E++ ++ANC+ IR  +  LG +E+ AL  C+ELF D +A+
Sbjct  74    DLASKSLPEFISATLNKTMDEVRASSANCNAIRNKI-KLGPLEKVALKDCIELFDDTIAE  132

Query  807   LRTVLDGL--ENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRH  634
             L++ +  L    S +K + DLQTLLS AMTNQYTCLDGF  S   VR  I K +  IS H
Sbjct  133   LKSAISDLAPRKSTSKHYHDLQTLLSGAMTNQYTCLDGFARSKGKVRKAIKKGLYNISHH  192

Query  633   VSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKA  454
             VSN+L+ML KI     N   S    E   +K GFP WLS +DR LL+A       +  K 
Sbjct  193   VSNSLAMLKKIPGV--NTSKSEVFPEYGNVKHGFPSWLSSKDRKLLQA-----SANATKF  245

Query  453   DMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIG  274
             D++VAKDG+G+F +I+ A+ AAP+SSDTRFVIYIKAG+Y+E V+V++KK M++F+GDGIG
Sbjct  246   DLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIYIKAGAYFENVEVERKKKMLVFIGDGIG  305

Query  273   KTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFY  94
             KT +K  R++ DGW TFR+ATVAV G GFIAKGI+FEN AGP  HQAVALR+ SD S FY
Sbjct  306   KTVVKAKRSVVDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDLSAFY  365

Query  93    DCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              CSFVGYQDTLYVHS RQF+RECDVYGT+DF
Sbjct  366   QCSFVGYQDTLYVHSLRQFYRECDVYGTIDF  396



>gb|EPS62329.1| pectinesterase [Genlisea aurea]
Length=560

 Score =   410 bits (1055),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/357 (57%), Positives = 261/357 (73%), Gaps = 6/357 (2%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKT-PDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             QVA SACD +LY DLCVST+    P+LR K++PEII+AT+NVT+ E++TA++NCS +RR 
Sbjct  41    QVAESACDGTLYPDLCVSTVSAVLPELRRKTLPEIIAATINVTMKEVRTASSNCSSLRRK  100

Query  882   V-PDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA--KRHADLQTLLSTAMTNQYT  712
             +   L  +E RAL  CLELFS   +DL  +   L+ S A  K + DL+TLLS AMTNQYT
Sbjct  101   LNKKLEPLELRALEDCLELFSYTASDLSKIFSDLKASSAQEKYYDDLRTLLSAAMTNQYT  160

Query  711   CLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGF  532
             CLDGF  S  N R  I  R+++IS H SNAL+M+ K+K+              R  +DGF
Sbjct  161   CLDGFAYSKNNTREIIQGRLKRISHHASNALAMVRKLKRRSRKLIEEDSPVVARMRRDGF  220

Query  531   PKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYI  352
             P W+ + DR  L++       +    D++VA+DGSG+F +IN AL+AAP++S+TRFVIYI
Sbjct  221   PAWMKKSDRRFLQS--AANSTNSTSYDLIVAQDGSGNFSTINDALNAAPNNSNTRFVIYI  278

Query  351   KAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGI  172
             K+G+YYEYVD+ + KT+I FVGDGIGKT IKGNR++ DGW TFR+ATVAV G+GFIA GI
Sbjct  279   KSGAYYEYVDIPRSKTLISFVGDGIGKTLIKGNRSVIDGWTTFRSATVAVVGNGFIATGI  338

Query  171   SFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + ENYAG   HQAVALR+ +D+S FY CSFVGYQDTLYV+S RQFFR+CD+YGTVDF
Sbjct  339   TIENYAGAVKHQAVALRSGADFSAFYRCSFVGYQDTLYVYSNRQFFRQCDIYGTVDF  395



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   409 bits (1052),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 215/400 (54%), Positives = 282/400 (71%), Gaps = 16/400 (4%)
 Frame = -3

Query  1179  MQNLGRNPIMLVPVVLLAPFLSLTVFQSSAMNATTSHDIH-----QVAHSACDHSLYRDL  1015
             M NL    I+ V   LL  FLS T F ++   ++  H +H     QVA S C  +LY DL
Sbjct  1     MNNLTLASILTVISALL--FLS-THFTNTPTRSSEKH-LHFHKHMQVAQSTCQGTLYPDL  56

Query  1014  CVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCL  835
             CVSTL   PDL +KS+P++IS+ VN T+ E+K++  NCS +++ + +L  +++RAL  CL
Sbjct  57    CVSTLATFPDLTSKSVPQVISSVVNHTMYEVKSSFYNCSSLKKKIRNLNPLDQRALDDCL  116

Query  834   ELFSDALADLRTVLDGLENSP--AKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFII  661
             +LF D   +L+T +D L  S   +KRH DLQTLLS AMTN YTCLDGF  S   VR  I 
Sbjct  117   KLFQDTNLELKTTIDDLSKSSIGSKRHHDLQTLLSGAMTNLYTCLDGFAYSKGRVRDRIE  176

Query  660   KRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMG  481
             K++ +IS H+SN+L+ML K+   K     S    E   +K GFP W+S +DR LL+A + 
Sbjct  177   KKLLEISHHMSNSLAMLKKVPGVKTRTSKSEVFPEYGKMKKGFPLWVSPKDRKLLQASV-  235

Query  480   KGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTM  301
                 ++ K D+VVAKDG+G+F +I  AL+ AP+SS TRFVI+IK G+Y+E V+V +KKT 
Sbjct  236   ----NESKFDLVVAKDGTGNFTTIGEALALAPNSSTTRFVIHIKEGAYFENVEVIRKKTN  291

Query  300   IMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALR  121
             +MFVGDGIGKT +KG+RN+ DGW TF++ATVAV G GFIAKGI+FEN AGPE HQAVALR
Sbjct  292   LMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVLGEGFIAKGITFENSAGPEKHQAVALR  351

Query  120   ADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + +D+S F+ CSFVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  352   SGADFSAFFRCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  391



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   407 bits (1047),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 212/406 (52%), Positives = 281/406 (69%), Gaps = 19/406 (5%)
 Frame = -3

Query  1179  MQNLGRNPIMLVPVVLLAPFLSLTVFQSSAMNATTSHD----------IHQVAHSACDHS  1030
             M NL    I+ V   LL  FL  T F ++ +  T + D          I  VA S C  +
Sbjct  1     MNNLTLASILTVISALLL-FLGTTHFTNTPITITRAPDQKHLHHFQKHIQVVAKSTCQGT  59

Query  1029  LYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRA  850
             LY DLCVSTL   PDL  KS+P++IS+ VN T+ E+++++ NCS +++++ +L  +++RA
Sbjct  60    LYPDLCVSTLATFPDLATKSVPQVISSVVNHTMYEVRSSSYNCSGLKKMLKNLNPLDQRA  119

Query  849   LHVCLELFSDALADLRTVLDGLENSP--AKRHADLQTLLSTAMTNQYTCLDGFPNSNKNV  676
             L  CL+LF D   +L+  +D L  S   +KRH DLQT+LS AMTN YTCLDGF  S   V
Sbjct  120   LDDCLKLFEDTNVELKATIDDLSKSTIGSKRHHDLQTMLSGAMTNLYTCLDGFAYSKGRV  179

Query  675   RPFIIKRVEQISRHVSNALSMLTKIKK-EKDNrfsssfrRENRGLKDGFPKWLSRRDRAL  499
             R  I K++ +IS HVSN+L+ML K+   +K     S    E   +K GFP W+S +DR L
Sbjct  180   RDRIEKKLLEISHHVSNSLAMLNKVPGVKKLTTSESVVFPEYGNMKKGFPSWVSSKDRKL  239

Query  498   LEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDV  319
             L+A     K  + K D++VAKDG+G+F +I  AL+ AP+SS TRFVI+IK G+Y+E V+V
Sbjct  240   LQA-----KVKETKFDLLVAKDGTGNFTTIGEALAVAPNSSTTRFVIHIKEGAYFENVEV  294

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENH  139
              +KKT +MFVGDGIGKT +KG+RN+ DGW TF++ATVAV G+GFIAKGI+FEN AGP+ H
Sbjct  295   IRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVVGAGFIAKGITFENSAGPDKH  354

Query  138   QAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR+ +D+S FY CSFVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  355   QAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  400



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   407 bits (1047),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 275/389 (71%), Gaps = 21/389 (5%)
 Frame = -3

Query  1161  NPIMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDL  982
             NPI   P  +  P L L             H   Q+AHSAC+ +LY +LCVST+   PDL
Sbjct  30    NPIKKEPKSIKIPPLHL-------------HKHLQIAHSACEGTLYPELCVSTVSSFPDL  76

Query  981   RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLR  802
              +K+IP+IISATV  TV+E++T+A+NC+  R     L  +++ AL  CLEL  + +A+L+
Sbjct  77    ASKTIPDIISATVQHTVNEVRTSASNCTGJRMKRRTLDPLQQMALDDCLELLDETVAELK  136

Query  801   TVLDGL--ENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVS  628
             + L  L  +NSP++ + DL TLLS AMTN+YTCLDGF +S  NVR  I + +  IS  VS
Sbjct  137   SALSDLSPKNSPSRHYNDLGTLLSAAMTNEYTCLDGFVHSKGNVREEIKQGLYNISHSVS  196

Query  627   NALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADM  448
             N+L+ML KI K   +  +  F    R +  GFP+W+S RDR LL+A       +  K D+
Sbjct  197   NSLAMLKKIPKSNRSSKAEVFPEYGR-MVGGFPRWVSPRDRKLLQA-----STNTTKFDL  250

Query  447   VVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKT  268
             VVAKDGSG+F +I+ A++AAP+S+ TRFVIYIKAG+Y+E VDVDKKKTM+MFVGDGIGKT
Sbjct  251   VVAKDGSGNFTTISDAVAAAPNSTTTRFVIYIKAGAYFENVDVDKKKTMLMFVGDGIGKT  310

Query  267   RIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDC  88
              +K NR++ DGW TFR+ATVAV G+GFIA+ ++FEN AGP  HQAVALR+ SD S FY C
Sbjct  311   VVKANRSVVDGWTTFRSATVAVVGNGFIARDMTFENSAGPNKHQAVALRSGSDLSAFYRC  370

Query  87    SFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             SFVGYQDTLYVHS RQF+R+CD+YGTVDF
Sbjct  371   SFVGYQDTLYVHSLRQFYRDCDIYGTVDF  399



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   407 bits (1047),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 213/391 (54%), Positives = 275/391 (70%), Gaps = 15/391 (4%)
 Frame = -3

Query  1158  PIMLVPVVLLAPFLSLTVFQSSAMNATTSHDIH---QVAHSACDHSLYRDLCVSTLVKTP  988
             PI ++ V LL+ F     F S  +     H IH   Q+AHSAC  +LY +LCVSTLV  P
Sbjct  16    PISILVVTLLS-FKRPAKFSSKTIEIPRLH-IHKHIQIAHSACKGTLYPELCVSTLVSLP  73

Query  987   DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALAD  808
             DL +KS+ E ISAT+N T+ E++ ++A+C+ IR  +  LG +E+ AL  C+ELF D +A+
Sbjct  74    DLASKSLQEFISATLNKTMDEVRASSADCNAIRNKM-KLGPLEKVALKDCIELFDDTIAE  132

Query  807   LRTVLD--GLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRH  634
             L++ +    L    +K + DLQTLLS AMTNQYTCLDGF  S   VR  I K +  IS H
Sbjct  133   LKSAISNLALRKPTSKHYHDLQTLLSGAMTNQYTCLDGFARSKGKVRKAIKKGLYNISHH  192

Query  633   VSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKA  454
             VSN+L+ML KI     N   S    E   +K GFP WLS +DR LL+A       +  K 
Sbjct  193   VSNSLAMLKKIPGV--NASKSEVFPEYGNVKHGFPSWLSTKDRKLLQA-----SANATKF  245

Query  453   DMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIG  274
             D++VAKDG+G+F +I+ A+ AAP+SSDTRFVI+IKAG+Y+E V+V++KK M++F+GDGIG
Sbjct  246   DLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIHIKAGAYFENVEVERKKKMLVFIGDGIG  305

Query  273   KTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFY  94
             KT +K NR++ DGW TFR+ATVAV G GFIAKGI+FEN AGP  HQAVALR+ SD S FY
Sbjct  306   KTVVKANRSVVDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDLSAFY  365

Query  93    DCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              CSFVGYQDTLYVH+ RQF+RECD+YGT+DF
Sbjct  366   QCSFVGYQDTLYVHTLRQFYRECDIYGTIDF  396



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   405 bits (1042),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 264/360 (73%), Gaps = 10/360 (3%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  892
             H+  Q+AHSAC+ +LY DLCVST+   PDL +K++PE+I AT+N T+ E++ ++ANC+ I
Sbjct  46    HNHLQIAHSACEGTLYPDLCVSTISVLPDLASKTLPELIQATLNQTMYEVRLSSANCTGI  105

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL---ENSPAKRHADLQTLLSTAMTN  721
              + +      E  A++ CLELF D L +L+  L  L   + + ++ + DLQT LS AMTN
Sbjct  106   EKRIKSYSKREEAAINDCLELFDDTLEELKVALADLAPKKLAVSRNYHDLQTFLSAAMTN  165

Query  720   QYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLK  541
             QYTCLDGF  S  NVR  I K +  I+ HVSN+L ML K+     N+  S +  +   LK
Sbjct  166   QYTCLDGFARSKGNVRNIIKKGLHNITHHVSNSLVMLKKVPGV--NKSKSEYFPQQGRLK  223

Query  540   DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
             +GFP WLSR+DR LL+A +     ++ + D++VAKDG+G+F +IN A++AAP++S+TRFV
Sbjct  224   NGFPSWLSRQDRILLQASV-----NETEFDLIVAKDGTGNFTTINDAVAAAPNNSNTRFV  278

Query  360   IYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIA  181
             IYIKAGSY+E V+V KKK M+MFVGDGIGKT +K NRN+ DG+ TFR+ATVAV G GFIA
Sbjct  279   IYIKAGSYFENVEVVKKKKMLMFVGDGIGKTVVKANRNVVDGFTTFRSATVAVVGEGFIA  338

Query  180   KGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KGI+FEN AGP  HQAVALR+ SD S FY CSFV YQDTLYVHS RQF+RECD+YGTVDF
Sbjct  339   KGITFENSAGPSKHQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGTVDF  398



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   405 bits (1042),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 210/383 (55%), Positives = 276/383 (72%), Gaps = 9/383 (2%)
 Frame = -3

Query  1140  VVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPE  961
             + LL   +S+T+F   A ++       Q+AHSAC+ +LY +LCVSTL   PDL +K+I +
Sbjct  45    IQLLVLTISITLFLVQASSSIPVLHHLQIAHSACEGTLYPELCVSTLSSFPDLTSKTISQ  104

Query  960   IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL-  784
             +IS+TVN TV E++ +A+NC+ IR+ +     +E+RAL  CLELF + +++L+T L  L 
Sbjct  105   MISSTVNYTVKEVEISASNCTDIRKNLKAQDPLEQRALDDCLELFDETISELQTALSDLS  164

Query  783   -ENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNV-RPFIIKRVEQISRHVSNALSML  610
              ++SP+K + DLQTLLS AMTNQYTCLDG    N+ V R  I + +  IS  VSN+L+ML
Sbjct  165   PKSSPSKHYNDLQTLLSAAMTNQYTCLDGLSLGNEQVIREEIKQNLNNISHLVSNSLAML  224

Query  609   TKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDG  430
             TK+ K  D      F  E   +   FP W+S +DR LL+A       + +K D+VVAKDG
Sbjct  225   TKMPKAADTLKDEVFP-EYGKMAGRFPGWVSPKDRKLLQA-----STNTMKFDLVVAKDG  278

Query  429   SGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNR  250
             SG+F++I  A++AAP+SS TRFVIYIKAG+Y+E VDV KKKTM+MFVGDGIGKT +K +R
Sbjct  279   SGNFRTIGEAVAAAPNSSATRFVIYIKAGTYFENVDVGKKKTMLMFVGDGIGKTVVKASR  338

Query  249   NMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQ  70
             N+ DGW TFR+ATVAV G+GFIA+ ++ EN AGP  HQAVALR+ SD S FY CSFVGYQ
Sbjct  339   NVVDGWTTFRSATVAVVGNGFIARDMTIENAAGPSKHQAVALRSGSDLSAFYRCSFVGYQ  398

Query  69    DTLYVHSRRQFFRECDVYGTVDF  1
             DTLYVHS RQF+RECD+YGTVDF
Sbjct  399   DTLYVHSLRQFYRECDIYGTVDF  421



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score =   404 bits (1038),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 201/359 (56%), Positives = 261/359 (73%), Gaps = 9/359 (3%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  892
             H   Q+AHS C+ +LY +LCVSTL   PDL +K++PE+I+ATV+ TV E+K +A+NCS I
Sbjct  46    HKHVQIAHSHCEGTLYPELCVSTLSTFPDLASKTVPEVIAATVSHTVGEVKLSASNCSGI  105

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQ  718
             RR + +L T+E RA++ CLEL    +A L++ +  L   NSPAK + DLQTLLS ++TN 
Sbjct  106   RRKLKNLNTLEGRAINDCLELHDCTIAQLQSTISDLSHNNSPAKHYHDLQTLLSGSITNL  165

Query  717   YTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD  538
             YTCLDGF  S K++R  I   +  IS HVSN+L+ML KI   + ++       E    KD
Sbjct  166   YTCLDGFAYSKKHIRSSIEGPLRNISHHVSNSLAMLKKIPGVQSSKSEIFP--EYGSTKD  223

Query  537   GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVI  358
             GFP WLS +DR LL+A   +     I  ++ VAKDGSGDF +I  A++AAP+SS TRFVI
Sbjct  224   GFPAWLSGKDRRLLQASASQ-----IHYNLTVAKDGSGDFTTIGEAIAAAPNSSTTRFVI  278

Query  357   YIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAK  178
             +IKAG+Y+EY+D+ + KTM+M VGDG+  T IKGNR++  GW TF++ TVAV  + FIAK
Sbjct  279   HIKAGAYFEYLDIARSKTMLMLVGDGLENTYIKGNRSVGGGWTTFQSGTVAVVANNFIAK  338

Query  177   GISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             GISFENYAGP NHQAVALR+ +D SVFY C F+GYQDTLYVHS RQF+RECDVYGT+DF
Sbjct  339   GISFENYAGPSNHQAVALRSGADLSVFYLCRFIGYQDTLYVHSLRQFYRECDVYGTIDF  397



>emb|CBI36883.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   402 bits (1034),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 201/359 (56%), Positives = 258/359 (72%), Gaps = 16/359 (4%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  892
             H   Q+AHS C+ +LY +LCVSTL   PDL +K++PE+I+ATV+ TV E+K +A+NCS I
Sbjct  56    HKHVQIAHSHCEGTLYPELCVSTLSTFPDLASKTVPEVIAATVSHTVGEVKLSASNCSGI  115

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQ  718
             RR + +L T+E RA++ CLEL    +A L++ +  L   NSPAK + DLQTLLS ++TN 
Sbjct  116   RRKLKNLNTLEGRAINDCLELHDCTIAQLQSTISDLSHNNSPAKHYHDLQTLLSGSITNL  175

Query  717   YTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD  538
             YTCLDGF  S K++R  I   +  IS HVSN+L+ML KI              E    KD
Sbjct  176   YTCLDGFAYSKKHIRSSIEGPLRNISHHVSNSLAMLKKIPG---------IFPEYGSTKD  226

Query  537   GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVI  358
             GFP WLS +DR LL+A   +     I  ++ VAKDGSGDF +I  A++AAP+SS TRFVI
Sbjct  227   GFPAWLSGKDRRLLQASASQ-----IHYNLTVAKDGSGDFTTIGEAIAAAPNSSTTRFVI  281

Query  357   YIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAK  178
             +IKAG+Y+EY+D+ + KTM+M VGDG+  T IKGNR++  GW TF++ TVAV  + FIAK
Sbjct  282   HIKAGAYFEYLDIARSKTMLMLVGDGLENTYIKGNRSVGGGWTTFQSGTVAVVANNFIAK  341

Query  177   GISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             GISFENYAGP NHQAVALR+ +D SVFY C F+GYQDTLYVHS RQF+RECDVYGT+DF
Sbjct  342   GISFENYAGPSNHQAVALRSGADLSVFYLCRFIGYQDTLYVHSLRQFYRECDVYGTIDF  400



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   400 bits (1029),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 215/418 (51%), Positives = 289/418 (69%), Gaps = 24/418 (6%)
 Frame = -3

Query  1206  SYHSTIDSEMQNLGRNPIMLVPVVLLAPFLSLTVFQSSAMNATTS--------HDIHQVA  1051
             S H+T  + M NL R   +L+ V+  +  L + +F ++ +  + S        + I   A
Sbjct  6     SLHTT--TTMYNLRRRTKLLLSVLPTSALLLILLFSNTHLRNSNSITPKTHVHNRIQLAA  63

Query  1050  HSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI-RRVVPD  874
             HSAC  +LY+DLCVSTL   PDL  KS+P+IIS TV+ TVSE++ +++NC+ I ++    
Sbjct  64    HSACQDTLYKDLCVSTLSTFPDLSTKSVPQIISYTVSHTVSEVQASSSNCTGIIKKQFKK  123

Query  873   LGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQYTCLDG  700
             L  +++ AL  CLELF D +A+L+ V+  L  E   + R+ DL+TLLS AMTNQYTCLDG
Sbjct  124   LDALQQIALDDCLELFDDTIAELKAVISDLSVEKLSSDRYYDLKTLLSGAMTNQYTCLDG  183

Query  699   FPNSNKNVRPFIIKRVEQISRHVSNALSMLTKI----KKEKDNrfsssfrRENRG-LKDG  535
             F N    VR  I  R++ IS+HVSNAL ML KI    K E     +SS      G +++G
Sbjct  184   F-NDTGIVRHEIQSRLQTISQHVSNALVMLKKIPGALKYENSKSSTSSEMFPEFGPMRNG  242

Query  534   FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIY  355
             FP W+S +DR LL++ +     +  K D+VVAKDG+G+F +I+ A++ AP+SS TRFVIY
Sbjct  243   FPTWVSSKDRKLLQSVV-----NGTKYDLVVAKDGTGNFTTISEAVAVAPNSSATRFVIY  297

Query  354   IKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKG  175
             IK+G+Y+E V+V +KKT +MF+GDGIGKT +K +RN+ DGW TFR+ATVAV G GFIA+G
Sbjct  298   IKSGAYFENVEVVRKKTKLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFIAQG  357

Query  174   ISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             I+FEN AGP  HQAVA R+ SD+S FY CSFVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  358   ITFENAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  415



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   399 bits (1026),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 207/396 (52%), Positives = 276/396 (70%), Gaps = 13/396 (3%)
 Frame = -3

Query  1167  GRNPIMLVPVVLLAPFLSLTVFQSSAMNATTSHDIH-----QVAHSACDHSLYRDLCVST  1003
             GR+  +L  + + A +L + +      N+     +H     Q+AHSAC+ +LY +LCVST
Sbjct  6     GRSKFLLTLLPISALYLIILLATPHFKNSEEIPHLHIQKHNQIAHSACEGTLYPELCVST  65

Query  1002  LVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFS  823
             L   PDL  +S+ ++IS+T++ T+ E++ + +NCS I+  +  L  +ER AL+ CLELF+
Sbjct  66    LSSLPDLTYRSLQQLISSTISRTMYEVRVSYSNCSGIKNKLRKLNKIERVALNDCLELFT  125

Query  822   DALADLRTVLDGLEN--SPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVE  649
             + + +L   +  L +  S ++ H DLQTLLS AMTNQYTCLDGF  S   VR  I   + 
Sbjct  126   ETMDELNVAISDLTSRKSVSQHHHDLQTLLSGAMTNQYTCLDGFAYSRGRVRKTIKNSLY  185

Query  648   QISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKK  469
              ISRHVSN+L+ML KI    +    S    E   +K GFP WLS +D  LL+AP+     
Sbjct  186   NISRHVSNSLAMLKKIPG-VNASKESEAFPEYGEVKHGFPSWLSSKDLELLQAPL-----  239

Query  468   HDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFV  289
             +  K D+VVAKDG+G+F +I+ A++AAP+SS TRFVIYIK G+Y+E VDVDKKKT +MF+
Sbjct  240   NATKFDLVVAKDGTGNFSTISQAVAAAPNSSLTRFVIYIKEGAYFENVDVDKKKTNLMFI  299

Query  288   GDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSD  109
             GDGIGKT +K NR++  GW TFR+ATVAV G+GF+AKGI+FEN AGP+ HQAVALR+ SD
Sbjct  300   GDGIGKTVVKANRSVVGGWTTFRSATVAVVGNGFVAKGITFENSAGPDMHQAVALRSGSD  359

Query  108   YSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              S FY CSFVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  360   LSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  395



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   397 bits (1020),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 280/405 (69%), Gaps = 18/405 (4%)
 Frame = -3

Query  1179  MQNLGRNPIMLVPVV-----LLAPFLSLTVFQSSAMNATTSH---DIHQVAHSACDHSLY  1024
             M NL R   +L+ V+     LL    S T F++S  N   +H    I   AHSAC  +LY
Sbjct  1     MYNLRRRTKLLLSVLPTSALLLILLFSNTHFRNSNSNTPKTHVHNRIQLAAHSACQDTLY  60

Query  1023  RDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMERRAL  847
             + LCVSTL   PDL  KS+P+IIS TV+ TVSE++ +++NC+ I ++    L  +++ AL
Sbjct  61    KLLCVSTLSTFPDLTTKSVPQIISYTVSHTVSEVQASSSNCTGIIKKQFKKLDALQQIAL  120

Query  846   HVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVR  673
               CLELF D +A+L  V+  L  +   + R+ DL+TLLS AMTNQYTCLDGF N    VR
Sbjct  121   DDCLELFDDTIAELNAVISDLSIKKLSSNRYYDLKTLLSGAMTNQYTCLDGF-NDTGIVR  179

Query  672   PFIIKRVEQISRHVSNALSMLTKIKKE-KDNrfsssfrRENRGLKDGFPKWLSRRDRALL  496
               I  R++ IS+HVSNAL ML KI    K     S    E   +K+GFP W+S +DR LL
Sbjct  180   QEIQSRLQTISQHVSNALVMLKKIPGALKYENSKSEMFPEFGPMKNGFPTWVSSKDRKLL  239

Query  495   EAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVD  316
             ++ +  G K+D    +VVAKDG+G+F +I+ A++ AP+SS TRFVIYIK+G+Y+E V+V 
Sbjct  240   QS-VANGTKYD----LVVAKDGTGNFTTISEAVAVAPNSSATRFVIYIKSGAYFENVEVV  294

Query  315   KKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQ  136
             +KKT +MF+GDGIGKT +K +RN+ DGW TFR+ATVAV G GFIA+GI+FEN AGP  HQ
Sbjct  295   RKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFIAQGITFENAAGPSKHQ  354

Query  135   AVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVA R+ SD+S FY CSFVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  355   AVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  399



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/384 (53%), Positives = 270/384 (70%), Gaps = 8/384 (2%)
 Frame = -3

Query  1146  VPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSI  967
             V V+LL      ++   +  +   +H    VA+S C+ +LY DLCVSTL   PDL +K++
Sbjct  62    VHVLLLFSVTQFSITAGATRSLQQNHLHFHVANSTCEGTLYPDLCVSTLTSFPDLTSKTV  121

Query  966   PEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDG  787
             PE+I + VN T+ E+  +++NCS +R+ +P L  +E+RAL  CL LF + + +L+T +  
Sbjct  122   PEMIRSVVNHTIYEVTLSSSNCSSLRKKLPGLNKLEKRALDDCLNLFDETVEELKTTVKD  181

Query  786   LENSP--AKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSM  613
             L  S   +KR+ D QT LS AMTN YTCLDGF  S  NVR  I + V +IS  VSN+L+M
Sbjct  182   LSQSTIGSKRYHDSQTFLSGAMTNLYTCLDGFAYSKGNVRDRIEEGVLEISHLVSNSLAM  241

Query  612   LTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKD  433
             L K+  EK  +  +    E   +KDGFP W+S  DR LL+A +     ++ K D+VVAKD
Sbjct  242   LKKVP-EKKKQSKNEVFPEYGKMKDGFPSWVSPNDRKLLQAAV-----NETKFDLVVAKD  295

Query  432   GSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGN  253
             GSG+F +I AA++AAP+SS TRFVI+IKAG+Y+E V+V +KK+ +M+VGDGIGKT +K +
Sbjct  296   GSGNFTTIGAAVAAAPNSSATRFVIHIKAGAYFENVEVIRKKSNLMWVGDGIGKTVVKAS  355

Query  252   RNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGY  73
             RN+ DGW TF++ATVAV G GFIAKGI+FEN AGP  HQAVALR+ +D S FY CSFV Y
Sbjct  356   RNVVDGWTTFQSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGADLSAFYQCSFVAY  415

Query  72    QDTLYVHSRRQFFRECDVYGTVDF  1
             QDTLYVHS RQF+RECDVYGTVDF
Sbjct  416   QDTLYVHSLRQFYRECDVYGTVDF  439



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score =   392 bits (1006),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 210/420 (50%), Positives = 281/420 (67%), Gaps = 20/420 (5%)
 Frame = -3

Query  1242  YIY--FPPVSSVWLSYHSTIDSEMQNLGRNPIMLVPVVLLAPFLSLTVFQSSAMNATTSH  1069
             YIY  + P+S       S +D+         I+    VLL   L+     ++A      +
Sbjct  48    YIYTMYSPISRKKPPMESHVDT---------ILSAIFVLLLSSLTHFSITANATRTPQEN  98

Query  1068  DIH-QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  892
              +H QVA+S C+ +LY DLCVSTL   PDL +K++P++I + VN T+ E+  +A+NCS +
Sbjct  99    SLHFQVANSTCEGTLYSDLCVSTLASFPDLTSKTLPQMIRSVVNHTIYEVTLSASNCSGL  158

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSP--AKRHADLQTLLSTAMTNQ  718
             RR +P L  +E+RAL  CL LF D +++L T +  L  S    KR+ D QTLLS AMTN 
Sbjct  159   RRNLPKLDKLEQRALDDCLNLFDDTVSELETTIADLSQSTIGPKRYHDAQTLLSGAMTNL  218

Query  717   YTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRG-LK  541
             YTCLDGF  S  +VR    + + +IS HVSN+L+ML K+        S +      G +K
Sbjct  219   YTCLDGFAYSKGHVRDRFEEGLLEISHHVSNSLAMLKKLPAGVKKLASKNEVFPGYGKIK  278

Query  540   DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
             DGFP WLS +DR LL+A +     ++   +++VAKDG+G+F +I  A++ AP+SS TRFV
Sbjct  279   DGFPTWLSTKDRKLLQAAV-----NETNFNLLVAKDGTGNFTTIAEAVAVAPNSSATRFV  333

Query  360   IYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIA  181
             I+IKAG+Y+E V+V +KKT +MFVGDGIGKT +K +RN+ DGW TF++ATVAV G GFIA
Sbjct  334   IHIKAGAYFENVEVIRKKTNLMFVGDGIGKTVVKASRNVVDGWTTFQSATVAVVGDGFIA  393

Query  180   KGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             KGI+FEN AGP  HQAVALR+ SD+S FY CSFV YQDTLYVHS RQF+R+CDVYGTVDF
Sbjct  394   KGITFENSAGPSKHQAVALRSGSDFSAFYKCSFVAYQDTLYVHSLRQFYRDCDVYGTVDF  453



>ref|XP_004290811.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   386 bits (992),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 202/402 (50%), Positives = 272/402 (68%), Gaps = 25/402 (6%)
 Frame = -3

Query  1155  IMLVPV--VLLAPFLSLTVFQSS-------AMNATTSHDIHQVAHSACDHSLYRDLCVST  1003
             + L+P    +L  F SL  F +S        ++    + ++QVAHS C ++LY+DLCVST
Sbjct  12    LSLLPTSAFILIIFFSLNHFTNSPKPTKEFTIHVEKHNQLNQVAHSTCQNTLYKDLCVST  71

Query  1002  LVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD-LGTMERRALHVCLELF  826
             L   P+L +K++P+IIS+TVN T+ E+  + +NC+ I++   + L  ++++AL  CLELF
Sbjct  72    LTSFPNLSSKTVPQIISSTVNKTMYEVIASNSNCTGIKKHNKNKLAAVQQQALDDCLELF  131

Query  825   SDALADLRTVLDGL--ENSPAKRHAD-LQTLLSTAMTNQYTCLDGFPNSN----KNVRPF  667
              D +A L+  +  L  + SPA +H + L+TLLS AMTNQYTCL+GF +S     K V+  
Sbjct  132   DDTVAQLKVTMSELSSKKSPAAKHYNHLRTLLSAAMTNQYTCLEGFDSSTSSTVKAVKAE  191

Query  666   IIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAP  487
             +  R+    +H SNAL ML KI+             E   +K+GFP W+  + R LL+  
Sbjct  192   LESRLNTTCKHFSNALVMLKKIR----GVVERESTDEFGAMKNGFPTWVGSKARKLLQTS  247

Query  486   MGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKK  307
                  K+D    ++VAKDGSG+F +I  A++AAP+SS TRFVIYIKAG+Y+E V+V  KK
Sbjct  248   SANQTKYD----LLVAKDGSGNFTTITDAVAAAPNSSATRFVIYIKAGAYFENVEVVSKK  303

Query  306   TMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVA  127
             T +MF+GDGIGKT +K +RN+ DGW TFR+ATVAV G GFIAKGI+FEN AGP  HQAVA
Sbjct  304   TNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGGGFIAKGITFENSAGPSKHQAVA  363

Query  126   LRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             LR+ SD S FY CSFVGYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  364   LRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDF  405



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   384 bits (987),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 201/393 (51%), Positives = 266/393 (68%), Gaps = 17/393 (4%)
 Frame = -3

Query  1158  PIMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLR  979
             PI+   +VLL    S+T F   A  AT   +  QVA SAC+ +LY+DLCVSTL   PDL 
Sbjct  13    PILSTILVLL---FSVTNFSKLATAATLQTNHIQVAQSACEGTLYQDLCVSTLSTLPDLT  69

Query  978   AKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMERRALHVCLELFSDALADLR  802
             +K++P+II + +N T+ E+K +++NC+ +R R       +++RAL  C+ LF   + +L+
Sbjct  70    SKTVPQIICSVLNNTIKEVKQSSSNCTGLRIRGRSAQSILDQRALEDCVNLFDTTIDELK  129

Query  801   TVLDGLEN------SPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQIS  640
             T +  L        S +KR  D QTLLS AMTN YTCLDGF  S   +R  I  ++  IS
Sbjct  130   TTISDLSQTQTTVASSSKR--DCQTLLSGAMTNVYTCLDGFAYSKSKLRKKIEAKLNDIS  187

Query  639   RHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDI  460
              HVSN+L+ML K+   K     S    E   +KDGFP W+S +DR LL+A +     +  
Sbjct  188   SHVSNSLAMLKKVPGVKTKASESETFPEYGKVKDGFPSWVSPKDRKLLQAAV-----NQT  242

Query  459   KADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDG  280
             K D+VVAKDG+G+F +I  A++AAP+SS TRFVI+IKAG+Y+E V+V KKKT +M VGDG
Sbjct  243   KFDLVVAKDGTGNFATIGEAIAAAPNSSATRFVIHIKAGAYFENVEVIKKKTNLMLVGDG  302

Query  279   IGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSV  100
             IG+T +K +RN+ DGW TF+++T AV G  FIAKGI+FEN AGP  HQAVA+R  +D+S 
Sbjct  303   IGQTVVKASRNVVDGWTTFQSSTFAVVGDKFIAKGITFENSAGPSKHQAVAVRNGADFSA  362

Query  99    FYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FY CSFV YQDTLYVHS RQF+RECDVYGTVDF
Sbjct  363   FYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDF  395



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score =   382 bits (981),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 206/365 (56%), Positives = 258/365 (71%), Gaps = 15/365 (4%)
 Frame = -3

Query  1077  TSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCS  898
             TS    ++  +AC+ + ++DLC S L   P   + S+PE+I+ATVN T+SE+  +++NCS
Sbjct  39    TSQTPSRLVRTACERTRFKDLCFSPLSSLPPGNSSSVPELIAATVNETISEVMISSSNCS  98

Query  897   RI-RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLEN-SPAKRHADLQTLLSTAMT  724
              + RR+ PDL   + RAL  CLEL  D   DL   L  L + S A+   DLQTLLS AMT
Sbjct  99    GLQRRLGPDLSPRDSRALEDCLELLGDTAGDLDDALADLHSPSAAREFYDLQTLLSAAMT  158

Query  723   NQYTCLDGFPNSNKN----VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRE  556
             NQYTCLDGF  + +N    VR  I   +  ISRHVSN+L+ML +I   K   F    R E
Sbjct  159   NQYTCLDGFAFNERNRKYRVRDSIKDSLFNISRHVSNSLAMLQEIPA-KPGVFPEYGRVE  217

Query  555   NRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSS  376
             N     GFP W+SR DR LL+AP    K  D    +VVAKDG+G+F +++AA++AAP+SS
Sbjct  218   N----GGFPTWVSRSDRRLLQAPANDTKLFD----LVVAKDGTGNFTTVSAAVAAAPNSS  269

Query  375   DTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGG  196
              TRFVIYIK G+Y+E V+V +KKTM+M VGDGIGKT +K NRN+ DGW TFR+ATVAV G
Sbjct  270   TTRFVIYIKEGAYFENVEVGRKKTMLMLVGDGIGKTVVKANRNVVDGWTTFRSATVAVVG  329

Query  195   SGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVY  16
             +GFIAKGI+FEN+AGP  HQAVALR+ SD+S FY CSFVGYQDTLYVHS RQFFRECD+Y
Sbjct  330   NGFIAKGITFENFAGPTKHQAVALRSGSDHSAFYLCSFVGYQDTLYVHSFRQFFRECDIY  389

Query  15    GTVDF  1
             GTVDF
Sbjct  390   GTVDF  394



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/320 (60%), Positives = 238/320 (74%), Gaps = 14/320 (4%)
 Frame = -3

Query  933  VSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALAD-LRTVLDGLE-----NSP  772
            ++E+K++A NCS I   V  L  +E+RAL  C+EL  D   D L+T L  L      NSP
Sbjct  1    MNEVKSSAENCSNILHHVSKLDPIEKRALDDCIELLGDTTIDELQTTLYDLSTKNSSNSP  60

Query  771  AKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKK-  595
             K + DLQTLLS AMTNQ TCL+G  NS  N+  +I K +  IS+HVSN+L ML K+K  
Sbjct  61   LKHYNDLQTLLSGAMTNQDTCLNGIYNSKHNLSQYIEKNLHTISQHVSNSLVMLKKLKTG  120

Query  594  --EKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGD  421
              +  +  S+    E   +K+G+PKWL ++DR LL+AP+ +     IK D+VVAKDGSG+
Sbjct  121  SAQGSSSNSNEVFPEYGTMKNGYPKWLKKKDRTLLQAPVNQ-----IKFDLVVAKDGSGN  175

Query  420  FKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMK  241
            F +INAALSAAP+SS TRFVIYIKAG+Y+EY+DV++KK+MIMFVGDGIGKT IKGNRN+ 
Sbjct  176  FTTINAALSAAPNSSSTRFVIYIKAGTYFEYIDVERKKSMIMFVGDGIGKTVIKGNRNVV  235

Query  240  DGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTL  61
            DGW TFR+ATVAV G+GF+A+GI+FENYAGP  HQAVALR+ SD S FY CSFV YQDTL
Sbjct  236  DGWTTFRSATVAVVGNGFLARGITFENYAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTL  295

Query  60   YVHSRRQFFRECDVYGTVDF  1
            YVHS RQF+R CDVYGTVDF
Sbjct  296  YVHSLRQFYRNCDVYGTVDF  315



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score =   381 bits (979),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/396 (49%), Positives = 273/396 (69%), Gaps = 12/396 (3%)
 Frame = -3

Query  1179  MQNLGRNPIM-LVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVST  1003
             M N   +P++ L+  VLL    SLT   +       +    QVAHS C  +LY +LCVST
Sbjct  1     MHNGKTSPLLALISFVLL---FSLTNSSNLPTTPPQTKTHLQVAHSTCQGTLYPNLCVST  57

Query  1002  LVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFS  823
             L    DL +KS+P+II +T+N T++E+K+++ NC+R+++  P L   ++RAL  CL LF 
Sbjct  58    LSTFQDLASKSVPQIICSTLNSTINEVKSSSFNCTRLKKR-PSLHPYDQRALDDCLNLFD  116

Query  822   DALADLRTVLDGLENSP--AKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVE  649
             + + +L++ ++ L  +   +K + + QTLLS AMTN YTCLDGF  S  N+R  I K++ 
Sbjct  117   NTIEELKSTINDLSQTKITSKPYHNCQTLLSGAMTNVYTCLDGFAYSKTNLRHKIEKKLY  176

Query  648   QISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKK  469
             +IS HVSN+L++L K+   K+    S    E   +  GFP W++R+DR LL+A +     
Sbjct  177   KISNHVSNSLALLMKVPGVKNKSSESEAFPEYGEVNGGFPSWITRKDRKLLQAAVS----  232

Query  468   HDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFV  289
              +   ++VVAKDG+G+F +I  AL+AAP+SS TRFVI+IK G+Y+E V+V KKK  +M V
Sbjct  233   -ETHFNLVVAKDGTGNFSTIGEALAAAPNSSTTRFVIHIKEGAYFENVEVIKKKINLMLV  291

Query  288   GDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSD  109
             GDGIGKT +K +RN+ DGW TF++AT AV GS FIAKGI+FEN AGP  HQAVA+R+ +D
Sbjct  292   GDGIGKTVVKASRNVIDGWTTFQSATFAVVGSNFIAKGITFENSAGPSKHQAVAVRSGAD  351

Query  108   YSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +S FY+CSFV YQDTLYVHS RQF+RECD+YGTVDF
Sbjct  352   FSAFYNCSFVAYQDTLYVHSLRQFYRECDIYGTVDF  387



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   376 bits (965),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 211/366 (58%), Positives = 262/366 (72%), Gaps = 20/366 (5%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI-RRV  883
             QVAHS C  +LY DLCVSTL   PDL +KS+PEIIS+TVN+T ++ ++A+++CS + RR+
Sbjct  41    QVAHSTCQGTLYPDLCVSTLASFPDLASKSVPEIISSTVNLTSAQARSASSSCSALERRL  100

Query  882   VPDLGTMERRALHVCLEL-------FSDALADLRTVLDGLENSPAKRHADLQTLLSTAMT  724
                LG +ERRAL  CLEL       F  A++DL +  +G   +PA    DLQTLLS AMT
Sbjct  101   AAKLGPLERRALDDCLELLARTVDEFGKAISDLSSA-NG-PTAPAAHFHDLQTLLSGAMT  158

Query  723   NQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrR-----  559
             NQYTCLDGF  S + VR  I   +  ISRHVSN+L ML K+   K     S         
Sbjct  159   NQYTCLDGFAYSKQKVRDAIQSNLFNISRHVSNSLVMLKKLPGVKGRPSGSPAAAGEVFP  218

Query  558   ENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDS  379
             E   +++GFP WLS +DR LL+AP+          ++ VA+DG+G+F +++AA++AAP++
Sbjct  219   EYGRMRNGFPAWLSPKDRRLLQAPVSA-----TSYNVSVAQDGTGNFTTVSAAVAAAPNA  273

Query  378   SDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVG  199
             S TRFVIYIKAGSY+E V+V  KKT IMF+GDGIGKT IKGNRN+ DGW TFR+ATVA  
Sbjct  274   STTRFVIYIKAGSYFENVEVISKKTNIMFLGDGIGKTWIKGNRNVVDGWTTFRSATVAAV  333

Query  198   GSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDV  19
             GSGFIAKGISFENYAGP  HQAVA R+ SD S FY CSF+GYQDTLYVHS RQF+RECD+
Sbjct  334   GSGFIAKGISFENYAGPSKHQAVAFRSGSDLSAFYSCSFIGYQDTLYVHSLRQFYRECDI  393

Query  18    YGTVDF  1
             YGTVDF
Sbjct  394   YGTVDF  399



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   372 bits (956),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 207/421 (49%), Positives = 276/421 (66%), Gaps = 33/421 (8%)
 Frame = -3

Query  1179  MQNLGRNPIMLVPVVLLAP-FLSLTVFQSSAMNATT-SHDIH----------QVAHSACD  1036
             M NL R  I+L  + L +  FLSL   +    N+ + S  IH          + AH AC 
Sbjct  1     MYNLRRTKILLSTLFLTSILFLSLLFSKPHFKNSNSKSPKIHFQNHIQKQVLETAHWACQ  60

Query  1035  HSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRR-VVPDLGTME  859
              +LY+ LC+STL   P+L +K++P+IIS+TV+ TV E+K +++NC+ I++     L +++
Sbjct  61    DTLYKSLCLSTLATFPNLASKTLPQIISSTVSHTVLEVKASSSNCTSIKKQFSKKLSSLQ  120

Query  858   RRALHVCLELFSDALADLRTVLDGLENSP---AKRHADLQTLLSTAMTNQYTCLDGF---  697
             + AL  CLEL  + + +L++ +  L  +    + R+ DL+ LLS AMTNQ TCLDGF   
Sbjct  121   QWALDDCLELLDNTIDELKSAISDLSXNKTLNSNRYYDLKALLSAAMTNQDTCLDGFSAN  180

Query  696   ---PNSNKN--VRPFIIKRVEQISRHVSNALSMLTKI----KKEKDNrfsssfrRENRGL  544
                P S+    VR  I  R+  IS+HVSNAL ML KI    K E      S    +    
Sbjct  181   GTAPRSSNXGIVRSEIEGRINTISQHVSNALVMLKKIPGAHKYEYSETMKSEMFPDFGPA  240

Query  543   KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRF  364
             K  FP W+S +DR LL++       ++ K D+VVAKDG+G+F +I+ A+  AP+SS TRF
Sbjct  241   KKKFPTWVSSKDRRLLQSST-----NETKYDLVVAKDGTGNFTTISEAVDVAPNSSATRF  295

Query  363   VIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFI  184
             VIYIKAG+Y+E V+V KKKT +MF+GDGIG T +K +RN+ DGW TFR+ATVAV G GFI
Sbjct  296   VIYIKAGAYFENVEVVKKKTNLMFLGDGIGNTIVKASRNVVDGWTTFRSATVAVVGBGFI  355

Query  183   AKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVD  4
             AKGI+FEN AGP  HQAVALR+ +D+S FY CSFVGYQDTLYVHS RQF+RECDVYGTVD
Sbjct  356   AKGITFENGAGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVD  415

Query  3     F  1
             F
Sbjct  416   F  416



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   363 bits (931),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 191/374 (51%), Positives = 254/374 (68%), Gaps = 16/374 (4%)
 Frame = -3

Query  1101  QSSAMNATTSHDIH-----QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNV  937
             +SSA+    +H +H     QVA   CD +LY DLCVSTL   P+L +K +P++I+A VN 
Sbjct  32    KSSAIGRRQNH-LHIRSDLQVASRHCDGTLYPDLCVSTLADIPNLSSKPLPDVIAAVVNR  90

Query  936   TVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRH-  760
             T + ++++A+NC+        +   +R AL+ CLEL    L DLRT +  L    +  H 
Sbjct  91    TAAAVRSSASNCTSYLHRRGHMDFRQRLALNDCLELLDQTLDDLRTAIADLAGCNSSAHV  150

Query  759   ADLQTLLSTAMTNQYTCLDGFPNSNKN-VRPFIIKRVEQISRHVSNALSMLTKIKKEKDN  583
             +DLQT+LS A+TNQYTCLDGF   N   VRP I  R+  +S  VSN+L+M+ KI++++  
Sbjct  151   SDLQTVLSAAITNQYTCLDGFAYVNGGGVRPSIEGRLYHVSHLVSNSLAMVKKIRRQRRG  210

Query  582   rfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINA  403
             R +     E   +  GFP W++R+DR LL+A       +    D+VVAKDGSG+F +I  
Sbjct  211   REAFE---EYGRMSGGFPTWVTRKDRRLLQA-----AANATSPDLVVAKDGSGNFTTIGE  262

Query  402   ALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTF  223
             A++AAP++S TRFVIYIKAG+Y+E VDV K K  +MF+GDGIGKT +K +RN+ DGW TF
Sbjct  263   AVAAAPNNSATRFVIYIKAGAYFENVDVAKNKKNLMFIGDGIGKTVVKASRNVVDGWTTF  322

Query  222   RTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRR  43
             R+ATVAV G GF+A+ I+ EN AGP  HQAVALR  +D S FY CSFV YQDTLYVHS R
Sbjct  323   RSATVAVVGDGFLARDITIENSAGPSKHQAVALRVGADLSAFYRCSFVAYQDTLYVHSLR  382

Query  42    QFFRECDVYGTVDF  1
             QF+R+CDVYGTVDF
Sbjct  383   QFYRDCDVYGTVDF  396



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   352 bits (904),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/312 (56%), Positives = 232/312 (74%), Gaps = 8/312 (3%)
 Frame = -3

Query  927  EIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSP--AKRHAD  754
            E+++++ NCS +++++ +L  +++RAL  CL+LF D   +L+  +D L  S   +KRH D
Sbjct  3    EVRSSSYNCSGLKKMLKNLNPLDQRALDDCLKLFEDTNVELKATIDDLSKSTIGSKRHHD  62

Query  753  LQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKK-EKDNrf  577
            LQT+LS AMTN YTCLDGF  S   VR  I K++ +IS HVSN+L+ML K+   +K    
Sbjct  63   LQTMLSGAMTNLYTCLDGFAYSKGRVRDRIEKKLLEISHHVSNSLAMLNKVPGVKKLTTS  122

Query  576  sssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAAL  397
             S    E   +K GFP W+S +DR LL+A     K  + K D++VAKDG+G+F +I  AL
Sbjct  123  ESVVFPEYGNMKKGFPSWVSSKDRKLLQA-----KVKETKFDLLVAKDGTGNFTTIGEAL  177

Query  396  SAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRT  217
            + AP+SS TRFVI+IK G+Y+E V+V +KKT +MFVGDGIGKT +KG+RN+ DGW TF++
Sbjct  178  AVAPNSSTTRFVIHIKEGAYFENVEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQS  237

Query  216  ATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQF  37
            ATVAV G+GFIAKGI+FEN AGP+ HQAVALR+ +D+S FY CSFVGYQDTLYVHS RQF
Sbjct  238  ATVAVVGAGFIAKGITFENSAGPDKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQF  297

Query  36   FRECDVYGTVDF  1
            +RECD+YGTVDF
Sbjct  298  YRECDIYGTVDF  309



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score =   355 bits (912),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/364 (50%), Positives = 248/364 (68%), Gaps = 9/364 (2%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             +++  IHQ A S C+ +L+ DLC S L   P L + S  ++  + +N T  E+  A  NC
Sbjct  69    SSNPQIHQTARSLCNGTLFPDLCFSKLSSFPLLASLSPEKLAGSALNFTSREVLLAYTNC  128

Query  900   SRIR-RVVPDLGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTA  730
             + ++  +   L   +R AL  CLEL   ++A+L+  +  L    SPA    DL TL+S A
Sbjct  129   TNLKTHLYSGLNPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAA  188

Query  729   MTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKK-EKDNrfsssfrREN  553
             MTN  TC+DGF NS+  VR  +   + +I +H+S  L+ML KI    +          E 
Sbjct  189   MTNHRTCVDGFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPGVNRATGVDQEMLPEY  248

Query  552   RGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSD  373
               +K GFPKW+S +DR LL+A +     ++ K +MVVAKDGSG+F +++ A++AAP++S 
Sbjct  249   GAVKGGFPKWVSVKDRRLLQAAV-----NETKFNMVVAKDGSGNFTTVSEAVAAAPNAST  303

Query  372   TRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGS  193
             TRFVIYIKAG+Y+E V++ + K+ +MFVGDGIGKT IK +RN+ DGW TFR+ATVAV G+
Sbjct  304   TRFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGT  363

Query  192   GFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYG  13
             GFIAKGI+FENYAGP  HQAVALR++SD+S FY CSF+GYQDTLYVHS RQF+RECDVYG
Sbjct  364   GFIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRECDVYG  423

Query  12    TVDF  1
             T+DF
Sbjct  424   TIDF  427



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score =   355 bits (910),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/364 (49%), Positives = 248/364 (68%), Gaps = 9/364 (2%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             +++  +HQ A S C+ +L+ DLC S L   P L + S  ++  + +N T  E+  A  NC
Sbjct  39    SSNPQVHQTARSLCNGTLFPDLCFSKLSSFPQLASLSPEKLAGSALNFTSREVLLAYTNC  98

Query  900   SRIR-RVVPDLGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTA  730
             + ++  +   L   +R AL  CLEL   ++A+L+  +  L    SPA    DL TL+S A
Sbjct  99    TNLKTHLYSGLNPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAA  158

Query  729   MTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKK-EKDNrfsssfrREN  553
             MTN  TC+DGF NS+  VR  +   + +I +H+S  L+ML KI    +          E 
Sbjct  159   MTNHRTCVDGFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPGVNRATGVDQEMLPEY  218

Query  552   RGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSD  373
               +K GFPKW+S +DR LL+A +     ++ K +MVVAKDGSG+F +++ A++AAP++S 
Sbjct  219   GAVKGGFPKWVSVKDRRLLQAAV-----NETKFNMVVAKDGSGNFTTVSEAVAAAPNAST  273

Query  372   TRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGS  193
             TRFVIYIKAG+Y+E V++ + K+ +MFVGDGIGKT IK +RN+ DGW TFR+ATVAV G+
Sbjct  274   TRFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGT  333

Query  192   GFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYG  13
             GFIAKGI+FENYAGP  HQAVALR++SD+S FY CSF+GYQDTLYVHS RQF+R+CDVYG
Sbjct  334   GFIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVYG  393

Query  12    TVDF  1
             T+DF
Sbjct  394   TIDF  397



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score =   354 bits (908),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 180/359 (50%), Positives = 244/359 (68%), Gaps = 9/359 (3%)
 Frame = -3

Query  1065  IHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIR-  889
              HQ A S C+ +L+ DLC S L   P L + S  ++  + +N T  E+  A  NC+ ++ 
Sbjct  97    FHQTARSLCNGTLFPDLCFSKLSSFPQLASLSPEKLAGSALNFTSREVLLAYTNCTNLKT  156

Query  888   RVVPDLGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQY  715
              +   L   +R AL  CLEL   ++A+L+  +  L    SPA    DL TL+S AMTN  
Sbjct  157   HLYSGLNPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAAMTNHR  216

Query  714   TCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKK-EKDNrfsssfrRENRGLKD  538
             TC+DGF NS+  VR  +   + +I +H+S  L+ML KI    +          E   +K 
Sbjct  217   TCVDGFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPGVNRATGVDQEMLPEYGAVKG  276

Query  537   GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVI  358
             GFPKW+S +DR LL+A +     ++ K +MVVAKDGSG+F +++ A++AAP++S TRFVI
Sbjct  277   GFPKWVSVKDRRLLQAAV-----NETKFNMVVAKDGSGNFTTVSEAVAAAPNASTTRFVI  331

Query  357   YIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAK  178
             YIKAG+Y+E V++ + K+ +MFVGDGIGKT IK +RN+ DGW TFR+ATVAV G+GFIAK
Sbjct  332   YIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTGFIAK  391

Query  177   GISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             GI+FENYAGP  HQAVALR++SD+S FY CSF+GYQDTLYVHS RQF+R+CDVYGT+DF
Sbjct  392   GITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVYGTIDF  450



>ref|XP_008451545.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=595

 Score =   353 bits (905),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 185/363 (51%), Positives = 253/363 (70%), Gaps = 8/363 (2%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             +++  IHQ A S C+ +L+ +LC S L   P L + S  ++  + +N T  E+  A ANC
Sbjct  74    SSNPQIHQTARSLCNGTLFPNLCFSKLSSFPQLASLSPEKLAGSALNFTTREVLLAYANC  133

Query  900   SRIR-RVVPDLGTMERRALHVCLELFSDALADLR-TVLD-GLENSPAKRHADLQTLLSTA  730
             + ++  +   L   +R AL  CLEL  D++A+L+ ++LD G   S A+   DL TL+S A
Sbjct  134   TNLKTHLYCGLNPTDRHALDDCLELLDDSIAELKASILDLGPSQSAARHSHDLLTLVSAA  193

Query  729   MTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENR  550
             MTN  TC+DGF NS+  VR  +   + +I +H+S  L+ML KI              E  
Sbjct  194   MTNHRTCVDGFYNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPGVNRATKVEEVLPEYG  253

Query  549   GLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDT  370
              +K GFPKW+S +DR LL+A +     ++ K ++VVAKDGSG+F ++N A++AAP+SS T
Sbjct  254   AVKGGFPKWVSVKDRRLLQAAV-----NETKFNLVVAKDGSGNFTTVNEAVAAAPNSSTT  308

Query  369   RFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSG  190
             RFVIYIKAG+Y+E V++ + K+ +MFVGDGIGKT IKG+RN+ DGW TFR+ATVAV G+G
Sbjct  309   RFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKGDRNVVDGWTTFRSATVAVVGTG  368

Query  189   FIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGT  10
             FIAKGI+FENYAGP  HQAVALR++SD+S FY CSF+GYQDTLYVHS RQF+RECD+YGT
Sbjct  369   FIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRECDIYGT  428

Query  9     VDF  1
             +DF
Sbjct  429   IDF  431



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   362 bits (928),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 188/373 (50%), Positives = 252/373 (68%), Gaps = 10/373 (3%)
 Frame = -3

Query  1113  LTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVT  934
             L+   +++ ++ T+ D   +A SACD +LY DLCVST+V T   R  ++PE+I+ATV+V 
Sbjct  428   LSAANNNSTDSGTNSDYVHLAESACDGALYDDLCVSTVV-TKLRRNTTLPEMIAATVDVA  486

Query  933   VSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLD--GLENSPAKRH  760
             ++E+ +A++N   +RR +     ++ RAL  CLEL S    +L  VL+      SP K +
Sbjct  487   MAEVMSASSNFRNLRRKLKKAELLDVRALDDCLELLSSTAEELSEVLEMTTAPASPVKHY  546

Query  759   ADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNr  580
              DL+TLLS +MTNQYTCLDG    N   R  I  R  +IS H+SNAL+++ K+K+ K   
Sbjct  547   DDLKTLLSGSMTNQYTCLDGLAYGNTRRR-LIEARTRRISHHLSNALALVGKLKR-KSRP  604

Query  579   fsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAA  400
                         +  FP W+SR DR  L++       +    +++VA+DG+G+F +IN A
Sbjct  605   SDELLEFAKLSSRTEFPNWMSRSDRRFLQS-----AANSTNYNLIVAQDGTGNFSTINDA  659

Query  399   LSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFR  220
             ++A+P++S TRFVIYIKAG+YYEYV V   K MI FVGDGIGKT IKGNR++ DGW T++
Sbjct  660   INASPNNSRTRFVIYIKAGAYYEYVQVPSNKIMISFVGDGIGKTLIKGNRSVVDGWTTYQ  719

Query  219   TATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQ  40
             +ATVAV G GFIA GI+ ENYAGPE HQAVALR  +D S FY CSFVGYQDTLYV S RQ
Sbjct  720   SATVAVAGQGFIATGITIENYAGPEKHQAVALRCGADMSAFYQCSFVGYQDTLYVFSLRQ  779

Query  39    FFRECDVYGTVDF  1
             F+RECD+YGTVDF
Sbjct  780   FYRECDIYGTVDF  792



>ref|XP_010684346.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=576

 Score =   346 bits (888),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 186/368 (51%), Positives = 248/368 (67%), Gaps = 15/368 (4%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV-  883
             Q+A S CD +LY DLC+STL   P L  KS+ EI+   ++VT +E++ +A N S +  V 
Sbjct  47    QLAQSHCDGTLYTDLCISTLSNIPHLHKKSLTEILRYVISVTEAEVRASATNISGLESVN  106

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQYTC  709
                L  ++  A+  CLEL +D   +L TVLD +  +  P+   ++++T LS AMT QYTC
Sbjct  107   RHTLSRLQHFAVRDCLELLADTTDELDTVLDEMTGQCGPSNNVSNIRTYLSAAMTYQYTC  166

Query  708   LDGFP-NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKE---KDNrfsssfrREN----  553
             LDGF   S+K +R  I   +  I+ HVSN+L+ML KI+     KD   SS    ++    
Sbjct  167   LDGFDVGSSKTLRRLIETGLLNITHHVSNSLAMLNKIRGPRHCKDKTMSSPPYHDDDLHD  226

Query  552   -RGL-KDGFPKWLSRRDRALLEA--PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAP  385
               GL + G P+W+ ++DR LL+   P   G     + D+VVAKDGSG+F +I  A++AA 
Sbjct  227   RNGLDRAGLPRWMEKKDRRLLQTAKPASPGSGTTTQVDIVVAKDGSGNFTTIREAVAAAR  286

Query  384   DSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVA  205
             + S TRFVIYIK G+Y+E V+V KKKT IMF+GDGIGKT IK  RN+ DG+ TFR+AT+A
Sbjct  287   NWSTTRFVIYIKTGAYFENVEVKKKKTNIMFLGDGIGKTVIKAKRNVADGYTTFRSATLA  346

Query  204   VGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFREC  25
             V G+GFIAK ++ ENYAGP  HQAVALR+ SD+S FY CSF+GYQDTLY HS RQF+REC
Sbjct  347   VVGAGFIAKDLTVENYAGPAKHQAVALRSGSDFSAFYRCSFIGYQDTLYTHSLRQFYREC  406

Query  24    DVYGTVDF  1
             D+YGTVDF
Sbjct  407   DIYGTVDF  414



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score =   343 bits (879),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 232/324 (72%), Gaps = 9/324 (3%)
 Frame = -3

Query  960  IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLE  781
            +I + VN T+ E+  +A+NCS +RR +P+L  +E+RAL  CL LF D +++L T +  L 
Sbjct  1    MIRSVVNHTIYEVTLSASNCSGLRRNLPELDKLEQRALDDCLNLFDDTVSELETTIADLS  60

Query  780  NSP--AKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLT  607
             S    KR+ D QTLLS AMTN YTCLDGF  S  +VR    + + +IS HVSN+L+ML 
Sbjct  61   QSTIGPKRYHDAQTLLSGAMTNLYTCLDGFAYSKGHVRDRFEEGLLEISHHVSNSLAMLK  120

Query  606  KIKKEKDNrfsssfrRENRG-LKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDG  430
            K+        S +      G +KDGFP WLS +DR LL+A +     ++   +++VAKDG
Sbjct  121  KLPAGVKKLASKNEVFPGYGKIKDGFPTWLSTKDRKLLQAAV-----NETNFNLLVAKDG  175

Query  429  SGDFKSINAALSAAPDSSDTR-FVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGN  253
            +G+F +I  A++ AP+SS TR FVI+IKAG+Y+E V+V +KKT +MFVGDGIGKT +K +
Sbjct  176  TGNFTTIAEAVAVAPNSSATRQFVIHIKAGAYFENVEVIRKKTNLMFVGDGIGKTVVKAS  235

Query  252  RNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGY  73
            RN+ DGW TF++ATVAV G GFIAKGI+FEN AGP  HQAVALR+ SD+S FY CSFV Y
Sbjct  236  RNVVDGWTTFQSATVAVVGDGFIAKGITFENSAGPSKHQAVALRSGSDFSAFYKCSFVAY  295

Query  72   QDTLYVHSRRQFFRECDVYGTVDF  1
            QDTLYVHS RQF+R+CDVYGTVDF
Sbjct  296  QDTLYVHSLRQFYRDCDVYGTVDF  319



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   343 bits (881),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 177/360 (49%), Positives = 236/360 (66%), Gaps = 8/360 (2%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSR-  895
             H   Q A   CD +LY DLC STL   PDL +KS+PE+I AT+N +   +  +A NC++ 
Sbjct  50    HSHLQDATXHCDGTLYPDLCASTLSTIPDLHSKSLPEVICATINASEXAVIKSAKNCTKY  109

Query  894   IRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQY  715
             +      L T +R AL  CL+LFS  L +L      L  +P      +QTLLS A+TNQY
Sbjct  110   LHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQY  169

Query  714   TCLDGFPNSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLK  541
             TCLDGF    K+   R  I + +  +S  VSN+L+M+ KI+++K              + 
Sbjct  170   TCLDGFAYVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPXHPRREALEGYGEVA  229

Query  540   DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
             +GFP W+S +DR LL+A       +    +++VAKDGSG+F +I+ A++AAP  S+TRFV
Sbjct  230   EGFPVWVSGKDRRLLQA-----AANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFV  284

Query  360   IYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIA  181
             IYIKAG+Y E V+V K KT +MF+GDGIGKT +K +RN+ DGW TFR+ATVA+ G+GF+ 
Sbjct  285   IYIKAGAYLENVEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLM  344

Query  180   KGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + ++ EN AGP  HQAVALR  +D S FY CSFVGYQDTLY HS RQF+RECDVYGT+DF
Sbjct  345   RDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDF  404



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   343 bits (880),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 177/360 (49%), Positives = 236/360 (66%), Gaps = 8/360 (2%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSR-  895
             H   Q A   CD +LY DLC STL   PDL +KS+PE+I AT+N +   +  +A NC++ 
Sbjct  49    HSHLQDATGHCDGTLYPDLCASTLSTIPDLHSKSLPEVICATINASEGAVIKSAKNCTKY  108

Query  894   IRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQY  715
             +      L T +R AL  CL+LFS  L +L      L  +P      +QTLLS A+TNQY
Sbjct  109   LHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQY  168

Query  714   TCLDGFPNSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLK  541
             TCLDGF    K+   R  I + +  +S  VSN+L+M+ KI+++K              + 
Sbjct  169   TCLDGFAYVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPPHPRREALEGYGEVA  228

Query  540   DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
             +GFP W+S +DR LL+A       +    +++VAKDGSG+F +I+ A++AAP  S+TRFV
Sbjct  229   EGFPVWVSGKDRRLLQA-----AANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFV  283

Query  360   IYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIA  181
             IYIKAG+Y E V+V K KT +MF+GDGIGKT +K +RN+ DGW TFR+ATVA+ G+GF+ 
Sbjct  284   IYIKAGAYLENVEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLM  343

Query  180   KGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + ++ EN AGP  HQAVALR  +D S FY CSFVGYQDTLY HS RQF+RECDVYGT+DF
Sbjct  344   RDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDF  403



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   343 bits (880),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 237/360 (66%), Gaps = 8/360 (2%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSR-  895
             H   Q A   CD +LY DLC STL   PDL +KS+PE+I AT+N + + +  +A NC++ 
Sbjct  50    HSHLQDATDHCDGTLYPDLCASTLSTIPDLHSKSLPEVICATINASEAAVIKSAKNCTKY  109

Query  894   IRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQY  715
             +      L T +R AL  CL+LFS  L +L      L  +P      +QTLLS A+TNQY
Sbjct  110   LHHHNYTLDTRQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQY  169

Query  714   TCLDGFPNSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLK  541
             TCLDGF    K+   R  I + +  +S  VSN+L+M+ KI+++K              + 
Sbjct  170   TCLDGFAYVGKDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPPHPRREALEGYGEVA  229

Query  540   DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
             +GFP W+S +DR LL+A       +    +++VAKDGSG+F +I+ A++AAP  S+TRFV
Sbjct  230   EGFPVWVSGKDRRLLQA-----AANTTTPNLIVAKDGSGNFTTISEAVAAAPSKSETRFV  284

Query  360   IYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIA  181
             IYIKAG+Y E V+V K +T +MF+GDGIGKT +K +RN+ DGW TFR+ATVA+ G+GF+ 
Sbjct  285   IYIKAGAYLENVEVGKSQTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLM  344

Query  180   KGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + ++ EN AGP  HQAVALR  +D S FY CSFVGYQDTLY HS RQF+RECDVYGT+DF
Sbjct  345   RDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDF  404



>ref|XP_010056842.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=538

 Score =   342 bits (876),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 177/358 (49%), Positives = 236/358 (66%), Gaps = 18/358 (5%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIR-RV  883
             QV HS C  + Y DLCVSTL     L + S PEIISA ++ + SE++ A+ +C+ ++   
Sbjct  32    QVTHSRCRGTPYSDLCVSTLASFTGLASMSFPEIISAMLHQSASEVRAASTHCTVMKNHF  91

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA--KRHADLQTLLSTAMTNQYTC  709
             +  L  +ER+AL +CLELF D   D    +  LE+S    + + DLQ+LLS  MTN YTC
Sbjct  92    LGKLSMLERQALDICLELFRDIFDDFDNAVSYLESSKVTVRHYYDLQSLLSGMMTNVYTC  151

Query  708   LDGF-PNS-NKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG  535
              D F P++ N N+   +  R+  I RHVSN+L +L KI+   +            G+++ 
Sbjct  152   TDEFDPHTDNLNLGDSMKDRLSNILRHVSNSLFLLAKIRGVNN--------PSGHGIRER  203

Query  534   FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIY  355
             FP W+S  D  L++ P      +  K D+VVAKDGSG+F SIN A++AAPD+S TRFVIY
Sbjct  204   FPAWMSLEDSLLVQTP-----TNATKFDLVVAKDGSGNFTSINDAVAAAPDNSKTRFVIY  258

Query  354   IKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKG  175
             IK G Y EYV V+K KT +MFVGDGI KT IKGNRN  DGW  + +ATVA+ G GF+AKG
Sbjct  259   IKEGDYLEYVTVNKTKTNLMFVGDGIEKTLIKGNRNYDDGWTAYWSATVAIEGDGFLAKG  318

Query  174   ISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             I+FEN+AGP+  QA A R+ SD S F+ C+F  YQDT+YVHS RQF+R+CD+YGT+DF
Sbjct  319   ITFENFAGPKKGQAAAFRSRSDKSAFFQCNFSSYQDTMYVHSHRQFYRDCDIYGTIDF  376



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   341 bits (874),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 235/350 (67%), Gaps = 9/350 (3%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             CD +LY DLCVSTL   PDL AKS+PE+I A+VN T + ++ AA NC+        L   
Sbjct  62    CDGTLYPDLCVSTLSTIPDLHAKSLPEVICASVNTTAAAVRNAAKNCTNFLHRRGYLDPR  121

Query  861   ERRALHVCLELFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFP--NS  688
             +R A+  CL+LFS  L +L      L   PA    D+QT+LS A+TNQYTCLDGF     
Sbjct  122   QRLAVTDCLDLFSQTLDELGAASAALAADPAAHVDDVQTVLSAAITNQYTCLDGFAYVGR  181

Query  687   NKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRG-LKDGFPKWLSRR  511
                 RP I +R+  +S  VSN+L+M+ K  + +          E  G + +GFP W+S +
Sbjct  182   GGGYRPAIERRLYHVSHLVSNSLAMV-KRIRRRRASRPRRGALEGYGEVSEGFPAWVSAK  240

Query  510   DRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYE  331
             DR LL+AP      +    D+ VAKDGSG+F +I+ A++AAP+++DTRFVIY+KAG+Y+E
Sbjct  241   DRKLLQAPT-----NATIPDLEVAKDGSGNFTTISDAVAAAPNNTDTRFVIYVKAGAYFE  295

Query  330   YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAG  151
              V+V K KT ++ +GDGIGKT +K +R++ DGW TFR+ATVAV G GF+ + I+ EN AG
Sbjct  296   NVEVGKSKTNLLLIGDGIGKTVVKASRSVVDGWTTFRSATVAVVGDGFLMRDITIENAAG  355

Query  150   PENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             P  HQAVALR  +D S FY CSFVGYQDTLYVHS RQF+REC+VYGTVDF
Sbjct  356   PSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRECNVYGTVDF  405



>ref|XP_010058840.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=599

 Score =   328 bits (840),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 174/373 (47%), Positives = 239/373 (64%), Gaps = 20/373 (5%)
 Frame = -3

Query  1101  QSSAMNATTSHDIHQ--VAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVS  928
             +S +M+   SH  H        C  + Y  LCVSTL     L + S PEIIS  ++ + S
Sbjct  77    KSYSMDNGESHTQHTQPCPLPRCRGTPYSGLCVSTLASFTGLASMSFPEIISGMLHQSAS  136

Query  927   EIKTAAANCSRIRR-VVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA--KRHA  757
             E++ A+ +C+ ++   +  L  +ER+AL +CLELF D L D    +  L++     + + 
Sbjct  137   EVRAASTHCTVMKNHFLEKLSMLERQALDICLELFRDILDDFDNTVSYLDSLKVTIRHYY  196

Query  756   DLQTLLSTAMTNQYTCLDGF-PNS-NKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDN  583
             DLQ+LLS  MTN YTC D F PN+ N N+   +  R+  ISR VSN+L +LTK++   + 
Sbjct  197   DLQSLLSGMMTNVYTCTDEFDPNTDNLNLGDSMKDRLSNISRQVSNSLFLLTKMRGVNN-  255

Query  582   rfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINA  403
                        G+++ FP W+S  D  L++ P      +  K D+VVAKDGSG+F SIN 
Sbjct  256   -------PSGHGIRERFPAWMSLEDSLLVQTPT-----NATKFDLVVAKDGSGNFTSIND  303

Query  402   ALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTF  223
             +++AAPD+S+TRFVIYIK G Y EYV V+K KT +MFVGDGI KT IKGNRN  DGW  +
Sbjct  304   SVAAAPDNSNTRFVIYIKEGDYLEYVTVNKTKTNLMFVGDGIEKTLIKGNRNYDDGWTAY  363

Query  222   RTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRR  43
              +ATVA+ G GF+AKGI+FEN+AGP+  QA A R+ SD S F+ C+F  YQDT+YVHS R
Sbjct  364   WSATVAIEGDGFLAKGITFENFAGPKKGQAAAFRSRSDKSAFFQCNFSSYQDTMYVHSHR  423

Query  42    QFFRECDVYGTVD  4
             QF+R+CD+YGT+D
Sbjct  424   QFYRDCDIYGTID  436



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/275 (59%), Positives = 202/275 (73%), Gaps = 10/275 (4%)
 Frame = -3

Query  816  LADLRTVLDGL--ENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQI  643
            + +L+  L+ L    S ++ + +LQTLLS AMTNQYTCLDGF  S  NVR  I   +  I
Sbjct  1    MDELKVALNDLYSRKSASQHYHELQTLLSAAMTNQYTCLDGFAYSEGNVRKVIKSNLYNI  60

Query  642  SRHVSNALSMLTKIKKEKDNrfsssfrRENRG-LKDGFPKWLSRRDRALLEAPMGKGKKH  466
            S HVSN+L ML KI     N  + S      G +K GFP WLS +DR LL+AP+     +
Sbjct  61   SHHVSNSLVMLKKIPGV--NISNKSEVFTGHGDIKHGFPSWLSSKDRKLLQAPL-----N  113

Query  465  DIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVG  286
                +++VAKDGSG+F +++ A++AAP+SS+ RFVIYIKAG+Y+E VDV KKK M+MF+G
Sbjct  114  ATTFNLIVAKDGSGNFTTVSEAVAAAPNSSNARFVIYIKAGAYFENVDVHKKKNMLMFIG  173

Query  285  DGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDY  106
            DGIGKT IK NR++ DGW TFR+ATVAV G+GFIAKGI+FEN AGP  HQAVALR+ SD 
Sbjct  174  DGIGKTVIKANRSVVDGWTTFRSATVAVVGNGFIAKGITFENSAGPSMHQAVALRSGSDL  233

Query  105  SVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            S FY CSFVGYQDTLYVHS RQF+RECDVYGT+DF
Sbjct  234  SAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDF  268



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   319 bits (818),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 172/363 (47%), Positives = 233/363 (64%), Gaps = 21/363 (6%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             C+ +LY +LC+STL   PDL  K +P++I ATVN T  E+   A+NCS   +    L   
Sbjct  43    CEGTLYPELCLSTLATVPDLHKKPLPDVICATVNRTEVEVADMASNCSSFLQQGKSLPPR  102

Query  861   ERRALHVCLELFSDALADLRTVLDGLE--NSPAKRHADLQTLLSTAMTNQYTCLDGF---  697
             +R A+  C+EL    + +L+     L+  ++ A     + T+LS A+TNQ+TCL GF   
Sbjct  103   DRVAIADCIELLGTTMDELQATTSDLQQPSNGATVVDHVMTVLSGAITNQHTCLSGFTYH  162

Query  696   -PNSNKNV---RPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRG------  547
              P +   V   RP++   +  ISR VSN L+M  K++  K N  S S + + R       
Sbjct  163   GPRNGGQVSLARPYMEPGIRHISRMVSNTLAMAKKMRSTKPNSPSPSVQVQRRQPFTGYG  222

Query  546   -LKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDT  370
              +  GFP+W+   DR LL+A         I A+ VVAKDGSG + +++AA++AAP +S +
Sbjct  223   QMVKGFPRWVRPGDRRLLQA-----AASGITANAVVAKDGSGGYTTVSAAVTAAPANSKS  277

Query  369   RFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSG  190
             R+VIYIKAG+Y E V+V K +  +MF+GDGIGKT IK +RN+ DG+ TFR+ATVAV G+ 
Sbjct  278   RYVIYIKAGAYLENVEVGKNQKNLMFIGDGIGKTVIKASRNVVDGYTTFRSATVAVVGNN  337

Query  189   FIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGT  10
             FIA+ ++ EN AGP  HQAVALR  +D S FY CSFVGYQDTLYVHS RQFFR+CDVYGT
Sbjct  338   FIARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDVYGT  397

Query  9     VDF  1
             VDF
Sbjct  398   VDF  400



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   318 bits (816),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 184/387 (48%), Positives = 245/387 (63%), Gaps = 21/387 (5%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAK  973
             + + V  +A FL L +  SSA+  + SH         C+ +LY DLC+STL  +     +
Sbjct  10    ITMAVATIATFLLLFIPSSSAL--SHSH--------MCEDTLYPDLCLSTLSSSLKTTPR  59

Query  972   SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVL  793
                + I+AT+N+T      A ++CS +   +      ++RAL  C EL S +L D+ + L
Sbjct  60    ---QSIAATLNLTAKSATEAISSCSNLSHEISSTDLPDQRALSDCEELLSTSLGDISSCL  116

Query  792   DGLENSPAKRHA-DLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALS  616
               L NS ++  +  LQT LS A+TNQYTCLDGF  +N  +R  I   +  ISRH+SN+L+
Sbjct  117   ADLSNSSSRSSSIHLQTFLSAAITNQYTCLDGFSYANHTLRSRIEANIVNISRHISNSLA  176

Query  615   MLTKIKKEK--DNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVV  442
             M  K++  +  +N  S     E   +  GFP W+  +DR LL+A       +   AD+VV
Sbjct  177   MFKKVRASELPENSDSGEVFEEYGRVDGGFPAWIPPKDRRLLQA-----SANQTNADLVV  231

Query  441   AKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRI  262
             AKDGSGDF +I+ A++  PD+  TRFVIYIK G Y E VDV +KKT +M +GDGI KT +
Sbjct  232   AKDGSGDFTTISEAIAKVPDNGKTRFVIYIKTGEYLENVDVGEKKTNLMLIGDGIEKTVV  291

Query  261   KGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSF  82
             K +RN+ DGW TFR+AT AV GS FIA+ +SFEN AGP  HQAVALR+ +D S FY CSF
Sbjct  292   KASRNVVDGWTTFRSATFAVVGSNFIARDMSFENSAGPSKHQAVALRSGADLSAFYRCSF  351

Query  81    VGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VGYQDTLYVHS RQF+RECDVYGTVDF
Sbjct  352   VGYQDTLYVHSLRQFYRECDVYGTVDF  378



>ref|XP_010058837.1| PREDICTED: uncharacterized protein LOC104446716 [Eucalyptus grandis]
Length=1688

 Score =   333 bits (854),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 232/352 (66%), Gaps = 18/352 (5%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD-LGT  865
             C  + Y DLCVSTL     L   S PEIISA ++ + SE++ A+ +C+ ++   P+ L  
Sbjct  1189  CRGTPYSDLCVSTLASFTGLATMSFPEIISAMLHQSASEVRAASTHCTVMKNHFPEKLSM  1248

Query  864   MERRALHVCLELFSDALADLRTVLDGLENSPA--KRHADLQTLLSTAMTNQYTCLDGF-P  694
             +ER+AL +CLEL  D L D    +  LE+S    + + DLQ+LLS  MTN YTC D   P
Sbjct  1249  LERQALDICLELSRDILDDFDNAVSYLESSKVTIRHYYDLQSLLSGVMTNVYTCTDELDP  1308

Query  693   NS-NKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLS  517
             ++ N N+   +  R+  ISRHVSN+L +LTK+    +            G+++ FP W+S
Sbjct  1309  HTDNLNLGDSMKDRLSNISRHVSNSLFLLTKMCGVNN--------PSGHGIRERFPAWMS  1360

Query  516   RRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSY  337
               D  L++ P    K      ++VVAKDGSG+F SIN A++AAPD+S+TRFVIYIK G Y
Sbjct  1361  LEDSLLVQTPTNAKK-----FNLVVAKDGSGNFTSINDAVAAAPDNSNTRFVIYIKEGDY  1415

Query  336   YEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENY  157
              EYV V K KT +MFVGDGI KT IKGNRN  DGW TF +ATVA+ G GF+AKGI+FEN+
Sbjct  1416  LEYVTVSKTKTNLMFVGDGIEKTLIKGNRNSADGWATFWSATVAIEGDGFLAKGITFENF  1475

Query  156   AGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AGP   QAVA R+ SD S  + C+F+GYQDT+YVHS RQF+R+CD+YGT DF
Sbjct  1476  AGPTKGQAVAFRSGSDKSALFQCNFLGYQDTMYVHSHRQFYRDCDIYGTTDF  1527



>ref|XP_010456049.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39 
[Camelina sativa]
Length=532

 Score =   316 bits (809),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 167/336 (50%), Positives = 227/336 (68%), Gaps = 24/336 (7%)
 Frame = -3

Query  975  KSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMERRALHVCLELFSDALADLRT  799
            K  PE++ AT+N T+ ++  A+++ S ++ R  P+L + ER AL  CL L  D ++DL+ 
Sbjct  49   KVTPELVIATLNQTILKVSVASSSFSDLQNRFGPNLSSRERCALEDCLGLLDDTISDLQA  108

Query  798  VLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFP---NSNKNVRPFII-------KRVE  649
             L  L +S  + H D++ LLS A+TNQ TCLDGF    N N+N     +       + + 
Sbjct  109  ALSNLRSSSFESH-DVKMLLSNAITNQDTCLDGFSRCRNDNENNNDMSVALPKNLKESIL  167

Query  648  QISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKK  469
             IS ++SN+L ML  + ++  +R       E+  +   +P W+S  D+ LL+AP+     
Sbjct  168  NISNNLSNSLDMLQVMSRKNPSR-------ESSDVDVKYPGWVSEFDQRLLQAPV-----  215

Query  468  HDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFV  289
             +   ++ VAKDG+G+F +I+AA+SAAP+SS+TRF+IYIK G Y+E V+V KKKTMIMFV
Sbjct  216  QETSFNLSVAKDGTGNFTTISAAVSAAPNSSETRFIIYIKGGEYFENVEVPKKKTMIMFV  275

Query  288  GDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSD  109
            GDGIGKT IK NRN  DGWPTFRTATV V G GFIAK I+F N+AGP   QAVALR+ SD
Sbjct  276  GDGIGKTVIKANRNCVDGWPTFRTATVGVKGKGFIAKDITFVNFAGPAKKQAVALRSGSD  335

Query  108  YSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             S FY C+F GYQDTLYVHS +QF+RECD+YGT+DF
Sbjct  336  LSAFYRCAFYGYQDTLYVHSAKQFYRECDIYGTIDF  371



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score =   317 bits (812),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 176/373 (47%), Positives = 239/373 (64%), Gaps = 28/373 (8%)
 Frame = -3

Query  1065  IHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAANCSRIR  889
             + +V   AC  +LY +LCVS++   P L  ++ P EI+   ++V+++ ++ A A  +RI 
Sbjct  77    VPKVVQDACSSTLYPELCVSSVSSFPGLSDRAGPIEIVHVVLSVSIAAVEKANA-LARIM  135

Query  888   RVVPDLGTMERRALHVCLELFSDALADLRTVLDGLEN----SPAKRHADLQTLLSTAMTN  721
                P L   +R AL  CLELF + L +L   +  L+N    S  ++  DL+TLLS A+TN
Sbjct  136   WTRPGLSHRKRGALQDCLELFDETLDELYETVSNLKNGSCMSAPEKVNDLETLLSAAITN  195

Query  720   QYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGL-  544
             QYTCLD    SN  +R  +   +  IS  VSN+L+++  I     N   +S    NR L 
Sbjct  196   QYTCLDSSARSN--LRQELQGGLMSISHLVSNSLAIVKNIATRASNVTVNSI--HNRRLL  251

Query  543   ------------KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAA  400
                          DGFP W+S ++R+LL++      + +I  + VVAKDGSG   SI  A
Sbjct  252   SDDQGSEFMAMESDGFPSWMSAKERSLLQS-----SRDNIMPNAVVAKDGSGHHTSIGDA  306

Query  399   LSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFR  220
             ++AAP  S TR+VI+IKAG Y+E V+V+KKKT +MF+GDGIG T + GNRN+KDG+ T+R
Sbjct  307   VNAAPQKSRTRYVIHIKAGIYWENVEVNKKKTHLMFIGDGIGATVVAGNRNVKDGYTTYR  366

Query  219   TATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQ  40
             +ATVAV G+GFIA+ I+FEN AG   HQAVALR  SD+S FY CSF GYQDTLYVHS RQ
Sbjct  367   SATVAVNGNGFIARDITFENTAGAAKHQAVALRVGSDFSAFYRCSFQGYQDTLYVHSLRQ  426

Query  39    FFRECDVYGTVDF  1
             F+REC+VYGTVDF
Sbjct  427   FYRECNVYGTVDF  439



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score =   313 bits (801),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 233/354 (66%), Gaps = 15/354 (4%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             C  +L+RD+CVSTL   P+L  K + ++IS  V    S ++ +++NC+   +    L T 
Sbjct  72    CAGTLHRDVCVSTLSTIPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRTR  131

Query  861   ERRALHVCLELFSDALADLRTVLDGLE--NSPAKRHA-DLQTLLSTAMTNQYTCLDGF--  697
             +R AL  CLELF   L  L T    L   NS A+  A  +QT+LS AMTNQYTCLDGF  
Sbjct  132   DRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMTNQYTCLDGFAG  191

Query  696   PNSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKW  523
             P+++++  VRPFI  R+  ++  VSN+L+M+ ++  ++              ++ GFP W
Sbjct  192   PSASEDGRVRPFIQGRIYHVAHLVSNSLAMVRRLPTQRRRGAEEEPLEGYGRVRRGFPSW  251

Query  522   LSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAG  343
             +S  DR  L+          + AD+VVAKDGSG F +++ A++AAP++S+TR+VIYIKAG
Sbjct  252   VSASDRRRLQ--------QQVAADVVVAKDGSGKFTTVSEAVAAAPNNSETRYVIYIKAG  303

Query  342   SYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFE  163
              Y+E V+V  +KT IMFVGDG  KT IK +RN+ D   TFR+AT+AV G+GF+A+ I+ E
Sbjct  304   GYFENVEVGSEKTNIMFVGDGTWKTVIKASRNVVDNSTTFRSATLAVVGTGFLARDITVE  363

Query  162   NYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             N AGP  HQAVALR ++D S FY CSF GYQDTLY HS RQF+R+CD+YGTVDF
Sbjct  364   NAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVDF  417



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score =   312 bits (800),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 233/354 (66%), Gaps = 15/354 (4%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             C  +L+RD+CVSTL   P+L  K + ++IS  V    S ++ +++NC+   +    L T 
Sbjct  72    CAGTLHRDVCVSTLSTIPNLARKPLRDVISEVVGRAASAVRASSSNCTSYLQRPRQLRTR  131

Query  861   ERRALHVCLELFSDALADLRTVLDGLE--NSPAKRHA-DLQTLLSTAMTNQYTCLDGF--  697
             +R AL  CLELF   L  L T    L   NS A+  A  +QT+LS AMTNQYTCLDGF  
Sbjct  132   DRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMTNQYTCLDGFAG  191

Query  696   PNSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKW  523
             P+++++  VRPFI  R+  ++  VSN+L+M+ ++  ++              ++ GFP W
Sbjct  192   PSASEDGRVRPFIQGRIYHVAHLVSNSLAMVRRLPTQRRRGAEEEPLEGYGRVRRGFPSW  251

Query  522   LSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAG  343
             +S  DR  L+          + AD+VVAKDGSG F +++ A++AAP++S+TR+VIYIKAG
Sbjct  252   VSASDRRRLQ--------QQVAADVVVAKDGSGKFTTVSEAVAAAPNNSETRYVIYIKAG  303

Query  342   SYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFE  163
              Y+E V+V  +KT IMFVGDG  KT IK +RN+ D   TFR+AT+AV G+GF+A+ I+ E
Sbjct  304   GYFENVEVGSEKTNIMFVGDGTWKTVIKASRNVVDNSTTFRSATLAVVGTGFLARDITVE  363

Query  162   NYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             N AGP  HQAVALR ++D S FY CSF GYQDTLY HS RQF+R+CD+YGTVDF
Sbjct  364   NAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVDF  417



>gb|KDO87160.1| hypothetical protein CISIN_1g015794mg [Citrus sinensis]
Length=400

 Score =   306 bits (784),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 156/244 (64%), Positives = 182/244 (75%), Gaps = 8/244 (3%)
 Frame = -3

Query  729  MTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENR  550
            MTNQYTCLDGF  S+ NVR  I   +  ISRHVSN+L ML KI    DN  S        
Sbjct  1    MTNQYTCLDGFAYSDGNVRDVIKSSLYNISRHVSNSLVMLKKI--PGDNMSSKYEVFPEY  58

Query  549  G-LKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSD  373
            G +K GFP WLS  DR LL+  +     +  K D++VAKDGSG+F +I  A+ AAP+ S+
Sbjct  59   GRIKRGFPTWLSLNDRKLLQKSV-----NLTKFDLIVAKDGSGNFTTITEAVEAAPNKSN  113

Query  372  TRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGS  193
            TRFVIYIKAG+Y+E V+VDKKKTM+MFVGDGIGKT +K NR++ DGW TFR+ATVAV G+
Sbjct  114  TRFVIYIKAGAYFENVEVDKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGT  173

Query  192  GFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYG  13
            GFIAKGI+ EN AGP  HQAVALR+ SD S FY CSFVGYQDTLYVHS RQF+RECDVYG
Sbjct  174  GFIAKGITVENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYG  233

Query  12   TVDF  1
            TVDF
Sbjct  234  TVDF  237



>gb|ABG46324.1| putative pectin methylesterase [Picea abies]
Length=393

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/367 (44%), Positives = 224/367 (61%), Gaps = 25/367 (7%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAANCSRIRRV  883
             +  H AC  +LY + CVS++   P L  +  P EI+   V ++++ ++ A A   R+ R 
Sbjct  32    KAVHHACSSTLYPEFCVSSVSSFPGLSKRPGPMEILKVVVKLSIAAVEKANARARRLSR-  90

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLEN----SPAKRHADLQTLLSTAMTNQY  715
              P L   +R AL  C ELF + L +L + L  L+N    S  +  +DL+TLLS A+TNQY
Sbjct  91    -PGLDQRQRGALQDCFELFDETLDELYSTLSDLKNKTFISIPQSASDLETLLSAAITNQY  149

Query  714   TCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGL---  544
             TC+D F +   N++  ++  +  IS  VSN+L+M+  I  E  N    +   +NR L   
Sbjct  150   TCIDSFTHCKGNLKQSLLGGLRNISHLVSNSLAMVKNISAEASNLARRTVSNQNRRLLSD  209

Query  543   ----------KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALS  394
                        DGFP W+S  DR LL+   G      +K + VVAKDGSG++ +I  A+ 
Sbjct  210   QSDPNFMPMDSDGFPSWMSAGDRRLLQTSTGT-----VKPNAVVAKDGSGNYTNITEAVE  264

Query  393   AAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTA  214
             AAP+ S TR+VI+IKAG Y E V++ KKKT +MF+GDG+  T + GNRN+K+ + TFR+A
Sbjct  265   AAPEKSKTRYVIHIKAGVYAENVELHKKKTNLMFIGDGMDVTVVTGNRNVKENFTTFRSA  324

Query  213   TVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFF  34
             TVAV G GFIA+ ++FEN AG   HQAVALR  SD S FY CSF GYQDTLY HS RQF+
Sbjct  325   TVAVLGKGFIARDMTFENTAGAAKHQAVALRVGSDLSAFYRCSFKGYQDTLYAHSLRQFY  384

Query  33    RECDVYG  13
             RE  +YG
Sbjct  385   REWHIYG  391



>ref|XP_002872846.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49105.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=531

 Score =   308 bits (790),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 177/392 (45%), Positives = 240/392 (61%), Gaps = 46/392 (12%)
 Frame = -3

Query  1149  LVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKS  970
             L+P++    FLS  V  SS   + T+H  H++  +                       K+
Sbjct  16    LLPLIFFIIFLSTVV--SSHSPSYTTHKTHRLTET-----------------------KT  50

Query  969   IPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMERRALHVCLELFSDALADLRTVL  793
             IPE+I A +N+T+ ++  A++N S ++ R+ P+L   ER A   CL L  D ++DL+T +
Sbjct  51    IPELIIADLNLTILKVNLASSNFSDLQTRLGPNLTHCERCAFEDCLGLLDDTISDLKTAI  110

Query  792   DGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNS-NKNVRPFIIKRVEQ-------ISR  637
               L +S  + + D+  LLS AMT+Q TCLDGF  S N+N    + +  E        IS 
Sbjct  111   SKLRSSSFEFN-DVSLLLSNAMTDQDTCLDGFSTSDNENNNDMMYELPENLKESILDISN  169

Query  636   HVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIK  457
              +SN+L ML  I  +     SS    E       +P W+S+ D+ LLEAP+    +    
Sbjct  170   DLSNSLDMLQMISGKNSTLESSEVDVE-------YPSWVSKNDKRLLEAPV----QEITN  218

Query  456   ADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGI  277
              ++ VA DG+G+F +INAA+SAAP+ SDTRF+IYIK G Y+E V++ KKKTMIMF+GDGI
Sbjct  219   FNLSVAIDGTGNFTTINAAVSAAPNKSDTRFIIYIKGGEYFENVELPKKKTMIMFIGDGI  278

Query  276   GKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVF  97
             GKT IK NR+  DGW TF+TATV V G GFIAK ISF N+AG    QAVALR+ SD+S F
Sbjct  279   GKTVIKANRSRIDGWSTFQTATVGVKGKGFIAKDISFVNFAGLAKEQAVALRSGSDHSAF  338

Query  96    YDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             Y C F GYQDTLYVHS +QF+RECD+YGT+DF
Sbjct  339   YRCEFDGYQDTLYVHSAKQFYRECDIYGTIDF  370



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 172/373 (46%), Positives = 225/373 (60%), Gaps = 32/373 (9%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             CD +LY +LC+STL   PDL  K +P++I A VN T   +   + NCS   +    L   
Sbjct  49    CDGTLYPELCLSTLADIPDLHKKPLPDVICAAVNHTEDVVTATSTNCSYYLQDR-SLSAR  107

Query  861   ERRALHVCLELFSDALADLRTVLDGLENSPAKRHA--------------DLQTLLSTAMT  724
             +R A++ CLEL S  + +LR     L  S     +               + T+LS A+T
Sbjct  108   DRLAINDCLELLSTTMDELRATTADLSTSSGGNGSAAAPSVGTRRVTMDHVMTVLSAAIT  167

Query  723   NQYTCLDGFPNSNKN-VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRG  547
             NQYTCLDGF   N   VR +I      +SR VSN+L+M  K+     +  S+    E   
Sbjct  168   NQYTCLDGFAYQNGGRVRHYIEPTFHHVSRMVSNSLAMAKKLPGASPSPSSAPTTTETAA  227

Query  546   LK-----------DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAA  400
             +             GFP+W+   DR LL+AP        I AD VVAKDGSG + +++AA
Sbjct  228   VARQPFMGYGQMVKGFPRWVRPGDRRLLQAPATA-----ITADAVVAKDGSGGYTTVSAA  282

Query  399   LSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFR  220
             ++AAP +S  R+VIYIKAG+Y E V+V KK   +MFVGDGIGKT IK +RN+ DG+ TFR
Sbjct  283   VAAAPTNSKKRYVIYIKAGAYMENVEVGKKHVNLMFVGDGIGKTVIKASRNVVDGYTTFR  342

Query  219   TATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQ  40
             +ATVAV G+ F+A+ ++ EN AGP  HQAVALR  +D S FY CSFVGYQDTLYVHS RQ
Sbjct  343   SATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQ  402

Query  39    FFRECDVYGTVDF  1
             FFR+CD+YGT+DF
Sbjct  403   FFRDCDIYGTIDF  415



>emb|CDP15269.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/297 (51%), Positives = 201/297 (68%), Gaps = 13/297 (4%)
 Frame = -3

Query  1071  HDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  892
             H   Q+AHS C  + Y DLCVSTL   PDLR +++PEIIS  VN TV E++ +  NC+RI
Sbjct  72    HQHLQIAHSTCQDTFYPDLCVSTLATFPDLRQRTLPEIISGMVNSTVFEVRDSKQNCTRI  131

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLEN--SPAKRHADLQTLLSTAMTNQ  718
             RR + +L  ++RRAL  CL+L  D +A L+  +  L +  S  + + DLQTL S AMTNQ
Sbjct  132   RRKLQNLDPLDRRALEDCLQLLDDTVAQLKAAISDLSSNKSALQHYMDLQTLFSAAMTNQ  191

Query  717   YTCLDGFPNSN-KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENR---  550
              TCLDGF  S  K +R FI  R+ +IS HVSN+L+ML ++KK++    +     E     
Sbjct  192   DTCLDGFAFSRRKYIREFIEGRLRKISHHVSNSLAMLKRVKKQQAAAGAVFQEEEGEFGT  251

Query  549   --GLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSS  376
                   GFP WL ++DRALL+AP+ +      K ++ VAKDGSG+F +IN AL AAP+SS
Sbjct  252   PVKSGAGFPTWLKKKDRALLQAPLNQ-----TKVNLTVAKDGSGNFTTINDALQAAPNSS  306

Query  375   DTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVA  205
              TRFVIYIKAG+YYEY++V+ +K MIMF+GDGIGKT IKGNR++  GW TFR++TV 
Sbjct  307   TTRFVIYIKAGAYYEYIEVESRKKMIMFLGDGIGKTVIKGNRSVGAGWTTFRSSTVG  363



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/357 (47%), Positives = 226/357 (63%), Gaps = 16/357 (4%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             CD +LY +LC+STL   PDL  K +P++I A VN T +E+ T +ANCS   R    L   
Sbjct  55    CDGTLYPELCLSTLADIPDLHKKPLPDVICAAVNRTETEVTTMSANCSGYLRER-SLSGR  113

Query  861   ERRALHVCLELFSDALADLRTVLDGLENSPAKRHADL---QTLLSTAMTNQYTCLDGFP-  694
             +  A+  C+EL    + +L      LE+  A R   +    T+LS A+TNQ TCL+GF  
Sbjct  114   DHLAVTDCMELLETTMEELVATTADLESPSAARRPTMDHAMTVLSAAITNQQTCLEGFSY  173

Query  693   NSNKNVRPFIIKRVEQISRHVSNALSML------TKIKKEKDNrfsssfrRENRGLKDGF  532
                  VR ++   +  I++ VSN+L+M       TK    + +     F    + +K GF
Sbjct  174   QKGGEVRRYMEPGILHIAKMVSNSLAMAKKLPGATKPSSTERSVARQPFTGYGQVVKGGF  233

Query  531   PKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYI  352
             P+W+   DR LL+AP        IKA+ VVAKDGSG F +++AA++AAP +S +R+VIYI
Sbjct  234   PRWVRPGDRRLLQAP-----ASGIKANAVVAKDGSGGFTTVSAAVAAAPTNSQSRYVIYI  288

Query  351   KAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGI  172
             KAG+Y E V+V K    +MF+GDG+GKT IK + N+ DG  TFR+ATVAV G+ F+A+ +
Sbjct  289   KAGAYMENVEVGKNHKNLMFMGDGMGKTVIKASLNVVDGSTTFRSATVAVVGNNFLARDL  348

Query  171   SFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + EN AGP  HQAVALR  +D S FY CSFVGYQDTLYVHS RQFFRECD+YGT+DF
Sbjct  349   TIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTIDF  405



>ref|XP_004958677.1| PREDICTED: pectinesterase 3-like [Setaria italica]
Length=598

 Score =   303 bits (775),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 236/355 (66%), Gaps = 16/355 (5%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             C  +L+R++C STL   P+L  K + ++IS  V    + ++ +++NCS   R    L   
Sbjct  90    CAGTLHREVCASTLASIPNLARKPLRDVISDVVARAAAAVRASSSNCSSYLRRPRGLRVR  149

Query  861   ERRALHVCLELFSDALADLRTVLDGLE--NSPAKRH-ADLQTLLSTAMTNQYTCLDGF--  697
             +R AL  CLELF   L  L T  D L   N  A+   A +QT+LS A+TNQYTCL+GF  
Sbjct  150   DRLALSDCLELFGRTLGQLGTAADELSAGNRTAEESIAGVQTVLSAALTNQYTCLEGFAG  209

Query  696   PNSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKW  523
             P+++++  VRP+I  R+  ++  VSN+L+ML ++ + +  R   +     R ++ GFP W
Sbjct  210   PSASEDGRVRPYIQGRIYHVAHLVSNSLAMLRRLPQRRRRRGREALEGYGR-VRRGFPSW  268

Query  522   LSRRDRA-LLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKA  346
             +S  DR  LLE   G        AD+VVAKDGSG+F ++  A++AAP++S++RFVIYIKA
Sbjct  269   VSAGDRRRLLEPSAGA-------ADLVVAKDGSGNFTTVGEAVAAAPNNSESRFVIYIKA  321

Query  345   GSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISF  166
             G Y+E V+V  +KT +MFVGDG+ KT IK +RN+ D   T+R+AT+AV G+GF+A+ ++ 
Sbjct  322   GGYFENVEVGPEKTNLMFVGDGMWKTVIKASRNVVDNSTTYRSATLAVVGTGFLARDLTV  381

Query  165   ENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             EN AGP  HQAVALR ++D S FY CSF GYQDTLY HS RQF+R+CDVYGTVDF
Sbjct  382   ENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDVYGTVDF  436



>ref|XP_006396438.1| hypothetical protein EUTSA_v10029453mg [Eutrema salsugineum]
 gb|ESQ37891.1| hypothetical protein EUTSA_v10029453mg [Eutrema salsugineum]
Length=524

 Score =   300 bits (768),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 221/337 (66%), Gaps = 29/337 (9%)
 Frame = -3

Query  981  RAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMERRALHVCLELFSDALADL  805
            ++    E++ AT+N T+S++  +++N   ++ R+ P L   +R A   CL L  D ++DL
Sbjct  46   KSNDTTELVVATLNQTISKVNLSSSNFFDLQNRLGPTLTFRDRCAFEDCLGLLDDTISDL  105

Query  804  RTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSN---KNVRPF-----IIKRVE  649
            +T +  L++S    H D+  LLS AMTNQ TCL+GF  SN    N R +     + + + 
Sbjct  106  KTAISKLQSSSFGSH-DVSMLLSDAMTNQDTCLEGFTASNDENNNDRTYELNESLKESIL  164

Query  648  QISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD-GFPKWLSRRDRALLEAPMGKGK  472
             IS ++ N+L M+ KI               N+   D  FP W+S  D+ LL+A +    
Sbjct  165  NISNNLGNSLDMVQKIPG-------------NKHFPDVEFPSWVSENDKRLLQASV----  207

Query  471  KHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMF  292
              + K ++ VA+DGSG+F +I++A+SAAP+SS+TRF IYIK G Y+E V++ KKKTMIMF
Sbjct  208  -KETKFNLSVAQDGSGNFTTISSAVSAAPNSSETRFTIYIKGGVYFENVEIPKKKTMIMF  266

Query  291  VGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADS  112
            VGDGIGKT IK NR+  DGW TF++ATV V G GFIAKGISF N+AG   HQAVALR+ S
Sbjct  267  VGDGIGKTIIKANRSRVDGWSTFQSATVGVKGKGFIAKGISFVNFAGLAKHQAVALRSGS  326

Query  111  DYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            D S FY C+F GYQDTLYVHS +QF+RECD++GTVDF
Sbjct  327  DLSAFYQCAFEGYQDTLYVHSAKQFYRECDIFGTVDF  363



>ref|XP_006289196.1| hypothetical protein CARUB_v10002644mg [Capsella rubella]
 gb|EOA22094.1| hypothetical protein CARUB_v10002644mg [Capsella rubella]
Length=530

 Score =   297 bits (760),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 164/340 (48%), Positives = 219/340 (64%), Gaps = 30/340 (9%)
 Frame = -3

Query  981  RAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMERRALHVCLELFSDALADL  805
              K  PE++ AT+N+T+S+++ +++N S ++ RV P L   ER A   CL L  D ++DL
Sbjct  47   ETKITPELVIATLNLTISKVRLSSSNFSDLQNRVGPILTHGERCAFEDCLGLLDDTISDL  106

Query  804  RTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSN------------KNVRPFII  661
            +  L  L +S  K H D+  LL+ AMTNQ TCLDGF  S             +N++  I+
Sbjct  107  QATLSNLRSSSLKSH-DVNMLLTNAMTNQDTCLDGFSTSGDGDNIAMTFELPQNLKENIL  165

Query  660  KRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMG  481
                 IS ++SN+L ML  + ++  +  SS    E       +P W+S  D+ +L+AP+ 
Sbjct  166  N----ISNNLSNSLDMLQVMWRKNPSSESSEVDVE-------YPSWVSELDQRVLQAPV-  213

Query  480  KGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTM  301
                 +   ++ VAKDG+G+F +I+ A+ AAP+SS+TRF+IYIK G Y E V++ KKKTM
Sbjct  214  ----QETSFNLSVAKDGTGNFTTISDAVYAAPNSSETRFIIYIKGGEYIENVELRKKKTM  269

Query  300  IMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALR  121
            IMFVGDGIG T IK NR+  DGW TF+TATV V G GFIAK ISF N+AG    QAVALR
Sbjct  270  IMFVGDGIGITVIKANRSRVDGWSTFQTATVGVKGKGFIAKDISFVNFAGLAKGQAVALR  329

Query  120  ADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            + SD S FY C F GYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  330  SGSDLSAFYRCEFDGYQDTLYVHSARQFYRECDIYGTVDF  369



>ref|XP_002463382.1| hypothetical protein SORBIDRAFT_02g042780 [Sorghum bicolor]
 gb|EER99903.1| hypothetical protein SORBIDRAFT_02g042780 [Sorghum bicolor]
Length=599

 Score =   298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 166/365 (45%), Positives = 236/365 (65%), Gaps = 25/365 (7%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             C  +L+RD+C STL   PDL  K + ++ISA V    + ++ +A+NCS   R     G +
Sbjct  80    CAGTLHRDVCASTLSAIPDLAQKPVRDVISAVVARAAAAVRASASNCSAYLRRPAGAGAL  139

Query  861   ---ERRALHVCLELFSDALADLRTVLDGLENSPAKRH----------ADLQTLLSTAMTN  721
                +R AL  C+EL    LA L T    L  + +             A +QT+LS A+TN
Sbjct  140   RVRDRLALSDCVELLQHTLAQLGTAEAELSAANSSTSTSTSTDEESVAGVQTVLSAALTN  199

Query  720   QYTCLDGF--PNSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrREN  553
             QYTCLDGF  P+++++  VRP+I  R+  ++  VSN+L+ML ++ + +  R   +   E 
Sbjct  200   QYTCLDGFAGPSASEDGRVRPYIQGRIYHVAHLVSNSLAMLRRLPQRRRRRGREALELEG  259

Query  552   RG-LKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSS  376
              G ++ GFP W+S  DR  L+       +  +  D+VVAKDGSG+F ++  A++AAP++S
Sbjct  260   YGRVRRGFPSWVSAADRRRLQ-------QQQVVPDLVVAKDGSGNFTTVGEAVAAAPNNS  312

Query  375   DTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGG  196
             ++RFVIYIKAG Y+E V+V  +KT +MFVGDG+ KT IK +RN+ D   TFR+AT+AV G
Sbjct  313   ESRFVIYIKAGGYFENVEVGSEKTNLMFVGDGMWKTVIKASRNVVDNSTTFRSATLAVVG  372

Query  195   SGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVY  16
             +GF+A+ ++ EN AGP  HQAVALR ++D + FY CSF GYQDTLY HS RQF+R+CDVY
Sbjct  373   TGFLARDLTVENAAGPSKHQAVALRVNADLAAFYRCSFAGYQDTLYAHSLRQFYRDCDVY  432

Query  15    GTVDF  1
             GTVDF
Sbjct  433   GTVDF  437



>ref|NP_192139.1| Probable pectinesterase/pectinesterase inhibitor 39 [Arabidopsis 
thaliana]
 sp|O81415.1|PME39_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
39; Includes: RecName: Full=Pectinesterase inhibitor 39; AltName: 
Full=Pectin methylesterase inhibitor 39; Includes: RecName: 
Full=Pectinesterase 39; Short=PE 39; AltName: Full=Pectin 
methylesterase 39; Short=AtPME39; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC28174.1| T2H3.6 [Arabidopsis thaliana]
 emb|CAB80723.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAY78785.1| pectinesterase family protein [Arabidopsis thaliana]
 gb|AEE82152.1| Probable pectinesterase/pectinesterase inhibitor 39 [Arabidopsis 
thaliana]
Length=532

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 215/336 (64%), Gaps = 22/336 (7%)
 Frame = -3

Query  981  RAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMERRALHVCLELFSDALADL  805
              K+IPE+I A +N+T+ ++  A++N S ++ R+ P+L   ER A   CL L  D ++DL
Sbjct  49   ETKTIPELIIADLNLTILKVNLASSNFSDLQTRLFPNLTHYERCAFEDCLGLLDDTISDL  108

Query  804  RTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFP---NSNKNVRPFIIKR-----VE  649
             T +  L +S +    D+  LL+  MT Q TCLDGF    N N N   + +       + 
Sbjct  109  ETAVSDLRSS-SLEFNDISMLLTNVMTYQDTCLDGFSTSDNENNNDMTYELPENLKEIIL  167

Query  648  QISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKK  469
             IS ++SN+L ML  I ++K +  SS    E       +P WLS  D+ LLEAP+     
Sbjct  168  DISNNLSNSLHMLQVISRKKPSPKSSEVDVE-------YPSWLSENDQRLLEAPV-----  215

Query  468  HDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFV  289
             +   ++ VA DG+G+F +IN A+ AAP+ S+TRF+IYIK G Y+E V++ KKKTMIMF+
Sbjct  216  QETNYNLSVAIDGTGNFTTINDAVFAAPNMSETRFIIYIKGGEYFENVELPKKKTMIMFI  275

Query  288  GDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSD  109
            GDGIGKT IK NR+  DGW TF+T TV V G G+IAK ISF N AGP   QAVA R+ SD
Sbjct  276  GDGIGKTVIKANRSRIDGWSTFQTPTVGVKGKGYIAKDISFVNSAGPAKAQAVAFRSGSD  335

Query  108  YSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            +S FY C F GYQDTLYVHS +QF+RECD+YGT+DF
Sbjct  336  HSAFYRCEFDGYQDTLYVHSAKQFYRECDIYGTIDF  371



>ref|XP_006658118.1| PREDICTED: pectinesterase 3-like [Oryza brachyantha]
Length=577

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 239/359 (67%), Gaps = 18/359 (5%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             C  +L+RD+CVSTL   P+L  K + ++IS  V    S ++ ++ANCS   +    L   
Sbjct  63    CAGTLHRDVCVSTLATIPNLAQKPLRDVISEVVGRAASAVRASSANCSSYLQRSQQLRVR  122

Query  861   ERRALHVCLELFSDALADLRTV---LDGLENSPAKRHADLQTLLSTAMTNQYTCLDGF--  697
             +R AL  CLELF   L  L T    L     S  +  A +QT+LS AMTNQYTCL+GF  
Sbjct  123   DRLALSDCLELFGHTLDQLGTAAAELSAGNRSAEESIAGVQTVLSAAMTNQYTCLEGFAG  182

Query  696   PNSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrREN-RG---LKDG  535
             P+++++  VRP+I  R+  ++  VSN+L+M+ ++ +++  R      +E   G   ++ G
Sbjct  183   PSASEDGRVRPYIQGRIYHVAHLVSNSLAMVRRLPQQRRGRGRGLRSKEPLEGYGRVRRG  242

Query  534   FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIY  355
             FP W+S  DR  L+      ++    A++VVAKDGSG+F +++ A++AAP++S+TR+VIY
Sbjct  243   FPSWVSGSDRRRLQ------QQVAPAANVVVAKDGSGNFTTVSEAVAAAPNNSETRYVIY  296

Query  354   IKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAV-GGSGFIAK  178
             IKAG Y+E V+V  +KT IMFVGDG+ +T IK +RN+ D   TFR+AT+AV GG+GF+A+
Sbjct  297   IKAGGYFENVEVGSEKTNIMFVGDGMWRTVIKASRNVVDNSTTFRSATLAVGGGTGFLAR  356

Query  177   GISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              I+ EN AGP  HQAVALR ++D S FY CSF GYQDTLY HS RQF+R+CD+YGTVDF
Sbjct  357   DITVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVDF  415



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   294 bits (753),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 168/366 (46%), Positives = 224/366 (61%), Gaps = 29/366 (8%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI---RRVVPDL  871
             C+ +LY +LC+STL   PDL  KS+P++I  TVN T   +   + NCS     + + P  
Sbjct  49    CEGTLYPELCLSTLADIPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKYLTP--  106

Query  870   GTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHAD---------------LQTLLS  736
                +R A+  C+EL    + +L+     LE SPA    +               + T LS
Sbjct  107   --RDRLAISDCMELLDTTMDELQATTSDLE-SPAVAGGNNGSASMAAKRVTMDHVMTELS  163

Query  735   TAMTNQYTCLDGFP-NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrR  559
              AMTNQYTCLDGF     + VR ++   +  +SR VSN+L+M  K+              
Sbjct  164   AAMTNQYTCLDGFDYKDGERVRHYMESSIHHVSRMVSNSLAMAKKLPGAGGETTQRQPFM  223

Query  558   ENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDS  379
                 + +GFPKW+   DR LL+AP        I  D VVAKDGSG + +++AA++AAP +
Sbjct  224   GYGQMANGFPKWVRPGDRRLLQAP-----ASSITPDAVVAKDGSGGYTTVSAAVAAAPAN  278

Query  378   SDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVG  199
             S+ R+VI+IKAG+Y E V+V K K  +MF+GDGIGKT IK +RN+ DG  TFR+ATVAV 
Sbjct  279   SNKRYVIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTVIKASRNVVDGSTTFRSATVAVV  338

Query  198   GSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDV  19
             G+ F+A+ ++ EN AGP  HQAVALR  +D S FY CSFVGYQDTLYVHS RQFFRECD+
Sbjct  339   GNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDI  398

Query  18    YGTVDF  1
             YGT+DF
Sbjct  399   YGTIDF  404



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   295 bits (754),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 230/365 (63%), Gaps = 23/365 (6%)
 Frame = -3

Query  1047  SACDHSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAANCSRIRRVVPDL  871
             +AC  +LY++LCVS++     L +++   EI+ A VNV ++ +K   A+   +     DL
Sbjct  76    NACSSTLYQELCVSSISSYEGLSSQAGHMEILDAAVNVAINAVKKGQAHTRSL--FSRDL  133

Query  870   GTMERRALHVCLELFSDALADLRTVLDGLEN----SPAKRHADLQTLLSTAMTNQYTCLD  703
              + +R AL+ C+E++ D L +L   L  L N    S  K  ADL+TLLS A+TNQ+TCL+
Sbjct  134   DSRQRGALNDCMEMYDDTLDELHDTLSDLHNATFLSMPKHAADLETLLSAAITNQFTCLE  193

Query  702   GFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIK-KEKDNrfsssfrRENRGL------  544
             GF     +++  +   +  +S  VSN+L+ +  I  + K     +    + R L      
Sbjct  194   GFTLCKGHLKQQVKGELHNVSHLVSNSLATVGNISARAKQALGIADSLADRRRLLSESFV  253

Query  543   ---KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSD  373
                ++GFP W+S  DR LL+  +      +I A+ VVAKDGSG + +I+AA+ AAP+ S 
Sbjct  254   STDEEGFPSWMSVGDRRLLQVNVT-----NITANAVVAKDGSGHYSTISAAVDAAPEKST  308

Query  372   TRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMK-DGWPTFRTATVAVGG  196
             TRF+IY+K G Y E V++ KKK  +MF+GDG G T +  +R+++     TF +ATVAV G
Sbjct  309   TRFIIYVKKGVYQENVEIHKKKHFLMFIGDGEGVTVVTASRSVRGSNHTTFHSATVAVTG  368

Query  195   SGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVY  16
              GFIA+ ++FEN AGP NHQAVALR  SD+SVFY CSF GYQDTLYVHS RQFFR+CD+Y
Sbjct  369   KGFIARDMTFENTAGPSNHQAVALRVGSDFSVFYRCSFKGYQDTLYVHSLRQFFRDCDIY  428

Query  15    GTVDF  1
             GTVDF
Sbjct  429   GTVDF  433



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   293 bits (751),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 162/368 (44%), Positives = 225/368 (61%), Gaps = 23/368 (6%)
 Frame = -3

Query  1056  VAHSACDHSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAANCSRIRRVV  880
             V   AC  +L+ +LCVS++     L +K+   EI+ + V V +  ++ A A+  R+ R  
Sbjct  62    VLKDACSSTLHPELCVSSIASYGGLSSKADHMEIVESAVRVGIGAVEKAKAHVRRLSR--  119

Query  879   PDLGTMERRALHVCLELFSDALADLRTVLDGLEN----SPAKRHADLQTLLSTAMTNQYT  712
             P L   +R AL  C+E+F D L +L+  L  L+N    S  K   DL+TLLS A+TNQYT
Sbjct  120   PGLDFRQRGALKDCMEMFDDTLEELQDTLTDLQNATFMSLPKYADDLKTLLSGAITNQYT  179

Query  711   CLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLK---  541
             CLDGF     ++R  +   +  IS  VSN+L+M+    ++ +    ++    +R  +   
Sbjct  180   CLDGFHLCKGHLRQDLNAELLNISHLVSNSLAMVCNFSQQANLALGNADSLSDRRRRLLS  239

Query  540   --------DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAP  385
                      GFP W+S  DR LL+ P       +I A+ VVAKDGSG + +I+AA++AAP
Sbjct  240   NDFMSSDDHGFPSWMSAGDRRLLQTP-----AQNINANAVVAKDGSGSYTTISAAVAAAP  294

Query  384   DSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVA  205
             + S +R+VI+IK G Y E VD+ K K  +MF+GDG   T +  NRN+ DG+ TF +AT A
Sbjct  295   EKSTSRYVIHIKKGVYQENVDIPKNKHNLMFIGDGKDVTVVTANRNVVDGYTTFHSATAA  354

Query  204   VGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFREC  25
             V G GF+A+ ++F+N AGP  HQAVALR  SD S F  C+F GYQDTLYVHS RQF+REC
Sbjct  355   VTGKGFVARDMTFKNTAGPTKHQAVALRVGSDLSAFLRCTFEGYQDTLYVHSLRQFYREC  414

Query  24    DVYGTVDF  1
             DVYGTVDF
Sbjct  415   DVYGTVDF  422



>ref|XP_010937249.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=582

 Score =   290 bits (743),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 170/426 (40%), Positives = 248/426 (58%), Gaps = 30/426 (7%)
 Frame = -3

Query  1209  LSYHSTIDSEMQNLGRNPIMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAH----SA  1042
             ++ H   DS  +   R  ++L   ++LA  ++ T    +   AT S D   V+H    S+
Sbjct  1     MTTHHNSDSNPKK--RRKLLLTSFLVLAALITTTSILIARRTATASSDDPTVSHAILRSS  58

Query  1041  CDHSLYRDLCVSTLVKTPDL-RAKSIP-EIISATVNVTVSEIKTAAANCSRIRRVVPDLG  868
             C  + + DLC S +  TP L    S P ++I A++N+T++ I+ +  +  R+     +L 
Sbjct  59    CRSARFPDLCYSAIAATPPLVHTISKPKDVIHASLNLTITAIERSFRHVERLSAAAANLT  118

Query  867   TMERRALHVCLELFSDALADLRTVLDGLENSPA----KRHA-DLQTLLSTAMTNQYTCLD  703
               ER ALH CLE+F ++L +LR     L   PA    +RHA DL+ L+S AMTNQ +C D
Sbjct  119   ARERTALHDCLEMFDESLDELRLTDADLRAYPAGKPLRRHALDLEILVSAAMTNQESCAD  178

Query  702   GFPNSN--KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRE--NRGLK--  541
             GF + +  + +R  ++  +  ++R   NAL+M+  +         +        RG +  
Sbjct  179   GFSHGDVDRRLRSELVSGLMHVTRMCRNALAMIKNMTGADIAAAEAVVDGSIGTRGRRML  238

Query  540   ------DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDS  379
                   +G P W+ ++DR  L    G     ++KA+ VVA DGSGD+K++  A++AAP  
Sbjct  239   GFNIDEEGLPDWIEKKDRRRLLQAAG-----EVKANAVVAADGSGDYKTVGKAVAAAPAK  293

Query  378   SDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVG  199
             S TR+VI IKAG+Y E V+V KKKT +MF+GDG   T I G+RN+ DG  TF +AT+AV 
Sbjct  294   SKTRWVIRIKAGTYEENVEVPKKKTNLMFIGDGRKTTIITGSRNVVDGSTTFHSATLAVV  353

Query  198   GSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDV  19
             G+GF+A+G+S +N AGP  HQAVALR  SD S FYDC  + YQDTLY+HS R FFR C +
Sbjct  354   GAGFLARGLSIQNTAGPSKHQAVALRVSSDLSAFYDCDIIAYQDTLYLHSLRHFFRSCLI  413

Query  18    YGTVDF  1
              GTVDF
Sbjct  414   QGTVDF  419



>ref|XP_008653464.1| PREDICTED: pectinesterase-like [Zea mays]
 tpg|DAA64103.1| TPA: hypothetical protein ZEAMMB73_876271 [Zea mays]
Length=605

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 169/363 (47%), Positives = 235/363 (65%), Gaps = 21/363 (6%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSR-IRRVVPDLGT  865
             C  +L+RD+C STL   PDL  K   E+ISA V    S ++ +A+NCS  +RR    L  
Sbjct  86    CAGTLHRDVCASTLGSIPDLARKPAREVISAVVARAASAVRASASNCSAYLRRPAGALRV  145

Query  864   MERRALHVCLELFSDALADLRTVLDGLENS---------PAKRHADLQTLLSTAMTNQYT  712
              +R AL  C+EL    LA L T    L             ++  A +QT+LS A+TNQYT
Sbjct  146   RDRLALADCVELLGHTLAQLGTAEAELSAGNFTAAEAEVESESLAAVQTVLSAALTNQYT  205

Query  711   CLDGF--PNSNKN--VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrR-ENRG  547
             CLDGF  P+++++  VRP+I  R+  ++  VSN+L+ML ++ + +  R        E  G
Sbjct  206   CLDGFAGPSASEDGRVRPYIQGRMYHVAHLVSNSLAMLRRLPQRRRRRQGRGALELEGYG  265

Query  546   -LKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDT  370
              ++ GFP W+S  DR  L+      ++     D+VVAKDGSG+F ++  A++AAP++S+T
Sbjct  266   RVRRGFPSWVSGADRRRLQQ-----QQVVPGPDLVVAKDGSGNFTTVGEAVAAAPNNSET  320

Query  369   RFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSG  190
             RFVIYIKAG Y+E V+V  +KT +MFVGDG+ +T IK +RN+ D   TFR+AT+AV G+G
Sbjct  321   RFVIYIKAGGYFENVEVGSEKTNLMFVGDGMWRTVIKASRNVVDNSTTFRSATLAVVGTG  380

Query  189   FIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGT  10
             F+A+ ++ EN AGP  HQAVALR ++D S FY C+F GYQDTLY HS RQF+R+CDVYGT
Sbjct  381   FLARDLTVENAAGPSKHQAVALRVNADLSAFYRCAFAGYQDTLYAHSLRQFYRDCDVYGT  440

Query  9     VDF  1
             VDF
Sbjct  441   VDF  443



>ref|NP_001146685.1| pectinesterase precursor [Zea mays]
 gb|ACL54524.1| unknown [Zea mays]
 tpg|DAA54385.1| TPA: pectinesterase [Zea mays]
Length=563

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 180/387 (47%), Positives = 235/387 (61%), Gaps = 35/387 (9%)
 Frame = -3

Query  1104  FQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSE  925
             F  SA +A  +H         CD +LY +LC+STL   PDL  K +P++I A VN T   
Sbjct  32    FYPSAESAAAAH---------CDGTLYPELCLSTLADIPDLHKKPLPDVICAAVNRTEDV  82

Query  924   IKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHA----  757
             +   ++NCS   +    L   +R A++ CLEL S  + +LR     L  SPA R +    
Sbjct  83    VVATSSNCSYYLQDR-SLSARDRLAINDCLELLSTTMDELRASTADLA-SPAGRGSASAG  140

Query  756   -----------DLQTLLSTAMTNQYTCLDGFP-NSNKNVRPFIIKRVEQISRHVSNALSM  613
                         + T+LS A+TNQYTCLDGF   S   VR +I      +SR VSN+L+M
Sbjct  141   VSQGARRATMEHVMTVLSAAITNQYTCLDGFAYQSGGRVRRYIEPTFHHVSRMVSNSLAM  200

Query  612   LTKIKKEKDNrfsssfrRENRG---LKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVV  442
               K+     +   +  R+   G   +  GFP+W+   DR LL+A         + AD VV
Sbjct  201   AKKLPGAGASAAPAPPRQPFTGYGQMVKGFPRWVRPGDRRLLQA-----PASAVAADAVV  255

Query  441   AKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRI  262
             AKDGSGD+ ++ AA++AAP +S  R VIYIKAG+Y E V+V KK   +MFVGDGIGKT I
Sbjct  256   AKDGSGDYTTVAAAVAAAPTNSKKRHVIYIKAGAYMENVEVGKKHVNLMFVGDGIGKTVI  315

Query  261   KGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSF  82
             K +RN+ DG+ TFR+ATVAV G+ F+A+ ++ EN AGP  HQAVALR  +D S FY CSF
Sbjct  316   KASRNVVDGYTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSF  375

Query  81    VGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VGYQDTLYVHS RQFFR+CDVYGT+DF
Sbjct  376   VGYQDTLYVHSLRQFFRDCDVYGTIDF  402



>ref|XP_006396439.1| hypothetical protein EUTSA_v10029374mg [Eutrema salsugineum]
 gb|ESQ37892.1| hypothetical protein EUTSA_v10029374mg [Eutrema salsugineum]
Length=534

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 160/351 (46%), Positives = 227/351 (65%), Gaps = 29/351 (8%)
 Frame = -3

Query  1008  STLVKTPDL-RAKSIPEIISATVNVTVSEIKTAAANCSRIR-RVVPDLGTMERRALHVCL  835
             STL KT     + +I E++ AT+N T+S++  +++N S ++ R+  ++   +R A   CL
Sbjct  37    STLHKTQRFASSDNITELVVATLNQTISKVNLSSSNFSHLQNRLGSNISHRDRCAFQDCL  96

Query  834   ELFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGF--------PNSNKN  679
             EL  D + DL T +  L + P   H ++  LLS  MTN  TCLDGF         NSN +
Sbjct  97    ELLDDTVYDLTTAISELRSLPPVLH-NVNMLLSAVMTNTRTCLDGFYSSDDEDDENSNND  155

Query  678   VRPFII-----KRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSR  514
              + + +     + +  ISR+V  +L+ML       +N   +   +  + +K  FP W+S 
Sbjct  156   NKIYGVAESMKESLLNISRNVRESLAML------DENIPGNIPGKLEKDVK--FPMWVSG  207

Query  513   RDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYY  334
              DR LL+ P+     ++ KA++VVA++G+G+F +I AA+SAAP+SS+TRFVIYI  G Y+
Sbjct  208   SDRKLLQDPV-----NETKANIVVAQNGTGNFTTIGAAVSAAPNSSETRFVIYITCGVYF  262

Query  333   EYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYA  154
             E +++ ++KTMIMFVGDGIG+T +K NR+  DGW  F +ATV V GSGFIAK ISF N A
Sbjct  263   ENIEIPREKTMIMFVGDGIGRTILKANRSSADGWTAFNSATVGVRGSGFIAKDISFVNDA  322

Query  153   GPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             GP  HQAVALR+ SD S +Y CSF  YQDT+YVHS +QF+RECD+YGTVDF
Sbjct  323   GPTKHQAVALRSSSDLSAYYRCSFESYQDTIYVHSHKQFYRECDIYGTVDF  373



>ref|NP_192141.1| probable pectinesterase/pectinesterase inhibitor 40 [Arabidopsis 
thaliana]
 sp|O81301.1|PME40_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
40; Includes: RecName: Full=Pectinesterase inhibitor 40; AltName: 
Full=Pectin methylesterase inhibitor 40; Includes: RecName: 
Full=Pectinesterase 40; Short=PE 40; AltName: Full=Pectin 
methylesterase 40; Short=AtPME40; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC19272.1| T14P8.1 [Arabidopsis thaliana]
 emb|CAB80725.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AAY78786.1| pectinesterase family protein [Arabidopsis thaliana]
 gb|AEE82154.1| probable pectinesterase/pectinesterase inhibitor 40 [Arabidopsis 
thaliana]
Length=518

 Score =   287 bits (734),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 213/336 (63%), Gaps = 28/336 (8%)
 Frame = -3

Query  969  IPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMERRALHVCLELFSDALADLRTVL  793
            I E++   +N T+S +  +++N S + +R+  +L   +  A   CLEL  D + DL T +
Sbjct  37   ITELVVTALNQTISNVNLSSSNFSDLLQRLGSNLSHRDLCAFDDCLELLDDTVFDLTTAI  96

Query  792  DGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNK------------NVRPFIIKRVE  649
              L +   + H +++ LLS AMTN  TCLDGF +S+              V   + + + 
Sbjct  97   SKLRSHSPELH-NVKMLLSAAMTNTRTCLDGFASSDNDENLNNNDNKTYGVAESLKESLF  155

Query  648  QISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKK  469
             IS HVS++L+ML  I      +              GFP W+S  DR LL+ P+     
Sbjct  156  NISSHVSDSLAMLENIPGHIPGKVKEDV---------GFPMWVSGSDRNLLQDPV-----  201

Query  468  HDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFV  289
             + K ++VVA++G+G++ +I  A+SAAP+SS+TRFVIYIK G Y+E +++ ++KTMIMF+
Sbjct  202  DETKVNLVVAQNGTGNYTTIGEAISAAPNSSETRFVIYIKCGEYFENIEIPREKTMIMFI  261

Query  288  GDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSD  109
            GDGIG+T IK NR+  DGW  F +ATV V GSGFIAK +SF NYAGPE HQAVALR+ SD
Sbjct  262  GDGIGRTVIKANRSYADGWTAFHSATVGVRGSGFIAKDLSFVNYAGPEKHQAVALRSSSD  321

Query  108  YSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             S +Y CSF  YQDT+YVHS +QF+RECD+YGTVDF
Sbjct  322  LSAYYRCSFESYQDTIYVHSHKQFYRECDIYGTVDF  357



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   288 bits (737),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 168/404 (42%), Positives = 242/404 (60%), Gaps = 33/404 (8%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNAT---TSHDIHQVAHSACDHSLYRDLCVSTLVKTPDL  982
             +   +V++A  + +    SS  N+    TSH  H V  SAC  + Y DLC S +   P  
Sbjct  31    LFASLVIVAAIIGIVAGVSSRNNSDESDTSH--HAVVKSACSGTFYPDLCFSAVTTVPAG  88

Query  981   RAKSI---PEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMERRALHVCLELFSDA  817
              AK +    ++I  ++N+T + ++    N  +I++++   DL T E+ ALH CLE   + 
Sbjct  89    TAKKVRSQKDVIELSLNITTTAVE---HNYFKIKKLLARKDLTTREKTALHDCLETIDET  145

Query  816   LADLRTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIK  658
             L +L   ++ L   P K+    HAD L+TL+S AMTNQ TCLDGF +  ++K +R  +I 
Sbjct  146   LDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLID  205

Query  657   RVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD-----GFPKWLSRRDRALLE  493
               + + +  SNAL+M+  +  + D       +  NR LK+      +P+WLS  DR LL+
Sbjct  206   GEKYVEKMCSNALAMIKNMT-DTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQ  264

Query  492   APMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDK  313
             +         +  ++VVA DGSG+FK+++ A++ AP+ S  R++I IKAG Y E V+V K
Sbjct  265   SS-------SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPK  317

Query  312   KKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQA  133
             KK+ IMF+GDG  KT I G+RN+ DG  TF +ATVAV G  F+A+ I+F+N AGP  HQA
Sbjct  318   KKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLARDITFQNTAGPSKHQA  377

Query  132   VALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VALR  SD S FY+C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  378   VALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDF  421



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   288 bits (738),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 225/370 (61%), Gaps = 29/370 (8%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  889
             H V  SAC  + Y DLC S +   P    K  S  ++I+ ++N+TV+ ++    N   I 
Sbjct  94    HAVLKSACSSTRYPDLCYSAIATVPGASKKVTSQKDVIAVSLNITVTAVE---HNYFTIE  150

Query  888   RVV--PDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLSTA  730
             +++   +L   E+ ALH CLE   + L +L   +D L+  P K+    HAD L+TL+S A
Sbjct  151   KLLDFKNLTKREKAALHDCLETIDETLDELHVAMDDLDEYPDKKSLTQHADDLKTLMSAA  210

Query  729   MTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRE  556
             MTNQ TCLDGF   +++K+VR  ++K    +    SNAL+M   IK   D   +      
Sbjct  211   MTNQETCLDGFSHDDADKHVREVLLKGQRHVEHMCSNALAM---IKNMTDTDIAREREAM  267

Query  555   NRGL-----KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSA  391
             NR L     + G+PKWLS  DR LL++         +  D+VVA DGSGD+K+++AA++A
Sbjct  268   NRKLMEERDESGWPKWLSAGDRRLLQSS-------SVTPDVVVAADGSGDYKTVSAAVAA  320

Query  390   APDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTAT  211
             AP+ S  R++I IKAG Y E V+V KKKT IMF+GDG   T I G++N+ DG  TF +AT
Sbjct  321   APEKSSKRYIIGIKAGVYKENVEVGKKKTNIMFLGDGRSNTIITGSKNVVDGSTTFNSAT  380

Query  210   VAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFR  31
             VAV G  FIA+ I+F+N AGP  HQAVALR  SD S FY C  + YQDTLYVHS RQF+ 
Sbjct  381   VAVVGEKFIARDITFQNTAGPSKHQAVALRVGSDLSAFYKCDMLAYQDTLYVHSNRQFYI  440

Query  30    ECDVYGTVDF  1
              C V GTVDF
Sbjct  441   NCLVAGTVDF  450



>ref|XP_010462289.1| PREDICTED: pectinesterase 2 [Camelina sativa]
Length=584

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 174/422 (41%), Positives = 236/422 (56%), Gaps = 34/422 (8%)
 Frame = -3

Query  1185  SEMQNLGRNPIMLVPVVLLAPFLSLTVFQSSAMNA---------TTSHDIHQVAHSACDH  1033
             S+  +   N  +++    +A FL  TV   +A  +         T S   H V  S C  
Sbjct  9     SKFSDFKNNKKLILSSAAVALFLFATVVGVAATKSNQNKIQEITTLSSTSHAVLKSVCSS  68

Query  1032  SLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERR  853
             +LY +LC S +  T      S  ++I A++N+T   ++       ++      L   E  
Sbjct  69    TLYPELCFSAVAATGGKELASQKDVIEASLNLTTKAVRHNYFAVKKLITKRKGLTAREVT  128

Query  852   ALHVCLELFSDALADLRTVLDGLENSPA----KRHAD-LQTLLSTAMTNQYTCLDGFP--  694
             ALH CLE   + L +L   ++ L   P     ++HAD L+TL+S+A+TNQ TCLDGF   
Sbjct  129   ALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFSYD  188

Query  693   NSNKNVRPFIIKRVEQISRHVSNALSM---LTKIKKEKDNrfsssfrRENRGLKD-----  538
             N++K VR  ++K    +    SNAL+M   +T     K      S    NR LK+     
Sbjct  189   NADKQVRKALLKGQVHVEHMCSNALAMIKNMTDTDIAKFELIDKSSTPTNRKLKEITGEL  248

Query  537   ---GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTR  367
                G+P WLS  DR LL+          +KAD  VA DGSGDF++I AA++AAP+ S+ R
Sbjct  249   DGEGWPHWLSVGDRRLLQGST-------VKADATVAADGSGDFRTIVAAVTAAPEKSNKR  301

Query  366   FVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGF  187
             FVI+IKAG Y E V+V KKK  IMF+GDG GKT I  +RN+ DG  TF +ATVA  G  F
Sbjct  302   FVIHIKAGVYRENVEVTKKKKNIMFLGDGRGKTIITASRNVVDGSTTFHSATVAAVGERF  361

Query  186   IAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTV  7
             +A+ I+F+N AGP  HQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTV
Sbjct  362   LARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTV  421

Query  6     DF  1
             DF
Sbjct  422   DF  423



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 169/385 (44%), Positives = 226/385 (59%), Gaps = 48/385 (12%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI---RRVVPDL  871
             C+ +LY +LC+STL   PDL  KS+P++I  TVN T   +   + NCS     + + P  
Sbjct  49    CEGTLYPELCLSTLADIPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKYLTP--  106

Query  870   GTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHAD---------------LQTLLS  736
                +R A+  C+EL    + +L+     LE SPA    +               + T LS
Sbjct  107   --RDRLAISDCMELLDTTMDELQATTSDLE-SPAVAGGNNGSASMAAKRVTMDHVMTELS  163

Query  735   TAMTNQYTCLDGFP-NSNKNVRPFIIKRVEQISRHVSNALSMLTKI--------------  601
              AMTNQYTCLDGF     + VR ++   +  +SR VSN+L+M  K+              
Sbjct  164   AAMTNQYTCLDGFDYKDGERVRHYMESSIHHVSRMVSNSLAMAKKLPGAGGGGMTPSSSS  223

Query  600   -----KKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAK  436
                  + E               + +GFPKW+   DR LL+AP        I  D VVAK
Sbjct  224   PDTATQSESSETTQRQPFMGYGQMANGFPKWVRPGDRRLLQAP-----ASSITPDAVVAK  278

Query  435   DGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKG  256
             DGSG + +++AA++AAP +S+ R+VI+IKAG+Y E V+V K K  +MF+GDGIGKT IK 
Sbjct  279   DGSGGYTTVSAAVAAAPANSNKRYVIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTVIKA  338

Query  255   NRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVG  76
             +RN+ DG  TFR+ATVAV G+ F+A+ ++ EN AGP  HQAVALR  +D S FY CSFVG
Sbjct  339   SRNVVDGSTTFRSATVAVVGNNFLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVG  398

Query  75    YQDTLYVHSRRQFFRECDVYGTVDF  1
             YQDTLYVHS RQFFRECD+YGT+DF
Sbjct  399   YQDTLYVHSLRQFFRECDIYGTIDF  423



>ref|XP_010939846.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=591

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 167/391 (43%), Positives = 232/391 (59%), Gaps = 35/391 (9%)
 Frame = -3

Query  1092  AMNATTSHD---IHQVAHSACDHSLYRDLCVSTLVKTPDL-RAKSIP-EIISATVNVTVS  928
             A  A TSH+    H +  S+C  + Y DLC S +  TP L +  S P ++I A++N+T++
Sbjct  46    ARRAVTSHEPTVSHAILRSSCRSTRYPDLCYSAVAATPALIQTISKPKDVIHASINLTIT  105

Query  927   EIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDAL-------ADLRTVLDGLENSPA  769
              I+ +  +  R+    P+L T ER ALH CLE+F ++L       ADLR    G    P 
Sbjct  106   AIQRSFRHVERLSASYPNLTTRERTALHDCLEMFDESLDELNLTDADLRAYPAG---KPL  162

Query  768   KRHA-DLQTLLSTAMTNQYTCLDGFPNSN--KNVRPFIIKRVEQISRHVSNALSMLTKIK  598
             +RHA DL+ L+S AMTNQ +C DGF   +    +R  I   +  ++R   NAL+M+  + 
Sbjct  163   RRHALDLEILVSAAMTNQESCSDGFSYEDIEGRLRREIRSELTHVTRMCRNALAMIKNMI  222

Query  597   KEKDNrfsssfrRE----NRGLK--------DGFPKWLSRRDRALLEAPMGKGKKHDIKA  454
                     +    +    N+G +        +GFP W+ ++DR  L    G     +++ 
Sbjct  223   DADIAAAEAEAGADGGALNQGRRMSGFDVDEEGFPDWMEKKDRRRLLQAAG-----EVQV  277

Query  453   DMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIG  274
             + VVA DGSGD+K++  A++AAP  S TR+VI IKAG+Y E V+V KKKT +MF+GDG  
Sbjct  278   NAVVAADGSGDYKTVGEAVAAAPAKSTTRWVIRIKAGTYEENVEVPKKKTNLMFIGDGRT  337

Query  273   KTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFY  94
              T I G+RN+ DG  TF +AT+AV G+GF A+G+  EN AGP  HQAVALR  SD S FY
Sbjct  338   ATIITGSRNVMDGSTTFHSATLAVVGTGFQARGLRIENTAGPSKHQAVALRVSSDLSAFY  397

Query  93    DCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             DC  +GYQDTLY+HS R FFR C + GTVDF
Sbjct  398   DCDLIGYQDTLYLHSLRHFFRSCLIQGTVDF  428



>ref|XP_008800482.1| PREDICTED: pectinesterase-like isoform X1 [Phoenix dactylifera]
Length=585

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/382 (42%), Positives = 231/382 (60%), Gaps = 23/382 (6%)
 Frame = -3

Query  1092  AMNATTSHDI---HQVAHSACDHSLYRDLCVSTLVKTPDL-RAKSIP-EIISATVNVTVS  928
             A +A TSH+    H +  S+C  + Y DLC S +   P L +  S P ++I A++N+T++
Sbjct  46    ARHAVTSHEATVSHAILRSSCLSARYPDLCYSAVAANPALVQTISKPKDVIHASINLTIT  105

Query  927   EIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA----KRH  760
              I+ +  +  R+     +L T ER ALH CLE+F ++L +LR     L   PA    +RH
Sbjct  106   AIQRSFRHVERLSASHANLTTRERTALHDCLEMFDESLDELRLTDADLRAYPAGKPLRRH  165

Query  759   A-DLQTLLSTAMTNQYTCLDGF--PNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEK  589
             A DL+ L+S +MTNQ +C DGF   +  + +R  I+  +  ++    NAL+M+  +    
Sbjct  166   ALDLEILVSASMTNQESCSDGFSYEDVERRLRREILSGLTHVTHMCRNALAMIKNMIDAD  225

Query  588   DNrfsssfrRENRGL------KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGS  427
                   +     R +      ++GFP W+ ++DR  L    G     ++KA+ VVA DGS
Sbjct  226   IAAADVAADGRGRRMLGFDIDEEGFPDWMEKKDRRRLLQATG-----EVKANAVVAPDGS  280

Query  426   GDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRN  247
             GD+K++  A++AAP  S TR+VI I AG+Y E V+V KKKT +MF+G+G   T I G+RN
Sbjct  281   GDYKTVGEAVAAAPAKSKTRWVIQITAGTYEENVEVPKKKTNLMFIGEGRKTTIITGSRN  340

Query  246   MKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQD  67
             + DG  TFR+AT+AV G GF+A+G+  +N AGP  HQAVALR  SD S FYDC  +GYQD
Sbjct  341   VVDGSTTFRSATLAVVGEGFLARGLRIQNTAGPSKHQAVALRVGSDLSAFYDCDIIGYQD  400

Query  66    TLYVHSRRQFFRECDVYGTVDF  1
             TLY+HS R FFR C + GTVDF
Sbjct  401   TLYLHSLRHFFRSCLIQGTVDF  422



>ref|XP_010501045.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 166/378 (44%), Positives = 221/378 (58%), Gaps = 25/378 (7%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  S C  +LY DLC S +  T      S  ++I A++N+T   ++      
Sbjct  63    TLSSTSHAVLKSVCSSTLYPDLCFSAVAATGGKELASQKDVIEASLNLTTKAVRHNYFAV  122

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA----KRHAD-LQTLLS  736
              ++      L   E  ALH CLE+  + L  L   ++ L   P     ++HAD L+TL+S
Sbjct  123   KKLITKRKGLTAREVTALHDCLEMIDETLDGLHVAVEDLHQYPKQKSLRKHADDLKTLIS  182

Query  735   TAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSM---LTKIKKEKDNrfss  571
             +A+TNQ TCLDGF   N++K VR  ++K    +    SNAL+M   +T     K    + 
Sbjct  183   SAITNQGTCLDGFSYDNADKQVRKALLKGQVHVEHMCSNALAMIKNMTDTDIAKFELINK  242

Query  570   sfrRENRGLKD--------GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFK  415
             S    NR LK+        G+P WLS  +R LL+          + AD  VA DGSGDF+
Sbjct  243   SSTPTNRKLKEITGDLDSEGWPHWLSVGERRLLQGST-------VNADATVAADGSGDFR  295

Query  414   SINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDG  235
             +I AA++AAP+ S+ RFVI+IKAG Y E V+V KKK  IMF+GDG GKT I G+RN+ DG
Sbjct  296   TIVAAVAAAPEKSNKRFVIHIKAGVYRENVEVTKKKKNIMFLGDGRGKTIITGSRNVVDG  355

Query  234   WPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYV  55
               TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C  + YQDTLYV
Sbjct  356   STTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYV  415

Query  54    HSRRQFFRECDVYGTVDF  1
             HS RQFF +C + GTVDF
Sbjct  416   HSNRQFFVKCHIIGTVDF  433



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 167/404 (41%), Positives = 241/404 (60%), Gaps = 33/404 (8%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNAT---TSHDIHQVAHSACDHSLYRDLCVSTLVKTPDL  982
             +   +V++A  + +    SS  N+    TSH  H V  SAC  + Y DLC S +   P  
Sbjct  31    LFASLVIVAAIIGIVAGVSSRNNSDESDTSH--HAVVKSACSGTFYPDLCFSAVTTVPAG  88

Query  981   RAKSI---PEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMERRALHVCLELFSDA  817
              AK +    ++I  ++N+T + ++    N  +I++++   DL T E+ ALH CLE   + 
Sbjct  89    TAKKVRSQKDVIELSLNITTTAVE---HNYFKIKKLLARKDLTTREKTALHDCLETIDET  145

Query  816   LADLRTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIK  658
             L +L   ++ L   P K+    HAD L+TL+S AMTNQ TCLDGF +  ++K +R  +I 
Sbjct  146   LDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLID  205

Query  657   RVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD-----GFPKWLSRRDRALLE  493
               + + +  SNAL+M+  +  + D       +  NR LK+      +P+WLS  DR LL+
Sbjct  206   GEKYVEKMCSNALAMIKNMT-DTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQ  264

Query  492   APMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDK  313
             +         +  ++VVA DGSG+FK+++ A++ AP+ S  R++I IKAG Y E V+V K
Sbjct  265   SS-------SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPK  317

Query  312   KKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQA  133
             KK+ IMF+GDG  KT I G+RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQA
Sbjct  318   KKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQNTAGPSKHQA  377

Query  132   VALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VALR  SD S FY+C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  378   VALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDF  421



>ref|XP_010479961.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 220/378 (58%), Gaps = 25/378 (7%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  S C  +LY DLC S +  T      S  ++I A++N+T   ++      
Sbjct  63    TLSSTSHAVLKSVCSSTLYPDLCFSAVAATGGKELASQKDVIEASLNLTTKAVRHNYFAV  122

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA----KRHAD-LQTLLS  736
              ++      L   E  ALH CLE   + L +L   ++ L   P     ++HAD L+TL+S
Sbjct  123   KKLITKRKGLTAREVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLIS  182

Query  735   TAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSM---LTKIKKEKDNrfss  571
             +A+TNQ TCLDGF   N++K VR  ++K    +    SNAL+M   +T     K      
Sbjct  183   SAITNQGTCLDGFSYDNADKQVRKALLKGQVHVEHMCSNALAMIKNMTDTDIAKFELIDK  242

Query  570   sfrRENRGLKD--------GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFK  415
             S    NR LK+        G+P WLS  DR LL+          +KAD  VA DGSGDF+
Sbjct  243   SSTPTNRKLKEITGDLDGEGWPHWLSVGDRRLLQGST-------VKADATVAADGSGDFR  295

Query  414   SINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDG  235
             +I AA++AAP+ S+ RFVI+IKAG Y E V+V KKK  IMF+GDG GKT I  +RN+ DG
Sbjct  296   TIVAAVAAAPEKSNKRFVIHIKAGVYRENVEVTKKKKNIMFLGDGRGKTIITASRNVVDG  355

Query  234   WPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYV  55
               TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C  + YQDTLYV
Sbjct  356   STTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYV  415

Query  54    HSRRQFFRECDVYGTVDF  1
             HS RQFF +C + GTVDF
Sbjct  416   HSNRQFFVKCHIIGTVDF  433



>gb|AFI23415.1| pectin methylesterase [Coffea arabica]
Length=325

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 152/180 (84%), Gaps = 5/180 (3%)
 Frame = -3

Query  540  DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
            DGFP WL ++DRALL+AP+     +  K ++ VAKDGSG+F +INAAL AAP+SS TRFV
Sbjct  31   DGFPTWLKKKDRALLQAPL-----NQTKVNLTVAKDGSGNFTTINAALQAAPNSSTTRFV  85

Query  360  IYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIA  181
            IYIKAG+Y+EY++V++KKTMIMF+GDGIGKT IKGNR++  GW TFR++TVAV G GFIA
Sbjct  86   IYIKAGAYFEYIEVERKKTMIMFLGDGIGKTVIKGNRSVGAGWTTFRSSTVAVVGDGFIA  145

Query  180  KGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            +GI+ ENYAGP  HQAVALR+ SD S FY CSF+GYQDTLYVHS RQF+RECDVYGTVDF
Sbjct  146  RGITIENYAGPSQHQAVALRSGSDLSAFYQCSFIGYQDTLYVHSLRQFYRECDVYGTVDF  205



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 166/404 (41%), Positives = 241/404 (60%), Gaps = 33/404 (8%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNAT---TSHDIHQVAHSACDHSLYRDLCVSTLVKTPDL  982
             +   +V++A  + +    SS  N+    TSH  H +  SAC  + Y DLC S +   P  
Sbjct  31    LFASLVIVAAIIGIVAGVSSRNNSDESDTSH--HAIVKSACSGTFYPDLCFSAVATVPAG  88

Query  981   RAKSI---PEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMERRALHVCLELFSDA  817
              AK +    ++I  ++N+T + ++    N  +I++++   DL T E+ ALH CLE   + 
Sbjct  89    TAKKVRSQKDVIELSLNITTTAVE---HNYFKIKKLLARKDLTTREKTALHDCLETIDET  145

Query  816   LADLRTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIK  658
             L +L   ++ L   P K+    HAD L+TL+S AMTNQ TCLDGF +  ++K +R  +I 
Sbjct  146   LDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLID  205

Query  657   RVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD-----GFPKWLSRRDRALLE  493
               + + +  SNAL+M+  +  + D       +  NR LK+      +P+WLS  DR LL+
Sbjct  206   GEKYVEKMCSNALAMIKNMT-DTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQ  264

Query  492   APMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDK  313
             +         +  ++VVA DGSG+FK+++ A++ AP+ S  R++I IKAG Y E V+V K
Sbjct  265   SS-------SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYIENVEVPK  317

Query  312   KKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQA  133
             KK+ IMF+GDG  KT I G+RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQA
Sbjct  318   KKSNIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAAVGEKFLARDITFQNTAGPSKHQA  377

Query  132   VALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VALR  SD S FY+C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  378   VALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDF  421



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 168/404 (42%), Positives = 240/404 (59%), Gaps = 33/404 (8%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNAT---TSHDIHQVAHSACDHSLYRDLCVSTLVKTPDL  982
             +   +V++A  + +    SS  N+    TSH  H V  SAC  + Y DLC S +   P  
Sbjct  31    LFASLVIVAAIIGIVAGVSSRNNSDESDTSH--HAVVKSACSGTFYPDLCFSAVTAVPAG  88

Query  981   RAKSI---PEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMERRALHVCLELFSDA  817
              AK +    ++I  ++N T + ++    N  +I++++   DL T E+ ALH CLE   + 
Sbjct  89    TAKKVRSQKDVIELSLNTTTTAVE---HNYFKIKKLLARKDLTTREKTALHDCLETIDET  145

Query  816   LADLRTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIK  658
             L +L   ++ L   P K+    HAD L+TL+S AMTNQ TCLDGF +  ++K +R  +I 
Sbjct  146   LDELHEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHEGADKKIREVLID  205

Query  657   RVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD-----GFPKWLSRRDRALLE  493
               + + +  SNAL+M+  +  + D       +  NR LK+      +P+WLS  DR LL+
Sbjct  206   GEKYVEKMCSNALAMIKNMT-DTDIANEMMLKSSNRKLKEDESGIAWPEWLSAGDRRLLQ  264

Query  492   APMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDK  313
             +         +  ++VVA DGSG+FK+++ A++ AP+ S  R+ I IKAG Y E V+V K
Sbjct  265   SS-------SVTPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYTIRIKAGVYRENVEVPK  317

Query  312   KKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQA  133
             KK+ IMF+GDG  KT I G+RN+ DG  TF +ATVAV G  F+A+ I+F+N AGP  HQA
Sbjct  318   KKSSIMFIGDGRTKTIITGSRNVVDGSTTFHSATVAVVGEKFLAREITFQNTAGPSKHQA  377

Query  132   VALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VALR  SD S FY+C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  378   VALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDF  421



>emb|CDX98441.1| BnaC05g39340D [Brassica napus]
Length=572

 Score =   285 bits (729),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 220/367 (60%), Gaps = 14/367 (4%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  SAC  +LY +LC+S +     ++  S  ++I A++N+T + ++      
Sbjct  52    TLSPTSHAVLRSACSSTLYPELCISAVATAGGVKLMSQKDVIEASLNLTTTAVEHNYFGV  111

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLS  736
              ++ +    L   E+ ALH CLE   + L +L   L+ L   P K+    HA DL+TL+S
Sbjct  112   KKLIKNTKGLTPREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLIS  171

Query  735   TAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfr  562
             +A+TNQ TCLDGF +  ++K VR  ++K    +    SNAL+M+  +       F    +
Sbjct  172   SAITNQETCLDGFSHDAADKKVRKALLKGQMHVEHMCSNALAMIKNMTDTDIANFELKAK  231

Query  561   RENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPD  382
               +    DG+P WLS  DR LL+          +KAD  VA DGSG F +I+AA++AAP+
Sbjct  232   LTSNNRADGWPTWLSAGDRRLLQGST-------VKADATVAADGSGTFTTISAAVAAAPE  284

Query  381   SSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAV  202
             +S+ R+VI+IKAG Y E VDV KKK  IMF+GDG   T I  +RN+ DG  TF +ATVA 
Sbjct  285   NSNKRYVIHIKAGVYRENVDVAKKKKNIMFMGDGRTTTIITASRNVVDGSTTFHSATVAA  344

Query  201   GGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECD  22
              G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C  + YQDTLYVHS RQFF +C 
Sbjct  345   VGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCL  404

Query  21    VYGTVDF  1
             + GTVDF
Sbjct  405   IAGTVDF  411



>gb|AAC50023.1| ATPME2 precursor, partial [Arabidopsis thaliana]
Length=582

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 165/375 (44%), Positives = 224/375 (60%), Gaps = 28/375 (7%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             H +  S C  +LY +LC S +  T      S  E+I A++N+T   +K       ++   
Sbjct  54    HAILKSVCSSTLYPELCFSAVAATGGKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAK  113

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA----KRHAD-LQTLLSTAMTNQ  718
                L   E  ALH CLE   + L +L   ++ L   P     ++HAD L+TL+S+A+TNQ
Sbjct  114   RKGLTPREVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQ  173

Query  717   YTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKK------EKDNrfsssfr  562
              TCLDGF   ++++ VR  ++K    +    SNAL+M+  + +      E  ++F +  +
Sbjct  174   GTCLDGFSYDDADRKVRKALLKGQVHVEHMCSNALAMIKNMTETDIANFELRDKFFNLHQ  233

Query  561   RENRGLK--------DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSIN  406
             ++ R LK        DG+PKWLS  DR LL+          IKAD  VA DGSGDF + +
Sbjct  234   QQQRKLKEVTGDLDSDGWPKWLSVGDRRLLQGST-------IKADATVADDGSGDFDNGS  286

Query  405   AALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPT  226
             AA++AAP+ S+ RFVI+IKAG Y E V+V KKKT IMF+GDG GKT I G+RN+ DG  T
Sbjct  287   AAVAAAPEKSNKRFVIHIKAGVYRENVEVTKKKTNIMFLGDGRGKTIITGSRNVVDGSTT  346

Query  225   FRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSR  46
             F +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C    YQDTLYVHS 
Sbjct  347   FHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSN  406

Query  45    RQFFRECDVYGTVDF  1
             RQFF +C + GTVDF
Sbjct  407   RQFFVKCHITGTVDF  421



>ref|XP_006307088.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
 gb|EOA39986.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
Length=584

 Score =   284 bits (727),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 169/407 (42%), Positives = 234/407 (57%), Gaps = 35/407 (9%)
 Frame = -3

Query  1146  VPVVLLAPFLSLTVFQSSAMN----ATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLR  979
             + ++L A  + +   +S+        T S   H V  S C  +LY +LC S +  +    
Sbjct  27    IALILFATIVGVAATKSNQNKNQQITTISSTSHAVLKSVCSSTLYPELCYSAVAASGGKE  86

Query  978   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD---LGTMERRALHVCLELFSDALAD  808
               S  ++I A++N+T    K    N   +++++     L   E  ALH CLE   + L +
Sbjct  87    LTSHKDVIEASLNLTT---KAVTHNYFAVKKLITKRKGLTAREVTALHDCLETIDETLDE  143

Query  807   LRTVLDGLENSPA----KRHAD-LQTLLSTAMTNQYTCLDGFP--NSNKNVRPFIIKRVE  649
             L    + L   P     ++HAD L+TL+S+A+TNQ TCLDGF   N++K VR  ++K   
Sbjct  144   LHEAKEDLHMYPTQKSLRKHADDLKTLISSAITNQGTCLDGFSYDNADKKVRKALLKGQV  203

Query  648   QISRHVSNALSMLTKIK---------KEKDNrfsssfrRENRGLKDG--FPKWLSRRDRA  502
              +    SNAL+M+  +          ++K +  ++    E  G  DG  +P WLS  DR 
Sbjct  204   HVEHMCSNALAMIKNMTDTDIANFELRDKSSTSNNRKLMEITGDLDGEGWPHWLSVGDRR  263

Query  501   LLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVD  322
             LL+          +KAD  VA DGSGDFK+I AA++AAP+ S  RFVI+IKAG Y E V+
Sbjct  264   LLQGST-------VKADATVAADGSGDFKTIVAAVAAAPEKSSKRFVIHIKAGVYRENVE  316

Query  321   VDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPEN  142
             V KKK  IMF+GDG GKT I  +RN+ DG  TF +ATVA  G GF+A+ I+F+N AGP  
Sbjct  317   VSKKKKNIMFLGDGRGKTIITASRNVVDGSTTFHSATVAAVGEGFLARDITFQNTAGPSK  376

Query  141   HQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             HQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  377   HQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIVGTVDF  423



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 172/376 (46%), Positives = 228/376 (61%), Gaps = 34/376 (9%)
 Frame = -3

Query  1065  IHQVAHSACDHSLYRDLCVSTLVKTPDL--RAKSIPEIISATVNVTVSEIKTAAANCSRI  892
              H V  SAC  +LY +LC S+L   P    +A S  ++I A +N++++  + A     ++
Sbjct  41    FHAVVKSACSSTLYPELCFSSLSAFPAAAEKASSQKDVIEAALNLSITAGEHAYFKLKKL  100

Query  891   --RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLST  733
               R+   D+   E  ALH CLEL  + L +LR   + LE  P+K+    HA DL+TLLS 
Sbjct  101   YGRK---DVLEAEHTALHDCLELVDETLDELRKTDEELELYPSKKSISDHASDLKTLLSG  157

Query  732   AMTNQYTCLDGFPN-SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRE  556
             AMTNQ TCLDGF +     VR  I      + + +SNAL+M   IK   D   ++     
Sbjct  158   AMTNQETCLDGFSHIKGGGVRKIISGGCVYVEKLISNALAM---IKNMTDTDMAAERSAA  214

Query  555   NRGLK-----------DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSI  409
              R L+           DGFP W+S  DR LL++         +  ++VVA DGSGDFK++
Sbjct  215   GRKLEENNLPESFAGEDGFPAWMSAGDRRLLQSS-------SVTPNVVVAADGSGDFKTV  267

Query  408   NAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWP  229
              AA++AAP+ S  R+VI IKAG Y E V+V KKKT IMF+GDG  KT I G++N+KDG  
Sbjct  268   AAAVAAAPEKSSKRYVIRIKAGVYRENVEVPKKKTNIMFLGDGRMKTIITGSKNVKDGST  327

Query  228   TFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHS  49
             TFR+ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C  + YQDTLYVHS
Sbjct  328   TFRSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYRCDMIAYQDTLYVHS  387

Query  48    RRQFFRECDVYGTVDF  1
              RQF+REC +YGTVDF
Sbjct  388   LRQFYRECFIYGTVDF  403



>ref|XP_006360163.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Solanum tuberosum]
Length=595

 Score =   282 bits (722),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 158/397 (40%), Positives = 230/397 (58%), Gaps = 20/397 (5%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATTSH-DIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             +L+    ++  + +TV  ++   AT  H    Q     C  + +  LC+++L + P    
Sbjct  43    ILIIASAISAAVVVTVRSTTKTGATVRHIKPSQAISRTCSRTRFPTLCLNSLHEFPGALT  102

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDAL----AD  808
              S  E++  +VN T+     A    S I  +V D  T  R A   CLEL  D++      
Sbjct  103   ASDAELVHISVNATLQRFGRAFYMASDINSLVMDKRT--RSAYESCLELLEDSVYLLSRS  160

Query  807   LRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVS  628
             L +V  G   SP   + D+QT LS A+TNQ TC +GF + + NV+  +   ++ +S+ VS
Sbjct  161   LTSVAPGAGKSPPGNNNDVQTWLSAALTNQDTCTEGFADVSGNVKDQMATNLKDLSQLVS  220

Query  627   NALSMLTKIKKEKDNrfsssfrRENRGL-------KDGFPKWLSRRDRALLEAPMGKGKK  469
             N L++   +    D        R  R +        + FPKWLSR+DR LL+AP+     
Sbjct  221   NCLAIFAAVNGNDDFAGVPIHNRRRRLMSTVASAKNENFPKWLSRKDRKLLDAPVST---  277

Query  468   HDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYE-YVDVDKKKTMIMF  292
               I+ADM+V+KDG+G FK+I  A+   PD S  R +IY+KAG Y E  + V +KKT +MF
Sbjct  278   --IQADMIVSKDGNGTFKTIAEAIKKLPDYSSRRIIIYVKAGRYEEDILKVGRKKTNVMF  335

Query  291   VGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADS  112
             +GDG G+T I G +++     TF TA+ A  G+GFIA+ I+F+N+AGP  HQAVALR  +
Sbjct  336   IGDGKGQTMISGGKSVSQNLTTFHTASFAATGAGFIARDITFQNWAGPGKHQAVALRIGA  395

Query  111   DYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             D++V Y C+ +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  396   DHAVIYRCNIIGYQDTLYVHSQRQFYRECDIYGTVDF  432



>ref|XP_009146386.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Brassica 
rapa]
Length=592

 Score =   281 bits (720),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 162/388 (42%), Positives = 223/388 (57%), Gaps = 36/388 (9%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  SAC  +LY +LC+S +     ++  S  ++I A++N+T + ++      
Sbjct  52    TLSPTSHAVLRSACSSTLYPELCISAVATAGGVKLTSQKDVIEASLNLTTTAVEHNYFGV  111

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLS  736
              ++ +    L   E+ ALH CLE   + L +L   L+ L   P K+    HA DL+TL+S
Sbjct  112   KKLIKKTKGLTPREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLIS  171

Query  735   TAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLT---------------  607
             +A+TNQ TCLDGF +  ++K VR  ++K    +    SNAL+M+                
Sbjct  172   SAITNQETCLDGFSHDAADKKVRKALLKGQMHVEHMCSNALAMIKNMTDTDIANFELKAK  231

Query  606   ------KIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMV  445
                   K+K+E+             G  DG+P WLS  DR LL+          +KAD  
Sbjct  232   LSSNNRKLKEEETTVAVDIAGAGELG-ADGWPTWLSAGDRRLLQGST-------VKADAT  283

Query  444   VAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTR  265
             VA DGSG F +I+AA++AAP++S+ R+VI+IKAG Y E VDV KKK  IMF+GDG   T 
Sbjct  284   VAADGSGTFTTISAAVAAAPENSNKRYVIHIKAGVYRENVDVAKKKKNIMFMGDGRTTTI  343

Query  264   IKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCS  85
             I  +RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C 
Sbjct  344   ITASRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCD  403

Query  84    FVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              + YQDTLYVHS RQFF +C + GTVDF
Sbjct  404   MLAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>emb|CDX97564.1| BnaA05g25150D [Brassica napus]
Length=592

 Score =   281 bits (720),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 162/388 (42%), Positives = 223/388 (57%), Gaps = 36/388 (9%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  SAC  +LY +LC+S +     ++  S  ++I A++N+T + ++      
Sbjct  52    TLSPTSHAVLRSACSSTLYPELCISAVATAGGVKLTSQKDVIEASLNLTTTAVEHNYFGV  111

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLS  736
              ++ +    L   E+ ALH CLE   + L +L   L+ L   P K+    HA DL+TL+S
Sbjct  112   KKLIKKTKGLTPREKTALHDCLETIDETLDELHEALEDLHMYPNKKSLREHAGDLKTLIS  171

Query  735   TAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLT---------------  607
             +A+TNQ TCLDGF +  ++K VR  ++K    +    SNAL+M+                
Sbjct  172   SAITNQETCLDGFSHDAADKKVRKALLKGQMHVEHMCSNALAMIKNMTDTDIANFELKAK  231

Query  606   ------KIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMV  445
                   K+K+E+             G  DG+P WLS  DR LL+          +KAD  
Sbjct  232   LSSNNRKLKEEETTVAVDIAGAGELG-ADGWPTWLSAGDRRLLQGST-------VKADAT  283

Query  444   VAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTR  265
             VA DGSG F +I+AA++AAP++S+ R+VI+IKAG Y E VDV KKK  IMF+GDG   T 
Sbjct  284   VAADGSGTFTTISAAVAAAPENSNKRYVIHIKAGVYRENVDVAKKKKNIMFMGDGRTTTI  343

Query  264   IKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCS  85
             I  +RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C 
Sbjct  344   ITASRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCD  403

Query  84    FVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              + YQDTLYVHS RQFF +C + GTVDF
Sbjct  404   MLAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score =   281 bits (719),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 163/405 (40%), Positives = 239/405 (59%), Gaps = 28/405 (7%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATTSH-DI-------HQVAHSACDHSLYRDLCVSTLV  997
             ++  V+L+A  + +     S  N +  H DI       H +  SAC+++L+ +LC ST+ 
Sbjct  31    VVASVLLVAAVIGVVAGVKSRSNNSNDHADIQAITSAAHAIVKSACENTLHPELCYSTIA  90

Query  996   KTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFS  823
                D   K  S  ++I  ++N+T   ++       ++ +    L   E+ ALH CLE   
Sbjct  91    SVSDFSKKVTSQKDVIELSLNITCKAVQHNFFTVEKLIKTRKGLTPREKVALHDCLETID  150

Query  822   DALADLRTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFP--NSNKNVRPFI  664
             + L +L T +D LE  P K+    HAD L+TL+S+A+TNQ TCLDGF   +++K VR  +
Sbjct  151   ETLDELHTAIDDLELYPNKKSLKDHADDLKTLISSAITNQETCLDGFSHDDADKKVRKAL  210

Query  663   IKRVEQISRHVSNALSMLTKIK-KEKDNrfsssfrRENRGLKDG---FPKWLSRRDRALL  496
             +K  + + +  SNAL+M+  +   +  N         NR L++    +P+WLS  DR +L
Sbjct  211   LKGQKHVEKMCSNALAMICNMTDTDIANEMKLKGTTTNRKLREDNSEWPEWLSAGDRRML  270

Query  495   EAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVD  316
             ++         +  D+VVA DGSG+F++++ A++ AP+ S  R+VI IKAG Y E VDV 
Sbjct  271   QSST-------VSPDVVVAADGSGNFRTVSEAVAKAPEKSSKRYVIRIKAGVYRENVDVP  323

Query  315   KKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQ  136
             KKKT IMF+GDG   T I G+RN+KDG  TF +ATVA  G  F+A+ I+F+N AG   HQ
Sbjct  324   KKKTNIMFMGDGRSNTIITGSRNVKDGSTTFNSATVAAVGEKFLARDITFQNTAGAAKHQ  383

Query  135   AVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR  SD S FY C  + YQD+LYVHS RQ+F +C + GTVDF
Sbjct  384   AVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDF  428



>ref|NP_175786.1| pectin methylesterase 2 [Arabidopsis thaliana]
 sp|Q42534.2|PME2_ARATH RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase 2; Short=AtPME2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02856.1|AC009324_5 pectinesterase 2 [Arabidopsis thaliana]
 gb|AAK32805.1|AF361637_1 At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AAM91439.1| At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AEE33007.1| pectin methylesterase 2 [Arabidopsis thaliana]
Length=587

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 168/381 (44%), Positives = 224/381 (59%), Gaps = 28/381 (7%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H +  S C  +LY +LC S +  T      S  E+I A++N+T   +K      
Sbjct  53    TLSSTSHAILKSVCSSTLYPELCFSAVAATGGKELTSQKEVIEASLNLTTKAVKHNYFAV  112

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA----KRHAD-LQTLLS  736
              ++      L   E  ALH CLE   + L +L   ++ L   P     ++HAD L+TL+S
Sbjct  113   KKLIAKRKGLTPREVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLIS  172

Query  735   TAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKK------EKDNr  580
             +A+TNQ TCLDGF   ++++ VR  ++K    +    SNAL+M+  + +      E  ++
Sbjct  173   SAITNQGTCLDGFSYDDADRKVRKALLKGQVHVEHMCSNALAMIKNMTETDIANFELRDK  232

Query  579   fsssfrRENRGLK--------DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSG  424
              S+     NR LK        DG+PKWLS  DR LL+          IKAD  VA DGSG
Sbjct  233   SSTFTNNNNRKLKEVTGDLDSDGWPKWLSVGDRRLLQGST-------IKADATVADDGSG  285

Query  423   DFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNM  244
             DF ++ AA++AAP+ S+ RFVI+IKAG Y E V+V KKKT IMF+GDG GKT I G+RN+
Sbjct  286   DFTTVAAAVAAAPEKSNKRFVIHIKAGVYRENVEVTKKKTNIMFLGDGRGKTIITGSRNV  345

Query  243   KDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDT  64
              DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C    YQDT
Sbjct  346   VDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDT  405

Query  63    LYVHSRRQFFRECDVYGTVDF  1
             LYVHS RQFF +C + GTVDF
Sbjct  406   LYVHSNRQFFVKCHITGTVDF  426



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score =   280 bits (715),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 156/367 (43%), Positives = 224/367 (61%), Gaps = 20/367 (5%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +  SAC+++L+ +LC ST+    D   K  S  ++I  ++N+T   ++       ++ 
Sbjct  59    HAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNFFKVEKLI  118

Query  888   RVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLSTAMT  724
             +    L   E+ ALH CLE   + L +L T +  LE  P K+    HAD L+TL+S+A+T
Sbjct  119   KTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKTLISSAIT  178

Query  723   NQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIK-KEKDNrfsssfrREN  553
             NQ TCLDGF   +++K VR  ++K  + + +  SNAL+M+  +   +  N         N
Sbjct  179   NQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTTTN  238

Query  552   RGLKDG---FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPD  382
             R L++    +P+WLS  DR LL++         ++ D+VVA DGSG+FK+++ A++ AP+
Sbjct  239   RKLREDNSEWPEWLSAGDRRLLQSST-------VRPDVVVAADGSGNFKTVSEAVAKAPE  291

Query  381   SSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAV  202
              S  R+VI IKAG Y E VDV KKKT IMF+GDG   T I G+RN+KDG  TF +ATVA 
Sbjct  292   KSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAA  351

Query  201   GGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECD  22
              G  F+A+ I+F+N AG   HQAVALR  SD S FY C  + YQD+LYVHS RQ+F +C 
Sbjct  352   VGEKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCL  411

Query  21    VYGTVDF  1
             + GTVDF
Sbjct  412   IAGTVDF  418



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 156/367 (43%), Positives = 224/367 (61%), Gaps = 20/367 (5%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +  SAC+++L+ +LC ST+    D   K  S  ++I  ++N+T   ++       ++ 
Sbjct  69    HAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNFFKVEKLI  128

Query  888   RVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLSTAMT  724
             +    L   E+ ALH CLE   + L +L T +  LE  P K+    HAD L+TL+S+A+T
Sbjct  129   KTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADDLKTLISSAIT  188

Query  723   NQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIK-KEKDNrfsssfrREN  553
             NQ TCLDGF   +++K VR  ++K  + + +  SNAL+M+  +   +  N         N
Sbjct  189   NQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTTTN  248

Query  552   RGLKDG---FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPD  382
             R L++    +P+WLS  DR LL++         ++ D+VVA DGSG+FK+++ A++ AP+
Sbjct  249   RKLREDNSEWPEWLSAGDRRLLQSST-------VRPDVVVAADGSGNFKTVSEAVAKAPE  301

Query  381   SSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAV  202
              S  R+VI IKAG Y E VDV KKKT IMF+GDG   T I G+RN+KDG  TF +ATVA 
Sbjct  302   KSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAA  361

Query  201   GGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECD  22
              G  F+A+ I+F+N AG   HQAVALR  SD S FY C  + YQD+LYVHS RQ+F +C 
Sbjct  362   VGEKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCL  421

Query  21    VYGTVDF  1
             + GTVDF
Sbjct  422   IAGTVDF  428



>ref|XP_004240956.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Solanum lycopersicum]
Length=595

 Score =   280 bits (715),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 154/379 (41%), Positives = 221/379 (58%), Gaps = 20/379 (5%)
 Frame = -3

Query  1098  SSAMNATTSH-DIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEI  922
             ++   AT +H    Q     C  + ++ LC+++L + P     S  E++  +VN T+   
Sbjct  61    TTKTGATVTHIKPSQAISRTCSRTRFKTLCLNSLHEFPGALTASDAELVHISVNATLQRF  120

Query  921   KTAAANCSRIRRVVPDLGTMERRALHVCLELFSDAL----ADLRTVLDGLENSPAKRHAD  754
               A    S I  +V D  T  R A   C+EL  D++      L +V  G   SP   + D
Sbjct  121   GRAFYMASDINSLVMDKHT--RSAYESCIELLEDSVYLLSRSLTSVAPGAGESPPGNNND  178

Query  753   LQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKD----  586
             +QT LS A+TNQ TC +GF +   NV+  +   ++ +S+ VSN L++   +    D    
Sbjct  179   VQTWLSAALTNQDTCTEGFADVRGNVKDQMATNLKDLSQLVSNCLAIFAAVNGNDDFAGV  238

Query  585   ---NrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFK  415
                NR        +    + FPKWLSR+DR LL AP+       I+ADM+V+KDG+G FK
Sbjct  239   PIHNRRRRLMSTVSSAKNENFPKWLSRKDRKLLNAPVST-----IQADMIVSKDGNGTFK  293

Query  414   SINAALSAAPDSSDTRFVIYIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKD  238
             +I  A+   PD S  R +IY+KAG Y E  + V +KKT +MF+GDG G+T I G +++  
Sbjct  294   TIAEAIKKLPDYSSRRIIIYVKAGRYEEDILKVGRKKTNVMFIGDGKGQTVISGGKSVSQ  353

Query  237   GWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLY  58
                TF TA+ A  G+GFIA+ I+F+N+AGP  HQAVALR  +D++V Y C+ +GYQDTLY
Sbjct  354   NLTTFHTASFAATGAGFIARDITFQNWAGPGKHQAVALRIGADHAVIYRCNIIGYQDTLY  413

Query  57    VHSRRQFFRECDVYGTVDF  1
             VHS+RQF+RECD+YGTVDF
Sbjct  414   VHSQRQFYRECDIYGTVDF  432



>emb|CDY52779.1| BnaCnng23240D [Brassica napus]
Length=556

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/335 (47%), Positives = 214/335 (64%), Gaps = 24/335 (7%)
 Frame = -3

Query  972  SIPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMERRALHVCLELFSDALADLRTV  796
            SI E+I AT+N T+  +  +  +   + +R+ P++    R A   CL L  D +++L T 
Sbjct  74   SITELIVATLNQTILNVNVSYTSFFNLQKRLGPNIAHRYRCAFEDCLGLLDDTISNLETA  133

Query  795  LDGLENSPAKRHADLQTLLSTAMTNQYTCLDGF------PNSNKNVRPF--IIK-RVEQI  643
            +  L+ S    H D+  LLS AMTNQ TCL+GF       N+N N      I+K  + +I
Sbjct  134  IFKLQTSSVGTH-DVNMLLSDAMTNQDTCLEGFTTSGIHENNNDNTYKLTDILKDSILKI  192

Query  642  SRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHD  463
            S ++S++L ML KI + K ++ +     E       FP W+   D+  L AP+      +
Sbjct  193  SSNLSDSLGMLQKIPRHKHSKEAYEVDVE-------FPSWVLENDKRRLHAPV-----KE  240

Query  462  IKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGD  283
            IK +++VA+DG+G+F +INAA+SAAP+SS TRFVIYIK G Y+E V++  KKTMIMFVGD
Sbjct  241  IKFNLMVAQDGTGNFTTINAAVSAAPNSSATRFVIYIKRGVYFENVEIPNKKTMIMFVGD  300

Query  282  GIGKTRIKGNR-NMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDY  106
            G G+T IK NR +   G  T++TATV V G GFIAK ISF N+AGP   QAVA R+ S++
Sbjct  301  GTGRTVIKANRYSTPHGRTTYQTATVGVKGEGFIAKDISFVNFAGPFKGQAVAFRSGSNH  360

Query  105  SVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            S FY CSF GYQDTLYVHS  QF+RECD+YGT+DF
Sbjct  361  SAFYRCSFEGYQDTLYVHSAEQFYRECDIYGTIDF  395



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 161/401 (40%), Positives = 234/401 (58%), Gaps = 27/401 (7%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             ++L  ++L+   +++    +S  N + +   H +  S+C  +LY +LC S +   P   +
Sbjct  30    VILASLLLVTTIIAIATGVNSHRN-SKNEGTHAILKSSCSSTLYPELCYSAVATVPGATS  88

Query  975   K--SIPEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMERRALHVCLELFSDALAD  808
                S  ++I  ++N+T    K    N   + +++    L   E+ ALH CLE+  + L +
Sbjct  89    NLASQKDVIELSINLTT---KAVQHNFFTVEKLIATKKLSKREKTALHDCLEIIDETLDE  145

Query  807   LRTVLDGLENSPA----KRHAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVE  649
             L   L  L   P     K+HAD L+TLLS+A+TNQ TCLDGF +  ++K VR  ++K   
Sbjct  146   LHEALVDLNEYPNNKSLKKHADDLKTLLSSAITNQETCLDGFSHDEADKKVRKALLKGQI  205

Query  648   QISRHVSNALSML-----TKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPM  484
              + +  SN L+M+     T +  E         ++E  G +  +P+W+S  DR LL++  
Sbjct  206   HVEKMCSNVLAMIKNMTDTDVANELKITNRKLMQQEKEGNESEWPEWMSVADRRLLQSS-  264

Query  483   GKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKT  304
                    +  D+VVA DGSG++K+++AA++AAP  S  R++I IKAG Y E VDV K KT
Sbjct  265   ------SVTPDVVVAADGSGNYKTVSAAVAAAPKKSSKRYIIRIKAGVYRENVDVPKDKT  318

Query  303   MIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVAL  124
              IMF+GDG   T I  +RN+ DG  TF +ATVA  G GF+A+GI+F+N AGP  HQAVAL
Sbjct  319   NIMFMGDGRKTTIITASRNVVDGSTTFNSATVAAVGQGFLARGITFQNTAGPSKHQAVAL  378

Query  123   RADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             R  SD S FYDC  + YQDTLYVHS RQFF  C + GTVDF
Sbjct  379   RVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCFIAGTVDF  419



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/399 (41%), Positives = 233/399 (58%), Gaps = 25/399 (6%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATT-SHDIHQVAHSACDHSLYRDLCVSTLVKTPDL--  982
             ++   +L+A  + +    +S  N++      H +  S+C  +LY DLC S +   P    
Sbjct  31    LIASFLLVASVIGIVAGVASRKNSSKIPSSAHAILKSSCSSTLYPDLCYSAIATVPGAAD  90

Query  981   RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMERRALHVCLELFSDALAD  808
                +  ++I  ++N+T + ++    N   I++++    L   E+ ALH CLE+  + L +
Sbjct  91    NLSTQKDVIEISLNITTTAVE---HNYFTIKKLLAHEKLTEREKTALHDCLEMVDETLDE  147

Query  807   LRTVLDGLENSPAKR----HA-DLQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVE  649
             L    + L+  P K+    HA DL+ LLS AMTNQ TC+DGF +  ++K VR  ++K  E
Sbjct  148   LHETAEDLKQYPNKKSLDEHAEDLKILLSAAMTNQDTCIDGFSHEQADKEVRNALLKGQE  207

Query  648   QISRHVSNALSM---LTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGK  478
              +    SNAL+M   +T     ++         E+ G  DGFP WLS  DR LL+A    
Sbjct  208   HVYHMCSNALAMIKNMTDTDMAEEKLKMGRKLGESTGEIDGFPGWLSAGDRRLLQAST--  265

Query  477   GKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMI  298
                  +  D+ VA DGSG++K+++ A++AAP +S+ R++I IKAG Y E VDV KKK  I
Sbjct  266   -----VTPDVTVASDGSGNYKTVSEAVAAAPINSNKRYIIRIKAGVYKENVDVSKKKKNI  320

Query  297   MFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRA  118
             MFVGDG   T I G+RN+ DG  TF +ATVA  G GF+A+ I+F+N AGP  HQAVALR 
Sbjct  321   MFVGDGRKNTIITGSRNVVDGSTTFHSATVAAVGEGFLARDITFQNTAGPSKHQAVALRV  380

Query  117   DSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              SD S FY C  + YQDTLYVHS RQF+ +C + GTVDF
Sbjct  381   GSDKSAFYRCDMLAYQDTLYVHSLRQFYVDCLIVGTVDF  419



>ref|XP_009614734.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nicotiana tomentosiformis]
Length=585

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 160/398 (40%), Positives = 230/398 (58%), Gaps = 20/398 (5%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHD-IHQVAHSACDHSLYRDLCVSTLVKTPDLR  979
             I+   V+L+A  +S+ V      N+    D   Q     C  +LY  LC+++L+  P  +
Sbjct  32    IIFATVLLIASAISVAVLVGVRKNSGNRIDKPSQAMARTCSRTLYPSLCLNSLINYPGAK  91

Query  978   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDAL----A  811
             + S  +++  +VN+T+     A    S I  +   + T  R A   CLEL  +++     
Sbjct  92    SASDNDLVHISVNLTLQRFGKALYISSDINNL--QMNTQIRSAYDDCLELLEESVDLLSH  149

Query  810   DLRTVLDGLE--NSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISR  637
              L +V  G +  NSP     D+ T LS A+TNQ TC DGF +   NV+  + + ++ +S 
Sbjct  150   SLNSVFPGGDGSNSPTGSTHDVMTWLSAALTNQDTCTDGFADVTGNVKDQMSENLKDLSE  209

Query  636   HVSNALSMLTKIKKEKDNrfsssfrRENRGLK-----DGFPKWLSRRDRALLEAPMGKGK  472
              VSNAL++      + D        R  R +K     D FPKWLSRRDR LL   +    
Sbjct  210   LVSNALAIYAAANGDDDFSGIPIQNRRRRLMKFEKHHDDFPKWLSRRDRKLLNKSVSA--  267

Query  471   KHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYE-YVDVDKKKTMIM  295
                I+AD++VAKDGSG  K+I  A+   P+ S+ R +IY+KAG Y E  + V +KK  +M
Sbjct  268   ---IQADIIVAKDGSGTVKTIAEAIKKVPEKSNRRTIIYVKAGRYEEDNLKVGRKKMNVM  324

Query  294   FVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRAD  115
             F+GDG GKT I G +++     TF TA+ A  G+GF+A+ ++FENYAGP NHQAVALR  
Sbjct  325   FIGDGKGKTVITGGKSVAQHITTFHTASFAATGAGFVARDMTFENYAGPSNHQAVALRIG  384

Query  114   SDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              D++V + C+ +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  385   GDHAVVFRCNIIGYQDTLYVHSQRQFYRECDIYGTVDF  422



>ref|XP_004234960.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Solanum lycopersicum]
Length=583

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 159/398 (40%), Positives = 229/398 (58%), Gaps = 20/398 (5%)
 Frame = -3

Query  1155  IMLVP--VVLLAPFLSLTVFQSSAMNATTSHDI-HQVAHSACDHSLYRDLCVSTLVKTPD  985
             IML+   V+L+A  +S+ V       A    D   Q     C  +LY  LC+++L+  P 
Sbjct  30    IMLISATVLLIASAISVAVLIGVRHKAGNRIDKPSQAMARTCSRTLYPSLCLNSLINYPG  89

Query  984   LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDAL---  814
               + S  +++  +VN+T+          S I  +   + T  R A   CLEL  +++   
Sbjct  90    ANSASDSDLVHISVNLTLQRFGKGLYKASDINNL--QMNTQVRSAYDDCLELLEESVDLL  147

Query  813   -ADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISR  637
                L +V  G  +SP     D+ T LS A+TNQ TC DGF +   NV+  + + ++ +S 
Sbjct  148   SHSLDSVFSGDGDSPTGSTQDVMTWLSAALTNQDTCTDGFADVTGNVKDHMSENLKDLSE  207

Query  636   HVSNALSMLTKIKKEKDNrfsssfrRENRGLK-----DGFPKWLSRRDRALLEAPMGKGK  472
              VSNAL++ T    + D        R  R ++     D FPKW+SRRDR L+   +    
Sbjct  208   LVSNALAIYTAANGDDDFSGIPIQNRRRRLMEFETYHDEFPKWMSRRDRKLMNKSVST--  265

Query  471   KHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIM  295
                I+AD++VAKDGSG  K+I  A+   P+ S+ R +IY+KAG Y E  + V +KK  +M
Sbjct  266   ---IQADIIVAKDGSGTVKTIAEAIKKVPEKSNHRTIIYVKAGRYEENNLKVGRKKMNVM  322

Query  294   FVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRAD  115
             F+GDG GKT I G +++     TF TA+ A  G+GFIA+ ++FENYAGP NHQAVALR  
Sbjct  323   FIGDGKGKTVITGGKSVSQHLTTFHTASFAATGAGFIARDMTFENYAGPNNHQAVALRIG  382

Query  114   SDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              D++V + C+ +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  383   GDHAVVFRCNVIGYQDTLYVHSQRQFYRECDIYGTVDF  420



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 164/403 (41%), Positives = 240/403 (60%), Gaps = 32/403 (8%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             ++L  ++L+   +++ V   ++  ++ +   H +  S+C  +LY +LC S +   P   +
Sbjct  35    VILASLLLVTAIIAI-VAGVNSHKSSKNEGTHAILKSSCSSTLYPELCYSAVATVPGATS  93

Query  975   K--SIPEIISATVNVTVSEIKTAAANCSRIRRVVP--DLGTMERRALHVCLELFSDALAD  808
                S  ++I  ++N+T   ++    N   + +++    L   E+ ALH CLE+  + L +
Sbjct  94    NLASQKDVIELSINLTTKAVQ---HNFFTVEKLIATKKLTKREKTALHDCLEIIDETLDE  150

Query  807   LRTVLDGLENSP----AKRHAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVE  649
             L   L  L + P     K+HAD L+TLLS+A+TNQ TCLDGF +  ++K VR  ++K   
Sbjct  151   LHEALVDLNDYPNNKSLKKHADDLKTLLSSAITNQETCLDGFSHDEADKKVRKALLKGQI  210

Query  648   QISRHVSNALSMLTKIKKEKDNrfsssfrRENRGL---KDG----FPKWLSRRDRALLEA  490
              + +  SN L+M   IK   D   ++  +  NR L   K+G    +P+W+S  DR LL++
Sbjct  211   HVEKMCSNVLAM---IKNMTDTDVANELKTTNRKLMQEKEGNESEWPEWMSVADRRLLQS  267

Query  489   PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKK  310
                      +  D+VVA DGSG++K+++AA++AAP  S  R++I IKAG Y E VDV K 
Sbjct  268   S-------SVTPDVVVAADGSGNYKTVSAAVAAAPKKSSKRYIIRIKAGVYRENVDVPKD  320

Query  309   KTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAV  130
             KT IMF+GDG   T I  +RN+ DG  TF +ATVA  G GF+A+GI+F+N AGP  HQAV
Sbjct  321   KTNIMFMGDGRKTTIITASRNVVDGSTTFNSATVAAVGQGFLARGITFQNTAGPSKHQAV  380

Query  129   ALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR  SD S FYDC  + YQDTLYVHS RQFF  C V GTVDF
Sbjct  381   ALRVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCLVAGTVDF  423



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score =   278 bits (712),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 163/408 (40%), Positives = 240/408 (59%), Gaps = 31/408 (8%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTV-FQSSAMNATTSHDI-------HQVAHSACDHSLYRDLCVSTLV  997
             ++  V+L+A  + + +    S  N++    I       H +  S+C  +L++ LC ST+ 
Sbjct  32    LIASVLLIAAVIGVVIGVNYSRKNSSNQAQIQAISLATHTIVKSSCSITLHQQLCYSTIA  91

Query  996   KT-PDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELF  826
                P+   K  +  ++I  ++N+T   ++       ++ +    L   E+ ALH CLE  
Sbjct  92    NNIPNFSKKVTNQKDVIELSLNITTKAVQRNYYAIDKLIKTRKGLTEREKIALHDCLETI  151

Query  825   SDALADLRTVLDGLENSPA----KRHAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPF  667
              + + +L T ++ LE  P     ++HAD L+TL+S A+TNQ TCLDGF +  ++K VR  
Sbjct  152   DETIDELHTAVEDLEKYPNAKALRQHADDLKTLISAAITNQETCLDGFSHDEADKKVRKV  211

Query  666   IIKRVEQISRHVSNALSMLTKIKKE--KDNrfsssfrRENRGLKD----GFPKWLSRRDR  505
             ++K    + +  SNAL+M+  +     ++     S  + NR L +     +P+WLS  DR
Sbjct  212   LLKGQVYVEKLCSNALAMIKNMTDTDIQNEMKLGSSGKVNRKLNEESSGTWPEWLSTGDR  271

Query  504   ALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYV  325
              LL++P        + AD+VVA DGSGD+K++  A++ AP+ S  R+VI IKAG Y E V
Sbjct  272   RLLQSP-------SVTADVVVAADGSGDYKTVAEAVANAPEKSSKRYVIRIKAGVYKENV  324

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPE  145
             +V KKK  IMF+GDG   T I G+RN+KDG  TF +ATVA  G GF+A+ I+FEN AG E
Sbjct  325   EVSKKKKNIMFMGDGRENTIITGSRNVKDGSTTFHSATVAAVGEGFLARDITFENTAGHE  384

Query  144   NHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              HQAVALR  +D S FY C  +GYQDTLYVHS RQFF +C + GTVDF
Sbjct  385   KHQAVALRVGADLSAFYKCDMLGYQDTLYVHSNRQFFVQCFISGTVDF  432



>ref|XP_002891774.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68033.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   278 bits (711),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 174/424 (41%), Positives = 238/424 (56%), Gaps = 36/424 (8%)
 Frame = -3

Query  1185  SEMQNLGRNPIMLVPVVLLAPFLSLTVFQSSAMN--------ATTSHDIHQVAHSACDHS  1030
             S+  +   N  +++    +A  L  TV   +A           T S   H V  S C  +
Sbjct  9     SKFSDFKNNKKLILSSAAIALLLFATVVGIAATTNQNKNKKITTLSSTSHAVLKSVCSST  68

Query  1029  LYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRA  850
             LY +LC ST+  T   +  S  E+I A++N+T   +K       ++      L   E  A
Sbjct  69    LYPELCFSTVAATGGKQLTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTPREVTA  128

Query  849   LHVCLELFSDALADLRTVLDGLENSPA----KRHAD-LQTLLSTAMTNQYTCLDGFP--N  691
             LH CLE   + L +L   ++ +   P     ++HAD L+TL+S+A+TNQ TCLDGF   +
Sbjct  129   LHDCLETIDETLDELHVAVEDIHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFSYDD  188

Query  690   SNKNVRPFIIKRVEQISRHVSNALSMLTKIKK------EKDNrfsssfrRENRGLKD---  538
             +++ VR  ++K    +    SNAL+M+  + +      E  ++ SS     NR LK+   
Sbjct  189   ADRKVRKVLLKGQVHVEHMCSNALAMIKNMTETDIANFELRDKSSSFTNNNNRKLKEVTG  248

Query  537   -----GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSD  373
                  G+P WLS  DR LL+          IKAD  VA DGSGDF ++ AA++AAP+ S+
Sbjct  249   DLDSEGWPMWLSVGDRRLLQGST-------IKADATVAADGSGDFTTVAAAVAAAPEKSN  301

Query  372   TRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGS  193
              RFVI+IKAG Y E V+V KKK  IMF+GDG GKT I G+RN+ DG  TF +ATVA  G 
Sbjct  302   KRFVIHIKAGVYRENVEVTKKKKNIMFLGDGQGKTIITGSRNVVDGSTTFHSATVAAVGE  361

Query  192   GFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYG  13
              F+A+ I+F+N AGP  HQAVALR  SD+S FY C    YQDTLYVHS RQFF +C + G
Sbjct  362   NFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNRQFFVKCHITG  421

Query  12    TVDF  1
             TVDF
Sbjct  422   TVDF  425



>ref|XP_010925933.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Elaeis guineensis]
Length=587

 Score =   278 bits (711),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 153/382 (40%), Positives = 228/382 (60%), Gaps = 15/382 (4%)
 Frame = -3

Query  1122  FLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATV  943
             F  L  F++ +  +  +    Q     C  +LY  LC+S+L+  P        +++  ++
Sbjct  50    FGLLVGFRAGSSGSGRNRSPTQAISQTCGLTLYPALCISSLLDFPGAFDARDRDLVHISL  109

Query  942   NVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLR---TVLDGLENSP  772
             N+T+  +  A    S I  V  D   + R A   C+EL  D+L  L     V+    + P
Sbjct  110   NMTMQRVSKALYGASAIAGVSMD--ALARAAYEDCMELLEDSLDQLSESLAVVSPSASGP  167

Query  771   A-KRHADLQTLLSTAMTNQYTCLDGFPN-SNKNVRPFIIKRVEQISRHVSNALSMLTKIK  598
             A   + D+ T LS A+TNQ TC +G  + ++  VR  +  +++ ++  VSN L++ + + 
Sbjct  168   AGASNEDVLTWLSAALTNQDTCTEGLTDVADGYVRAQMQSKLKDLAELVSNCLAIFSAVS  227

Query  597   KEKDNrfsssfrRENRGLKDG---FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGS  427
             + KD        ++ R L  G   FP+WL RRDR LL+ P+ +     I+ADMVV+KDG+
Sbjct  228   RNKDFSGIPIKNKKRRLLSSGDGDFPEWLGRRDRKLLQVPVAQ-----IQADMVVSKDGN  282

Query  426   GDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRN  247
             G +KSI  A+ AAP+ S  R +IY+KAG Y E + V +KKT +MF+GDG GKT +  +R+
Sbjct  283   GTYKSIADAVKAAPERSTRRIIIYVKAGRYDENIKVSRKKTNLMFIGDGKGKTIVAASRS  342

Query  246   MKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQD  67
             + + + TF TAT A  G+GFI + ++ EN+AGP  HQAVALR  +D++V Y C+ +GYQD
Sbjct  343   VAENYTTFHTATFASTGNGFIMRDMTIENWAGPAKHQAVALRVGADHAVVYRCNIIGYQD  402

Query  66    TLYVHSRRQFFRECDVYGTVDF  1
             TLYVHS+RQFFRECDVYGTVDF
Sbjct  403   TLYVHSQRQFFRECDVYGTVDF  424



>ref|XP_010501842.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=592

 Score =   278 bits (710),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 159/383 (42%), Positives = 225/383 (59%), Gaps = 36/383 (9%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             H V  S+C  +LY +LC+S +     ++  S  ++I A++N+T + ++       ++ + 
Sbjct  56    HAVLRSSCSSTLYPELCISAVATAGGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKK  115

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLSTAMTNQ  718
                L   E+ ALH CLE   + L +L   ++ L   P K+    HA DL+TL+S+A+TNQ
Sbjct  116   RKGLTPREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLREHASDLKTLISSAITNQ  175

Query  717   YTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKE--KDNrfsssfrRENR  550
              TCLDGF   +++K VR  + K    +    SNAL+M+  +      +    +     NR
Sbjct  176   ETCLDGFSHDSADKEVRKALQKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAKITSNNR  235

Query  549   GLKD--------------------GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDG  430
              LK+                    G+P WLS  DR LL+   G G    ++AD  VA DG
Sbjct  236   KLKEESQETTVAVDIAGAGELDAEGWPTWLSAGDRRLLQ---GSG----VRADATVAADG  288

Query  429   SGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNR  250
             SG FK++ +A++AAP++S+ R+VI+IKAG Y E VDV KKK  IMF+GDG  +T I GNR
Sbjct  289   SGTFKTVASAVAAAPENSNKRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRTIITGNR  348

Query  249   NMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQ  70
             N+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C  + YQ
Sbjct  349   NVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQ  408

Query  69    DTLYVHSRRQFFRECDVYGTVDF  1
             DTLYVHS RQFF +C + GTVDF
Sbjct  409   DTLYVHSNRQFFVKCLIAGTVDF  431



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score =   277 bits (709),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 155/367 (42%), Positives = 223/367 (61%), Gaps = 20/367 (5%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +  SAC+++L+ +LC ST+    D   K  S  ++I  ++N+T   ++       ++ 
Sbjct  59    HAIVKSACENTLHPELCYSTIASVSDFSKKVTSQKDVIELSLNITCRAVQHNFFKVEKLI  118

Query  888   RVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLSTAMT  724
             +    L   E+ ALH CLE   + L +L T +  LE  P K+    HAD L+TL+S+A+T
Sbjct  119   KTRKGLKPREKVALHDCLETIDETLDELHTAIKDLELYPNKKSLKAHADGLKTLISSAIT  178

Query  723   NQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIK-KEKDNrfsssfrREN  553
             NQ TCLDGF   +++K VR  ++K  + + +  SNAL+M+  +   +  N         N
Sbjct  179   NQETCLDGFSHDDADKKVRKALLKGQKHVEKMCSNALAMICNMTDTDIANEQKLKGTTTN  238

Query  552   RGLKDG---FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPD  382
             R L++    +P+WL   DR LL++         ++ D+VVA DGSG+FK+++ A++ AP+
Sbjct  239   RKLREDNSEWPEWLPAGDRRLLQSST-------VRPDVVVAADGSGNFKTVSEAVAKAPE  291

Query  381   SSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAV  202
              S  R+VI IKAG Y E VDV KKKT IMF+GDG   T I G+RN+KDG  TF +ATVA 
Sbjct  292   KSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRSNTIITGSRNVKDGSTTFHSATVAA  351

Query  201   GGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECD  22
              G  F+A+ I+F+N AG   HQAVALR  SD S FY C  + YQD+LYVHS RQ+F +C 
Sbjct  352   VGEKFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCL  411

Query  21    VYGTVDF  1
             + GTVDF
Sbjct  412   IAGTVDF  418



>ref|XP_010422610.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40 
[Camelina sativa]
Length=523

 Score =   276 bits (705),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 155/342 (45%), Positives = 211/342 (62%), Gaps = 42/342 (12%)
 Frame = -3

Query  963  EIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMERRALHVCLELFSDALADLRTVLDG  787
            E++ A +N T+S++  +++N S +  R+  +L   +R A   CL+L  D + DL   +  
Sbjct  42   ELLVAALNQTISKVNLSSSNFSDLLNRLGSNLSHRDRCAFDDCLQLLDDTVFDLTAAISE  101

Query  786  LENSPAKRHADLQTLLSTAMTNQYTCLDGFP------------NSNK--NVRPFIIKRVE  649
            L +   + H +++ LLS  MTN  TCLDGF             N+NK   V   + + + 
Sbjct  102  LRSHSPEIH-NVKMLLSATMTNTRTCLDGFASSDDEEEDDLNYNNNKTYGVAESLKESLF  160

Query  648  QISRHVSNALSMLTKI------KKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAP  487
             IS HV N+L ML  I      K E+D                GFP W+S  DR LL+ P
Sbjct  161  DISSHVRNSLDMLEDIPGNIPGKLEEDV---------------GFPMWVSGSDRNLLQDP  205

Query  486  MGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKK  307
            +      + K D+VVA++G+G++ +I  A+SAAP+SSDTRFVIYIK+G Y+E +++ ++K
Sbjct  206  V-----DETKVDLVVAQNGTGNYTTIGEAVSAAPNSSDTRFVIYIKSGVYFENIEILREK  260

Query  306  TMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVA  127
            TMIMFVGDGIG T IK NR+  DGW  + +ATV V GSGFIAK +SF N AGP  HQAVA
Sbjct  261  TMIMFVGDGIGLTVIKANRSYGDGWTAYFSATVGVRGSGFIAKDLSFVNDAGPAKHQAVA  320

Query  126  LRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            LR+ SD S FY CSF  YQDT+Y HS +QF+RECD+YGTVDF
Sbjct  321  LRSSSDLSAFYRCSFESYQDTIYAHSHKQFYRECDIYGTVDF  362



>ref|XP_010465323.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Camelina 
sativa]
Length=592

 Score =   278 bits (710),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 159/389 (41%), Positives = 227/389 (58%), Gaps = 36/389 (9%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  S+C  +LY +LC+S +     ++  S  ++I A++N+T + ++      
Sbjct  50    TLSPSSHAVLRSSCSSTLYPELCISAVATAGGVKLTSQKDVIEASLNLTTTAVEHNYFTV  109

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR-----HADLQTLLS  736
              ++ +    L   E+ ALH CLE   + L +L   ++ L   P K+      ADL+TL+S
Sbjct  110   KKLIKKRKGLTPREKTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAADLKTLIS  169

Query  735   TAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLTKI---------KKEK  589
             +A+TNQ TCLDGF +  ++K VR  +      +    SNAL+M+  +         +K K
Sbjct  170   SAITNQETCLDGFSHDGADKQVRKALQMGQIHVEHMCSNALAMIKNMTDTDIANFEQKAK  229

Query  588   DNrfsssfrRENRGLK-------------DGFPKWLSRRDRALLEAPMGKGKKHDIKADM  448
                 +   + EN+                +G+P WLS  DR LL+   G G    ++AD 
Sbjct  230   ITSNNRKLKEENQETSVAVDIAGAGELDSEGWPTWLSAGDRRLLQ---GSG----VRADA  282

Query  447   VVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKT  268
              VA DGSG FK++ +A++AAP++S+ R+VI+IKAG Y E VDV KKK  IMF+GDG  +T
Sbjct  283   TVAADGSGKFKTVASAVAAAPENSNKRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRT  342

Query  267   RIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDC  88
              I GNRN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C
Sbjct  343   IITGNRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNC  402

Query  87    SFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               + YQDTLYVHS RQFF +C + GTVDF
Sbjct  403   DMLAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>ref|XP_006828588.1| hypothetical protein AMTR_s00129p00047530 [Amborella trichopoda]
 gb|ERM96004.1| hypothetical protein AMTR_s00129p00047530 [Amborella trichopoda]
Length=535

 Score =   276 bits (706),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 148/343 (43%), Positives = 204/343 (59%), Gaps = 21/343 (6%)
 Frame = -3

Query  990  PDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALA  811
            PD     + +  + T+  T+SEI+ A +  S+    +P+    +R A+  C++L   +  
Sbjct  39   PDCTTSQL-DTFATTLKTTLSEIQKALSLLSKFTEFIPNF--RQRTAIQDCVDLLDLSSD  95

Query  810  DLRTVLDGLENS-------PA--KRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIK  658
            +L   L    NS       PA  +R  D+ T LS A+ NQ TCLDGF  ++  V+  I+ 
Sbjct  96   ELTWTLSQTPNSGVSRPVFPATGRRKNDVATWLSAALGNQDTCLDGFEGTDGVVKELILG  155

Query  657  RVEQISRHVSNALSMLTKIKK----EKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEA  490
             + Q++  V   L M+ +I      +  +        E R L  GFP W   +DR LL+ 
Sbjct  156  SLVQVTGLVGEILGMVKQIATVPLGKPLSGAGKQLATEGRRLMGGFPSWFPSKDRRLLQI  215

Query  489  PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKK  310
            P+G      +  +  VA DG+G++ ++  A++AAPD S+ R+VIY+K G Y E V+V KK
Sbjct  216  PVG-----GVAVNATVAADGTGNYTTVTDAITAAPDHSEQRYVIYVKKGVYNENVEVKKK  270

Query  309  KTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAV  130
            KT IM +GDG   T I GNRN  DGW TFR+AT AV G+GFIA+GI+FEN AGPE HQAV
Sbjct  271  KTNIMLLGDGKDVTVITGNRNFVDGWTTFRSATFAVSGNGFIARGITFENSAGPEKHQAV  330

Query  129  ALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            A R DSD S FY CSF G+QDTLY HS RQF+R+CD++GTVDF
Sbjct  331  AARVDSDLSAFYQCSFKGFQDTLYAHSLRQFYRDCDIFGTVDF  373



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 162/384 (42%), Positives = 226/384 (59%), Gaps = 32/384 (8%)
 Frame = -3

Query  1101  QSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVS  928
             ++S  N    H  H +  S+C  + Y DLC S +   P+   K  S  ++I  ++N+T +
Sbjct  55    KNSGDNGNEPH--HAILKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTT  112

Query  927   EIKTAAANCSRIRRVVP--DLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR---  763
              ++    N   I++++   +L   E+ ALH CLE   + L +L   ++ LE  P K+   
Sbjct  113   AVE---HNYFGIQKLLKRTNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLS  169

Query  762   -HAD-LQTLLSTAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKK  595
              HAD L+TL+S AMTNQ TCLDGF   ++NK+VR  +      + +  SNAL+M   IK 
Sbjct  170   QHADDLKTLMSAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAM---IKN  226

Query  594   EKDNrfsssfrRENRGL------KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKD  433
               D          NR L       DG+P WLS  DR LL++         +  ++VVA D
Sbjct  227   MTDTDMMIMRTSNNRKLIEETSTVDGWPAWLSTGDRRLLQSS-------SVTPNVVVAAD  279

Query  432   GSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGN  253
             GSG+FK++ A+++AAP     R++I IKAG Y E V+V KK   IMF+GDG  +T I G+
Sbjct  280   GSGNFKTVAASVAAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGS  339

Query  252   RNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGY  73
             RN+ DG  TF++ATVAV G GF+A+ I+F+N AGP  HQAVALR  +D S FY+C  + Y
Sbjct  340   RNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAY  399

Query  72    QDTLYVHSRRQFFRECDVYGTVDF  1
             QDTLYVHS RQFF  C + GTVDF
Sbjct  400   QDTLYVHSNRQFFVNCLIAGTVDF  423



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 158/370 (43%), Positives = 224/370 (61%), Gaps = 23/370 (6%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAKSI---PEIISATVNVTVSEIKTAAANCSRI  892
             H +  S+C  +L+++LC ST+       +K +    ++I  ++N+T   ++       ++
Sbjct  69    HTIVKSSCSITLHQELCYSTIANNIPNSSKKVTNQKDVIELSLNITTKAVQRNYYAIDKL  128

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA----KRHAD-LQTLLSTAM  727
              +    L   E+ ALH CLE   + + +L T ++ LE  P     ++HAD L+TL+S A+
Sbjct  129   VKTRKGLTEREKIALHDCLETIDETIDELHTAVEDLEKYPNAKSLRQHADDLKTLISAAI  188

Query  726   TNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSML-----TKIKKE-KDNrfss  571
             TNQ TCLDGF +  ++K VR  ++K    + +  SNAL+M+     T I+ E K      
Sbjct  189   TNQETCLDGFSHDEADKKVRKILLKGQVYVEKLCSNALAMIKNMTDTDIQNEMKLVASGK  248

Query  570   sfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSA  391
               R+ N      +P+WLS  DR LL++P        + AD+VVA DGSGD+K++  A++ 
Sbjct  249   VKRKLNEESSGTWPEWLSTGDRRLLQSP-------SVTADVVVAADGSGDYKTVAEAVAN  301

Query  390   APDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTAT  211
             AP+ S  R+VI IKAG Y E V+V KKK  IMF+GDG   T I G+RN+KDG  TF +AT
Sbjct  302   APEKSSKRYVIRIKAGVYKESVEVSKKKKNIMFMGDGRENTIITGSRNVKDGSTTFHSAT  361

Query  210   VAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFR  31
             VA  G GF+A+ I+FEN AG E HQAVALR  +D S FY C  +GYQDTLYVHS RQFF 
Sbjct  362   VAAVGEGFLARDITFENTAGHEKHQAVALRVGADLSAFYKCDMLGYQDTLYVHSNRQFFV  421

Query  30    ECDVYGTVDF  1
             +C + GTVDF
Sbjct  422   QCFISGTVDF  431



>emb|CDY33229.1| BnaC01g37020D [Brassica napus]
Length=570

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 162/364 (45%), Positives = 226/364 (62%), Gaps = 22/364 (6%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             H V  SAC  +LY +LCVS +  +  ++  S  ++I A++N+T + ++       ++ + 
Sbjct  58    HAVLRSACSSTLYPELCVSAVAISGGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKN  117

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLSTAMTNQ  718
                L   E+ ALH CLE   + L +L   L+ L+  P K+    HA DL+TL+S+A+TNQ
Sbjct  118   KKGLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQ  177

Query  717   YTCLDGFP--NSNKNVRPFIIKRVEQISRHV-SNALSMLTKIK-KEKDNrfsssfrRENR  550
              TCLDGF   +++K VR F++K      +H+ SNAL+M+  +   +  N    +    N 
Sbjct  178   ETCLDGFSHDDADKKVRNFLLK-----GQHMCSNALAMIKNMTDTDIANFELKAKLSSNN  232

Query  549   GL-KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSD  373
              L  +G+P WLS  DR LL+          ++AD  VA +GSG FK+I AA++AAPD+S 
Sbjct  233   QLDAEGWPTWLSAGDRRLLQGS-------SVRADATVAANGSGKFKTIAAAVAAAPDNSK  285

Query  372   TRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGS  193
              R+VI+IKAG Y E V+V KKK  IMF+GDG  +T I GNRN+ DG  TF +ATVA  G 
Sbjct  286   RRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVAAVGE  345

Query  192   GFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYG  13
              F+A+ I+F+N AGP  HQAVALR  SD+S FY C  + YQDTLYVHS RQFF +C + G
Sbjct  346   RFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAG  405

Query  12    TVDF  1
             TVDF
Sbjct  406   TVDF  409



>ref|XP_010266532.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Nelumbo nucifera]
Length=602

 Score =   277 bits (709),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/367 (40%), Positives = 216/367 (59%), Gaps = 21/367 (6%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  880
             Q     C  + YR +CV++L+  P   + +  +++  TVN+T+  +  A    S I  V 
Sbjct  80    QAISQTCSRTRYRSICVNSLLDFPGALSANDRDLVHITVNMTLQRVGKALYGVSEIANVA  139

Query  879   PDLGTMERRALHVCLELFSDALADLRTVLDGL------ENSPAKRHADLQTLLSTAMTNQ  718
              D  ++ R A   C EL  D++  L   L+ +         P     D+ T LS A+TNQ
Sbjct  140   MD--SLSRSAYEDCFELLEDSMDQLSLSLNSIAPPGQRSGKPVGTTQDVLTWLSAALTNQ  197

Query  717   YTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKD-------NrfsssfrR  559
              TC++G   +N  VR  +  R++ ++  VSN L++      ++D       NR       
Sbjct  198   DTCVEGLSGANGYVRSQMENRLKDLTELVSNCLAIFAYSGGDQDFSGVPIQNRRRLMESS  257

Query  558   ENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDS  379
              +  ++DG P WL+RR+R LLE P+       I+AD+VV+KDG+G +K I+ A+ + PD 
Sbjct  258   SDFQMEDGMPAWLTRRERRLLEMPV-----SSIQADIVVSKDGNGTYKKISDAIKSVPDY  312

Query  378   SDTRFVIYIKAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAV  202
             +  R +IY+KAG Y E  + V +KKT +MF+GDG  KT I G +N  D   TF TA+ A 
Sbjct  313   NSRRTIIYVKAGVYEEKNLKVGRKKTNLMFIGDGKSKTIITGGKNFFDNITTFHTASFAA  372

Query  201   GGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECD  22
              G+GFIA+ I+FENYAGP  HQAVALR  +D++V Y C+ +GYQD+LYVHS+RQF+RECD
Sbjct  373   SGAGFIARDITFENYAGPAKHQAVALRVGADHAVVYRCNVIGYQDSLYVHSQRQFYRECD  432

Query  21    VYGTVDF  1
             +YGTVDF
Sbjct  433   IYGTVDF  439



>ref|XP_006350555.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61-like 
[Solanum tuberosum]
Length=585

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 158/398 (40%), Positives = 227/398 (57%), Gaps = 20/398 (5%)
 Frame = -3

Query  1155  IMLVP--VVLLAPFLSLTVFQSSAMNATTSHD-IHQVAHSACDHSLYRDLCVSTLVKTPD  985
             IML+   V+L+A  +++ V       A    D   Q     C  +LY  LC+++L+  P 
Sbjct  32    IMLISATVLLIASAIAVAVLIGVRHKAGNRIDKPSQAMARTCSRTLYPSLCLNSLINYPG  91

Query  984   LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDAL---  814
               + S  +++  +VN+T+          S I  +   + T  R A   CLEL  +++   
Sbjct  92    ANSASDSDLVHISVNLTLQRFGKGLYKASDINNL--QMNTQIRSAYDDCLELLEESVDLL  149

Query  813   -ADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISR  637
                L +V  G  +SP     D+ T LS A+TN  TC DGF N   NV+  I + ++ +S 
Sbjct  150   SHSLNSVFSGDGDSPTGSTQDVMTWLSAALTNHDTCTDGFANVTGNVKDHISENLKDLSE  209

Query  636   HVSNALSMLTKIKKEKDNrfsssfrRENRGLK-----DGFPKWLSRRDRALLEAPMGKGK  472
              VSNAL++      + D        R  R ++     D FPKW+SRRDR L+   +    
Sbjct  210   LVSNALAIYAAANGDDDFSRIPIQNRRRRLMEFETHHDEFPKWMSRRDRKLMNKSVSA--  267

Query  471   KHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIM  295
                I+AD++VAKDGSG  K+I  A+   P+ S+ R +IY+KAG Y E  + V +KK  +M
Sbjct  268   ---IQADIIVAKDGSGTVKTIAEAIKKVPEKSNHRTIIYVKAGRYEENNLKVGRKKMNVM  324

Query  294   FVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRAD  115
             F+GDG GKT I G +++     TF TA+ A  G+GFIA+ ++FENYAGP NHQAVALR  
Sbjct  325   FIGDGKGKTVITGGKSVSQHLTTFHTASFAATGAGFIARDMTFENYAGPNNHQAVALRIG  384

Query  114   SDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              D++V + C+ +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  385   GDHAVVFRCNVIGYQDTLYVHSQRQFYRECDIYGTVDF  422



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 163/403 (40%), Positives = 235/403 (58%), Gaps = 27/403 (7%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTV-FQSSAMNATTSHDI-------HQVAHSACDHSLYRDLCVSTLV  997
             ++  V+L+A  + +    +S + N+    DI       H +  SAC ++L+ +LC S +V
Sbjct  21    IVASVLLVAAVIGVVAGVKSRSNNSDDDADIMAISSSAHAIVKSACSNTLHPELCYSAIV  80

Query  996   KTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFS  823
                D   K  S  ++I  ++N+TV  ++        + +    L   E+ ALH CLE   
Sbjct  81    NVTDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGLTPREKVALHDCLETMD  140

Query  822   DALADLRTVLDGLENSPAKR----HA-DLQTLLSTAMTNQYTCLDGFPN--SNKNVRPFI  664
             + L +L T +  LE  P K+    HA DL+TL+S+A+TNQ TCLDGF +  ++K VR  +
Sbjct  141   ETLDELHTAVADLELYPNKKSLKEHAEDLKTLISSAITNQETCLDGFSHDEADKKVRKVL  200

Query  663   IKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG--FPKWLSRRDRALLEA  490
             +K  + + +  SNAL+M+  +    D           + ++D   +P+WLS  DR LL++
Sbjct  201   LKGQKHVEKMCSNALAMICNMT-NTDIANEMKLSGSRKLVEDNGEWPEWLSAGDRRLLQS  259

Query  489   PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKK  310
                      +  D+VVA DGSGD+K+++ A++ AP+ S  R+VI IKAG Y E VDV KK
Sbjct  260   ST-------VTPDVVVAADGSGDYKTVSEAVAKAPEKSSKRYVIRIKAGVYRENVDVPKK  312

Query  309   KTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAV  130
             KT IMF+GDG   T I  +RN++DG  TF +ATVA  G  F+A+ I+F+N AG   HQAV
Sbjct  313   KTNIMFMGDGRSNTIITASRNVQDGSTTFHSATVAAVGEKFLARDITFQNTAGASKHQAV  372

Query  129   ALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR  SD S FY C  + YQDTLYVHS RQFF +C V GTVDF
Sbjct  373   ALRVGSDLSAFYKCDILAYQDTLYVHSNRQFFVQCLVAGTVDF  415



>ref|XP_009776000.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nicotiana sylvestris]
Length=598

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 159/405 (39%), Positives = 230/405 (57%), Gaps = 27/405 (7%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHD-IHQVAHSACDHSLYRDLCVSTLVKTPDLR  979
             I++  V+L+A  +S+ V      N+    D   Q     C  +LY  LC+++L+  P  +
Sbjct  38    IIVATVLLIASVISVAVLVGVRKNSGNRIDKPSQAMARTCSRTLYPSLCLNSLINYPGAK  97

Query  978   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRT  799
             + S  +++  +VN+T+     A    S I  +  ++ T  R A   CLEL  +++  L  
Sbjct  98    SASDSDLVHISVNLTLQRFGKALYISSDINNL--EMNTHIRSAYDDCLELLEESVDLLSH  155

Query  798   VL------DGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISR  637
              L      DG  NSPA    D+ T LS A+TNQ TC D F +   NV+  + + ++ +S 
Sbjct  156   SLNSVFPGDGGGNSPAGSTQDVMTWLSAALTNQDTCTDSFADVTGNVKDQMSENLKDLSE  215

Query  636   HVSNALSMLTKIKKEKDNrfsssfrRENRGLK------------DGFPKWLSRRDRALLE  493
              VSNAL++      + D        R  R ++            D FPKWLSRRDR LL 
Sbjct  216   LVSNALAIYAAANGDDDFSGIPIQNRRRRLMELEHNDVPTTNEHDDFPKWLSRRDRKLLN  275

Query  492   APMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYV-DVD  316
               +       I+AD++VAKDGSG  K+I  A+   P+ S+ R +IY+KAG Y E +  V 
Sbjct  276   KSVSA-----IQADIIVAKDGSGTVKTIAEAIKKVPEKSNRRTIIYVKAGRYEENILKVG  330

Query  315   KKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQ  136
             +KK  +MF+GDG GKT I G +++     TF TA+ A  G+GF+A+ ++FENYAGP  HQ
Sbjct  331   RKKMNVMFIGDGKGKTVITGGKSVSQNITTFHTASFAATGAGFVARDMTFENYAGPSKHQ  390

Query  135   AVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR   D++V + C+ +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  391   AVALRIGGDHAVVFRCNIIGYQDTLYVHSQRQFYRECDIYGTVDF  435



>ref|XP_010466998.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39 
[Camelina sativa]
Length=413

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 182/256 (71%), Gaps = 13/256 (5%)
 Frame = -3

Query  744  LLSTAMTNQYTCLDGFP----NSNKNVRPFIIKRVEQ----ISRHVSNALSMLTKIKKEK  589
            LLS AMTNQ TCLDGF      +N ++   + K +++    IS ++SN+L ML  + ++ 
Sbjct  2    LLSNAMTNQDTCLDGFSKCGNETNNDMSVELPKNLKESILNISNNLSNSLYMLQVMSRKN  61

Query  588  DNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSI  409
             +R SS    E  G       W+S  D+ LL+AP+      +I  ++ VAKDG+GDF +I
Sbjct  62   PSRESSDVHVEYPGCTTRKQCWVSEFDQRLLQAPV-----QEISFNLSVAKDGTGDFTTI  116

Query  408  NAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWP  229
            +AA+SAAP+SS+TRF+IYIK G Y+E V+V KK TMIMFVGDGIGKT IK NRN  DGWP
Sbjct  117  SAAVSAAPNSSETRFIIYIKGGEYFENVEVPKKTTMIMFVGDGIGKTVIKANRNCVDGWP  176

Query  228  TFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHS  49
            TF+TATV V G GFIAK I+F N+AGP+  QAVA R+ SD+S FY C+F GYQDTLYVH+
Sbjct  177  TFQTATVGVKGKGFIAKDITFVNFAGPDKKQAVAFRSGSDHSAFYRCAFYGYQDTLYVHT  236

Query  48   RRQFFRECDVYGTVDF  1
             RQF+RECD+YGT+DF
Sbjct  237  ARQFYRECDIYGTIDF  252



>ref|XP_003559807.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=587

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 161/372 (43%), Positives = 222/372 (60%), Gaps = 42/372 (11%)
 Frame = -3

Query  1029  LYRDLCVSTL-VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD----LGT  865
             L+ D+C +TL    P L  K +PE+IS  V+     ++ AA+NC+    + P+    L  
Sbjct  65    LHGDVCAATLSAMPPGLSKKPLPEVISYVVSRAADAVRAAASNCTSY--LAPERHSQLRV  122

Query  864   MERRALHVCLELFSDALADLRTVLDGLE-------NSPAKRHADLQTLLSTAMTNQYTCL  706
              +R AL  CLELFS  L  L T    LE        +  +R A +QT+LS AMTNQ+TCL
Sbjct  123   RDRLALADCLELFSHTLTQLATASSELELELSNSSRTAEERVAGVQTVLSAAMTNQFTCL  182

Query  705   DGFPNSNKN-----------------VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrf  577
             DGF +  +                  VRP+I  R+  +S  +SN+L++L ++        
Sbjct  183   DGFSDPTQTPGGPSPGPGPSDSSPGRVRPYIQGRILHVSHLLSNSLALLRRLPSSS---R  239

Query  576   sssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAAL  397
                 R  NR    GFP W+S  DR  LE      ++    AD  VAKDGSGD+ ++  A+
Sbjct  240   RRRRRVPNRA--GGFPSWISAADRRRLE------QQQVAAADATVAKDGSGDYATVGEAV  291

Query  396   SAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRT  217
             +AAP++S  R+VI +K G Y+E V+V  +KT +M VGDG+ KT IK +RN+ D + TFR+
Sbjct  292   AAAPNNSARRWVIRVKTGGYFENVEVGSEKTNLMLVGDGMWKTVIKASRNVVDNYTTFRS  351

Query  216   ATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQF  37
             AT+AV G+GF+A+ ++ EN AGP  HQAVALR ++D S FY CSF GYQDTLY HS RQF
Sbjct  352   ATLAVAGTGFLARDLTVENGAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQF  411

Query  36    FRECDVYGTVDF  1
             +++CDVYGTVDF
Sbjct  412   YKDCDVYGTVDF  423



>ref|XP_009117000.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   276 bits (705),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 162/382 (42%), Positives = 225/382 (59%), Gaps = 36/382 (9%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             H V  SAC  +LY +LC+S +  +  ++  S  ++I A++N+T + ++       ++ + 
Sbjct  58    HAVLRSACSSTLYPELCISAVATSGGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKN  117

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLSTAMTNQ  718
             +  L   E+ ALH CLE   + L +L   L+ L+  P K+    HA DL+TL+S+A+TNQ
Sbjct  118   MKGLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQ  177

Query  717   YTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLT---------------------  607
              TCLDGF   +++K VR F++K    +    SNAL+M+                      
Sbjct  178   ETCLDGFSHDDADKKVRKFLLKGQVHVEHMCSNALAMIKNMTDTDIANFELKAKLSSNNR  237

Query  606   KIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGS  427
             K+K+EK          E    K G+P WLS  DR LL+          ++AD  VA +GS
Sbjct  238   KLKEEKTPEAVDIAGSEELDAK-GWPTWLSAGDRRLLQGS-------SVRADATVAANGS  289

Query  426   GDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRN  247
             G FK+I AA++AAPD+S  R+VI+IKAG Y E V+V KKK  IMF+GDG  +T I GNRN
Sbjct  290   GKFKTIAAAVAAAPDNSKRRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNRN  349

Query  246   MKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQD  67
             + DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C  + YQD
Sbjct  350   VVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQD  409

Query  66    TLYVHSRRQFFRECDVYGTVDF  1
             TLYVHS+RQFF +    GTVDF
Sbjct  410   TLYVHSKRQFFVKGLTAGTVDF  431



>ref|XP_006355852.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=264

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 178/252 (71%), Gaps = 14/252 (6%)
 Frame = -3

Query  933  VSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALAD-LRTVL-----DGLENSP  772
            ++E+K++A NCS I   V  L  +E+RAL  C+EL  D   D L+T L       + NSP
Sbjct  1    MNEVKSSAENCSNILHHVSKLDPIEKRALDDCIELLGDTTIDELQTTLYDLSTKNISNSP  60

Query  771  AKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKE  592
             K + DLQTLLS AMTNQ TCL+G  NS  N+  +I K +  IS+HVSN+L+ML K+K  
Sbjct  61   LKHYYDLQTLLSGAMTNQDTCLNGIYNSKHNLSQYIEKNLHTISQHVSNSLAMLKKLKTG  120

Query  591  KDNrfsssfrR---ENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGD  421
                  S+      E R +K+G+PKWL +++R LL+AP+ +     IK D+VVAKDGSG+
Sbjct  121  STQGSLSNSNEVFPEYRTMKNGYPKWLEKKERTLLQAPVNQ-----IKFDLVVAKDGSGN  175

Query  420  FKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMK  241
            F +INAALSAAP+SS TRFVIYIKAG Y+EY+DV++KK+MIMFVGDGIGKT IKGNRN+ 
Sbjct  176  FTTINAALSAAPNSSSTRFVIYIKAGMYFEYIDVERKKSMIMFVGDGIGKTTIKGNRNVV  235

Query  240  DGWPTFRTATVA  205
            DGW TFR+ATV 
Sbjct  236  DGWTTFRSATVG  247



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score =   275 bits (703),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 222/368 (60%), Gaps = 24/368 (7%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPD--LRAKSIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +  S+C  +LY +LC+ST+   PD   + KS  ++I  ++N+T++ +++   +  ++ 
Sbjct  55    HSIIKSSCSSTLYPELCLSTISAAPDAETKIKSPKDVIVTSMNLTITAVQSNYLSIKKLI  114

Query  888   RVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA-----KRHAD-LQTLLSTAM  727
                 +L   E+ AL+ CLEL  + L +L      L + P       +HAD L+TLLS AM
Sbjct  115   STNKNLPKREKTALNDCLELEDETLDELYKAEQDLSDYPTFNKSISQHADELKTLLSAAM  174

Query  726   TNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrREN  553
             TNQ TCLDGF   +++K VR  +I     +    SNAL+M   IK   D   +S      
Sbjct  175   TNQETCLDGFSHDSADKKVRQALIDGQMHVFHMCSNALAM---IKNLTDTDMASQGYPSG  231

Query  552   RGLKDG----FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAP  385
             R L++     +P+WLS  DR LL+AP        +  D+ VA DGSGDF++++ A++AAP
Sbjct  232   RQLEEQDETEWPEWLSAGDRRLLQAPT-------VTPDVTVAADGSGDFRTVSEAVAAAP  284

Query  384   DSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVA  205
             + S  R++I IKAG Y E VDV + KT +MFVGDG   T I  +RN+ DG  TF +ATVA
Sbjct  285   ERSTRRYIIKIKAGVYKENVDVPRGKTNLMFVGDGRVNTIITASRNVVDGSTTFNSATVA  344

Query  204   VGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFREC  25
               G GF+A+ I+F+N AGP  HQAVALR  SD S FY C  + YQDTLYVHS RQF+ +C
Sbjct  345   AVGDGFLARDITFQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYVQC  404

Query  24    DVYGTVDF  1
              V GTVDF
Sbjct  405   LVAGTVDF  412



>ref|XP_010534986.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
 ref|XP_010534987.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
Length=587

 Score =   275 bits (704),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 159/377 (42%), Positives = 221/377 (59%), Gaps = 30/377 (8%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTP--DLRAKSIPEIISATVNVTVSEIKTAAANCSRIR  889
             H V  SAC  + Y+DLCVS +  +    +   S  ++I A++N+T + ++       ++ 
Sbjct  57    HVVLRSACSSARYQDLCVSAISTSALTGVELTSQRDVIEASLNITTTAVEHNYFTIKKLL  116

Query  888   RVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLSTAMT  724
                  L   E+ ALH CLE   + L +L   +D L   P K+    HAD L+TL+S+A+T
Sbjct  117   EKRKGLTKREKTALHDCLETIDETLDELHEAMDDLNEYPDKKSLRQHADDLKTLISSAIT  176

Query  723   NQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENR  550
             NQ TCLDGF   +++K VR  + K    +    SNAL+M+  +       F       +R
Sbjct  177   NQETCLDGFSHDDADKKVRKALEKGQIHVEHMCSNALAMIKNMTDTDIANFELKANNHHR  236

Query  549   GL--------------KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKS  412
              L               DG+PKWLS  DR LL++         +KAD  VA DGSG+F++
Sbjct  237   KLVEDPAAVVGGGEMDGDGWPKWLSAGDRRLLQSTT-------VKADATVAADGSGNFRT  289

Query  411   INAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGW  232
             + A ++AAP++S+ R+VI+IKAG Y E V+V KKK  IMF+GDG  +T I G+RN+ DG 
Sbjct  290   VAAGVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTIITGSRNVVDGS  349

Query  231   PTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVH  52
              TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C  + YQD+LYVH
Sbjct  350   TTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDILAYQDSLYVH  409

Query  51    SRRQFFRECDVYGTVDF  1
             S RQFF +C V GTVDF
Sbjct  410   SNRQFFVKCLVTGTVDF  426



>ref|XP_006287480.1| hypothetical protein CARUB_v10000691mg [Capsella rubella]
 gb|EOA20378.1| hypothetical protein CARUB_v10000691mg [Capsella rubella]
Length=530

 Score =   274 bits (700),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 154/344 (45%), Positives = 210/344 (61%), Gaps = 42/344 (12%)
 Frame = -3

Query  969  IPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMERRALHVCLELFSDALADLRTVL  793
            I +++ A +N T+S++  +++N S +  R+   L   ER A   CLEL  D + DL T +
Sbjct  47   ITDLVVAAINQTISKVNLSSSNFSYLLNRLGSSLSHRERCAFDDCLELLDDTVFDLTTAI  106

Query  792  DGLENSPAKRHADLQTLLSTAMTNQYTCLDGFP------------NSNK--NVRPFIIKR  655
              L +   + H +++  LS  +TN  TCLDGF             N+NK   V   + + 
Sbjct  107  SELRSHSPEIH-NVKMFLSATLTNTRTCLDGFASNDEVEDENWNYNNNKTYGVAESLKES  165

Query  654  VEQISRHVSNALSMLTKI------KKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLE  493
            +  IS HV N+L+ML  I      K E+D                 FP W+S  DR LL+
Sbjct  166  LFNISSHVKNSLAMLEDIPGNIPGKLEEDV---------------AFPMWVSGSDRNLLQ  210

Query  492  APMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDK  313
             P+ + K      D+VVA++G+G++ +I  ALSAAP+SS+TRFVIYIK G Y E +++ +
Sbjct  211  DPVDESK-----VDLVVAQNGTGNYTTIGEALSAAPNSSETRFVIYIKCGVYLENIEIAR  265

Query  312  KKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQA  133
            +KTMIMFVGDGIG+T IK NR+  DGW  F +ATV V GSGFIAK +SF N AG   +QA
Sbjct  266  EKTMIMFVGDGIGQTVIKANRSYADGWTAFHSATVGVRGSGFIAKDLSFVNDAGRTRYQA  325

Query  132  VALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            VALR+ SD+S FY CSF  YQDT+Y HS +QF+RECD+YGTVDF
Sbjct  326  VALRSSSDHSAFYRCSFESYQDTIYAHSHKQFYRECDIYGTVDF  369



>ref|XP_010267633.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nelumbo nucifera]
Length=604

 Score =   276 bits (705),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/368 (40%), Positives = 218/368 (59%), Gaps = 24/368 (7%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  880
             Q     C  + Y DLC+++LV+ P   A    +++  + N+T+  +  A    S I  V 
Sbjct  83    QAISRTCSKTRYPDLCINSLVEFPGALAAGDRDLVHISFNMTLQRVGKALYGVSEIANVA  142

Query  879   PDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHA--------DLQTLLSTAMT  724
              D   + R A   CLEL  D++  L   L+ +  +P ++          D+ T LS A+T
Sbjct  143   MD--ALARSAYEDCLELLEDSMDQLSLSLNSV--APPEQGGGKGVGSTEDVMTWLSAALT  198

Query  723   NQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKD------Nrfsssfr  562
             NQ TC +G  + + NV+  +  R+  IS  VSN L++       +D              
Sbjct  199   NQDTCNEGLSDVSGNVKDQMQNRLSDISELVSNCLAIFASSSGNEDFSGIPIQNKRRLMT  258

Query  561   RENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPD  382
               +   ++  P WL+RR+R LLE P+       I+AD+VV+KDG+G +K+I  A+ A P+
Sbjct  259   ESSFQTEEELPAWLTRRERRLLEMPV-----SSIQADIVVSKDGTGTYKTITEAIKAVPE  313

Query  381   SSDTRFVIYIKAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVA  205
              S+ R +IY+KAG+Y E  + V +KKT +MF+GDG GKT I G +N+ + + TF TA+ A
Sbjct  314   HSNRRTIIYVKAGTYEESNLKVGRKKTNLMFIGDGRGKTVITGGKNVFEKYTTFHTASFA  373

Query  204   VGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFREC  25
               G+GFIA+ ++FENYAGP NHQAVALR  +D++V Y C+ +GYQDTLYVHS+RQF+REC
Sbjct  374   ATGAGFIARDMTFENYAGPSNHQAVALRVGADHAVVYRCNIIGYQDTLYVHSQRQFYREC  433

Query  24    DVYGTVDF  1
             D+YGTVDF
Sbjct  434   DIYGTVDF  441



>ref|XP_010915944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Elaeis guineensis]
Length=587

 Score =   275 bits (703),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 160/374 (43%), Positives = 222/374 (59%), Gaps = 20/374 (5%)
 Frame = -3

Query  1095  SAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKT  916
             S  N T +  I Q     C  + Y +LCVS+L+  P        +++  ++N+T   +  
Sbjct  62    SGPNRTPTQAISQT----CALTRYPELCVSSLLDFPGALDAGDRDLVHISLNMTTQRVGK  117

Query  915   AAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLR---TVLDGLENSPAK-RHADLQ  748
             A    S I  V  D  ++ R A   C+EL  D+L  L     V+   E  PA     D+ 
Sbjct  118   ALYGASAIAGVSMD--SLARSAYDDCMELLDDSLDQLSQSLAVIAPTELRPASASDEDVL  175

Query  747   TLLSTAMTNQYTCLDGFPN-SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfss  571
             T LS A++NQ TC DG  + +N  VR  +   ++ ++  VSN L++ +   + KD     
Sbjct  176   TWLSAALSNQDTCTDGLADVANGYVRAQMESNLKDLAELVSNCLAIFSAASRNKDFSGIP  235

Query  570   sfrRENRGLK---DG-FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINA  403
                ++ R L    DG FP+WL  RDR LL+ P  K     I+ADMVVAKDG+G  KSI  
Sbjct  236   IQNKKRRLLSSAGDGEFPEWLGWRDRRLLQVPAAK-----IQADMVVAKDGTGTHKSIAD  290

Query  402   ALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTF  223
             A+ AAP++S  R +IY+KAG Y E + V +KKT +MF+GDG G T + G+R++ D + TF
Sbjct  291   AVKAAPENSARRIIIYVKAGRYNENIKVTRKKTNLMFIGDGKGITTVAGSRSVADKYTTF  350

Query  222   RTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRR  43
              TAT A  G+GFI + ++ EN+AGPE HQAVALR  +D++V Y C+ VGYQDTLYVHS+R
Sbjct  351   HTATFASTGNGFIMRDMTIENWAGPEKHQAVALRVGADHAVVYRCNIVGYQDTLYVHSQR  410

Query  42    QFFRECDVYGTVDF  1
             QFFRECD+YGTVDF
Sbjct  411   QFFRECDIYGTVDF  424



>ref|XP_007024771.1| Pectin methylesterase 3 isoform 2, partial [Theobroma cacao]
 gb|EOY27393.1| Pectin methylesterase 3 isoform 2, partial [Theobroma cacao]
Length=500

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 236/400 (59%), Gaps = 33/400 (8%)
 Frame = -3

Query  1140  VVLLAPFLSLTVFQSSAMNAT---TSHDIHQVAHSACDHSLYRDLCVSTLVKTP---DLR  979
             +V++A  + +    +S  N+    TSH  H +  SAC  + Y DLC S +   P     +
Sbjct  35    LVIVAAIIGIVAGVNSRNNSDETDTSH--HAIVKSACSITRYPDLCFSEVAAAPAATSKK  92

Query  978   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERR--ALHVCLELFSDALADL  805
              KS  ++I  ++N+T + ++    N  +I++++   G  ER   ALH CLE   + L +L
Sbjct  93    VKSKKDVIELSLNITTTAVE---HNYFKIKKLLAKKGLTEREKTALHDCLETIDETLDEL  149

Query  804   RTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQ  646
                ++ L   P K+    HAD L+TL+S AMTNQ TCLDGF +  ++K +R  +I   + 
Sbjct  150   HEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHDAADKKIRKVLIDGEKY  209

Query  645   ISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD-----GFPKWLSRRDRALLEAPMG  481
             + R  SNAL+M+  +  + D          NR LK+      +P+WLS  DR LL++   
Sbjct  210   VERMCSNALAMIKNMT-DTDIANEMLKTSSNRKLKEQENGIAWPEWLSAGDRRLLQSS--  266

Query  480   KGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTM  301
                   +  D+VVA DGSG++K+++ A++ AP  S  R+VI IKAG Y E V+V KKKT 
Sbjct  267   -----SVTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYRENVEVPKKKTN  321

Query  300   IMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALR  121
             IMF+GDG  +T I G+RN+ DG  TF +ATVAV G  F+A+ I+F+N AGP  HQAVALR
Sbjct  322   IMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQNTAGPSKHQAVALR  381

Query  120   ADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               +D S FY+C  + YQDTLY HS RQF+  C + GTVDF
Sbjct  382   VGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDF  421



>emb|CDY08206.1| BnaA05g14130D [Brassica napus]
Length=585

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 169/409 (41%), Positives = 237/409 (58%), Gaps = 36/409 (9%)
 Frame = -3

Query  1149  LVPVVLLAPFLSLTVFQSSAMNATTSHDI-------HQVAHSACDHSLYRDLCVSTLVKT  991
             ++ +VL +  + + V +S   N T +  I       H V  S C  +LY +LC S +  T
Sbjct  26    VLALVLFSAVVGIAVTKS---NQTKNQKIPTLTPTSHAVLKSVCSSTLYPELCFSAVAAT  82

Query  990   PDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALA  811
                +  S  ++I A++N+T + +K       ++      L   E  ALH CLE+  + L 
Sbjct  83    GK-KLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTAREVTALHDCLEIIDETLD  141

Query  810   DLRTVLDGLENSPA----KRHAD-LQTLLSTAMTNQYTCLDGFP--NSNKNVRPFIIKRV  652
             +L   L+ L+  P     ++HAD L+TL+S+A+TNQ TCLDGF    +++ +R  ++K  
Sbjct  142   ELHVALEDLDQYPKGKSLRKHADDLKTLISSAITNQGTCLDGFSYDKADRKLRKALLKGQ  201

Query  651   EQISRHVSNALSM---LTKIKKEKDNrfsssfrRENRGLKD---------GFPKWLSRRD  508
               +    SNAL+M   +T+    K      S   +NR LK+         G+P WLS  D
Sbjct  202   VHVEHMCSNALAMIKNMTETDIAKFELKDKSSSTKNRKLKEELTDDLDGEGWPNWLSIGD  261

Query  507   RALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY  328
             R LL+   G      + AD  VA DGSGDF ++ AA++AAP+ S+ R+VI+IKAG Y E 
Sbjct  262   RRLLQGSTG------VNADATVAADGSGDFTTVAAAVAAAPEKSNKRYVIHIKAGVYREN  315

Query  327   VDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGP  148
             V+V KKK  IMF+GDG GKT I G RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP
Sbjct  316   VEVSKKKKNIMFLGDGRGKTIITGKRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGP  375

Query  147   ENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               HQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  376   SKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIAGTVDF  424



>ref|XP_008783207.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Phoenix dactylifera]
Length=588

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 228/393 (58%), Gaps = 26/393 (7%)
 Frame = -3

Query  1146  VPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSI  967
             V V LL  F + T    S  N T +  I Q     C  + Y  LCVS+L+  P       
Sbjct  48    VSVGLLVRFRART--SGSGTNRTPTQAISQT----CALTRYPALCVSSLLDFPGALEAGD  101

Query  966   PEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDG  787
              +++  ++N+TV  +  A    S +  V  D   + R A   C+EL  D+L  L   L  
Sbjct  102   RDLVHISLNMTVQRVGKALYQASAVAGVSMDF--LARSAYDDCMELLDDSLDQLSQSLAV  159

Query  786   LENSPAKRHA------DLQTLLSTAMTNQYTCLDGFPN-SNKNVRPFIIKRVEQISRHVS  628
             +  +P   H       D+ T LS+A+TNQ TC +G  + +N  VR  +   ++ ++  VS
Sbjct  160   I--APTGSHPAGASDEDVLTWLSSAVTNQDTCTEGLADVANGYVRAQMESNLKDLAELVS  217

Query  627   NALSMLTKIKKEKDNrfsssfrRENRGLK---DG-FPKWLSRRDRALLEAPMGKGKKHDI  460
             N L++ +   + KD        ++ R L    DG FP+W+ RRDR LL+ P  K     I
Sbjct  218   NCLAIFSAASRNKDFSGIPIQNKKRRLLSSAGDGEFPEWVGRRDRRLLQVPAAK-----I  272

Query  459   KADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDG  280
             +ADMVVAKDG+G  KSI AA+ AAP+ S  R +IY+KAG Y E + V +KKT +MF+GDG
Sbjct  273   QADMVVAKDGNGTHKSIAAAVKAAPELSARRIIIYVKAGRYVENIKVGRKKTNLMFIGDG  332

Query  279   IGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSV  100
              G T + G+R++ D + TF TAT A  G+GFI K ++ EN+AGP  HQAVALR  +D +V
Sbjct  333   KGMTIVAGSRSVADKYTTFSTATFASTGNGFIMKDMTIENWAGPAKHQAVALRVGADQAV  392

Query  99    FYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              Y C+ +GYQDTLYVHS+RQFFRECD++GTVDF
Sbjct  393   VYRCNIIGYQDTLYVHSQRQFFRECDIFGTVDF  425



>ref|XP_004494573.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Cicer arietinum]
Length=543

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 150/391 (38%), Positives = 223/391 (57%), Gaps = 17/391 (4%)
 Frame = -3

Query  1149  LVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKS  970
             L  ++LL  F  +  FQ    +   + D+  +   AC     ++ C++ +          
Sbjct  8     LFILILLPSFDKVLSFQDEIPSEIQTQDMQALIAQACMDIENQNSCLTNIQNELTKTGPP  67

Query  969   IP-EIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLEL-------FSDAL  814
              P  +ISA +  T++E   A  N ++I      +   E+ A+  C EL        + +L
Sbjct  68    SPTSVISAALRTTINEAIGAINNMTKISTF--SVNNREQLAIEDCKELIDFSVSELAWSL  125

Query  813   ADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRH  634
              ++R +  G  N  A+   +L+  LS A++NQ TC++GF  +++ +  FI   + Q+++ 
Sbjct  126   GEMRRIRAGDRN--AQYEGNLEAWLSAALSNQDTCIEGFEGTDRRLESFISGSLTQVTQL  183

Query  633   VSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKA  454
             +SN LS+ T++ +       ++       +   FP+W++  D+ LL     K + H   A
Sbjct  184   ISNVLSLYTQLHRLPFRSPRNTTLLGTSDVSSEFPEWMTDADQELL-----KSRPHGAVA  238

Query  453   DMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIG  274
             + +VA DGSG +++IN A++AAP  S+ R+VIY+K G Y E VD+ KK T IM VGDGIG
Sbjct  239   NAIVALDGSGHYRTINEAVNAAPSHSNRRYVIYVKKGLYKENVDMKKKMTNIMIVGDGIG  298

Query  273   KTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFY  94
             +T I  NRN   GW TFRTAT AV G GFIAK ++F N AGP NHQAVALR DSD S F+
Sbjct  299   QTIITSNRNFMQGWTTFRTATFAVSGKGFIAKDVTFRNTAGPVNHQAVALRVDSDQSAFF  358

Query  93    DCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              CS  G QDTLY HS RQF+REC++YGT+DF
Sbjct  359   RCSIEGNQDTLYAHSLRQFYRECEIYGTIDF  389



>gb|KDP33984.1| hypothetical protein JCGZ_07555 [Jatropha curcas]
Length=583

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/427 (36%), Positives = 244/427 (57%), Gaps = 35/427 (8%)
 Frame = -3

Query  1203  YHSTIDSEMQNLGRNPIMLV---PVVLLAPFLSLTVFQSSAMNATTSHDIHQVAH----S  1045
             + S + ++ +N+ +  ++L+    ++L+   +S+    +S  N+T  ++ HQ AH    S
Sbjct  5     FPSGVTAKFKNMNKKKLLLILFASILLITAIVSMIACVASRKNSTAKNEYHQAAHAIIKS  64

Query  1044  ACDHSLYRDLCVSTLVKTPDL---RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD  874
             +C  +LY DLC ST+   P+    + ++  ++I  ++NVT   +  A    +RI   +  
Sbjct  65    SCSATLYPDLCFSTISTLPNAAISKVRNTRDVIGLSLNVTKESVTKAYLKINRISSGLKK  124

Query  873   LGTMERRALHVCLELFSDALADLRTVLDGLENSP------AKRHADLQTLLSTAMTNQYT  712
             L   E+ A   C EL +  +  +  V   L + P      A+   + + LLS A+TNQ T
Sbjct  125   LTPREKIAFGDCFELLNQTIVQINKVARKLHSYPSLKKSIAEHAEEFKILLSAALTNQET  184

Query  711   CLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLTKI--------KKEKDNrfsssfr  562
             C+DGF +   +K VR   +     + R  SNAL+++  +        K+E+ +  S    
Sbjct  185   CIDGFSSYEVDKKVRQLFLADERYVYRLCSNALALIKHMTDTDMVNSKEEQHSSSSDRKL  244

Query  561   RENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPD  382
              E+ G++  +PKW+S +DR LL+A         +   ++VA DGSG++K++  A++AAP 
Sbjct  245   EEDNGIE--WPKWMSTKDRRLLQA-------RSLTPHVIVAADGSGNYKTVTEAVNAAPS  295

Query  381   SSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAV  202
              S +R++I IKAG Y E ++V   KT IMF GDG  KT I  N+N+ DG  TF +ATVA 
Sbjct  296   RSTSRYIIKIKAGVYRETLEVPNSKTNIMFFGDGSSKTIITYNKNVVDGSTTFNSATVAA  355

Query  201   GGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECD  22
              G GF+A+ ++F+N AGP  HQAVALR  SD S FY CSF+ +QDTLYVH+ RQF+ +C 
Sbjct  356   VGDGFLARDLTFQNSAGPSKHQAVALRVGSDKSAFYRCSFIAFQDTLYVHTLRQFYVKCV  415

Query  21    VYGTVDF  1
             + GT+DF
Sbjct  416   IIGTIDF  422



>ref|XP_002872845.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49104.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=453

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/307 (48%), Positives = 196/307 (64%), Gaps = 36/307 (12%)
 Frame = -3

Query  876  DLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGF  697
            +L   +R A   CLEL  D + DL T +  L +   + H +++  LS AMTN  TCLDGF
Sbjct  7    NLSHRDRCAFDDCLELLDDTVFDLTTAVSELRSHSPELH-NVKMFLSAAMTNTRTCLDGF  65

Query  696  PNSNK---------NVRPFIIKRVEQISRHVSNALSMLTKI------KKEKDNrfsssfr  562
             +SN           V   + + +  IS HVS++L+ML +I      K E+D        
Sbjct  66   ASSNNDENNNNKTYGVAESLKESLFNISSHVSDSLAMLEEIPGNIPGKLEEDV-------  118

Query  561  RENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPD  382
                    GFP W+S  DR LL+ P+      + K ++VVA++G+ ++ +I  A+SAAP+
Sbjct  119  --------GFPMWVSGSDRNLLQDPV-----DETKVNLVVAQNGTSNYTTIGEAVSAAPN  165

Query  381  SSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAV  202
            SS+TRFVIYIK G Y+E +++ ++KTMIMF+GDGIG+T IK NR+  DGW  F +ATV V
Sbjct  166  SSETRFVIYIKCGEYFENIEIPREKTMIMFIGDGIGRTVIKANRSYADGWTAFHSATVGV  225

Query  201  GGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECD  22
             GSGFIAK +SF NYAG  +HQAVALR+ SD S FY CSF  +QDTLYVHS +QF+RECD
Sbjct  226  RGSGFIAKDLSFVNYAGLASHQAVALRSSSDLSAFYRCSFESFQDTLYVHSHKQFYRECD  285

Query  21   VYGTVDF  1
            +YGTVDF
Sbjct  286  IYGTVDF  292



>ref|XP_003554631.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Glycine max]
Length=544

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 158/402 (39%), Positives = 232/402 (58%), Gaps = 38/402 (9%)
 Frame = -3

Query  1155  IMLVPVVLLAP-----FLSLTVFQSSAMNATTSHDIHQVA-HSACDHSLYRDLCVSTLVK  994
             +ML+P     P     F++ +  Q+  M A  +     +   ++C  +++ +L   T + 
Sbjct  10    LMLLPSFEAIPSDEEVFINPSEVQTQDMQALIAQACMDIENQNSCLTNIHNEL---TKIG  66

Query  993   TPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELF----  826
              P     S   ++SA +  T++E + A  N ++I      +   E++A+  C EL     
Sbjct  67    PP-----SPTSVVSAALKHTLNEARVAIDNITKITTF--SVSYREQQAIEDCRELLDFSV  119

Query  825   ---SDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKR  655
                + ++ ++R +  G  N  A+   +L+  LS A++NQ TCL+GF  +++ +  +I   
Sbjct  120   SELAWSMGEMRRIRSGDTN--AQYEGNLEAWLSAALSNQDTCLEGFEGTDRRLESYISGS  177

Query  654   VEQISRHVSNALSMLTKIK----KEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAP  487
             + Q+++ +SN LS+ T++     K   N  +     E       FP+W+S  D+ LL   
Sbjct  178   LTQVTQLISNVLSLYTQLHSLPFKPPRNTTTPLTSHETLE----FPEWMSEGDQELL---  230

Query  486   MGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKK  307
               K K H ++AD VVA DGSG ++SI  A++AAP  S  R+VIY+K G Y E VD+ +K 
Sbjct  231   --KAKPHGVRADAVVALDGSGHYRSITDAVNAAPSYSQRRYVIYVKKGLYKENVDMKRKM  288

Query  306   TMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVA  127
             T IM VGDGIG+T I  NRN   GW TFRTAT+AV G GFIAK +SF N AGP NHQAVA
Sbjct  289   TNIMLVGDGIGQTIITSNRNFMQGWTTFRTATLAVSGKGFIAKDMSFRNTAGPVNHQAVA  348

Query  126   LRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             LR DSD S FY CS  G+QDTLY HS RQF+REC++YGT+DF
Sbjct  349   LRVDSDQSAFYRCSVEGHQDTLYAHSLRQFYRECEIYGTIDF  390



>ref|XP_009111300.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40 
isoform X2 [Brassica rapa]
Length=525

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 155/350 (44%), Positives = 216/350 (62%), Gaps = 37/350 (11%)
 Frame = -3

Query  1005  TLVKTPDLRAK-SIPEIISATVNVTVSEIKTAAANCSRIRRVV-PDLGTMERRALHVCLE  832
             TL KT  L +  +  +++ AT+N T+S++  +++N S ++  +  +L   +R A   CLE
Sbjct  37    TLHKTQHLTSSGNTTDLLVATLNQTISKVNLSSSNFSELQTSLGSNLTHRDRCAFGDCLE  96

Query  831   LFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNK--------NV  676
             L  D + DL   +  L+ SP      +  LLS AMTN  TCLDGF +S+         N 
Sbjct  97    LLDDTVLDLIAAVSELQ-SPYPVFNSVSMLLSAAMTNTRTCLDGFASSDDDEDENTYGNS  155

Query  675   RPFII-----KRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRR  511
             + + +     + +  ISRHV  +L+ML  I  + +N               GFP W+   
Sbjct  156   KTYGLAESMRESLYNISRHVRESLAMLENIPGKLENDV-------------GFPTWV---  199

Query  510   DRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYE  331
             DR LL+ P       + K D+VV+++G+G+F +I  A+SAAP+ S+TRFVIYIK G Y+E
Sbjct  200   DRKLLQDPT-----DETKIDLVVSRNGTGNFTTIGEAVSAAPNLSETRFVIYIKCGVYFE  254

Query  330   YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAG  151
              +++ ++KT IMF+GDGIG+T IK NR+  DGW  F +ATV V GSGFIAK ISF N AG
Sbjct  255   NIEIPREKTTIMFLGDGIGQTVIKANRSGADGWTAFNSATVGVRGSGFIAKDISFVNDAG  314

Query  150   PENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             P  HQAVALR+ SD S FY CSF  YQDT+YVHS +QF+REC++YGTVDF
Sbjct  315   PTKHQAVALRSGSDLSAFYRCSFESYQDTIYVHSHKQFYRECNIYGTVDF  364



>emb|CDY33228.1| BnaC01g37010D [Brassica napus]
Length=592

 Score =   273 bits (699),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 161/381 (42%), Positives = 224/381 (59%), Gaps = 34/381 (9%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             H V  SAC  +LY +LC+S +  +  ++  S  ++I A++N+T   ++       ++ + 
Sbjct  58    HAVLRSACSSTLYPELCISAVATSGGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKN  117

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLSTAMTNQ  718
                L   E+ ALH CLE   + L +L   L+ L+  P K+    HA DL+TL+S+A+TNQ
Sbjct  118   RKGLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQ  177

Query  717   YTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKI------------------K  598
              TCLDGF   +++K VR  ++K    +    SNAL+M+  +                  +
Sbjct  178   ETCLDGFSHDDADKKVRKVLLKGQVHVEHMCSNALAMIKNMTDTDIANFELKAKSFSNNR  237

Query  597   KEKDNrfsssfrRENRGLKD--GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSG  424
             K K+   + S      G  D  G+P WLS  DR LL+          ++AD  VA +GSG
Sbjct  238   KLKEEETTVSVDISGAGEVDAEGWPTWLSAGDRRLLQGS-------SVRADATVAANGSG  290

Query  423   DFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNM  244
              FK+I AA++AAPD+S  R+VI+IKAG Y E VDV KKK  IMF+GDG  +T I GNRN+
Sbjct  291   KFKTIAAAVAAAPDNSKRRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRTIITGNRNV  350

Query  243   KDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDT  64
              DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C  + YQDT
Sbjct  351   VDGSTTFHSATVAAVGESFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDILAYQDT  410

Query  63    LYVHSRRQFFRECDVYGTVDF  1
             LYVHS RQ+F +C + GTVDF
Sbjct  411   LYVHSNRQYFIKCLIAGTVDF  431



>ref|XP_011072691.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=551

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 160/374 (43%), Positives = 230/374 (61%), Gaps = 33/374 (9%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKT--PDLRAKSIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +A S+C  +LY +LC S +  +   + +  S  ++I  ++NVT+S ++    N   I 
Sbjct  43    HAIALSSCSSTLYPELCYSAIADSLSDNKKVTSKKDVIILSLNVTISSVQR---NYFAIE  99

Query  888   RVV----PDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLS  736
             +++     +L   E+ ALH CLE   + L +L T +  L+  P K+    HAD L+TLLS
Sbjct  100   KLLYAGKSNLTEREKTALHDCLETIDETLDELHTAVKDLKEYPLKKSIREHADDLKTLLS  159

Query  735   TAMTNQYTCLDGFP--NSNKNVRPFIIK-RVEQISRHVSNALSMLTKI------KKEKDN  583
             +A+TNQ TCLDGF    S+K+VR  ++  +V ++ +  SN+L+MLT +       + K N
Sbjct  160   SAITNQETCLDGFSYGKSDKHVREVLVGGQVLRVEKLCSNSLAMLTNMTDTDMENERKLN  219

Query  582   rfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINA  403
                     E+     G+P+WLS  DR LL++         ++ D+VVA DGSG+++++ A
Sbjct  220   GGRKLVAAED---GSGWPEWLSAGDRRLLQSS-------SVRPDVVVAADGSGNYRTVGA  269

Query  402   ALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTF  223
             A++AAP+ S  R+VI IKAG Y E V+V KKKT IMF+GDG   T I G+ N++DG  TF
Sbjct  270   AVAAAPERSSRRYVIRIKAGVYRENVEVPKKKTNIMFMGDGRSNTIITGSTNVRDGSTTF  329

Query  222   RTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRR  43
              +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD S FY C  + YQDTLYVHS R
Sbjct  330   NSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSNR  389

Query  42    QFFRECDVYGTVDF  1
             QFF +C + GTVDF
Sbjct  390   QFFVQCLISGTVDF  403



>gb|KHN43320.1| Putative pectinesterase/pectinesterase inhibitor 22 [Glycine 
soja]
Length=508

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 145/331 (44%), Positives = 205/331 (62%), Gaps = 24/331 (7%)
 Frame = -3

Query  960  IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELF-------SDALADLR  802
            ++SA +  T++E + A  N ++I      +   E++A+  C EL        + ++ ++R
Sbjct  37   VVSAALKHTLNEARVAIDNITKITTF--SVSYREQQAIEDCRELLDFSVSELAWSMGEMR  94

Query  801  TVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNA  622
             +  G  N  A+   +L+  LS A++NQ TCL+GF  +++ +  +I   + Q+++ +SN 
Sbjct  95   RIRSGDTN--AQYEGNLEAWLSAALSNQDTCLEGFEGTDRRLESYISGSLTQVTQLISNV  152

Query  621  LSMLTKIK----KEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKA  454
            LS+ T++     K   N  +     E       FP+W+S  D+ LL+A     K H ++A
Sbjct  153  LSLYTQLHSLPFKPPRNTTTPLTSHETLE----FPEWMSEGDQELLKA-----KPHGVRA  203

Query  453  DMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIG  274
            D VVA DGSG ++SI  A++AAP  S  R+VIY+K G Y E VD+ +K T IM VGDGIG
Sbjct  204  DAVVALDGSGHYRSITDAVNAAPSYSQRRYVIYVKKGLYKENVDMKRKMTNIMLVGDGIG  263

Query  273  KTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFY  94
            +T I  NRN   GW TFRTAT+AV G GFIAK +SF N AGP NHQAVALR DSD S FY
Sbjct  264  QTIITSNRNFMQGWTTFRTATLAVSGKGFIAKDMSFRNTAGPVNHQAVALRVDSDQSAFY  323

Query  93   DCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             CS  G+QDTLY HS RQF+REC++YGT+DF
Sbjct  324  RCSVEGHQDTLYAHSLRQFYRECEIYGTIDF  354



>gb|KDP33985.1| hypothetical protein JCGZ_07556 [Jatropha curcas]
Length=583

 Score =   273 bits (698),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 231/404 (57%), Gaps = 27/404 (7%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATTSHDIH-QVAH----SACDHSLYRDLCVSTLVKTP  988
             +   ++L+   +S+    +S  + T S + H Q AH    S+C  +LY +LC ST+   P
Sbjct  26    LFASILLITAIVSIVAGVASRKSTTISANAHHQAAHVVLKSSCSTTLYPELCFSTISTLP  85

Query  987   D---LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDA  817
             D    + KS  ++I  ++NVT   +K   +   ++     +    ER A H CL + ++ 
Sbjct  86    DDAVTKIKSTRDVIDLSLNVTKDSVKQTYSKIEKLAYSGTNYTQRERIAFHDCLLVLNET  145

Query  816   LADLRTVLDGLENSPAK----RHAD-LQTLLSTAMTNQYTCLDGFP--NSNKNVRPFIIK  658
             L ++  V D L+   +K    +HAD L+ LLS AMTNQ TCLDGF    ++K +R   + 
Sbjct  146   LDEINKVEDELKEYSSKETISQHADVLKILLSAAMTNQETCLDGFSYDTADKEIRQLFLD  205

Query  657   RVEQISRHVSNALSMLTKIK-KEKDNrfsssfrRENRGLKDG----FPKWLSRRDRALLE  493
                 + R  SN+L+M+  +   +  N          R L++     +PKW+S  DR LL+
Sbjct  206   DERHVYRLCSNSLAMIKNLTDTDMSNNNEQHSSSSERKLEEENELEWPKWMSAGDRRLLQ  265

Query  492   APMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDK  313
             A         +  ++VVA DGSG+F+++  A+ AAP+   TR++I IKAG Y E V+V K
Sbjct  266   AG-------SVTPNVVVAADGSGNFRTVKEAVDAAPEGLTTRYIIKIKAGVYRENVEVPK  318

Query  312   KKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQA  133
             KKT IMF+GDG   T I G+RN+ DG  TF +ATVA  G GF+A+ I+F+N AGP  HQA
Sbjct  319   KKTNIMFLGDGRTNTIITGSRNVVDGSTTFNSATVAAVGDGFLARDITFQNTAGPSKHQA  378

Query  132   VALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VALR  SD S FY C  + YQDTLYVHS RQF+  C V G+VDF
Sbjct  379   VALRVGSDQSAFYRCDMIAYQDTLYVHSLRQFYVSCIVIGSVDF  422



>ref|XP_009111299.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40 
isoform X1 [Brassica rapa]
Length=525

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 155/350 (44%), Positives = 216/350 (62%), Gaps = 37/350 (11%)
 Frame = -3

Query  1005  TLVKTPDLRAK-SIPEIISATVNVTVSEIKTAAANCSRIRRVV-PDLGTMERRALHVCLE  832
             TL KT  L +  +  +++ AT+N T+S++  +++N S ++  +  +L   +R A   CLE
Sbjct  37    TLHKTQHLTSSGNTTDLLVATLNQTISKVNLSSSNFSELQTSLGSNLTHRDRCAFGDCLE  96

Query  831   LFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNK--------NV  676
             L  D + DL   +  L+ SP      +  LLS AMTN  TCLDGF +S+         N 
Sbjct  97    LLDDTVLDLIAAVSELQ-SPYPVFNSVSMLLSAAMTNTRTCLDGFASSDDDEDENTYGNS  155

Query  675   RPFII-----KRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRR  511
             + + +     + +  ISRHV  +L+ML  I  + +N               GFP W+   
Sbjct  156   KTYGLAESMRESLYNISRHVRESLAMLENIPGKLENDV-------------GFPTWV---  199

Query  510   DRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYE  331
             DR LL+ P       + K D+VV+++G+G+F +I  A+SAAP+ S+TRFVIYIK G Y+E
Sbjct  200   DRKLLQDPT-----DETKIDLVVSRNGTGNFTTIGEAVSAAPNLSETRFVIYIKCGVYFE  254

Query  330   YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAG  151
              +++ ++KT IMF+GDGIG+T IK NR+  DGW  F +ATV V GSGFIAK ISF N AG
Sbjct  255   NIEIPREKTTIMFLGDGIGQTVIKANRSGADGWTAFNSATVGVRGSGFIAKDISFVNDAG  314

Query  150   PENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             P  HQAVALR+ SD S FY CSF  YQDT+YVHS +QF+REC++YGTVDF
Sbjct  315   PTKHQAVALRSGSDLSAFYRCSFESYQDTIYVHSHKQFYRECNIYGTVDF  364



>ref|XP_011084508.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Sesamum indicum]
Length=593

 Score =   273 bits (699),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 152/365 (42%), Positives = 220/365 (60%), Gaps = 21/365 (6%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  880
             Q    AC  +LY  LC+++L+  P     S  E++  +VN+T+ ++  A  + S IR + 
Sbjct  75    QAMSRACSRTLYPSLCLNSLLDFPGAITASDGELVHISVNMTLQKVGRALFSASEIRNL-  133

Query  879   PDLGTMERRALHVCLELFSDAL----ADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYT  712
              D+    R A   CLEL  D++      L +V+ G   +PA    D+ T LS ++TNQ T
Sbjct  134   -DMDPRVRSAYMDCLELLDDSVDLLSRSLTSVVPG--GAPAGSTQDVLTWLSASLTNQDT  190

Query  711   CLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG-  535
             C +GF   N  V+  +  R++ +S  VSN L++      ++D        R  R L    
Sbjct  191   CNEGFDELNGFVKSQMSDRLKDLSELVSNCLAIYAAAGGDRDFSGIPIQNRRRRLLSHKK  250

Query  534   ------FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSD  373
                    P WLSRR+R LL+ P+       I AD++V+KDG+G +K+I  A+  AP+ S+
Sbjct  251   EHEPFPLPIWLSRRERVLLDMPVSA-----INADIIVSKDGNGSYKTIAEAIKKAPEHSN  305

Query  372   TRFVIYIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGG  196
              RF+IY++AG Y E  + V +KKT IMF+GDG GKT I G ++++D   TF TA+ A  G
Sbjct  306   RRFIIYVRAGRYEEDNLKVGRKKTNIMFIGDGKGKTVISGGKSVQDKLTTFHTASFAATG  365

Query  195   SGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVY  16
             +GFIA+ I+FEN+AGP  HQAVALR  +D++V Y C+ +GYQDTLY HS+RQF+RECD+Y
Sbjct  366   AGFIARDITFENWAGPSKHQAVALRVGADHAVVYRCNVIGYQDTLYTHSQRQFYRECDIY  425

Query  15    GTVDF  1
             GTVDF
Sbjct  426   GTVDF  430



>gb|EYU21270.1| hypothetical protein MIMGU_mgv1a003278mg [Erythranthe guttata]
Length=594

 Score =   273 bits (698),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 168/415 (40%), Positives = 242/415 (58%), Gaps = 39/415 (9%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVF--QSSAMNATTSHDI-----HQVAHSACDHSLYRDLCVSTLV  997
             + L   +LLA  +   V   +S   N+  S DI     H +A S+C ++LY +LC S + 
Sbjct  28    LALFASILLAAAIVGVVVGVKSRKENSEDSSDIKLSRAHAIAKSSCSNTLYPELCYSAIA  87

Query  996   KTPD---LRAKSIPEIISATVNVTVSEIK------TAAANCSRIRRVVPDLGTMERRALH  844
              + D    + KS  ++I  ++NVT + ++                    +L   E+ ALH
Sbjct  88    DSLDGGKEKVKSKKDVIILSLNVTTAAVRRNYFAIEKLLAGGGGGAKSGNLTEREKSALH  147

Query  843   VCLELFSDALADLRTVLDGLENSPA-----KRHAD-LQTLLSTAMTNQYTCLDGFPN--S  688
              CLE   + L +L   ++ L+  P+     K HAD L+TL+S+A+TNQ TCLDGF +  +
Sbjct  148   DCLETIGETLDELHAAVEDLKEYPSLKKSVKNHADYLKTLISSAITNQETCLDGFSHGKT  207

Query  687   NKNVRPFIIK-RVEQISRHVSNALSML-----TKIKKEKDNrfsssfrRENRGLKDGFPK  526
             +++ R  ++  +V ++ +  SN+L+M+     T I+ EK    S        G   G+P+
Sbjct  208   DRHAREILVGGQVVRVEKLCSNSLAMICNMTDTDIENEKRGLTSGRKLVAEGG--GGWPE  265

Query  525   WLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKA  346
             WLS  DR LL++         +  D+VVA DGSGD ++++AA++AAP+ S+ R+VI IKA
Sbjct  266   WLSSGDRRLLQSST-------VTPDVVVAADGSGDHRTVSAAVAAAPEKSNRRYVIRIKA  318

Query  345   GSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISF  166
             G Y E VDV KKKT IMFVGDG   T I G++N++DG  TF +ATVAV G  F+A+ I+F
Sbjct  319   GVYRENVDVGKKKTNIMFVGDGRSTTIITGSKNVQDGSTTFNSATVAVVGEKFLARDITF  378

Query  165   ENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +N AGP  HQAVALR  SD S FY C  + YQDTLYVHS R FF +C + GTVDF
Sbjct  379   QNTAGPTKHQAVALRVGSDLSAFYRCDILAYQDTLYVHSNRHFFVQCLIAGTVDF  433



>gb|AFQ23194.1| pectin methylesterase [Theobroma cacao]
Length=582

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 236/400 (59%), Gaps = 33/400 (8%)
 Frame = -3

Query  1140  VVLLAPFLSLTVFQSSAMNAT---TSHDIHQVAHSACDHSLYRDLCVSTLVKTP---DLR  979
             +V++A  + +    +S  N+    TSH  H +  SAC  + Y DLC S +   P     +
Sbjct  35    LVIVAAIIGIVAGVNSRNNSDETDTSH--HAIVKSACSITRYPDLCFSEVAAAPAATSKK  92

Query  978   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERR--ALHVCLELFSDALADL  805
              KS  ++I  ++N+T + ++    N  +I++++   G  ER   ALH CLE   + L +L
Sbjct  93    VKSKKDVIELSLNITTTAVE---HNYFKIKKLLAKKGLTEREKTALHDCLETIDETLDEL  149

Query  804   RTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQ  646
                ++ L   P K+    HAD L+TL+S AMTNQ TCLDGF +  ++K +R  +I   + 
Sbjct  150   HEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHDAADKKIRKVLIDGEKY  209

Query  645   ISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD-----GFPKWLSRRDRALLEAPMG  481
             + R  SNAL+M+  +  + D          NR LK+      +P+WLS  DR LL++   
Sbjct  210   VERMCSNALAMIKNMT-DTDIANEMLKTSSNRKLKEQENGIAWPEWLSAGDRRLLQSS--  266

Query  480   KGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTM  301
                   +  D+VVA DGSG++K+++ A++ AP  S  R+VI IKAG Y E V+V KKKT 
Sbjct  267   -----SVTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYRENVEVPKKKTN  321

Query  300   IMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALR  121
             IMF+GDG  +T I G+RN+ DG  TF +ATVAV G  F+A+ I+F+N AGP  HQAVALR
Sbjct  322   IMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARSITFQNTAGPSKHQAVALR  381

Query  120   ADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               +D S FY+C  + YQDTLY HS RQF+  C + GTVDF
Sbjct  382   VGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDF  421



>emb|CAC01624.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=579

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 166/405 (41%), Positives = 232/405 (57%), Gaps = 39/405 (10%)
 Frame = -3

Query  1137  VLLAPFLSLTVFQSSA--MNATTSHD------IHQVAHSACDHSLYRDLCVSTLVKTPDL  982
             +LLA F +L +  + A  +    SH        H V  SAC  +LY +LC S +   P +
Sbjct  27    LLLASFAALFLVATIAAVVAGVNSHKNGENEGAHAVLKSACSSTLYPELCYSAIATVPGV  86

Query  981   RAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPD--LGTMERRALHVCLELFSDAL  814
                  S+ ++I  ++N+T    KT   N   + +++    L   E+ ALH CLE   + L
Sbjct  87    TGNLASLKDVIELSINLTT---KTVQQNYFTVEKLIAKTKLTKREKTALHDCLETIDETL  143

Query  813   ADLRTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKR  655
              +L      +   P K+     AD L TLLS+A+TNQ TCLDGF +  ++K VR  ++K 
Sbjct  144   DELHEAQVDISGYPNKKSLKEQADNLITLLSSAITNQETCLDGFSHDGADKKVRKALLKG  203

Query  654   VEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG-------FPKWLSRRDRALL  496
                + +  SNAL+M   IK   D   ++  +  NR LK+        +P+W+S  DR LL
Sbjct  204   QTHVEKMCSNALAM---IKNMTDTDIANELQNTNRKLKEEKEGNERVWPEWMSVADRRLL  260

Query  495   EAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVD  316
             ++         +  ++VVA DGSGD+K+++ A++AAP  S  R++I IKAG Y E V+V 
Sbjct  261   QSS-------SVTPNVVVAADGSGDYKTVSEAVAAAPKKSSKRYIIQIKAGVYRENVEVP  313

Query  315   KKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQ  136
             K K  IMF+GDG   T I  +RN+ DG  TF++ATVA  G GF+A+G++FEN AGP  HQ
Sbjct  314   KDKHNIMFLGDGRKTTIITASRNVVDGSTTFKSATVAAVGQGFLARGVTFENTAGPSKHQ  373

Query  135   AVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVALR  SD S FY+C  + YQDTLYVHS RQFF  C V GTVDF
Sbjct  374   AVALRVGSDLSAFYECDMLAYQDTLYVHSNRQFFINCFVAGTVDF  418



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 236/400 (59%), Gaps = 33/400 (8%)
 Frame = -3

Query  1140  VVLLAPFLSLTVFQSSAMNAT---TSHDIHQVAHSACDHSLYRDLCVSTLVKTP---DLR  979
             +V++A  + +    +S  N+    TSH  H +  SAC  + Y DLC S +   P     +
Sbjct  35    LVIVAAIIGIVAGVNSRNNSDETDTSH--HAIVKSACSITRYPDLCFSEVAAAPAATSKK  92

Query  978   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERR--ALHVCLELFSDALADL  805
              KS  ++I  ++N+T + ++    N  +I++++   G  ER   ALH CLE   + L +L
Sbjct  93    VKSKKDVIELSLNITTTAVE---HNYFKIKKLLAKKGLTEREKTALHDCLETIDETLDEL  149

Query  804   RTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQ  646
                ++ L   P K+    HAD L+TL+S AMTNQ TCLDGF +  ++K +R  +I   + 
Sbjct  150   HEAVEDLHEYPNKKSLTQHADDLKTLMSAAMTNQETCLDGFSHDAADKKIRKVLIDGEKY  209

Query  645   ISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD-----GFPKWLSRRDRALLEAPMG  481
             + R  SNAL+M+  +  + D          NR LK+      +P+WLS  DR LL++   
Sbjct  210   VERMCSNALAMIKNMT-DTDIANEMLKTSSNRKLKEQENGIAWPEWLSAGDRRLLQSS--  266

Query  480   KGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTM  301
                   +  D+VVA DGSG++K+++ A++ AP  S  R+VI IKAG Y E V+V KKKT 
Sbjct  267   -----SVTPDVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYRENVEVPKKKTN  321

Query  300   IMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALR  121
             IMF+GDG  +T I G+RN+ DG  TF +ATVAV G  F+A+ I+F+N AGP  HQAVALR
Sbjct  322   IMFLGDGRTETIITGSRNVVDGSTTFHSATVAVVGERFLARDITFQNTAGPSKHQAVALR  381

Query  120   ADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               +D S FY+C  + YQDTLY HS RQF+  C + GTVDF
Sbjct  382   VGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDF  421



>ref|XP_010261669.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 12 
[Nelumbo nucifera]
Length=574

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/397 (39%), Positives = 235/397 (59%), Gaps = 26/397 (7%)
 Frame = -3

Query  1170  LGRNPIMLVPVVLLAPFLSLTVFQSSAMNAT-TSHDIHQVA-HSACDHSLYRDLCVSTLV  997
             L R  ++L  + ++ P+    V  SS  +AT T+ D H  +  S C  + Y D C  +L 
Sbjct  37    LLRTFLLLSTIFIVRPW---AVNSSSFSSATDTTLDAHLASIRSFCKSTPYPDACFDSL-  92

Query  996   KTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM-----ERRALHVCLE  832
               P +     P II       +  ++TA     ++  +  ++G++     ++ A+  C E
Sbjct  93    -KPSISINIKPNIIG----YALQSLQTAIFEADKLLDLFLNIGSLGVVEKQKGAIQDCKE  147

Query  831   LFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRV  652
             L    ++ L+  L  + +  A++ +D +  LS ++TN+ TCL+G  ++   ++  I++ +
Sbjct  148   LHQITMSSLQRSLSRIRSGDARKLSDARAFLSASLTNKNTCLEGLDSATGPLKSVIVQSI  207

Query  651   EQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGK  472
               + RH+SN+LSML K +  K           NR L  GFP W+SR+DR +L++  G   
Sbjct  208   TSVYRHISNSLSMLPKQELRK------VTEGSNRRLM-GFPAWVSRKDRRILQSFDGDYN  260

Query  471   KHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMF  292
              +D+   + VAKDGSG+F +I  A++ AP++S  R +IYI+AG Y E +D+   KT I+ 
Sbjct  261   PNDV---LTVAKDGSGNFTTITDAVNFAPNTSYDRTIIYIRAGIYQENLDIPSYKTNIVL  317

Query  291   VGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADS  112
             +GDG   T I GNR++ DGW TFR+ATVAV G GF+A+ I FEN AGPE HQAVALR ++
Sbjct  318   LGDGADVTIITGNRSVGDGWTTFRSATVAVSGDGFLARDIKFENTAGPEKHQAVALRVNA  377

Query  111   DYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             D S  Y C+  GYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  378   DLSAVYRCAIDGYQDTLYVHSFRQFYRECDIYGTVDF  414



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 158/368 (43%), Positives = 215/368 (58%), Gaps = 24/368 (7%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAKSI---PEIISATVNVTVSEIKTAAANCSRI  892
             H +  S+C ++LY DLC STL   P   ++ I    ++I   +N T + ++        +
Sbjct  69    HAIVKSSCSNTLYPDLCFSTLANLPQAVSQKITSQKDVIELVLNHTTTTVEHNYFAVEHL  128

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLSTAM  727
                  +L   E+ ALH CLE   + L +L   +  LE  P+K+    HAD L+TL+S AM
Sbjct  129   IATHHNLTEREKTALHDCLETIDETLDELHQTVKDLELYPSKKSLKQHADDLKTLMSAAM  188

Query  726   TNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrREN  553
             TNQ TCLDGF   +++K+VR  +      + +  SNAL+M   IK   D           
Sbjct  189   TNQETCLDGFSHDDADKHVRQELSNGQVHVEKLCSNALAM---IKNMTDTDMERESEAGG  245

Query  552   RGLKD----GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAP  385
             R L++    G+P WLS  DR LL++         + AD+VVA DGSGDFK+++AA+ AAP
Sbjct  246   RKLEEEETNGWPNWLSAGDRRLLQSST-------VTADVVVAADGSGDFKTVSAAVEAAP  298

Query  384   DSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVA  205
             + S  R+VI IKAG Y E V+V KKKT IMF+GDG  KT I  +RN+ DG  TF +ATVA
Sbjct  299   EKSSRRYVIRIKAGVYRENVEVPKKKTNIMFLGDGRTKTIITASRNVVDGSTTFHSATVA  358

Query  204   VGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFREC  25
               G  F+A+ ++F+N AG   HQAVALR  SD S FY C  + +QDTLY HS RQF+  C
Sbjct  359   AVGERFLARDLTFQNTAGSSKHQAVALRVGSDLSAFYQCDILAHQDTLYAHSNRQFYINC  418

Query  24    DVYGTVDF  1
              + GTVDF
Sbjct  419   LIAGTVDF  426



>ref|XP_002885033.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61292.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   271 bits (692),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 159/388 (41%), Positives = 226/388 (58%), Gaps = 35/388 (9%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  S+C  + Y +LC+S +  T  +   S  ++I A++N+T+  ++    N 
Sbjct  49    TLSPSSHAVLRSSCSSTRYPELCISAVANTGGVEITSQKDVIEASLNLTIIAVEHNYFNV  108

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLS  736
              ++ +    L   E+ ALH CLE   + L +L   ++ L   PA++    HA DL+TL+S
Sbjct  109   KKLIKKRKGLTPREKTALHDCLETIDETLDELHETVEDLHLYPARKTLREHAGDLKTLIS  168

Query  735   TAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLT---------------  607
             +A+TNQ TCLDGF   +++K VR  ++K    +    SNAL+M+                
Sbjct  169   SAITNQETCLDGFSHDDADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAK  228

Query  606   ------KIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMV  445
                   K+K+E      +          +G+P WLS  DR LL+          +KAD  
Sbjct  229   ITSNNRKLKEENQETTVADIAGAGELDAEGWPTWLSAGDRRLLQGS-------SVKADAT  281

Query  444   VAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTR  265
             VA DGSG FK++ AA++AAP++S+ R+VI+IKAG Y E V+V KKK  IMF+GDG  +T 
Sbjct  282   VAADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTI  341

Query  264   IKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCS  85
             I G+RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C 
Sbjct  342   ITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCD  401

Query  84    FVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              + YQDTLYVHS RQFF +C + GTVDF
Sbjct  402   MLAYQDTLYVHSNRQFFIKCIIAGTVDF  429



>ref|XP_006407094.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
 gb|ESQ48547.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
Length=592

 Score =   271 bits (692),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 226/387 (58%), Gaps = 34/387 (9%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  S+C  +LY +LCVS +  + D++  S  ++I A++N+T   ++      
Sbjct  52    TLSASSHAVLRSSCSSTLYPELCVSAVATSGDVKLTSQKDVIEASLNLTTIAVEHNYFTV  111

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLS  736
              ++ +    L   E+ ALH CLE   + L +L   ++ L   P K+    HA DL+TL+S
Sbjct  112   KKLIKNRKGLTPREKTALHDCLETIDETLDELHEAVEDLHLYPTKKTLREHAGDLKTLIS  171

Query  735   TAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLTKIK------------  598
             +A+TNQ TCLDGF +  ++K VR  ++K    +    SNAL+M+  +             
Sbjct  172   SAITNQETCLDGFSHDAADKKVRKALMKGQIHVEHMCSNALAMIKNMTDTDIANFELKAK  231

Query  597   --------KEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVV  442
                     KE++   S +         +G+P WLS  DR LL+          +KAD  V
Sbjct  232   LTSNNRKLKEEETTASINIAGAGELDSEGWPTWLSAGDRRLLQGST-------VKADATV  284

Query  441   AKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRI  262
             A DGSG FK++ AA++AAP++S+ R+VI+IKAG Y E V+V KKK  IMF+GDG  +T I
Sbjct  285   AADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTII  344

Query  261   KGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSF  82
               NRN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C  
Sbjct  345   TANRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDM  404

Query  81    VGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + YQDTLYVHS RQFF +C + GTVDF
Sbjct  405   LAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>ref|XP_006388348.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
 gb|ERP47262.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
Length=579

 Score =   270 bits (691),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 155/372 (42%), Positives = 222/372 (60%), Gaps = 31/372 (8%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +  SAC  +LY +LC S +   P + +   S+ ++I  ++N+T    KT   N   + 
Sbjct  60    HAILKSACSSTLYPELCYSAIATVPGVTSNLASLKDVIELSINLTT---KTVQQNYFTVE  116

Query  888   RVVPD--LGTMERRALHVCLELFSDALADLRTV---LDGLENSPA-KRHAD-LQTLLSTA  730
             +++    L   E+ ALH CLE   + L +L      ++G  N  + K  AD L+TLLS+A
Sbjct  117   KLIAKTKLTKREKTALHDCLETIDETLDELHEAQVDINGYPNKKSLKEQADNLKTLLSSA  176

Query  729   MTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRE  556
             +TNQ TCLDGF +  ++K VR  ++K    + +  SNAL+M   I+   D   ++  +  
Sbjct  177   ITNQETCLDGFSHDGADKKVRKALLKGQTHVEKMCSNALAM---IRNMTDTDIANELQNT  233

Query  555   NRGLKDG-------FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAAL  397
             NR LK+        +P+W+S  DR LL++         +  ++VVA DGSGD+K+++ A+
Sbjct  234   NRKLKEEKEGNERVWPEWMSVADRRLLQSS-------SVTPNVVVAADGSGDYKTVSEAV  286

Query  396   SAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRT  217
             +A P  S TR+VI IKAG Y E V+V K K  +MF+GDG   T I  +RN+ DG  TF++
Sbjct  287   AAVPKKSSTRYVIQIKAGVYRENVEVPKDKHNVMFLGDGRKTTIITASRNVVDGSTTFKS  346

Query  216   ATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQF  37
             ATVA  G GF+A+G++FEN AGP  HQAVALR  SD S FY+C  + YQDTLY HS RQF
Sbjct  347   ATVAAVGQGFLARGVTFENTAGPSKHQAVALRVGSDLSAFYECDMLAYQDTLYAHSNRQF  406

Query  36    FRECDVYGTVDF  1
             F  C + GTVDF
Sbjct  407   FINCLIAGTVDF  418



>ref|XP_009338231.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Pyrus x bretschneideri]
Length=536

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 147/369 (40%), Positives = 214/369 (58%), Gaps = 17/369 (5%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVST----LVKTPDLRAKSIPEIISATVNVTVSEIKTA  913
             T+SH I  +    C     R+LC++     L KT      S+  II+A +  T++E K A
Sbjct  22    TSSHSIQSMVTQTCTDIDDRNLCLANVQAELQKTGPQIQDSV-SIITAALRHTLNETKNA  80

Query  912   AANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL-----ENSPAKRHADLQ  748
                 ++   +   +   E  A+  C EL   ++++L   L  +      ++      DL+
Sbjct  81    IQMITKFNSL--SISYRESVAIEDCKELLDYSVSELAWSLGEMIKIRGGDTNVHYEGDLK  138

Query  747   TLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsss  568
             + LS A++NQ TCL+GF  +++ +  F+   ++Q+++ + N L++ T++           
Sbjct  139   SWLSAALSNQDTCLEGFEGTDRRLESFVRGSLKQVTQLIGNVLALYTQLYSLPSPPGDHG  198

Query  567   frRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAA  388
                      D FP W+S  D+AL+++    G KH      VVA DGSG +++I  A++ A
Sbjct  199   PPMNKSSSGDDFPAWMSEDDKALVKSNPKSGAKH-----AVVAADGSGQYRTITEAVNEA  253

Query  387   PDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATV  208
             P+ S +R+VIY+K G Y E +D+ KKKT IMFVGDGIG+T I GNRN   GW TFRTATV
Sbjct  254   PNYSPSRYVIYVKKGIYKENIDLKKKKTNIMFVGDGIGQTIITGNRNFMQGWTTFRTATV  313

Query  207   AVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRE  28
             AV G GFIA+ ++  N AGP+NHQ VALR DSD S F+ CS  G QDTLY HS RQF+RE
Sbjct  314   AVSGKGFIAREMTIRNTAGPQNHQGVALRVDSDQSAFFRCSIEGNQDTLYAHSLRQFYRE  373

Query  27    CDVYGTVDF  1
             C +YGT+DF
Sbjct  374   CSIYGTIDF  382



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score =   270 bits (691),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 233/404 (58%), Gaps = 30/404 (7%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATTSHDI---HQVAHSACDHSLYRDLCVSTLVKTPDL  982
             +   ++L+   + +     S+ N +    I   H +  S+C  +LY DLC STL   P+ 
Sbjct  31    LFATILLVGAVIGIVTGVKSSKNNSDDETIEASHAIVKSSCSSTLYPDLCFSTLALHPEA  90

Query  981   RAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPD-LGTMERRALHVCLELFSDALA  811
               K  S  ++I  ++N+T + ++       ++ +   + L   E+ ALH CLE   + L 
Sbjct  91    SKKVSSQKDVIELSLNITTTAVQHIFFTVEKLLKSRKNKLTKREKGALHDCLETIDETLD  150

Query  810   DLRTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRV  652
             +L   ++ L   P  +    HAD L+TL S+A+TNQ TCL+GF +   +K VR  ++   
Sbjct  151   ELHEAVEDLHEYPNNKTLVQHADDLKTLJSSAITNQETCLNGFSHDGGDKKVRKVLLAGE  210

Query  651   EQISRHVSNALSMLTKIKKEKDNrfsssfrRE-NRGLKD------GFPKWLSRRDRALLE  493
             E I +  SN L+M   IK   D   ++  +   NR LK+      G+P+WLS  DR LL+
Sbjct  211   EHIEKLCSNVLAM---IKNMTDTDIANEMKMNVNRKLKENMVDEHGWPEWLSVADRRLLQ  267

Query  492   APMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDK  313
             +         +  ++VVA DG+G++K+++ A++AAP+ S +R+VI IKAG Y E VDV K
Sbjct  268   SS-------SVTPNVVVAADGTGNYKTVSEAVAAAPEKSSSRYVIKIKAGIYRENVDVPK  320

Query  312   KKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQA  133
             KKT IMF+GDG   T I  +RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQA
Sbjct  321   KKTNIMFLGDGRVNTIITASRNVVDGSTTFNSATVAAVGEKFLARDITFQNTAGPSKHQA  380

Query  132   VALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             VALR  SD S FY C  + YQD+LYVHS RQFF  C V GTVDF
Sbjct  381   VALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDF  424



>gb|AFW03476.1| pectin methylesterase 2 [Gossypium barbadense]
Length=521

 Score =   268 bits (686),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 162/403 (40%), Positives = 237/403 (59%), Gaps = 34/403 (8%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPD--L  982
             +++  +V +A  +S++  +SS   A      H +  S+C  +LY +LC ST+   PD   
Sbjct  20    LLVTAIVTIATTVSISKKKSSNTVAA-----HSIIKSSCSSTLYPELCYSTISSAPDAET  74

Query  981   RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP----DLGTMERRALHVCLELFSDAL  814
             + K+  ++I  ++N+TV+ +++   N   I++++      L   E+ AL+ CLEL  + L
Sbjct  75    KVKNPKDVIELSLNLTVTAVQS---NYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  813   ADLRTVLDGLENSPA-----KRHAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIK  658
              +L      L + P+      +HAD L++LLS AMTNQ TCLDGF +  ++K VR  ++ 
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  657   RVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG----FPKWLSRRDRALLEA  490
                 +    SNAL+M+  +  + D           R L++     +PKWLS  DR LL+A
Sbjct  192   GQMHVFHMCSNALAMIKNLT-DTDMASQGYHPSSGRQLEEQDQTEWPKWLSEGDRRLLQA  250

Query  489   PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKK  310
                      +  ++ VA DGSGDF +++ A++AAP+ S TR++I IKAG Y E VDV  K
Sbjct  251   TT-------VIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDVPSK  303

Query  309   KTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAV  130
             KT +MFVGDG   T I  +RN+ DG  TF +ATVA  G GF+A+ I+F+N AGP  HQAV
Sbjct  304   KTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKHQAV  363

Query  129   ALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR  SD S FY C  + YQDTLYVHS RQF+ +C V G+VDF
Sbjct  364   ALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDF  406



>ref|XP_006392745.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
 gb|ESQ30031.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
Length=584

 Score =   270 bits (691),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 172/426 (40%), Positives = 240/426 (56%), Gaps = 42/426 (10%)
 Frame = -3

Query  1185  SEMQNLGRNPIMLVPVVLLAPFLSLTVF---------QSSAMNATTSHDIHQVAHSACDH  1033
             S+  +   N  ++    +LA  L  TV           +S    T S   H V  S C  
Sbjct  9     SKFSDFKNNKKLVFSSAVLALLLFATVVGIATTKANHNNSQKTKTLSLTSHAVLKSVCTS  68

Query  1032  SLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPD----LGT  865
             + Y +LC S +  T   +  S  ++I A++N+T + +K    N   +++++      L  
Sbjct  69    TRYPELCFSAVASTGK-KLTSHKDVIEASLNLTTNVVK---HNYFAVKKLITKRKGGLRA  124

Query  864   MERRALHVCLELFSDALADLRTVLDGLENSPA----KRHAD-LQTLLSTAMTNQYTCLDG  700
              E  ALH CLE   + L +L   ++ L   P     ++HAD L+TL+S+A+TNQ TCLDG
Sbjct  125   REATALHDCLETIDETLDELHVAVEDLHQYPKGKSLRKHADDLKTLISSAITNQETCLDG  184

Query  699   FP--NSNKNVRPFIIKRVEQISRHVSNALSM---LTKIKKEKDNrfsssfrRENRGLKD-  538
             F   ++++ VR  ++K    +    SNAL+M   +T            S    NR LK+ 
Sbjct  185   FSYDDADRKVRKALMKGQVHVEHMCSNALAMIKNMTDTDIANFELKDRSTSSNNRKLKEV  244

Query  537   -------GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDS  379
                    G+P WLS  DR LL+          +KAD+ VA DGSGDF++I AA++AAP+ 
Sbjct  245   TGDLDGEGWPNWLSVGDRRLLQGST-------VKADVTVAADGSGDFRTIAAAVAAAPEK  297

Query  378   SDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVG  199
             S+ RFVI+IKAG Y E V+V KKK  +MF+GDG GKT I G+RN+ DG  TF +ATVA  
Sbjct  298   SNKRFVIHIKAGVYRENVEVTKKKKNVMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAV  357

Query  198   GSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDV  19
             G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C +
Sbjct  358   GERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHI  417

Query  18    YGTVDF  1
              GTVDF
Sbjct  418   IGTVDF  423



>gb|KFK38797.1| hypothetical protein AALP_AA3G161500 [Arabis alpina]
Length=593

 Score =   270 bits (691),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 160/388 (41%), Positives = 227/388 (59%), Gaps = 35/388 (9%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  SAC  +LY +LC+S L  + D++  S  ++I A++N+T + ++      
Sbjct  52    TLSPSSHAVLRSACSPTLYPELCISALATSGDVKLTSQKDVIEASLNLTTTVVEHNYFTV  111

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLS  736
              ++ +    L   E+ ALH CLE   + L +L   ++ L   P K+    HA DL+TL+S
Sbjct  112   KKLIKNRKGLTPREKTALHDCLETIDETLDELHEAVEDLHVYPNKKTLREHAGDLKTLIS  171

Query  735   TAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLT---------------  607
             +A+TNQ TCLDGF +  ++K VR  ++K  + + R  SNAL+M+                
Sbjct  172   SAITNQETCLDGFSHDEADKKVRKALLKGQKHVERMCSNALAMIKNMTDTDIANFDLKAK  231

Query  606   ------KIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMV  445
                   K+K+E++   +           +G+P WLS  DR LL+          ++AD  
Sbjct  232   LTTNNRKLKEEEETTVAVDIAGAGELDSEGWPTWLSAGDRRLLQGST-------VRADAT  284

Query  444   VAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTR  265
             VA DGSG FK+I AA++AAP +S+ R+VI+IKAG Y E V+V K K  IMF+GDG  +T 
Sbjct  285   VAADGSGQFKTIAAAVAAAPANSNKRYVIHIKAGVYRENVEVAKTKKNIMFMGDGRTRTI  344

Query  264   IKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCS  85
             I  +RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C 
Sbjct  345   ITASRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCD  404

Query  84    FVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              + YQDTLYVHS RQFF +C + GTVDF
Sbjct  405   MLAYQDTLYVHSNRQFFVKCLIAGTVDF  432



>gb|KDP40627.1| hypothetical protein JCGZ_24626 [Jatropha curcas]
Length=581

 Score =   270 bits (690),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 213/372 (57%), Gaps = 28/372 (8%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +  S+C  + + +LC S +   P   A   S  ++I  ++N+T + ++    N   + 
Sbjct  59    HAILKSSCSSTRFPELCFSAVASVPGATANLASQKDVIELSINLTTTAVQ---HNFFTVE  115

Query  888   RVVP--DLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLSTA  730
             +++    L   E+ ALH CLE   + L +L    + LE  P K+    HAD L+TLLS+A
Sbjct  116   KLIATRKLTKREKTALHDCLETIDETLDELHKAAEDLEEYPNKKSLSQHADDLKTLLSSA  175

Query  729   MTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRE  556
             +TNQ TCLDGF +  ++K +R  ++     + +  SNAL+M+  +               
Sbjct  176   ITNQETCLDGFSHDEADKRIREALLDGQVHVEKMCSNALAMIKNMTDTDIADELKLAATT  235

Query  555   NRGLKD-------GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAAL  397
             NR LK+       G+P+WLS  DR LL++         +  D+VVA DGSG +K I  A+
Sbjct  236   NRKLKEEGKNQESGWPEWLSAGDRRLLQSS-------SVTPDVVVAADGSGKYKKIQDAV  288

Query  396   SAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRT  217
             +AAP  S  R++I IKAG Y E V+V K KT IMF+GDG   T I  +RN+ DG  TF +
Sbjct  289   NAAPSKSSKRYIIRIKAGVYRENVEVPKSKTNIMFLGDGRKTTIITASRNVADGSTTFNS  348

Query  216   ATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQF  37
             ATVA  G GF+AK I+FEN AGP  HQAVALR  SD S FY C  + YQDTLYVHS RQF
Sbjct  349   ATVAAVGQGFLAKDITFENTAGPSKHQAVALRVGSDLSAFYQCDMLAYQDTLYVHSNRQF  408

Query  36    FRECDVYGTVDF  1
             F  C V GTVDF
Sbjct  409   FINCLVAGTVDF  420



>ref|XP_008806757.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 34 [Phoenix dactylifera]
Length=587

 Score =   270 bits (690),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 149/366 (41%), Positives = 217/366 (59%), Gaps = 15/366 (4%)
 Frame = -3

Query  1074  SHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSR  895
             +H   Q     C  + Y  LC+S+ +  P        +++  ++N+T   ++ A    S 
Sbjct  66    NHTPTQAISQTCSLTRYPALCISSFLDFPGALDAGQRDLVHISLNMTKQRVRKALYGASA  125

Query  894   IRRVVPDLGTMERRALHVCLELFSDALADLR---TVLDGLENSPA-KRHADLQTLLSTAM  727
             I  V   +  + R A   C+EL  D+L  L     V+    + PA     D+ T LS A+
Sbjct  126   IAGV--SMAPLARAAYEDCMELLDDSLDQLSQSLAVVSPSASGPAGSSDVDVLTWLSAAL  183

Query  726   TNQYTCLDGFPN-SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENR  550
             TNQ TC +G  + ++  VR  +   ++ ++  VSN L++ +  ++ KD        ++ R
Sbjct  184   TNQDTCTEGLADVADGYVRGQMESYLKDLAELVSNCLAIFSATRRNKDFSGIPIQNKKRR  243

Query  549   GLKDG---FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDS  379
              L  G   FP+WL RRDR LL+ P+ K     I+ADMVV+KDG+G  KSI  A+ AAP+ 
Sbjct  244   LLSSGDGEFPEWLGRRDRRLLQVPVAK-----IQADMVVSKDGNGTHKSIADAVKAAPEH  298

Query  378   SDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVG  199
             S  R VIY+KAG Y E + + +KKT +MF+GDG  KT + G+R++ + + TF TAT A  
Sbjct  299   STRRIVIYVKAGRYDENIKISRKKTNLMFIGDGKAKTIVAGSRSVAENYTTFHTATFAST  358

Query  198   GSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDV  19
             G+GFI + ++ EN+AGP  HQAVALR  +D++V Y C+ +GYQDTLYVHS+RQFFRECDV
Sbjct  359   GNGFIMRDMTIENWAGPAKHQAVALRVGADHAVVYRCNIIGYQDTLYVHSQRQFFRECDV  418

Query  18    YGTVDF  1
             YGTVDF
Sbjct  419   YGTVDF  424



>ref|XP_009116991.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   270 bits (691),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 157/379 (41%), Positives = 222/379 (59%), Gaps = 34/379 (9%)
 Frame = -3

Query  1056  VAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP  877
             V  SAC  +LY +LC+S +  +  ++  S  ++I A++N+T   ++       ++ + + 
Sbjct  60    VLRSACSSTLYTELCISAVATSGGVKLTSQKDVIEASLNLTTIAVEHNYFTVKKLIKNMK  119

Query  876   DLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLSTAMTNQYT  712
              L   E+ ALH CLE   + L +L   L+ L+  P K+    HA DL+TL+S+A+TNQ T
Sbjct  120   GLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQET  179

Query  711   CLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIK--------------------  598
             CLDGF   +++K VR  ++K    +    SNAL+M+  +                     
Sbjct  180   CLDGFSHDDADKKVRKVLLKGQVHVEHMCSNALAMIKNMTDPDIANFELKAKSFSNNRKL  239

Query  597   KEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDF  418
             KE++   S           +G+P WLS  DR LL+          ++AD  VA +GSG F
Sbjct  240   KEEETTVSVDIAGAGEVDAEGWPTWLSAGDRRLLQGS-------SVRADATVAANGSGKF  292

Query  417   KSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKD  238
             K+I AA++AAPD+S  R+VI+IKAG Y E V+V KKK  IMF+GDG  +T I GNRN+ D
Sbjct  293   KTIAAAVAAAPDNSKRRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNRNVVD  352

Query  237   GWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLY  58
             G  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY C  + YQDTLY
Sbjct  353   GSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLY  412

Query  57    VHSRRQFFRECDVYGTVDF  1
             VHS RQ+F +C + GTVDF
Sbjct  413   VHSNRQYFVKCLIAGTVDF  431



>emb|CDY51798.1| BnaC06g41940D [Brassica napus]
Length=585

 Score =   270 bits (689),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 166/406 (41%), Positives = 232/406 (57%), Gaps = 30/406 (7%)
 Frame = -3

Query  1149  LVPVVLLAPFLSLTVFQSSAMN----ATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDL  982
             ++ +VL +  + + V +S+        T S   H V  S C  +LY +LC S +  T   
Sbjct  26    VLALVLFSAVVGIAVTKSNQTKNQKIPTLSPTSHAVLKSVCSSTLYPELCFSAVAATGK-  84

Query  981   RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLR  802
             +  S  ++I A++N+T + +K       ++      L   E  ALH CLE+  + L +L 
Sbjct  85    KLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTARELTALHDCLEIIDETLDELH  144

Query  801   TVLDGLENSPA----KRHAD-LQTLLSTAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQI  643
               L+ L   P     ++HAD L+TL+S+A+TNQ TCLDGF    +++ +R  ++K    +
Sbjct  145   VALEDLHQYPKGKSLRKHADDLKTLISSAITNQGTCLDGFSYDKADRKLRKALLKGQVHV  204

Query  642   SRHVSNALSM---LTKIKKEKDNrfsssfrRENRGLKD---------GFPKWLSRRDRAL  499
                 SNAL+M   +T            S    NR LK+         G+P WLS  DR L
Sbjct  205   EHMCSNALAMIKNMTDTDIANFELKDKSGSTNNRKLKEELTGDLDGEGWPNWLSIGDRRL  264

Query  498   LEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDV  319
             L+   G      + AD  VA DGSGDF ++ AA++AAP+ S+ R+VI+IKAG Y E V+V
Sbjct  265   LQGSTG------VNADATVAADGSGDFTTVAAAVAAAPEKSNKRYVIHIKAGVYRENVEV  318

Query  318   DKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENH  139
              KKK  IMF+GDG GKT I G RN+ DG  TF +ATVA  G  F+A+ ++F+N AGP  H
Sbjct  319   SKKKKNIMFLGDGRGKTIITGKRNVVDGSTTFHSATVAAVGERFLARDMTFQNTAGPSKH  378

Query  138   QAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             QAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C + GTVDF
Sbjct  379   QAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIAGTVDF  424



>ref|XP_007136533.1| hypothetical protein PHAVU_009G053000g [Phaseolus vulgaris]
 gb|ESW08527.1| hypothetical protein PHAVU_009G053000g [Phaseolus vulgaris]
Length=585

 Score =   270 bits (689),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 215/358 (60%), Gaps = 13/358 (4%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  880
             Q   S C  + ++ +CV++L+  P  +A S  +++  + NVT+     A    + I    
Sbjct  72    QAISSTCSKTRFQTVCVNSLLDYPGSQAASEKDLVHISFNVTLQHFSKALYTSAAISSAT  131

Query  879   PDLGTMERRALHVCLELFSDALADLRTVLDGLE-NSPAKRHADLQTLLSTAMTNQYTCLD  703
              D     R A   CLEL  D++  L   L  +   +    + D+ T LS A+TNQ TC +
Sbjct  132   MD--PRVRSAYLDCLELLDDSVDALARSLSTVSLGAVGSANEDVVTWLSAALTNQDTCAE  189

Query  702   GFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLK---DGF  532
             GF +++  V+  +   ++ +S  VSN L++ +    + D+      +   R +    D F
Sbjct  190   GFADADGPVKDQMSNNLKDLSELVSNCLAIFSA-AADGDDFAGVPIQNRRRLMAMRADNF  248

Query  531   PKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYI  352
             P+WL+RRDR LL  P+       I+AD+VV+KDG+G  K+I  A+   P+ S  RF+IY+
Sbjct  249   PRWLNRRDRRLLSLPVSA-----IQADIVVSKDGNGTVKTIAEAIKKVPEYSSRRFIIYV  303

Query  351   KAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKG  175
             +AGSY E  + V +KKT +MF+GDG GKT I G +N  D   TF TA+ A  GSGFIA+ 
Sbjct  304   RAGSYEEENLKVGRKKTNLMFIGDGKGKTVITGGKNYMDNLTTFHTASFAASGSGFIARD  363

Query  174   ISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ++FENYAGP+NHQAVALR  +D++V Y C+ +GYQDT+YVHS RQF+RECD+YGTVDF
Sbjct  364   MTFENYAGPQNHQAVALRVGADHAVVYRCNVIGYQDTMYVHSNRQFYRECDIYGTVDF  421



>ref|NP_188048.1| pectin methylesterase 3 [Arabidopsis thaliana]
 sp|O49006.2|PME3_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 3; Includes: 
RecName: Full=Pectinesterase inhibitor 3; AltName: Full=Pectin 
methylesterase inhibitor 3; Includes: RecName: Full=Pectinesterase 
3; Short=PE 3; AltName: Full=Pectin methylesterase 
27; Short=AtPME27; AltName: Full=Pectin methylesterase 
3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01037.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK59769.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAK97722.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAN28889.1| At3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AEE75500.1| pectin methylesterase 3 [Arabidopsis thaliana]
Length=592

 Score =   270 bits (689),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 162/389 (42%), Positives = 230/389 (59%), Gaps = 36/389 (9%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  S+C  + Y +LC+S +V    +   S  ++I A+VN+T++ ++      
Sbjct  50    TLSPSSHAVLRSSCSSTRYPELCISAVVTAGGVELTSQKDVIEASVNLTITAVEHNYFTV  109

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLS  736
              ++ +    L   E+ ALH CLE   + L +L   ++ L   P K+    HA DL+TL+S
Sbjct  110   KKLIKKRKGLTPREKTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLIS  169

Query  735   TAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKI---------KKEK  589
             +A+TNQ TCLDGF   +++K VR  ++K    +    SNAL+M+  +         +K K
Sbjct  170   SAITNQETCLDGFSHDDADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAK  229

Query  588   DNrfsssfrRENRGL-------------KDGFPKWLSRRDRALLEAPMGKGKKHDIKADM  448
                 +   + EN+                +G+P WLS  DR LL+   G G    +KAD 
Sbjct  230   ITSNNRKLKEENQETTVAVDIAGAGELDSEGWPTWLSAGDRRLLQ---GSG----VKADA  282

Query  447   VVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKT  268
              VA DGSG FK++ AA++AAP++S+ R+VI+IKAG Y E V+V KKK  IMF+GDG  +T
Sbjct  283   TVAADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRT  342

Query  267   RIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDC  88
              I G+RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C
Sbjct  343   IITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNC  402

Query  87    SFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               + YQDTLYVHS RQFF +C + GTVDF
Sbjct  403   DMLAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>gb|KFK26958.1| hypothetical protein AALP_AA8G315400 [Arabis alpina]
Length=584

 Score =   269 bits (688),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 158/378 (42%), Positives = 216/378 (57%), Gaps = 27/378 (7%)
 Frame = -3

Query  1092  AMNATTSHD--IHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIK  919
             A+ A   H+  + Q     C  S Y++LC+ TL+  P     +  E+I  + N T+    
Sbjct  57    ALGAGRHHNPKLTQEISRTCSKSQYQNLCIDTLLDFPGALTANEQELIHISFNATLQGFS  116

Query  918   TAAANCSRI---RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL---ENSPAKRHA  757
              A  + S I    ++ P +    R A   CLEL  D++  L   L  +        + H+
Sbjct  117   KALYSSSSISYTNKMPPRV----RSAYDSCLELLDDSVDALSRALSLVAIASEDNGEHHS  172

Query  756   DLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrf  577
             D+ T LS+AMTN  TC DGF   +  V+  II+ V+ +S  VSN L++ +   K+     
Sbjct  173   DVVTWLSSAMTNHDTCTDGFEEISSGVKDQIIEAVKDLSEMVSNCLAIFSGNVKD----L  228

Query  576   sssfrRENRGL-----KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKS  412
             S      NR L      + FPKWL+R DR LL  P        I+AD+ V+KDG+G FK+
Sbjct  229   SGVPVVNNRKLLNTEETEEFPKWLNRGDRELLGTPA-----TTIQADITVSKDGNGTFKT  283

Query  411   INAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNMKDG  235
             I  A+  AP+ S  RFVIY+K+G Y E  + V +KKT IMF+GDG GKT I G +++ + 
Sbjct  284   IAEAIKKAPEHSSRRFVIYVKSGRYEEENLKVGRKKTNIMFIGDGKGKTVITGGKSIAND  343

Query  234   WPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYV  55
               TF TAT A  G+GFI + ++FENYAGP  HQAVALR   D++V Y C+ +GYQD LYV
Sbjct  344   LTTFHTATFAATGAGFIVRDMTFENYAGPAKHQAVALRVGGDHAVVYRCNVIGYQDALYV  403

Query  54    HSRRQFFRECDVYGTVDF  1
             HS RQFFRECD+YGTVDF
Sbjct  404   HSNRQFFRECDIYGTVDF  421



>ref|XP_007139063.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
 gb|ESW11057.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
Length=580

 Score =   269 bits (688),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 162/397 (41%), Positives = 237/397 (60%), Gaps = 30/397 (8%)
 Frame = -3

Query  1137  VLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDL--RAKSIP  964
             + LA    ++  ++SA NA+++   H +  SAC  +LY +LC+S++   P    +  +  
Sbjct  35    IALAVVAGVSSRKNSAHNASSTSS-HAIIKSACSSTLYPELCLSSIASEPGKADKVSTHK  93

Query  963   EIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERR--ALHVCLELFSDALADLRTVLD  790
              +I  ++N+TV  ++    N   + +++   G  +R+  ALH CLE   + L +L   +D
Sbjct  94    NVIEQSLNITVGIVER---NYFTVEKLLRKKGLTKRQKTALHDCLETIDETLDELHKAID  150

Query  789   GLENSPAKR----HA-DLQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHV  631
              L+  P+K+    HA DL+TL+S+A+TNQ TCLDGF +  ++K +R  +           
Sbjct  151   ELKEYPSKKSLSHHAEDLKTLMSSAITNQETCLDGFSHDQADKRLRQHLQAGQVHAEHLC  210

Query  630   SNALSMLTKIKKEKDNrfsssfrREN---RGLKDG----FPKWLSRRDRALLEAPMGKGK  472
             SNAL+M TK   + D   + S   EN   + ++D     +P W+S  DR LL+       
Sbjct  211   SNALAM-TKNLTDNDMAMAMSNNVENERRKTMEDPHEIVWPHWISAADRRLLQTGT----  265

Query  471   KHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMF  292
                +K D+VVA DGSG+F++++AA++AAP+ S  R+VI IKAG Y E VDV KKKT IMF
Sbjct  266   ---VKPDVVVAADGSGNFRTVSAAVAAAPEKSSKRYVIRIKAGVYRENVDVSKKKTNIMF  322

Query  291   VGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADS  112
             +GDG   T I  +RN+ DG  TF +ATV V G  F+ + I+F+N AGP  HQAVALR  +
Sbjct  323   LGDGRTNTIITASRNVVDGSTTFNSATVVVVGERFLGRDITFQNTAGPSKHQAVALRVGA  382

Query  111   DYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             D S FY C F+ YQDTLYVHS RQFF  C + G+VDF
Sbjct  383   DLSAFYRCDFLAYQDTLYVHSNRQFFSNCYIAGSVDF  419



>gb|AER38243.1| PME2 [Gossypium barbadense]
Length=521

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 162/403 (40%), Positives = 236/403 (59%), Gaps = 34/403 (8%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPD--L  982
             +++  +V +A  +S++  +SS   A      H +  S+C  +LY +LC ST+   PD   
Sbjct  20    LLVTAIVTIATTVSISKKKSSNTVAA-----HSIIKSSCSSTLYPELCYSTISSAPDAET  74

Query  981   RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP----DLGTMERRALHVCLELFSDAL  814
             + K+   +I  ++N+TV+ +++   N   I++++      L   E+ AL+ CLEL  + L
Sbjct  75    KVKNPKGVIELSLNLTVTAVQS---NYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  813   ADLRTVLDGLENSPA-----KRHAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIK  658
              +L      L + P+      +HAD L++LLS AMTNQ TCLDGF +  ++K VR  ++ 
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  657   RVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG----FPKWLSRRDRALLEA  490
                 +    SNAL+M+  +  + D           R L++     +PKWLS  DR LL+A
Sbjct  192   GQMHVFHMCSNALAMIKNLT-DTDMASQGYHPSSGRQLEEQDQTEWPKWLSEGDRRLLQA  250

Query  489   PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKK  310
                      +  ++ VA DGSGDF +++ A++AAP+ S TR++I IKAG Y E VDV  K
Sbjct  251   TT-------VIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDVPSK  303

Query  309   KTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAV  130
             KT +MFVGDG   T I  +RN+ DG  TF +ATVA  G GF+A+ I+F+N AGP  HQAV
Sbjct  304   KTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKHQAV  363

Query  129   ALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR  SD S FY C  + YQDTLYVHS RQF+ +C V G+VDF
Sbjct  364   ALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDF  406



>gb|KHF97383.1| Pectinesterase/pectinesterase inhibitor U1 [Gossypium arboreum]
Length=567

 Score =   268 bits (686),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 162/403 (40%), Positives = 237/403 (59%), Gaps = 34/403 (8%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPD--L  982
             +++  +V +A  +S++  +SS   A      H +  S+C  +LY +LC ST+   PD   
Sbjct  20    LLVTAIVTIATTVSISKKKSSNTVAA-----HSIIKSSCSSTLYPELCYSTISSAPDAET  74

Query  981   RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP----DLGTMERRALHVCLELFSDAL  814
             + K+  ++I  ++N+TV+ +++   N   I++++      L   E+ AL+ CLEL  + L
Sbjct  75    KVKNPKDVIELSLNLTVTAVQS---NYLSIKKLISTRRKSLTEREKAALNDCLELVDETL  131

Query  813   ADLRTVLDGLENSPA-----KRHAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIK  658
              +L      L + P+      +HAD L++LLS AMTNQ TCLDGF +  ++K VR  ++ 
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  657   RVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG----FPKWLSRRDRALLEA  490
                 +    SNAL+M+  +  + D           R L++     +PKWLS  DR LL+A
Sbjct  192   GQMHVFHMCSNALAMIKNLT-DTDMASQGYHPSSGRQLEEQDQTEWPKWLSEGDRRLLQA  250

Query  489   PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKK  310
                      +  ++ VA DGSGDF +++ A++AAP+ S TR++I IKAG Y E VDV  K
Sbjct  251   TT-------VIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDVPSK  303

Query  309   KTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAV  130
             KT +MFVGDG   T I  +RN+ DG  TF +ATVA  G GF+A+ I+F+N AGP  HQAV
Sbjct  304   KTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKHQAV  363

Query  129   ALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR  SD S FY C  + YQDTLYVHS RQF+ +C V G+VDF
Sbjct  364   ALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDF  406



>gb|AFB77928.1| pectin methylesterase [Gossypium hirsutum]
Length=567

 Score =   268 bits (686),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 162/403 (40%), Positives = 237/403 (59%), Gaps = 34/403 (8%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPD--L  982
             +++  +V +A  +S++  +SS   A      H +  S+C  +LY +LC ST+   PD   
Sbjct  20    LLVTAIVTIATTVSISKKKSSNTVAA-----HSIIKSSCSSTLYPELCYSTISSAPDAET  74

Query  981   RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP----DLGTMERRALHVCLELFSDAL  814
             + K+  ++I  ++N+TV+ +++   N   I++++      L   E+ AL+ CLEL  + L
Sbjct  75    KVKNPKDVIELSLNLTVTAVQS---NYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  813   ADLRTVLDGLENSPA-----KRHAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIK  658
              +L      L + P+      +HAD L++LLS AMTNQ TCLDGF +  ++K VR  ++ 
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADDLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  657   RVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG----FPKWLSRRDRALLEA  490
                 +    SNAL+M+  +  + D           R L++     +PKWLS  DR LL+A
Sbjct  192   GQMHVFHMCSNALAMIKNLT-DTDMASQGYHPSSGRQLEEQDQTEWPKWLSEGDRRLLQA  250

Query  489   PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKK  310
                      +  ++ VA DGSGDF +++ A++AAP+ S TR++I IKAG Y E VDV  K
Sbjct  251   TT-------VIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDVPSK  303

Query  309   KTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAV  130
             KT +MFVGDG   T I  +RN+ DG  TF +ATVA  G GF+A+ I+F+N AGP  HQAV
Sbjct  304   KTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKHQAV  363

Query  129   ALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR  SD S FY C  + YQDTLYVHS RQF+ +C V G+VDF
Sbjct  364   ALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDF  406



>gb|AFW03481.1| pectin methylesterase 2, partial [Gossypium hirsutum]
Length=521

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/403 (40%), Positives = 236/403 (59%), Gaps = 34/403 (8%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPD--L  982
             +++  +V +A  +S++  +SS   A      H +  S+C  +LY +LC ST+   PD   
Sbjct  20    LLVTAIVTIATTVSISKKKSSNTVAA-----HSIIKSSCSSTLYPELCYSTISSAPDAET  74

Query  981   RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVP----DLGTMERRALHVCLELFSDAL  814
             + K+  ++   ++N+TV+ +++   N   I++++      L   E+ AL+ CLEL  + L
Sbjct  75    KVKNPKDVTELSLNLTVTAVQS---NYLSIKKLISTQRKSLTEREKAALNDCLELVDETL  131

Query  813   ADLRTVLDGLENSPA-----KRHAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIK  658
              +L      L + P+      +HAD L++LLS AMTNQ TCLDGF +  ++K VR  ++ 
Sbjct  132   DELFVAEHDLSDYPSFNKSISQHADVLKSLLSAAMTNQETCLDGFSHDKADKKVRQALLD  191

Query  657   RVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG----FPKWLSRRDRALLEA  490
                 +    SNAL+M+  +  + D           R L++     +PKWLS  DR LL+A
Sbjct  192   GQMHVFHMCSNALAMIKNLT-DTDMASQGYHPSSGRQLEEQDQTEWPKWLSEGDRRLLQA  250

Query  489   PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKK  310
                      +  ++ VA DGSGDF +++ A++AAP+ S TR++I IKAG Y E VDV  K
Sbjct  251   TT-------VIPNVTVAADGSGDFLTVSEAVAAAPERSTTRYIIKIKAGVYRENVDVPSK  303

Query  309   KTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAV  130
             KT +MFVGDG   T I  +RN+ DG  TF +ATVA  G GF+A+ I+F+N AGP  HQAV
Sbjct  304   KTNLMFVGDGRVNTIITASRNVVDGSTTFHSATVAAVGDGFLARDITFQNTAGPSKHQAV  363

Query  129   ALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ALR  SD S FY C  + YQDTLYVHS RQF+ +C V G+VDF
Sbjct  364   ALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDF  406



>ref|XP_011048630.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=579

 Score =   268 bits (686),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 223/372 (60%), Gaps = 31/372 (8%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +  SAC  +LY +LC S +   P + +   S+ ++I  ++N+T    KT   N   + 
Sbjct  60    HAILKSACSSTLYPELCYSAIATVPGVTSNLASLRDVIELSINLTT---KTVQQNFFTVE  116

Query  888   RVVPD--LGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLSTA  730
             +++    L   E+ ALH CLE   + L +L      +   P K+     AD L TLLS+A
Sbjct  117   KLIAKTKLTKREKTALHDCLETIDETLDELHEAQVDIIGYPNKKSLKEQADNLITLLSSA  176

Query  729   MTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRE  556
             +TNQ TCLDGF +  ++K VR  ++K    + +  SNAL+M   IK   D   ++  ++ 
Sbjct  177   ITNQETCLDGFSHDGADKKVREALLKGQTHVEKMCSNALAM---IKNMTDTDIANKLQKT  233

Query  555   NRGLKDG-------FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAAL  397
             NR LK+        +P+W+S  DR LL++         +  ++VVA DGSGD+++++ A+
Sbjct  234   NRKLKEEKEGNERVWPEWMSVADRRLLQSS-------SVTPNVVVAADGSGDYETVSEAV  286

Query  396   SAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRT  217
             +AAP+ S TR++I IKAG Y E V+V K K  IMF+G+G   T I  +RN+ DG  TF++
Sbjct  287   AAAPNKSSTRYIIQIKAGVYRENVEVPKNKHNIMFLGEGRNTTIITASRNVVDGSTTFKS  346

Query  216   ATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQF  37
             ATVA  G GF+A+G++F+N AGP  HQAVALR  SD S FY+C  + YQDTLYVHS RQF
Sbjct  347   ATVAAVGQGFLARGVTFQNTAGPSKHQAVALRVGSDLSAFYECDMLAYQDTLYVHSNRQF  406

Query  36    FRECDVYGTVDF  1
             F  C + GTVDF
Sbjct  407   FINCLIAGTVDF  418



>gb|AAK69696.1|AF355057_1 putative pectin methylesterase LuPME5 [Linum usitatissimum]
Length=553

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 159/390 (41%), Positives = 240/390 (62%), Gaps = 26/390 (7%)
 Frame = -3

Query  1122  FLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA--KSIPEIISA  949
             FL LT   +  + ATT+   H V  S+C  +LY +LC S    +  + +  K+  +++  
Sbjct  13    FLLLTFSAAILITATTATVHHPVIKSSCSTTLYPELCHSAASASAAVLSDIKTTTDVVDL  72

Query  948   TVNVTVSEIKTAAANCSRIRRVVPD----LGTMERRALHVCLELFSDALAD-LRTV--LD  790
             ++N T++ ++   AN   I++++      L   E+ AL  C+EL  + + + ++T+  L 
Sbjct  73    SLNATIAAVQ---ANNQAIKKIISSRSLSLTKREKAALADCIELCGETMDEPVKTIEELH  129

Query  789   GLENSPAKRHADLQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALS  616
             G + S A+R  DL+TLLS AMTNQ TCLDGF +   +K VR  +      + R  SN+L+
Sbjct  130   GKKKSAAERGEDLKTLLSAAMTNQETCLDGFSHDKGDKKVRELLAAGQTNVGRMCSNSLA  189

Query  615   MLTKIKKEK--DNrfsssfrRENRGL---KDGFPKWLSRRDRALLEAPMGKGKKHDIKAD  451
             M+  I +E+      ++SF  E R +   +DG+P+W+S  DR LL+A         +  +
Sbjct  190   MVENITEEEVFREGKTASFLSEGRKMGEEEDGWPRWISAGDRRLLQAGT-------VTPN  242

Query  450   MVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGK  271
             +VVA DGSG+F++++ A++AAP+ S +R+VI IKAG Y E + V KKKT +MFVGDG   
Sbjct  243   VVVAADGSGNFRTVSQAVAAAPEGSTSRYVIRIKAGVYRETLVVPKKKTNLMFVGDGRTS  302

Query  270   TRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYD  91
             T I G+ N+ DG  TF +ATVAV G  F+A+ ++F+N AGP  HQAVALR ++D++ FY 
Sbjct  303   TIITGSMNVVDGSTTFNSATVAVVGDRFMARDLTFQNTAGPSKHQAVALRVNADFTAFYR  362

Query  90    CSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             C  + YQDTLYVHS RQF+  C + GTVDF
Sbjct  363   CDMLAYQDTLYVHSLRQFYVSCFIAGTVDF  392



>ref|XP_007146997.1| hypothetical protein PHAVU_006G088000g [Phaseolus vulgaris]
 gb|ESW18991.1| hypothetical protein PHAVU_006G088000g [Phaseolus vulgaris]
Length=543

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 152/392 (39%), Positives = 229/392 (58%), Gaps = 23/392 (6%)
 Frame = -3

Query  1140  VVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTL-VKTPDLRAKSIP  964
             +++L P      +Q       T  D+  +   AC     ++ C++ +  +   +   S  
Sbjct  9     ILMLLPSFQALSYQPIPSEIQT-QDMQALIAQACMDIENQNSCLTNIHNELTKIGPPSPT  67

Query  963   EIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLEL-------FSDALADL  805
              ++SA +  T++E   A  N ++I      +   E++A+  C EL        + +L ++
Sbjct  68    SVMSAALKATLNEAVMAIDNMTKITTF--SVSYREQQAIEDCKELVDFSVSELAWSLGEM  125

Query  804   RTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSN  625
             R +  G  +S  +   +L+  LS A++NQ TCL+GF  +++ +  +I   + Q+++ +SN
Sbjct  126   RRIRAG--DSNVQYEGNLEAWLSAALSNQDTCLEGFEGTDRRLESYISGSLTQVTQLISN  183

Query  624   ALSMLTKIK----KEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIK  457
              LS+ T++     K   N  +++   ++ G  + FP+W+S  D+ LL A     K   ++
Sbjct  184   VLSLYTQLHTLPFKPPRNTTAATSTTQSDGTSE-FPQWMSEDDQELLRA-----KPQGVR  237

Query  456   ADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGI  277
             AD VVA DG+G ++SI  A++AAP  S  R+VIY+K G Y E VD+ KK T IM VGDGI
Sbjct  238   ADAVVALDGTGHYRSIAEAVNAAPSHSPRRYVIYVKKGLYKENVDMKKKMTNIMLVGDGI  297

Query  276   GKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVF  97
             G+T I  NRN   GW TFRTAT+AV G GFIA+ +SF N AGP NHQAVALR DSD S F
Sbjct  298   GQTIITSNRNFMQGWTTFRTATLAVSGKGFIARDMSFRNTAGPVNHQAVALRVDSDQSAF  357

Query  96    YDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             Y CS  G+QDTLY HS RQF+REC++YGT+DF
Sbjct  358   YRCSVEGHQDTLYAHSLRQFYRECEIYGTIDF  389



>ref|XP_008370416.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Malus domestica]
Length=535

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/369 (40%), Positives = 213/369 (58%), Gaps = 17/369 (5%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVST----LVKTPDLRAKSIPEIISATVNVTVSEIKTA  913
             T+SH I  +    C     R+ C++     L KT      S+  II+A +  T++E K A
Sbjct  21    TSSHSIQSMVTQTCTDIEDRNSCLANVQAELQKTGPQIQDSV-SIITAALRHTLNETKNA  79

Query  912   AANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL-----ENSPAKRHADLQ  748
                 ++   +   +   E  A+  C EL   ++++L   L  +      ++      DL+
Sbjct  80    IQMITKFNSL--SISYRESVAIEDCKELLDYSVSELAWSLGEMIKIRGGDTNVHYEGDLK  137

Query  747   TLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsss  568
             + LS A++NQ TCL+GF  +++ +  F+   ++Q+++ + N L++ T++           
Sbjct  138   SWLSAALSNQDTCLEGFEGTDRRLESFVRGSLKQVTQLIGNVLALYTQLYSLPSPPRDHG  197

Query  567   frRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAA  388
                      D FP W+S  D+AL+++    G KH      VVA DGSG +++I  A++ A
Sbjct  198   PPMNKSSSGDDFPAWMSEDDQALVKSNPKSGAKH-----AVVAADGSGQYRTITEAVNEA  252

Query  387   PDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATV  208
             P+ S +R+VIY+K G Y E +D+ KKKT IMFVGDGIG+T + GNRN   GW TFRTATV
Sbjct  253   PNYSPSRYVIYVKKGIYKENIDLKKKKTNIMFVGDGIGQTIVTGNRNFMQGWTTFRTATV  312

Query  207   AVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRE  28
             AV G GFIAK ++  N AGP+NHQ VALR DSD S F+ CS  G QDTLY HS RQF+RE
Sbjct  313   AVSGKGFIAKEMTIRNTAGPQNHQGVALRVDSDQSAFFRCSIEGNQDTLYAHSLRQFYRE  372

Query  27    CDVYGTVDF  1
             C +YGT+DF
Sbjct  373   CSIYGTIDF  381



>ref|XP_010482728.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Camelina sativa]
Length=589

 Score =   268 bits (685),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 159/397 (40%), Positives = 214/397 (54%), Gaps = 23/397 (6%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             +++V V+    F  +    S+      +    Q     C  SLY +LC+ TL+  P    
Sbjct  41    VLVVGVICFGIFAGIRAVGSNKTEPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
                 E+I  + N T+     A  + S I      +    R A   CLEL  D++  L   
Sbjct  101   ADENELIHISFNATLQRFSKALYSSSTI--TYTQMPPRVRSAYDSCLELLDDSVDALSRA  158

Query  795   LDGLEN-SPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKN---VRPFIIKRVEQISRHVS  628
             L  +   S  + H+D+ TLLS+AMTN  TC DGF  +      V+  +I  V+ +S  VS
Sbjct  159   LSSVVVVSGDESHSDVMTLLSSAMTNHDTCTDGFDETGGQGGGVKDQVIGAVKDLSEMVS  218

Query  627   NALSMLTKIKKEKD-------NrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKK  469
             N L++     K KD       N        E   L+   P WL R DR LL  P      
Sbjct  219   NCLAIFAG--KVKDLSGVPVVNNRRLLGIEETEELQS--PNWLKREDRELLGTPTSA---  271

Query  468   HDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIMF  292
               I+AD+ V+KDG+G FK+I  A+  AP+ S  RFVIY+KAG Y E  + V +KKT +MF
Sbjct  272   --IQADITVSKDGTGTFKTITEAIKKAPEHSGRRFVIYVKAGRYEEENLKVGRKKTNLMF  329

Query  291   VGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADS  112
             +GDG GKT I G +++ D   TF TAT A  G+GFI + ++FENYAGP  HQAVALR   
Sbjct  330   IGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDMTFENYAGPAKHQAVALRVGG  389

Query  111   DYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             D++V Y C+ +GYQD LYVHS RQFFREC++YGTVDF
Sbjct  390   DHAVVYRCNIIGYQDALYVHSNRQFFRECEIYGTVDF  426



>ref|XP_002512462.1| Pectinesterase PPE8B precursor, putative [Ricinus communis]
 gb|EEF49914.1| Pectinesterase PPE8B precursor, putative [Ricinus communis]
Length=535

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 148/394 (38%), Positives = 229/394 (58%), Gaps = 28/394 (7%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA-  976
              L  + LL P  SL VF   ++   +S D   +   AC     +D C+S ++     +  
Sbjct  6     FLFIIFLLLP-SSLQVF---SIVIPSSLDTQTLIMQACTGVGNQDSCLSNMLAELGKKGT  61

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
             ++   ++SA +  +++E + A    ++   +   +   E+ A+  C EL   ++++L   
Sbjct  62    RNATSVLSAAMQASLNEARLAIDTITKFNAL--SVSYREQLAIEDCKELLDFSVSELAWS  119

Query  795   LDGLE-----NSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHV  631
             L  +E     ++      +L+  LS A++NQ TCL+GF  +++++  F+   ++Q+++ +
Sbjct  120   LAEMEKIRAGDNNVAYEGNLKAWLSAALSNQDTCLEGFEGTDRHLENFVKGSLKQVTQLI  179

Query  630   SNALSMLTKIK----KEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHD  463
              N L++ T++     K   N   ++   E       FP+W++  D+ LL     K     
Sbjct  180   GNVLALYTQLHSMPFKPSRNGTITNTSPE-------FPQWMTEGDQELL-----KFGTLG  227

Query  462   IKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGD  283
             +  D +V+ DGSG + +I  AL+ AP+ S+ R++IY+K G Y E +D+ KKKT IM VGD
Sbjct  228   VHVDAIVSLDGSGHYNTITQALNEAPNHSNRRYIIYVKQGIYRENIDMKKKKTNIMLVGD  287

Query  282   GIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYS  103
             GIGKT + GNRN   GW TFRTATVAV G GFIA+ ++F N AGPENHQAVALR DSD S
Sbjct  288   GIGKTVVTGNRNFMQGWTTFRTATVAVSGRGFIARDMTFRNTAGPENHQAVALRVDSDQS  347

Query  102   VFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              FY CS  GYQDTLY HS RQF+REC++YGT+D+
Sbjct  348   AFYRCSMEGYQDTLYAHSLRQFYRECNIYGTIDY  381



>ref|XP_006297218.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
 gb|EOA30116.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
Length=623

 Score =   269 bits (687),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 160/383 (42%), Positives = 225/383 (59%), Gaps = 36/383 (9%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             H V  S+C  +LY +LC+S +     +   S  ++I A++N+T + ++       ++ + 
Sbjct  87    HAVLRSSCSSTLYPELCISAVATAGGVELTSQKDVIEASLNLTKTAVEHNYFTVRKLIKK  146

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLSTAMTNQ  718
                L   E+ ALH CLE   + L +L   ++ L   P K+    HA DL+TL+S+A+TNQ
Sbjct  147   RKGLTPREKTALHDCLETIDETLDELHDAVEDLHLYPTKKTLRQHAGDLKTLISSAITNQ  206

Query  717   YTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKE--KDNrfsssfrRENR  550
              TCLDGF +  ++K VR  ++K    +    SNAL+M+  +      +    +     NR
Sbjct  207   ETCLDGFSHDGADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEAKAKVTSNNR  266

Query  549   GLKD--------------------GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDG  430
              LK+                    G+P WLS  DR LL+   G G    ++AD  VA DG
Sbjct  267   KLKEENQETTVAVDIAGAGELDAQGWPTWLSAGDRRLLQ---GTG----VRADATVAADG  319

Query  429   SGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNR  250
             SG FK++ AA++AAP++S+ R+VI+IKAG Y E VDV KKK  IMF+GDG  +T I GNR
Sbjct  320   SGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVDVSKKKKNIMFMGDGRTRTIITGNR  379

Query  249   NMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQ  70
             N+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C  + YQ
Sbjct  380   NVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQ  439

Query  69    DTLYVHSRRQFFRECDVYGTVDF  1
             DTLYVHS RQFF +C + GTVDF
Sbjct  440   DTLYVHSNRQFFVKCLIAGTVDF  462



>ref|XP_006433467.1| hypothetical protein CICLE_v10000816mg [Citrus clementina]
 ref|XP_006472137.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Citrus sinensis]
 gb|ESR46707.1| hypothetical protein CICLE_v10000816mg [Citrus clementina]
Length=536

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 151/395 (38%), Positives = 227/395 (57%), Gaps = 33/395 (8%)
 Frame = -3

Query  1131  LAPFLSLTVFQSS--AMNATTSHDIHQVAHSA-----CDHSLYRDLCVSTLVKTPDLRAK  973
             LA F  + +F  S  A++   S D   ++  A     C     +D C+  L    + +  
Sbjct  3     LAYFFLILIFSPSLAALSNAASLDKQNLSPQALMTLACSSIQNQDSCLLNLQSALENKIP  62

Query  972   SIPE-IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
               P  I+ A +  +++E K A  + ++   +   + + E+ A+  C EL   ++++L   
Sbjct  63    QTPNSILHAALRASLNEAKLAIQSITKFNSL--SISSREQMAIEDCKELLDFSVSELAWS  120

Query  795   LDGLENSPA-----KRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHV  631
             LD ++   A         +L+  LS A++NQ TCL+GF  +++ +  FI   ++Q+++ +
Sbjct  121   LDEMKRIRAGDKNVHYEGNLKAWLSAALSNQDTCLEGFEGTDRRLENFINGSLQQVTQLI  180

Query  630   SNALSMLTKI-----KKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKH  466
             +N LS+ T++     K  + N        + +     FPKW++  D+  ++      K  
Sbjct  181   TNVLSLYTQLHSLPFKPPRIN--------DTQSESPKFPKWMTEGDKGHMDM-----KPT  227

Query  465   DIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVG  286
              + AD VVA DG+G +++I  A++AAP  S  R+VIY+K G Y E VD+ KKKT IM VG
Sbjct  228   RMHADAVVALDGTGHYRTITEAINAAPSYSKRRYVIYVKKGVYRENVDMKKKKTNIMLVG  287

Query  285   DGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDY  106
             DGIG T + GNRN   GW TFRTATVAV G GFIA+ ++F N AGP+NHQAVALR DSD 
Sbjct  288   DGIGATVVTGNRNFMQGWTTFRTATVAVSGKGFIARDMTFRNTAGPQNHQAVALRVDSDQ  347

Query  105   SVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             S F+ CS  GYQDTLY HS RQF+REC++YGT+DF
Sbjct  348   SAFFRCSVEGYQDTLYAHSLRQFYRECNIYGTIDF  382



>ref|XP_008450600.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
isoform X1 [Cucumis melo]
Length=543

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 148/393 (38%), Positives = 229/393 (58%), Gaps = 24/393 (6%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             ++ +PV+ ++  + + V      N  T   I Q+     D    R+ C+S +        
Sbjct  13    LIFIPVLQVS-CIDVNVIYPDEQNNVTQSMISQICADIED----RNSCISNIQLEMGRSV  67

Query  975   KSIPE-IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLEL--FSDA----  817
              S P  ++SA +  T++E + A  + ++           E  A+  C EL  FS A    
Sbjct  68    NSNPSSVLSAAIRATINEARQAIESITKFSTF--SFSYREEMAIEDCKELLDFSVAELAW  125

Query  816   -LADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQIS  640
              LA+++ +  G   +P +   +L+  LS A++NQ TCL+GF  +++++  FI   ++Q++
Sbjct  126   SLAEMKRIRAGKNEAPDE--GNLKAWLSAALSNQDTCLEGFEGTDRHIVGFIRGSLKQVT  183

Query  639   RHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDI  460
               +SN L++ T++         +    + +  +  FP W+   +  L+     K    ++
Sbjct  184   LLISNVLALYTQLHSLPFQPPRNETMEKTKSSE--FPDWMMDSEHKLV-----KSHPRNV  236

Query  459   KADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDG  280
               D +VA DGSGDF+SI  A++ AP  S+ R++IY+K G Y E +D+ +KKT IMF+GDG
Sbjct  237   HVDAIVALDGSGDFRSITEAVNEAPSYSNRRYIIYVKKGVYKENIDMKRKKTNIMFIGDG  296

Query  279   IGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSV  100
             IG+T + G+RN   GW TFRTATVAV G GFIA+ ++F N AGPENHQAVALR DSD S 
Sbjct  297   IGETIVTGSRNFLQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQAVALRVDSDQSA  356

Query  99    FYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             F+ CSF G+QDTLYVHS RQF+REC++YGT+D+
Sbjct  357   FFRCSFEGHQDTLYVHSLRQFYRECNIYGTIDY  389



>ref|NP_200149.1| pectin methylesterase PCR fragment F [Arabidopsis thaliana]
 sp|Q9FK05.1|PME61_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
61; Includes: RecName: Full=Pectinesterase inhibitor 61; AltName: 
Full=Pectin methylesterase inhibitor 61; Includes: RecName: 
Full=Pectinesterase 61; Short=PE 61; AltName: Full=AtPMEpcrF; 
AltName: Full=Pectin methylesterase 61; Short=AtPME61 
[Arabidopsis thaliana]
 gb|AAK28637.1|AF360340_1 putative pectinesterase [Arabidopsis thaliana]
 dbj|BAB09799.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK93754.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AED96345.1| putative pectinesterase/pectinesterase inhibitor 61 [Arabidopsis 
thaliana]
Length=587

 Score =   268 bits (684),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 161/395 (41%), Positives = 212/395 (54%), Gaps = 21/395 (5%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             +++V VV    F  +    S       +    Q     C  SLY +LC+ TL+  P    
Sbjct  41    VLVVGVVCFGIFAGIRAVDSGKTEPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
                 E+I  + N T+ +   A    S I      +    R A   CLEL  D++  L   
Sbjct  101   ADENELIHISFNATLQKFSKALYTSSTI--TYTQMPPRVRSAYDSCLELLDDSVDALTRA  158

Query  795   LDGLEN-SPAKRHADLQTLLSTAMTNQYTCLDGF---PNSNKNVRPFIIKRVEQISRHVS  628
             L  +   S  + H+D+ T LS+AMTN  TC DGF         V+  +I  V+ +S  VS
Sbjct  159   LSSVVVVSGDESHSDVMTWLSSAMTNHDTCTDGFDEIEGQGGEVKDQVIGAVKDLSEMVS  218

Query  627   NALSMLTKIKKEKDNrfsssfrRENRGL-----KDGFPKWLSRRDRALLEAPMGKGKKHD  463
             N L++     K KD   S      NR L      +  P WL R DR LL  P        
Sbjct  219   NCLAIFAG--KVKD--LSGVPVVNNRKLLGTEETEELPNWLKREDRELLGTPTSA-----  269

Query  462   IKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIMFVG  286
             I+AD+ V+KDGSG FK+I  A+  AP+ S  RFVIY+KAG Y E  + V +KKT +MF+G
Sbjct  270   IQADITVSKDGSGTFKTIAEAIKKAPEHSSRRFVIYVKAGRYEEENLKVGRKKTNLMFIG  329

Query  285   DGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDY  106
             DG GKT I G +++ D   TF TAT A  G+GFI + ++FENYAGP  HQAVALR   D+
Sbjct  330   DGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDMTFENYAGPAKHQAVALRVGGDH  389

Query  105   SVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +V Y C+ +GYQD LYVHS RQFFREC++YGTVDF
Sbjct  390   AVVYRCNIIGYQDALYVHSNRQFFRECEIYGTVDF  424



>ref|NP_001275859.1| pectinesterase 1 precursor [Citrus sinensis]
 ref|XP_006426800.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
 gb|AAB57670.1| pectinesterase [Citrus sinensis]
 gb|ESR40040.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
Length=584

 Score =   268 bits (684),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 161/382 (42%), Positives = 222/382 (58%), Gaps = 28/382 (7%)
 Frame = -3

Query  1101  QSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVS  928
             ++S  N    H  H +  S+C  + Y DLC S +   P+   K  S  ++I  ++N+T +
Sbjct  55    KNSGDNGNEPH--HAILKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTT  112

Query  927   EIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----H  760
              ++       ++ +   +L   E+ ALH CLE   + L +L   ++ LE  P K+    H
Sbjct  113   AVEHNYFGIQKLLKRT-NLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQH  171

Query  759   AD-LQTLLSTAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEK  589
             AD L+TL+S AMTNQ TCLDGF   ++NK+VR  +      + +  SNAL+M   IK   
Sbjct  172   ADDLKTLMSAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAM---IKNMT  228

Query  588   DNrfsssfrRENRGLK------DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGS  427
             D          NR L       DG+P WLS  DR LL++         +  + VVA DGS
Sbjct  229   DTDMMIMRTSNNRKLTEETSTVDGWPAWLSPGDRRLLQSS-------SVTPNAVVAADGS  281

Query  426   GDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRN  247
             G+FK++ AA++AAP     R++I IKAG Y E V+V KK   IMF+GDG  +T I G+RN
Sbjct  282   GNFKTVAAAVAAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRN  341

Query  246   MKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQD  67
             + DG  TF++ATVAV G GF+A+ I+F+N AGP  HQAVALR  +D S FY+C  + YQD
Sbjct  342   VVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQD  401

Query  66    TLYVHSRRQFFRECDVYGTVDF  1
             TLYVHS RQFF  C + GTVDF
Sbjct  402   TLYVHSNRQFFVNCLIAGTVDF  423



>ref|XP_009414355.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Musa acuminata subsp. malaccensis]
Length=540

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 156/373 (42%), Positives = 219/373 (59%), Gaps = 17/373 (5%)
 Frame = -3

Query  1101  QSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSE  925
             QSS++    + +   + H AC ++   + C S +      + ++ P  I+   V  T+ E
Sbjct  24    QSSSLEEAKAFE-ESLLHQACLNTTDHEACTSRISIECHRQGRTGPISILHGAVRGTIDE  82

Query  924   IKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDG-----LENSPAKRH  760
                A    S +  V  DL   E  A+H C+EL   ++ +L   L+      LEN      
Sbjct  83    ALRAVGTLSGLAAVSSDL--REEMAIHDCVELLGYSIDELGWSLEEISRLVLENRNIHHE  140

Query  759   ADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNr  580
             A+L+  LS A++NQ TCL+GF  ++  +R +I  RV ++++ VSN L M  K++    + 
Sbjct  141   ANLRAWLSAALSNQDTCLEGFDGTDGRIRHYIHSRVAEVTQLVSNLLVMYRKMRSIIPHA  200

Query  579   fsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAA  400
                +  + + G +D  P W+   D+ LL A         ++AD VVA DGSG ++SIN A
Sbjct  201   PPRNGTKSD-GNRDS-PPWVVV-DQELLHA-----DPKALRADAVVASDGSGRYRSINEA  252

Query  399   LSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFR  220
             ++ AP  S  R+VIY+K G Y E V++ KKKT IM VGDG+G T I G+RN   GW TFR
Sbjct  253   VNRAPIHSSRRYVIYVKKGVYEENVELKKKKTNIMIVGDGMGITVISGSRNFMQGWTTFR  312

Query  219   TATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQ  40
             TAT AV G GFIA+ I+F N AGP+NHQAVALR DSD S F+ CS  GYQDTLY HS RQ
Sbjct  313   TATFAVSGQGFIARDITFRNTAGPQNHQAVALRVDSDRSAFFRCSIEGYQDTLYAHSLRQ  372

Query  39    FFRECDVYGTVDF  1
             F+REC++YGT+DF
Sbjct  373   FYRECNIYGTIDF  385



>ref|XP_002865971.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42230.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=587

 Score =   268 bits (684),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 160/395 (41%), Positives = 211/395 (53%), Gaps = 21/395 (5%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             +++V V+    F  +    S       +    Q     C  SLY +LC+ TL+  P    
Sbjct  41    VLVVGVICFGIFAGIRAVDSGKTEPKQTSKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
                 E+I  + N T+     A    S I      +    R A   CLEL  D++  L   
Sbjct  101   ADENELIHISFNATLQRFSKALYTSSTITYT--QMPPRVRSAYDSCLELLDDSVDALTRA  158

Query  795   LDGLEN-SPAKRHADLQTLLSTAMTNQYTCLDGF---PNSNKNVRPFIIKRVEQISRHVS  628
             L  +   S  + H+D+ T LS+AMTN  TC DGF         V+  +I  V+ +S  VS
Sbjct  159   LSSVVVVSGDESHSDVMTWLSSAMTNHDTCTDGFDEIEGQGGEVKDQVIGAVKDLSEMVS  218

Query  627   NALSMLTKIKKEKDNrfsssfrRENRGL-----KDGFPKWLSRRDRALLEAPMGKGKKHD  463
             N L++     K KD   S      NR L      +  P WL R DR LL  P        
Sbjct  219   NCLAIFAG--KVKD--LSGVPVVNNRKLLGTEETEELPNWLKREDRELLGTPTSA-----  269

Query  462   IKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIMFVG  286
             ++AD+ V+KDGSG FK+I  A+  AP+ S  RFVIY+K+G Y E  + V +KKT +MF+G
Sbjct  270   VQADITVSKDGSGTFKTIAEAIKKAPEHSSRRFVIYVKSGRYEEENLKVGRKKTNLMFIG  329

Query  285   DGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDY  106
             DG GKT I G +++ D   TF TAT A  G+GFI + I+FENYAGP  HQAVALR   D+
Sbjct  330   DGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDITFENYAGPAKHQAVALRVGGDH  389

Query  105   SVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +V Y CS +GYQD LYVHS RQFFREC++YGTVDF
Sbjct  390   AVVYRCSIIGYQDALYVHSNRQFFRECEIYGTVDF  424



>ref|XP_010445741.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Camelina sativa]
Length=589

 Score =   268 bits (684),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 158/397 (40%), Positives = 214/397 (54%), Gaps = 23/397 (6%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             +++V V+    F  +    S+      +    Q     C  SLY +LC+ TL+  P    
Sbjct  41    VLVVGVICFGIFAGIRAVDSNKTEPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
                 E+I  + N T+     A  + S I      +    R A   CLEL  D++  L   
Sbjct  101   ADENELIHISFNATLQRFSKALYSSSTI--TYTQMPPRVRSAYDSCLELLDDSVDALSRA  158

Query  795   LDGLEN-SPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKN---VRPFIIKRVEQISRHVS  628
             L  +   S  + H+D+ TLLS+AMTN  TC DGF  +      V+  +I  V+ +S  VS
Sbjct  159   LSSVVVVSGDESHSDVMTLLSSAMTNHDTCTDGFDETGGQGGGVKDQVIGAVKDLSEMVS  218

Query  627   NALSMLTKIKKEKD-------NrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKK  469
             N L++     K KD       N        E   L+   P WL R DR LL  P      
Sbjct  219   NCLAIFAG--KVKDLSGVPVVNNRRLLGTEETEELQ--LPNWLKREDRELLGTPTSA---  271

Query  468   HDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIMF  292
               I+AD+ V+KDG+G FK+I  A+  AP+ S  RFVIY+KAG Y E  + V +KKT +MF
Sbjct  272   --IQADITVSKDGTGTFKTITEAIKKAPEHSGRRFVIYVKAGRYEEENLKVGRKKTNLMF  329

Query  291   VGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADS  112
             +GDG GKT I G +++ D   TF TAT A  G+GFI + ++FENYAGP  HQAVALR   
Sbjct  330   IGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDMTFENYAGPAKHQAVALRVGG  389

Query  111   DYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             D++V Y C+ +GYQD LYVHS RQF+REC++YGTVDF
Sbjct  390   DHAVVYRCNIIGYQDALYVHSNRQFYRECEIYGTVDF  426



>ref|XP_009123661.1| PREDICTED: pectinesterase 2 [Brassica rapa]
Length=604

 Score =   268 bits (685),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 171/428 (40%), Positives = 237/428 (55%), Gaps = 55/428 (13%)
 Frame = -3

Query  1149  LVPVVLLAPFLSLTVFQSSAMNATTSHDI-------HQVAHSACDHSLYRDLCVSTLVKT  991
             ++ +VL +  + + V +S   N T +  I       H V  S C  +LY +LC S +  T
Sbjct  26    VLALVLFSAVVGIAVTKS---NQTKNQKIPTLTPTSHAVLKSVCSSTLYPELCFSAVAAT  82

Query  990   -----PDLRAKSIP-------------EIISATVNVTVSEIKTAAANCSRIRRVVPDLGT  865
                  PD      P             ++I A++N+T + +K       ++      L  
Sbjct  83    GKKLTPDKDVIEAPAVAATGKKLTSDKDVIEASLNLTTNAVKHNYFAVKKLITKRKGLTA  142

Query  864   MERRALHVCLELFSDALADLRTVLDGLENSPA----KRHAD-LQTLLSTAMTNQYTCLDG  700
              E  ALH CLE+  + L +L   L+ L+  P     ++HAD L+TL+S+A+TNQ TCLDG
Sbjct  143   REVTALHDCLEIIDETLDELHVALEDLDQYPKGKSLRKHADDLKTLISSAITNQGTCLDG  202

Query  699   FP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKD----NrfsssfrRENRGLKD  538
             F    +++ +R  ++K    +    SNAL+M+  +  E D         S    NR LK+
Sbjct  203   FSYDKADRKLRKALLKGQVHVEHMCSNALAMIKNMT-ETDIANFELKDKSSSTNNRKLKE  261

Query  537   ---------GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAP  385
                      G+P WLS  DR LL+   G      + AD  VA DGSGDF ++ AA++AAP
Sbjct  262   ELTGDLDGEGWPNWLSIGDRRLLQGSTG------VNADATVAADGSGDFTTVAAAVAAAP  315

Query  384   DSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVA  205
             + S+ R+VI+IKAG Y E V+V KKK  IMF+GDG GKT I G RN+ DG  TF +ATVA
Sbjct  316   EKSNKRYVIHIKAGVYRENVEVSKKKKNIMFLGDGRGKTIITGKRNVVDGSTTFHSATVA  375

Query  204   VGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFREC  25
               G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C  + YQDTLYVHS RQFF +C
Sbjct  376   AVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKC  435

Query  24    DVYGTVDF  1
              + GTVDF
Sbjct  436   HIAGTVDF  443



>ref|XP_009111301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39 
[Brassica rapa]
Length=522

 Score =   266 bits (679),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 156/334 (47%), Positives = 208/334 (62%), Gaps = 25/334 (7%)
 Frame = -3

Query  972  SIPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMERRALHVCLELFSDALADLRTV  796
            +I E+I AT+N T+  +  +      + +R+ P++    R A   CL L  D + DL T 
Sbjct  43   NITELIVATLNQTILNVNVSYTTFYNLQKRLGPNIARRYRCAFEDCLGLLDDTIFDLETA  102

Query  795  LDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSN---KN------VRPFIIKRVEQI  643
            +  L+ S    H D+  LLS AMTNQ TCL+GF  S    KN      +   +   + +I
Sbjct  103  ISKLQTSSLGAH-DVNMLLSDAMTNQDTCLEGFKTSGIHEKNSDNTYKLTDSLKDSILKI  161

Query  642  SRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHD  463
            S ++SN+L ML KI   + +  +     E       FP W+   D+  L AP+ K     
Sbjct  162  SSNLSNSLGMLQKIPGHELSPEAYEVDVE-------FPSWVLENDKRRLHAPVEK-----  209

Query  462  IKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGD  283
             K +++VA+DG+G+F +IN A+SAAP SS TRF+IYIK G Y+E V++ K KT+IMFVGD
Sbjct  210  TKFNLMVAQDGTGNFTTINDAVSAAPTSSVTRFMIYIKRGVYFENVEIPKNKTIIMFVGD  269

Query  282  GIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYS  103
            GIG+T IK NR  K    TF+TATV V G GFIAK ISF N+AGP + QAVALR+ SD+S
Sbjct  270  GIGRTVIKANRR-KGNLGTFQTATVGVKGEGFIAKDISFVNFAGP-SPQAVALRSGSDHS  327

Query  102  VFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FY CSF GYQDTLYV+S +QF+RECD+YGTVDF
Sbjct  328  AFYRCSFEGYQDTLYVYSGKQFYRECDIYGTVDF  361



>ref|XP_003588521.1| Pectinesterase [Medicago truncatula]
 gb|AES58772.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=609

 Score =   268 bits (685),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 163/415 (39%), Positives = 239/415 (58%), Gaps = 42/415 (10%)
 Frame = -3

Query  1152  MLVPVVLLAPFLS---LTVFQSSAMNATTSHDIH----QVAHSACDHSLYRDLCVSTLVK  994
             +L  V+++A  +S   +TV +S A ++  S+ +H    Q     C  + Y  LC+++L+ 
Sbjct  43    ILAAVLIIASAISAALITVVRSRA-SSNNSNLLHSKPTQAISRTCSKTRYPSLCINSLLD  101

Query  993   TPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDAL  814
              P   + S  E++  + N+T   I  A    S +   V +     R A   CLEL  +++
Sbjct  102   FPGSTSASEQELVHISFNMTHRHISKALFASSGLSYTVAN--PRVRAAYEDCLELMDESM  159

Query  813   ADLRTVLDGLENSP----------------AKRHADLQTLLSTAMTNQYTCLDGFPNSNK  682
               +R+ +D L  +                 A    D+ T LS A+TNQ TCL+GF +++ 
Sbjct  160   DAIRSSMDSLMTTSSTLSNDDGESRQFSNVAGSTEDVMTWLSAALTNQDTCLEGFEDTSG  219

Query  681   NVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENR---GLKD---GFPKWL  520
              V+  ++  ++ +S  VSN+L++ +      DN F+    +  R   G+ D    FPKWL
Sbjct  220   TVKDQMVGNLKDLSELVSNSLAIFSA---SGDNDFTGVPIQNKRRLMGMSDISREFPKWL  276

Query  519   SRRDRALLEAPMGKGKKHDIKADMVVAKDG-SGDFKSINAALSAAPDSSDTRFVIYIKAG  343
              +RDR LL  P+      +I+AD++V+K G +G  K+I  A+  AP+ S  RF+IY++AG
Sbjct  277   EKRDRRLLSLPVS-----EIQADIIVSKSGGNGTVKTITEAIKKAPEHSRRRFIIYVRAG  331

Query  342   SYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISF  166
              Y E  + V KKKT IMF+GDG GKT I G R++ DG  TF TA+ A  G GF+A+ I+F
Sbjct  332   RYEENNLKVGKKKTNIMFIGDGRGKTVITGKRSVGDGMTTFHTASFAASGPGFMARDITF  391

Query  165   ENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ENYAGPE HQAVALR  SD++V Y C+ VGYQD  YVHS RQFFREC++YGTVDF
Sbjct  392   ENYAGPEKHQAVALRVGSDHAVVYRCNIVGYQDACYVHSNRQFFRECNIYGTVDF  446



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score =   266 bits (681),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 151/371 (41%), Positives = 220/371 (59%), Gaps = 31/371 (8%)
 Frame = -3

Query  1047  SACDHSLYRDLCVSTLVKTPDLRA---KSIPEIISATVNVTVSEIKTAAANCSRIRRVVP  877
             S+C  +LY DLC+S L  +P L +   K+  ++++  +N+T++ ++       ++     
Sbjct  43    SSCSSTLYPDLCLSQLTSSPSLTSDAMKTPKDVVALALNLTITSVQHNYFTIKKVAATRS  102

Query  876   DLGTMERRALHVCLELFSDALADLRTVL-------DGLENSPAKRHADLQTLLSTAMTNQ  718
              L   ER ALH CLE+  + L ++R  L       +G   S ++   D++TLLS AMTNQ
Sbjct  103   GLTVRERTALHDCLEMVDETLDEVRETLADLLAYPNGGSKSVSELAEDMKTLLSAAMTNQ  162

Query  717   YTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGL  544
              +CLDGF   +++K VR  ++     +    S+AL+M+  I     +  +      NR L
Sbjct  163   ESCLDGFSHDSADKKVREALLGGQMHVFHLCSHALAMVKNITDA--DAANKRLPSSNRRL  220

Query  543   KD----------GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALS  394
             K+           +P+WLS  DR LL++         +  D+ VA DGSGD+++++ A+ 
Sbjct  221   KEEIKEEGQEPIQWPQWLSAGDRRLLQSTT-------VTPDVTVAADGSGDYRTVSEAVE  273

Query  393   AAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTA  214
             AAP+ S+ R+VI IKAG Y E V+V  +KT +MFVGDG   T I G+RN+ DG  TF +A
Sbjct  274   AAPERSERRYVIKIKAGVYRENVEVTSRKTNLMFVGDGRTTTIITGSRNVVDGSTTFNSA  333

Query  213   TVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFF  34
             TVAV G GF+A+ I+FEN AGP  HQAVALR +SD+S FY C  + YQDTLYVHS RQF+
Sbjct  334   TVAVVGEGFLARDITFENTAGPSKHQAVALRVNSDFSAFYRCCMLAYQDTLYVHSLRQFY  393

Query  33    RECDVYGTVDF  1
               C + GTVDF
Sbjct  394   FGCFIAGTVDF  404



>ref|XP_004157240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Cucumis sativus]
Length=543

 Score =   266 bits (680),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 148/393 (38%), Positives = 229/393 (58%), Gaps = 24/393 (6%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             ++ +PV+ ++ F  + V      N  T   I Q+     D    R+ C+S +        
Sbjct  13    LIFLPVLQVSCF-DVNVIYPDEQNNVTQSMISQICADIED----RNSCISNIQLEMGRNV  67

Query  975   KSIPE-IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLEL--FSDA----  817
              S P  ++SA +  T++E + A  + ++           E  A+  C EL  FS A    
Sbjct  68    NSNPNSVLSAAIRATINEARRAIESITKFSTF--SFSYREEMAIEDCKELLDFSVAELAW  125

Query  816   -LADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQIS  640
              LA+++ +  G   +P +   +L+  LS A++NQ TCL+GF  +++++  FI   ++Q++
Sbjct  126   SLAEMKRIRAGKNEAPDE--GNLKAWLSAALSNQDTCLEGFEGTDRHIVGFIRGSLKQVT  183

Query  639   RHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDI  460
               +SN L++ T++         +    + +  +  FP W+   +  ++     K    ++
Sbjct  184   LLISNVLALYTQLHSLPFQPPRNETMEKTKSSE--FPDWMMDSEHKIV-----KSHPRNV  236

Query  459   KADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDG  280
               D +VA DGSGDF+SI  A++ AP  S+ R++IY+K G Y E +D+ +KKT IMF+GDG
Sbjct  237   HVDAIVALDGSGDFRSITEAVNEAPSYSNRRYIIYVKKGVYKENIDMKRKKTNIMFIGDG  296

Query  279   IGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSV  100
             IG+T + G+RN   GW TFRTATVAV G GFIA+ ++F N AGPENHQAVALR DSD S 
Sbjct  297   IGETIVTGSRNFLQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQAVALRVDSDQSA  356

Query  99    FYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             F+ CSF G+QDTLYVHS RQF+REC++YGT+D+
Sbjct  357   FFRCSFEGHQDTLYVHSLRQFYRECNIYGTIDY  389



>ref|XP_004135600.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Cucumis sativus]
 gb|KGN66043.1| hypothetical protein Csa_1G569210 [Cucumis sativus]
Length=543

 Score =   266 bits (680),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 148/393 (38%), Positives = 229/393 (58%), Gaps = 24/393 (6%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             ++ +PV+ ++ F  + V      N  T   I Q+     D    R+ C+S +        
Sbjct  13    LIFLPVLQVSCF-DVNVIYPDEQNNVTQSMISQICADIED----RNSCISNIQLEMGRSV  67

Query  975   KSIPE-IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLEL--FSDA----  817
              S P  ++SA +  T++E + A  + ++           E  A+  C EL  FS A    
Sbjct  68    NSNPNSVLSAAIRATINEARRAIESITKFSTF--SFSYREEMAIEDCKELLDFSVAELAW  125

Query  816   -LADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQIS  640
              LA+++ +  G   +P +   +L+  LS A++NQ TCL+GF  +++++  FI   ++Q++
Sbjct  126   SLAEMKRIRAGKNEAPDE--GNLKAWLSAALSNQDTCLEGFEGTDRHIVGFIRGSLKQVT  183

Query  639   RHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDI  460
               +SN L++ T++         +    + +  +  FP W+   +  ++     K    ++
Sbjct  184   LLISNVLALYTQLHSLPFQPPRNETMEKTKSSE--FPDWMMDSEHKIV-----KSHPRNV  236

Query  459   KADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDG  280
               D +VA DGSGDF+SI  A++ AP  S+ R++IY+K G Y E +D+ +KKT IMF+GDG
Sbjct  237   HVDAIVALDGSGDFRSITEAVNEAPSYSNRRYIIYVKKGVYKENIDMKRKKTNIMFIGDG  296

Query  279   IGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSV  100
             IG+T + G+RN   GW TFRTATVAV G GFIA+ ++F N AGPENHQAVALR DSD S 
Sbjct  297   IGETIVTGSRNFLQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQAVALRVDSDQSA  356

Query  99    FYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             F+ CSF G+QDTLYVHS RQF+REC++YGT+D+
Sbjct  357   FFRCSFEGHQDTLYVHSLRQFYRECNIYGTIDY  389



>ref|XP_010910828.1| PREDICTED: pectinesterase 3-like [Elaeis guineensis]
Length=338

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/301 (48%), Positives = 193/301 (64%), Gaps = 15/301 (5%)
 Frame = -3

Query  1086  NATTSHDIH-----QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEI  922
             N    H +H     Q A   CD +LY DLCVSTL   P+L +KS+P++I+A VN T +++
Sbjct  34    NGRRRHQLHVHSHLQAAARHCDGTLYPDLCVSTLADIPNLTSKSLPDVIAAVVNRTANDV  93

Query  921   KTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRH-ADLQT  745
             + +A+NCS   R    + + +R AL+ CLEL    L DLRT    L    A  H +D+QT
Sbjct  94    RFSASNCSSYLRRRGYMDSRQRLALNDCLELLDQTLDDLRTAAADLTCGNASVHVSDIQT  153

Query  744   LLSTAMTNQYTCLDGFPNSNKN-VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsss  568
             +LS AMTNQYTCLDGF   N   VRP I  R+  +S  VSN+L+M+ KI++    R +  
Sbjct  154   VLSAAMTNQYTCLDGFAYVNGGGVRPSIEGRLNHVSHLVSNSLAMVKKIRRRWRGREAFE  213

Query  567   frRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAA  388
                E  G   GFP W+SR+DR LL+A       +    ++VVAKDGSG+F +I  A++AA
Sbjct  214   GYGEVAG---GFPTWVSRKDRRLLQAAA-----NATSPNLVVAKDGSGNFTTIGPAVAAA  265

Query  387   PDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATV  208
             P++S TRFVIYIKAG+Y+E VDV K K  +MF+GDGIGKT +K +RN+ DGW TFR+ATV
Sbjct  266   PNNSATRFVIYIKAGAYFENVDVAKNKKNLMFIGDGIGKTVVKASRNVVDGWTTFRSATV  325

Query  207   A  205
              
Sbjct  326   G  326



>ref|XP_011012638.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=573

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 158/403 (39%), Positives = 234/403 (58%), Gaps = 29/403 (7%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAH----SACDHSLYRDLCVSTLVKTPD  985
             +   ++L+A  +S+    +S+ N+T S++ HQVA+    S+C  +LY  LC S++   PD
Sbjct  20    LFSSILLVAAIVSIVAGVTSSKNSTESNNDHQVAYTILKSSCSSTLYPHLCFSSISAVPD  79

Query  984   L--RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALA  811
                + KS  ++I  ++N T+S  + +     ++          E  ALH CL + ++ L 
Sbjct  80    ATSKIKSKKDVIDLSLNRTMSATRHSYFKIQKLTFTRRSFTERENTALHDCLVMLNETLD  139

Query  810   DLRTVLDGLENSPAKR-----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKR  655
              L      L++ P+ +     HAD L+ LLS  MTNQ TCLDGF +  ++K VR   I  
Sbjct  140   QLSKAYQELQDYPSLKKSLSVHADDLKILLSATMTNQETCLDGFSHEKADKKVRELFIDE  199

Query  654   VEQISRHVSNALSML-----TKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEA  490
                +    S AL+++     T + KE+          EN G +  +P+WLS  DR LL+A
Sbjct  200   EMHVYHMSSIALAIIKNVTDTDMAKEQSLSSGRKLEEEN-GTE--WPEWLSAGDRRLLQA  256

Query  489   PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKK  310
                      +  ++VVA DGSG++++++ A++AAP+SS +R++I IKAG Y E VDV  +
Sbjct  257   TT-------VTPNVVVAADGSGNYRTVSEAVAAAPESSSSRYIIRIKAGVYRENVDVPSR  309

Query  309   KTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAV  130
             KT IMF+GDG   T I  +RN+ DG  TF +ATVA  G GF+A+ I+F+N AGP  HQAV
Sbjct  310   KTNIMFMGDGRTTTIITASRNVVDGSTTFNSATVAAVGGGFLARDITFQNSAGPSKHQAV  369

Query  129   ALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             A+R  SD S FY C  + YQDTLYVHS RQF+  C + G+VDF
Sbjct  370   AIRVGSDLSAFYRCGMIAYQDTLYVHSLRQFYVSCIIIGSVDF  412



>ref|XP_009421463.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Musa acuminata subsp. malaccensis]
Length=591

 Score =   266 bits (681),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/365 (42%), Positives = 219/365 (60%), Gaps = 19/365 (5%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPD-LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             Q    AC  + Y  LCVS+L+  P  L A    +++  +VN+T+  +  A    S I   
Sbjct  71    QAISRACGRTRYPALCVSSLLDFPGALEAAGERDLVHVSVNMTLHRVGAAIHGASAIAGA  130

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR-----HADLQTLLSTAMTNQ  718
               D  T+ R A   C+EL   +L  L   L  +  S   R       D+ T LS A+TNQ
Sbjct  131   AMD--TLARSAYDDCMELLDHSLDLLSNSLLVVSPSSQARVKAVSGEDVLTWLSGALTNQ  188

Query  717   YTCLDGF-PNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLK  541
              TC +G  P  +  V+  +  +++ ++  VSN L++ + + + +D        ++ + L 
Sbjct  189   DTCNEGLQPVKDLYVKKHMANQLKDLTELVSNCLAIFSGVSRNEDFTGIPIHNKKRKLLN  248

Query  540   -----DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSS  376
                  DGFP W++++DR LL+ P       DI+ADMVV+KDG+G + SI  A+ AAP+ S
Sbjct  249   AIDVDDGFPAWVAKKDRRLLQVPAA-----DIQADMVVSKDGNGTYTSIVDAVKAAPEYS  303

Query  375   DTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGG  196
               R +IYIKAG YYE + V +KKT +MF+GDG  +T I G+R++ D + TF TAT A  G
Sbjct  304   SRRIIIYIKAGRYYENIKVGRKKTNLMFIGDGKNQTIIAGSRSVYDNFTTFHTATFAATG  363

Query  195   SGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVY  16
             +GFI + I+ +N+AGPE HQAVALR  +D++V Y C+ +GYQDTLYVHS+RQFFRECD+Y
Sbjct  364   TGFIMRDITIQNWAGPEKHQAVALRVGADHAVVYRCNVIGYQDTLYVHSQRQFFRECDIY  423

Query  15    GTVDF  1
             GTVDF
Sbjct  424   GTVDF  428



>ref|XP_002532944.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF29428.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=577

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 157/399 (39%), Positives = 235/399 (59%), Gaps = 23/399 (6%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAK  973
             +   V+++A   ++    +S    TT+   H +  S+C  + Y DLC S +   P   +K
Sbjct  31    LFASVLIIATVTAIVTGVNSNKKDTTASPSHSILKSSCSTTRYPDLCFSAVASAPGATSK  90

Query  972   --SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRT  799
               S+ ++I  ++N+T + ++       ++ +    L   E+ ALH CLE   + L +L  
Sbjct  91    LVSLKDVIEVSLNLTTTAVEHNFFTVEKLAKR-KGLTKREKTALHDCLETIDETLDELHK  149

Query  798   VLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQIS  640
              +D L+  P K+    HAD L+TLLS+A+TNQ TCLDGF +  ++K++R  ++     + 
Sbjct  150   AMDDLKEYPNKKSLSQHADDLKTLLSSAITNQETCLDGFSHDGADKHIREALLAGQVHVE  209

Query  639   RHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG------FPKWLSRRDRALLEAPMGK  478
             +  SNAL+M+  +              +NR LK+       +P+WLS  DR LL++    
Sbjct  210   KMCSNALAMIKNMTDTDIANELKLSGSKNRKLKEEKDQESVWPEWLSAGDRRLLQSS---  266

Query  477   GKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMI  298
                  +  ++VVA DGSGD+K+++AA++AAP  S  R++I IKAG Y E V+V K KT +
Sbjct  267   ----SVTPNVVVAADGSGDYKTVSAAVAAAPSKSSKRYIIRIKAGVYKENVEVPKGKTNL  322

Query  297   MFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRA  118
             MF+GDG   T I G+RN+ DG  TF +ATVA  G GF+A+G++FEN AGP  HQAVALR 
Sbjct  323   MFLGDGRKTTIITGSRNVVDGSTTFNSATVAAVGQGFLARGVTFENKAGPSKHQAVALRV  382

Query  117   DSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              +D + FY+C  + YQDTLYVHS RQFF  C + GTVDF
Sbjct  383   GADLAAFYECDMIAYQDTLYVHSNRQFFINCYIAGTVDF  421



>sp|O04886.1|PME1_CITSI RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57667.1| pectinesterase [Citrus sinensis]
Length=584

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/382 (42%), Positives = 221/382 (58%), Gaps = 28/382 (7%)
 Frame = -3

Query  1101  QSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVS  928
             ++S  N    H  H +  S+C  + Y DLC S +   P+   K  S  ++I  ++N+T +
Sbjct  55    KNSGDNGNEPH--HAILKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTT  112

Query  927   EIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----H  760
              ++       ++ +   +L   E+ ALH CLE   + L +L   ++ LE  P K+    H
Sbjct  113   AVEHNYFGIQKLLKRT-NLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQH  171

Query  759   AD-LQTLLSTAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEK  589
             AD L+TL+S AMTNQ TCLDGF   ++NK+VR  +      + +  SNAL+M   IK   
Sbjct  172   ADDLKTLMSAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAM---IKNMT  228

Query  588   DNrfsssfrRENRGLK------DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGS  427
             D          NR L       DG+P WLS  DR LL++         +  + VVA DGS
Sbjct  229   DTDMMIMRTSNNRKLTEETSTVDGWPAWLSPGDRRLLQSS-------SVTPNAVVAADGS  281

Query  426   GDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRN  247
             G+FK++ AA++AAP     R++I IKAG Y E V+V KK   IMF+GDG  +T I G+RN
Sbjct  282   GNFKTVAAAVAAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRN  341

Query  246   MKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQD  67
             + DG  TF++AT AV G GF+A+ I+F+N AGP  HQAVALR  +D S FY+C  + YQD
Sbjct  342   VVDGSTTFKSATAAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQD  401

Query  66    TLYVHSRRQFFRECDVYGTVDF  1
             TLYVHS RQFF  C + GTVDF
Sbjct  402   TLYVHSNRQFFVNCLIAGTVDF  423



>gb|ACJ68111.1| pectinesterase [Brassica napus]
Length=521

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 208/334 (62%), Gaps = 25/334 (7%)
 Frame = -3

Query  972  SIPEIISATVNVTVSEIKTAAANCSRI-RRVVPDLGTMERRALHVCLELFSDALADLRTV  796
            +I E+I AT+N T+  +  +      + +R+ P++    R A   CL L  D + DL T 
Sbjct  43   NITELIVATLNQTILNVNVSYTTFYNLQKRLGPNIARRYRCAFEDCLGLLDDTIFDLETA  102

Query  795  LDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSN---KN------VRPFIIKRVEQI  643
            +  L+ S    H D+  LLS AMTNQ TCL+GF  S    KN      +   +   + +I
Sbjct  103  ISKLQTSSLGAH-DVNMLLSDAMTNQDTCLEGFKTSGIHEKNSDNTYKLTDSLKDSILKI  161

Query  642  SRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHD  463
            S ++SN+L ML KI   + +  +     E       FP W+   D+  L AP+ K     
Sbjct  162  SSNLSNSLGMLQKIPGHELSPEAYEVDVE-------FPSWVLENDKRRLHAPVEK-----  209

Query  462  IKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGD  283
             K +++VA+DG+G+F +IN A+SAAP SS TRF+IYIK G Y+E V++ K KT+IMF+GD
Sbjct  210  TKFNLMVAQDGTGNFTTINDAVSAAPTSSVTRFMIYIKRGVYFENVEIPKNKTIIMFMGD  269

Query  282  GIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYS  103
            GIG+T IK NR  K    TF+TATV V G GFIAK ISF N+AGP + QAVALR+ SD+S
Sbjct  270  GIGRTVIKANRR-KGNLGTFQTATVGVKGEGFIAKDISFVNFAGP-SPQAVALRSGSDHS  327

Query  102  VFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FY CSF GYQDTLYV+S +QF+RECD+YGTVDF
Sbjct  328  AFYRCSFEGYQDTLYVYSGKQFYRECDIYGTVDF  361



>gb|AAC72288.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=592

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 161/389 (41%), Positives = 228/389 (59%), Gaps = 36/389 (9%)
 Frame = -3

Query  1080  TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANC  901
             T S   H V  S+C  + Y +LC+S +V        S  ++I A+VN+T++ ++      
Sbjct  50    TLSPSSHAVLRSSCSSTRYPELCISAVVTAGACELTSQKDVIEASVNLTITAVEHNYFTV  109

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLS  736
              ++ +    L   E+ ALH CLE   + L +L   ++ L   P K+    HA DL+TL+S
Sbjct  110   KKLIKKRKGLTPREKTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLIS  169

Query  735   TAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKI---------KKEK  589
             +A+TNQ TCLDGF   +++K VR  ++K    +    SNAL+M+  +         +K K
Sbjct  170   SAITNQETCLDGFSHDDADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAK  229

Query  588   DNrfsssfrRENRGL-------------KDGFPKWLSRRDRALLEAPMGKGKKHDIKADM  448
                 +   + EN+                +G+P WLS  DR LL+   G G    +K D 
Sbjct  230   ITSNNRKLKEENQETTVAVDIAGAGELDSEGWPTWLSAGDRRLLQ---GSG----VKRDA  282

Query  447   VVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKT  268
              VA DGSG FK++ AA++AAP++S+ R+VI+IKAG Y E V+V KKK  IMF+GDG  +T
Sbjct  283   TVAADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRT  342

Query  267   RIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDC  88
              I G+RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP  HQAVALR  SD+S FY+C
Sbjct  343   IITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNC  402

Query  87    SFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
               + YQDTLYVHS RQFF +C + GTVDF
Sbjct  403   DMLAYQDTLYVHSNRQFFVKCLIAGTVDF  431



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 157/371 (42%), Positives = 223/371 (60%), Gaps = 28/371 (8%)
 Frame = -3

Query  1056  VAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             +  SAC  +LY +LC S +   P++  K  +  ++IS ++N+T   ++       ++  +
Sbjct  67    ILKSACTTTLYPELCFSAISSEPNITHKITNHKDVISLSLNITTRAVEHNYFTVEKLL-L  125

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLSTAMTNQ  718
                L   E+ ALH CLE   + L +L+   + L   P+K+    HAD L+TL+S+A+TNQ
Sbjct  126   RKSLTKREKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISSAITNQ  185

Query  717   YTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKD-----NrfsssfrR  559
              TCLDGF   +++K VR  + +    +    SNAL+M TK   +KD              
Sbjct  186   VTCLDGFSHDDADKEVRKVLQEGQIHVEHMCSNALAM-TKNMTDKDIAEFEQTNMVLGSN  244

Query  558   ENRGLKD-----GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALS  394
             +NR L +     G+P+W+S  DR LL+          +KAD+VVA DGSG+FK+++ A++
Sbjct  245   KNRKLLEEENGVGWPEWISAGDRRLLQGST-------VKADVVVAADGSGNFKTVSEAVA  297

Query  393   AAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTA  214
             AAP  S  R+VI IKAG Y E V+V KKKT IMF+GDG   T I G+RN+ DG  TF +A
Sbjct  298   AAPLKSSKRYVIKIKAGVYKENVEVPKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFHSA  357

Query  213   TVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFF  34
             TVA+ G  F+A+ I+F+N AGP  HQAVALR  +D S FY+C  + YQDTLYVH+ RQFF
Sbjct  358   TVAIVGGNFLARDITFQNTAGPAKHQAVALRVGADLSAFYNCDIIAYQDTLYVHNNRQFF  417

Query  33    RECDVYGTVDF  1
               C + GTVDF
Sbjct  418   VNCFISGTVDF  428



>ref|XP_003528739.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=598

 Score =   266 bits (680),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 156/379 (41%), Positives = 215/379 (57%), Gaps = 28/379 (7%)
 Frame = -3

Query  1074  SHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANC  901
             SH  H +  SAC  + Y +LC S +   P++  K  +  ++I  ++ +T   ++      
Sbjct  66    SHHSHTIVKSACSSTFYPELCYSAIASEPNVTHKITTNRDVIQLSLKITFRAVEQNYFTV  125

Query  900   SRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLS  736
              ++     DL   E+ ALH CLE   + L +LR     LE  P K+    HAD L+TL+S
Sbjct  126   KKLFTEHDDLTKREKTALHDCLETIDETLDELREAQHNLELYPNKKTLYQHADDLKTLIS  185

Query  735   TAMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfr  562
              A+TNQ TCLDGF   +++K+VR  + K    +    SNAL+M   +       +  + R
Sbjct  186   AAITNQVTCLDGFSHDDADKHVRKALEKGQVHVEHMCSNALAMTKNMTDSDIANYEYNMR  245

Query  561   RENRGLKDG------------FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDF  418
              EN G                +P+W+S  DR LL+A         +KAD+ VA DGSGDF
Sbjct  246   VENNGQNGNSNRKLLVENDVEWPEWISAADRRLLQAST-------VKADVTVAADGSGDF  298

Query  417   KSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKD  238
             K++  A+ AAP  S  RFVI IKAG Y E V+V KKK  IMF+GDG   T I  +RN+ D
Sbjct  299   KTVTEAVDAAPLKSSKRFVIRIKAGVYRENVEVPKKKNNIMFLGDGRTNTIITASRNVVD  358

Query  237   GWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLY  58
             G  TF +ATVAV GS F+A+ ++F+N AGP  HQAVALR   D S F++C  + +QDTLY
Sbjct  359   GSTTFHSATVAVVGSNFLARDLTFQNTAGPSKHQAVALRVGGDLSAFFNCDILAFQDTLY  418

Query  57    VHSRRQFFRECDVYGTVDF  1
             VH+ RQFF +C + GTVDF
Sbjct  419   VHNNRQFFVKCLIAGTVDF  437



>ref|XP_003626198.1| Pectinesterase [Medicago truncatula]
 gb|AES82416.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=544

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 148/393 (38%), Positives = 221/393 (56%), Gaps = 18/393 (5%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAK  973
              L  ++LL  F  +  F     +   + D+  +   AC     ++ C++ +         
Sbjct  7     FLFILILLPSFDQVLSFPDEIPSDIQTQDMQALIAQACMDIENQNSCLTNIHNELTRTGP  66

Query  972   SIP-EIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
               P  +I+A +  T++E   A  N ++I      +   E+ A+  C EL   ++++L   
Sbjct  67    PSPTSVINAALRTTINEAIGAINNMTKISTF--SVNNREQLAIEDCKELLDFSVSELAWS  124

Query  795   LDGLE-----NSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHV  631
             L  +      +  A+   +L+  LS A++NQ TC++GF  +++ +  +I   V Q+++ +
Sbjct  125   LGEMRRIRAGDRTAQYEGNLEAWLSAALSNQDTCIEGFEGTDRRLESYISGSVTQVTQLI  184

Query  630   SNALSMLTKIKK---EKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDI  460
             SN LS+ T++ +         +      +  L+  FP+W++  D+ LL     K K H  
Sbjct  185   SNVLSLYTQLNRLPFRPPRNTTLHETSTDESLE--FPEWMTEADQELL-----KSKPHGK  237

Query  459   KADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDG  280
              AD VVA DGSG +++IN A++AAP  S+ R VIY+K G Y E +D+ KK T IM VGDG
Sbjct  238   IADAVVALDGSGQYRTINEAVNAAPSHSNRRHVIYVKKGLYKENIDMKKKMTNIMMVGDG  297

Query  279   IGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSV  100
             IG+T +  NRN   GW TFRTAT AV G GFIAK ++F N AGP NHQAVALR DSD S 
Sbjct  298   IGQTIVTSNRNFMQGWTTFRTATFAVSGKGFIAKDMTFRNTAGPVNHQAVALRVDSDQSA  357

Query  99    FYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             F+ CS  G QDTLY HS RQF+REC++YGT+DF
Sbjct  358   FFRCSIEGNQDTLYAHSLRQFYRECEIYGTIDF  390



>ref|XP_011076457.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Sesamum indicum]
Length=594

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 147/361 (41%), Positives = 215/361 (60%), Gaps = 15/361 (4%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  880
             Q    AC  + Y  LCV++L+  P     S  +++  +VN+T+ +   A  + S I  + 
Sbjct  76    QAMSKACSRTRYPTLCVNSLLDFPGALTASDKDLVHISVNMTLQKFGRALYSASEISNL-  134

Query  879   PDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHA--DLQTLLSTAMTNQYTCL  706
              ++    R A   CLEL  D++  L   L  + +      +  D+ T LS ++TNQ TC 
Sbjct  135   -NMDPRVRSAYEDCLELLEDSVDLLSRSLTSVASGGGAGGSTQDVLTWLSASLTNQDTCT  193

Query  705   DGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG---  535
             DGF   N  V+  +  R++ +S  VSN L++      ++D        R  R L +    
Sbjct  194   DGFDELNGYVKSQMSDRLKDLSELVSNCLAIYAAAGGDEDFSGIPIQNRRRRLLSNDKEN  253

Query  534   --FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
               FP WLSRRDR LL+ P+       I AD++V++DG+G  K+I  A+  AP+ S+ RF+
Sbjct  254   KHFPVWLSRRDRKLLDMPVSA-----INADIIVSQDGNGTCKTITEAIKKAPEHSNRRFI  308

Query  360   IYIKAGSYYEYV-DVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFI  184
             IY++AG Y E +  V +KKT IMF+GDG GKT I G ++++D   TF TA+ A  G+GFI
Sbjct  309   IYVRAGKYEEKILKVGRKKTNIMFIGDGKGKTVIAGGKSVQDNMTTFHTASFAATGAGFI  368

Query  183   AKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVD  4
             A+ ++FEN+AGP  HQAVALR  +D++V Y C+ +GYQDTLY HS+RQF+RECD+YGTVD
Sbjct  369   ARDMTFENWAGPSKHQAVALRIGADHAVIYRCNIIGYQDTLYTHSQRQFYRECDIYGTVD  428

Query  3     F  1
             F
Sbjct  429   F  429



>ref|NP_001233857.1| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
 sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score =   265 bits (678),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 160/405 (40%), Positives = 231/405 (57%), Gaps = 28/405 (7%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTV-FQSSAMNATTSHDI-------HQVAHSACDHSLYRDLCVSTLV  997
             ++  V+L+A  + +    +S + N+    DI       H +  SAC ++L+ +LC S +V
Sbjct  25    IVASVLLVAAVIGVVAGVKSHSKNSDDHADIMAISSSAHAIVKSACSNTLHPELCYSAIV  84

Query  996   KTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFS  823
                D   K  S  ++I  ++N+TV  ++        + +    L   E+ ALH CLE   
Sbjct  85    NVSDFSKKVTSQKDVIELSLNITVKAVRRNYYAVKELIKTRKGLTPREKVALHDCLETMD  144

Query  822   DALADLRTVLDGLENSPAKRH-----ADLQTLLSTAMTNQYTCLDGFPN--SNKNVRPFI  664
             + L +L T ++ LE  P K+       DL+TL+S+A+TNQ TCLDGF +  ++K VR  +
Sbjct  145   ETLDELHTAVEDLELYPNKKSLKEHVEDLKTLISSAITNQETCLDGFSHDEADKKVRKVL  204

Query  663   IKRVEQISRHVSNALSMLTKIK-KEKDNrfsssfrRENRGLKDG---FPKWLSRRDRALL  496
             +K  + + +  SNAL+M+  +   +  N    S    NR L +    +P+WLS  DR LL
Sbjct  205   LKGQKHVEKMCSNALAMICNMTDTDIANEMKLSAPANNRKLVEDNGEWPEWLSAGDRRLL  264

Query  495   EAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVD  316
             ++         +  D+VVA DGSGD+K+++ A+  AP+ S  R+VI IKAG Y E VDV 
Sbjct  265   QSST-------VTPDVVVAADGSGDYKTVSEAVRKAPEKSSKRYVIRIKAGVYRENVDVP  317

Query  315   KKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQ  136
             KKKT IMF+GDG   T I  +RN++DG  TF +ATV       +A+ I+F+N AG   HQ
Sbjct  318   KKKTNIMFMGDGKSNTIITASRNVQDGSTTFHSATVVRVAGKVLARDITFQNTAGASKHQ  377

Query  135   AVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             AVAL   SD S FY C  + YQDTLYVHS RQFF +C V GTVDF
Sbjct  378   AVALCVGSDLSAFYRCDMLAYQDTLYVHSNRQFFVQCLVAGTVDF  422



>gb|AAG17110.1|AF188895_1 putative pectin methylesterase 3 [Linum usitatissimum]
Length=555

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 154/357 (43%), Positives = 208/357 (58%), Gaps = 15/357 (4%)
 Frame = -3

Query  1047  SACDHSLYRDLCVSTLVKTP-DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDL  871
             S+C ++ + DLC S+L   P  +   +  ++I A++NVT + +    A  ++      DL
Sbjct  45    SSCSNTRHPDLCFSSLASAPVHVSLNTQMDVIKASINVTCTSVLRNIAAVNKALSTRTDL  104

Query  870   GTMERRALHVCLELFSDALADLRTVLDGLENSPAK----RHAD-LQTLLSTAMTNQYTCL  706
                 R AL  C+E  S +L +L   L  L+  P K    RHAD L+TLLS A TNQ TCL
Sbjct  105   TPRSRSALKDCVETMSTSLDELHVALAELDEYPNKKSITRHADDLKTLLSAATTNQETCL  164

Query  705   DGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGF  532
             DGF   +S K VR  +     ++ +   NAL M+  +  E D   +++      G    +
Sbjct  165   DGFSHDDSEKKVRKTLETGPVRVEKMCGNALGMIVNMT-ETDMASATNAVNTEGGSSGSW  223

Query  531   PKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYI  352
             P W+   DR LL+A         +  ++VVA DGSG ++ ++ A++AAP  S  R+VI I
Sbjct  224   PIWMKGGDRRLLQAGT------TVTPNVVVAADGSGKYRRVSEAVAAAPSKSSKRYVIRI  277

Query  351   KAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGI  172
             KAG Y E V+V K KT IMFVGDG   T I GN+N+ DG  TF +ATVAV G GF+A+ I
Sbjct  278   KAGIYRENVEVPKDKTNIMFVGDGRSNTIITGNKNVVDGSTTFNSATVAVVGQGFLARDI  337

Query  171   SFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +F+N AGP  HQAVALR  +D + FY C F+ YQDTLYVHS RQFF  C V GTVDF
Sbjct  338   TFQNTAGPSKHQAVALRVGADLAAFYRCDFLAYQDTLYVHSNRQFFINCLVVGTVDF  394



>gb|KHG26122.1| putative pectinesterase/pectinesterase inhibitor 34 -like protein 
[Gossypium arboreum]
Length=548

 Score =   264 bits (675),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 146/394 (37%), Positives = 223/394 (57%), Gaps = 20/394 (5%)
 Frame = -3

Query  1158  PIMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLR  979
             P  L+ + LL  F  + V  +    A   H+  Q   + C  + + + CV++L+K PD  
Sbjct  4     PKNLITIFLLIVFTMINVCAAGRGAAVIRHNPTQAISNTCSRTRFPNYCVNSLLKFPDSF  63

Query  978   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRT  799
               S  +++  + N+T+     A    + +  +  D     R A   CLEL  D++  L  
Sbjct  64    TASEQDLVHVSFNMTLQHFSDALYMTTSVSNIKMD--PRVRSAFDACLELLVDSIEALSL  121

Query  798   VLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNAL  619
              L  + +       D+ T LS A+TN  TC +GF      ++  ++ ++  +S+ VSN L
Sbjct  122   SLSAVIHKGGSTQ-DVMTWLSAALTNLDTCAEGFEGVTGALKDHVVAKLNDLSQLVSNCL  180

Query  618   SMLTKIKKEKDNrfsssfrRENRGL-------KDGFPKWLSRRDRALLEAPMGKGKKHDI  460
             S+      +      +    ENR L       ++ FPKW+ R +R LL+ P+      +I
Sbjct  181   SIFAATGGDD----FAGVSVENRRLLASSPSNEEKFPKWVGRIERKLLDTPLS-----EI  231

Query  459   KADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIMFVGD  283
             +A ++V+KDG+G  ++I+ A+  AP++S  R VIY++AG Y E  + V +KK  +MF+GD
Sbjct  232   QAHIIVSKDGNGTVETISEAIKKAPENSSRRIVIYVRAGRYEETNLKVGRKKMNLMFIGD  291

Query  282   GIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYS  103
             G GKT I G +++ D   TF TAT A  GSGFIA+ ++FEN+AGP  HQAVALR  +D++
Sbjct  292   GKGKTVISGGKSVFDNVTTFHTATFAATGSGFIARDMTFENWAGPTKHQAVALRVGADHA  351

Query  102   VFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             V Y C+ +GYQDTLYVHS RQF+RECD+YGTVDF
Sbjct  352   VVYKCNIIGYQDTLYVHSNRQFYRECDIYGTVDF  385



>gb|EPS73427.1| pectinesterase [Genlisea aurea]
Length=579

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 144/354 (41%), Positives = 219/354 (62%), Gaps = 13/354 (4%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  880
             Q     C  + Y  LCV++L+  P   A S  ++++ +VN+T+  + +A  + S +  + 
Sbjct  76    QAMSRVCGMTQYPTLCVNSLLDFPGAIAASDQDLVTISVNMTLQRVGSALNSVSEMSYL-  134

Query  879   PDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDG  700
              ++ ++ R A   CLEL  D++ DL  +   L ++      D+ T LS A+TNQ TC +G
Sbjct  135   -EMDSIVRSAHTDCLELLDDSV-DL--LYQSLSSTDGASTEDVLTWLSAALTNQDTCGEG  190

Query  699   FPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWL  520
                   +V+  + KR+E +   +SN+L++ +   +           R  R L D FP W+
Sbjct  191   IQELKGHVKNRMSKRLENLWELISNSLAIYSA--RTGGFSTIPIQNRRRRLLGDRFPAWI  248

Query  519   SRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGS  340
             SR++R LL+ P  +     I AD++V++DG+G  K+I  A+  APD+S  RF+IY++AG 
Sbjct  249   SRKERMLLQIPASQ-----INADVIVSRDGNGTCKTIGEAIKLAPDNSKRRFIIYVRAGW  303

Query  339   YYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFE  163
             Y E  + + +KKT IM +GDG GKT I G ++++DG  TFRTA+ A  G+GFIA+ +SF 
Sbjct  304   YEEGTLKIGRKKTNIMVMGDGKGKTVISGGKSVQDGITTFRTASFAASGAGFIARDLSFV  363

Query  162   NYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             N+AGPE HQAVALR  +D++V Y CS  GYQDTLY HS+RQF+REC++YGTVDF
Sbjct  364   NWAGPEKHQAVALRVSADHAVVYRCSIEGYQDTLYAHSQRQFYRECNIYGTVDF  417



>ref|XP_010442899.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Camelina sativa]
Length=589

 Score =   265 bits (677),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 158/397 (40%), Positives = 211/397 (53%), Gaps = 23/397 (6%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             +++V V+    F  +    S       +    Q     C  SLY +LC+ TL+  P    
Sbjct  41    VLVVGVICFGIFAGIRAVGSDKTEPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
                 E+I  + N T+     A  + S I      +    R A   CLEL  D++  L   
Sbjct  101   ADENELIHISFNATLQRFSKALYSSSTI--TYTQMPPRVRSAYDSCLELLDDSVDALSRA  158

Query  795   LDGLENSPA-KRHADLQTLLSTAMTNQYTCLDGFPNSNKN---VRPFIIKRVEQISRHVS  628
             L  +      + H+D+ TLLS+AMTN  TC DGF  +      V+  +I  V+ +S  VS
Sbjct  159   LSSVVVVFGDESHSDVMTLLSSAMTNHDTCTDGFDETGGQGGGVKDQVIGAVKDLSEMVS  218

Query  627   NALSMLTKIKKEKD-------NrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKK  469
             N L++     K KD       N        E   L    P WL R DR LL  P      
Sbjct  219   NCLAIFAG--KVKDLSGVPVVNNRRLLGAEETEELH--LPNWLKREDRELLGTPTSA---  271

Query  468   HDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIMF  292
               I+AD+ V+KDG+G FK+I  A+  AP+ S  RFVIY+KAG Y E  + V +KKT +MF
Sbjct  272   --IQADITVSKDGTGTFKTITEAIKKAPEHSGRRFVIYVKAGRYEEENLKVGRKKTNLMF  329

Query  291   VGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADS  112
             +GDG GKT I G +++ D   TF TAT A  G+GFI + ++FENYAGP  HQAVALR   
Sbjct  330   IGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDMTFENYAGPAKHQAVALRVGG  389

Query  111   DYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             D++V Y C+ +GYQD LYVHS RQFFREC++YGTVDF
Sbjct  390   DHAVVYRCNIIGYQDALYVHSNRQFFRECEIYGTVDF  426



>ref|XP_006279604.1| hypothetical protein CARUB_v10026136mg [Capsella rubella]
 gb|EOA12502.1| hypothetical protein CARUB_v10026136mg [Capsella rubella]
Length=587

 Score =   265 bits (677),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 159/395 (40%), Positives = 212/395 (54%), Gaps = 21/395 (5%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             +++V V+    F  +    S       +    Q     C  SLY +LC+ TL+  P    
Sbjct  41    VLVVGVICFGIFAGIRAAGSDKTVPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLT  100

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
                 E+I  + N T+     A    S I      +    R A   CLEL  D++  L   
Sbjct  101   ADESELIHISFNATLQRFSKALYASSTITYT--QMPPRVRSAYDSCLELLDDSVEALTRA  158

Query  795   LDGLEN-SPAKRHADLQTLLSTAMTNQYTCLDGFPNSNK---NVRPFIIKRVEQISRHVS  628
             L  +   S  + H+D+ T LS+AMTN  TC DGF  ++     V+  +I  V+ +S  VS
Sbjct  159   LSSVVVVSGDESHSDVMTWLSSAMTNHDTCTDGFDETDGEGGGVKDQVIGAVKDLSEMVS  218

Query  627   NALSMLTKIKKEKDNrfsssfrRENRGL-----KDGFPKWLSRRDRALLEAPMGKGKKHD  463
             N L++       K    S      NR L      +  P WL+R DR LL  P        
Sbjct  219   NCLAIFAG----KVTDLSGVPVVNNRKLLGTEETEELPNWLNREDRELLGTPAPA-----  269

Query  462   IKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIMFVG  286
             I+AD+ V+KDG+G FK+I  A+  AP+ S  +FVIY+KAG Y E  + V +KKT I+F+G
Sbjct  270   IQADITVSKDGTGTFKTITEAIKKAPEHSSRKFVIYVKAGRYEEENLKVGRKKTNIVFIG  329

Query  285   DGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDY  106
             DG GKT I G +++ D   TF TAT A  G+GFI + I+FENYAGP  HQAVALR   D+
Sbjct  330   DGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVRDITFENYAGPGKHQAVALRIGGDH  389

Query  105   SVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +V Y CS +GYQD LYVHS RQFFRECD+YGTVDF
Sbjct  390   AVVYHCSIIGYQDALYVHSNRQFFRECDIYGTVDF  424



>ref|XP_010049073.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Eucalyptus grandis]
Length=589

 Score =   265 bits (676),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 149/356 (42%), Positives = 207/356 (58%), Gaps = 16/356 (4%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             C  + Y  LC+  L   PD    S  +++  + NVT+     A    S I  +   +   
Sbjct  78    CGLTRYPALCLDALAAFPDAEGASQQDLVHISFNVTLQRFSKALYVSSTIGHL--QMEPR  135

Query  861   ERRALHVCLELFSDALADLRTVLD----GLENSPAKRHADLQTLLSTAMTNQYTCLDGFP  694
              R A   CLEL  DA+  LR  L+    G   S +    D+ T LS AMTNQ TC +GF 
Sbjct  136   VRSAFDDCLELLDDAVDALRRSLNYVTPGGAKSASWSAQDVVTWLSAAMTNQDTCAEGFA  195

Query  693   NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLK----DGFPK  526
             + +  V+  + +R+  +S  VSN L++ +    E  +      RR  R +     DG P+
Sbjct  196   DVSGGVKQLMAERMRDLSELVSNCLAIFSATAGEDFDGVPIQNRRRRRLMGSSDGDGMPR  255

Query  525   WLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKA  346
             WL R++R LL+ P+       I+AD+ V+KDG+G  K+I+ A+  APD    RF+IY++A
Sbjct  256   WLRRKERRLLQMPVTA-----IQADVTVSKDGNGTCKTISEAIKKAPDYGTRRFIIYVRA  310

Query  345   GSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGIS  169
             G Y E  + V +KKT +MFVGDG   T I G +++ D   TF TA+ A  G+GFIA+ I+
Sbjct  311   GRYEEDNLKVGRKKTNVMFVGDGKSNTIISGGKSIFDNMTTFHTASFAATGAGFIARDIT  370

Query  168   FENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             FEN+AGP  HQAVALR  +D++V Y C+ +GYQDTLYVHS RQFFRECD+YGTVDF
Sbjct  371   FENWAGPAKHQAVALRVGADHAVVYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDF  426



>ref|XP_010029512.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=587

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 155/373 (42%), Positives = 221/373 (59%), Gaps = 26/373 (7%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPE--IISATVNVTVSEIKTAAANCSRI-  892
             H +  S+C  + Y DLC S +   P   A    +  +I A++N+T   ++       ++ 
Sbjct  61    HAILKSSCSSTRYPDLCYSAVAAFPGAAAGLATQKDVIEASLNITTVAVEHNFFAVEKLL  120

Query  891   RRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPA-----KRHAD-LQTLLSTA  730
              +    L   E+RALH CLE   + L +LR     L + P+     K+HAD L+TL+S+A
Sbjct  121   SKRSKSLTKREKRALHDCLETIDETLDELREAERDLSSYPSAAKSLKQHADDLKTLMSSA  180

Query  729   MTNQYTCLDGF--PNSNKNVRPFIIKRVEQISRHVSNALSMLTKI--------KKEKDNr  580
             +TNQ TCLDGF   ++++ VR  + K    + +  SNAL+M+  +        +K   NR
Sbjct  181   ITNQETCLDGFSHEDADRQVRKALAKGQVHVEKMCSNALAMIKNMTDADMEAERKAAANR  240

Query  579   fsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAA  400
                      +G K G+P+WLS  DR LL++         +  D+VVA DG+G +K+I+ A
Sbjct  241   KMLKEEDLVQGDKSGWPEWLSAGDRRLLQSTA-------VIPDVVVAADGTGKYKTISEA  293

Query  399   LSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFR  220
             ++AAP+ S  R+VI I AG Y E V V KKKT +MF+GDG   T I G+R++K G+ TF 
Sbjct  294   VAAAPEKSSKRYVIKINAGVYRENVQVPKKKTNLMFIGDGRTTTIITGDRSVKGGFTTFE  353

Query  219   TATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQ  40
             +ATVAV G  F+AK I+F+N AGP NHQAVALR  +D S FY+C  + YQDTLYVH+ RQ
Sbjct  354   SATVAVVGERFLAKSITFQNTAGPSNHQAVALRVGADLSAFYECDILAYQDTLYVHNNRQ  413

Query  39    FFRECDVYGTVDF  1
             FF +C + GTVDF
Sbjct  414   FFVKCLIAGTVDF  426



>ref|XP_009135376.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=591

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 165/411 (40%), Positives = 231/411 (56%), Gaps = 36/411 (9%)
 Frame = -3

Query  1146  VPVVLLAPFLSLTVFQSSAMNA---TTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             V ++L+     +TV  S A      T +   H V  SAC  + Y +LC+S +  +  +  
Sbjct  27    VALLLVTAIAGITVGASKANENGKRTLTPSSHAVLTSACISTRYPELCISAVATSGGVEL  86

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
              S  ++I A++N+T + ++       ++ +    L   E+ ALH CLE   + L +L   
Sbjct  87    TSQKDVIEASLNLTKTVVEHNYFTVKKLIKKRKGLTPREKTALHDCLETIDETLDELHEA  146

Query  795   LDGLENSPAKR----HA-DLQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQISR  637
             ++ L   P K+    HA DL+TL+S+A+TNQ TCLDGF +  ++K VR  + K    +  
Sbjct  147   VEDLHLYPNKKSLREHAGDLKTLISSAITNQETCLDGFSHDGADKKVRKALFKGQMHVEH  206

Query  636   HVSNALSMLTKIKKE--KDNrfsssfrRENRGLKD-----------------GFPKWLSR  514
               SNAL+M+  +      +    + F   NR LK+                 G+P WLS 
Sbjct  207   MCSNALAMIKNMTDTDITNFELKAKFTSNNRKLKEETTVAVDMASVGDLDAEGWPTWLSA  266

Query  513   RDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYY  334
              DR LL+          ++AD  VA DGSG F ++ AA++AAP++S+ R+VI+IKAG Y 
Sbjct  267   GDRRLLQGST-------VEADATVAADGSGTFTTVAAAVAAAPENSNKRYVIHIKAGVYR  319

Query  333   EYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYA  154
             E VDV KKK  IMF+GDG   T I  +RN  DGWPTF +ATVAV G  F+A+ I+F+N A
Sbjct  320   ENVDVAKKKKNIMFMGDGRTTTIITASRNAVDGWPTFSSATVAVVGERFLARDITFQNTA  379

Query  153   GPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             GP   QAVALR  SD+S FY C  + YQDTLYVHS RQFF  C + GTVDF
Sbjct  380   GPSKEQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVNCLIVGTVDF  430



>gb|KDP23440.1| hypothetical protein JCGZ_23273 [Jatropha curcas]
Length=538

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/358 (39%), Positives = 213/358 (59%), Gaps = 24/358 (7%)
 Frame = -3

Query  1044  ACDHSLYRDLC-VSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLG  868
             AC     +D C +S  V+     + S   ++SA +  ++SE + A    ++   +   + 
Sbjct  41    ACTGVENQDSCMLSMQVELEKAGSPSGHSVLSAALRASLSEARLAVDTITKFNSL--SIS  98

Query  867   TMERRALHVCLELFSDALADLRTVLDGLENSPA-----KRHADLQTLLSTAMTNQYTCLD  703
               E+ A+  C EL   ++++L   L+ +E   A     +   +L+  LS A++NQ TCL+
Sbjct  99    YREQVAIEDCKELLDFSVSELAWSLEEMEKIRAGDMNVRYEGNLKAWLSAALSNQDTCLE  158

Query  702   GFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIK----KEKDNrfsssfrRENRGLKDG  535
             GF  +++ +  F+   + Q+++ + N L++ T++     K   N   ++   E       
Sbjct  159   GFEGTDRRLENFMRGSLNQVTQLIGNVLALYTQLHSMPFKPSRNGTVTNRSPE-------  211

Query  534   FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIY  355
             FP+W++  D+ LL+A         I  D +V+ DGSG +++I  A++ AP  S+ R++IY
Sbjct  212   FPEWMTEGDQELLKA-----SSVGIHIDAIVSLDGSGHYRTITEAINEAPSHSNRRYIIY  266

Query  354   IKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKG  175
             +K G Y E +D+ KKKT IM VGDGIGKT + GNRN   GW TFRTATVAV G GFIA+ 
Sbjct  267   VKQGVYRENIDMKKKKTNIMLVGDGIGKTVVTGNRNFLQGWTTFRTATVAVSGRGFIARD  326

Query  174   ISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ++F N AGP+NHQAVALR DSD S FY CS  GYQDTLY HS RQF+REC++YGT+D+
Sbjct  327   MTFRNTAGPQNHQAVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECNIYGTIDY  384



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 167/408 (41%), Positives = 232/408 (57%), Gaps = 34/408 (8%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDI------HQVAHSACDHSLYRDLCVSTLVK  994
             I LV  +LL   L        + N  +  D       H +  S+C  +LY DLC STL  
Sbjct  30    IALVAAILLVGALIGIATGVKSQNKNSGDDSEASAASHAILKSSCSSTLYPDLCFSTLA-  88

Query  993   TPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSD  820
              P    K  S  ++I  ++N+T + ++       ++ +    L   E+ ALH CLE   +
Sbjct  89    APGAAKKVSSQKDVIELSLNITTTAVEHNFFAVKKLLKSRKKLTKREKVALHDCLENIDE  148

Query  819   ALADLRTVLDGLENSPAKRHA------DLQTLLSTAMTNQYTCLDGFP--NSNKNVRPFI  664
              L +L   +  L   P K+ +      DL+TL+S+A+TNQ TCLDGF   +++K VR  +
Sbjct  149   TLDELHAAVADLHEYPNKKKSLTQYADDLKTLISSAITNQETCLDGFSHDDADKKVRKVL  208

Query  663   IKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRE-NRGLKD------GFPKWLSRRDR  505
              K    + +  SNAL+M   I+   DN  +++ +   NR LK+      G+P+WLS  DR
Sbjct  209   EKGQVHVEQLCSNALAM---IRNMTDNDIANASKMNVNRKLKEEVVEEKGWPEWLSVADR  265

Query  504   ALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYV  325
              LL++         +  ++VVA DGSG++K+++ A++AAP+ S TR+VI IKAG Y E V
Sbjct  266   RLLQSST-------VTPNVVVAADGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGVYRENV  318

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPE  145
             DV KKKT IMF+GDG   T I  +RN+ DG  TF +ATVA  G  FIA+ I+F+N AGP 
Sbjct  319   DVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFNSATVAAVGEKFIARDITFQNTAGPS  378

Query  144   NHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              HQAVALR  SD S FY    + YQD+LYVHS RQFF  C V GTVDF
Sbjct  379   KHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDF  426



>gb|ABJ99594.1| pectinesterase inhibitor [Lycoris aurea]
Length=580

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/384 (40%), Positives = 218/384 (57%), Gaps = 18/384 (5%)
 Frame = -3

Query  1122  FLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATV  943
             FL  T    S + AT       ++ + C  +LY DLCV++LV+ P   +    +++  T+
Sbjct  42    FLVRTTAAKSTIQATRPRPTQAISRT-CGLTLYPDLCVNSLVEFPGALSAGERDLVHITL  100

Query  942   NVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADL-RTVL-------DG  787
             N+T+     A  + S I  V  D  T  R A   C+EL   ++  L R++L         
Sbjct  101   NMTLQHFSRALYDASAIAGVAMD--TYARSAYEDCIELLDSSIDQLSRSMLVVGPVQSQK  158

Query  786   LENSPAKRHADLQTLLSTAMTNQYTCLDGFPN-SNKNVRPFIIKRVEQISRHVSNALSML  610
                 P     D  T LS A+TNQ TC DG    ++  VR  +   ++ +S  VSN+L++ 
Sbjct  159   PMGGPPSDDEDELTWLSAALTNQDTCSDGLSGVTDDYVRQQMTGYLKDLSELVSNSLAIF  218

Query  609   TKIKKEKDNrfsssfrRENRGLK-DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKD  433
                 K KD        ++   L  + FP W+ + DR LL+ P        ++AD+VV+KD
Sbjct  219   AISSKNKDFSGIPIQNKKRNLLGMENFPNWVEKSDRRLLQVP-----ATGVQADIVVSKD  273

Query  432   GSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGN  253
             G+G + +I  A+  AP+ S  R +IY+KAG Y E + V +KK  +MF+GDG GKT I G+
Sbjct  274   GNGTYTTIADAIKHAPEGSSRRIIIYVKAGRYEENIKVGRKKINLMFIGDGKGKTVIAGS  333

Query  252   RNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGY  73
             R++ D + TF TAT A  G+GFI + ++ EN+AGP+ HQAVALR  +D SV Y C  +GY
Sbjct  334   RSVFDSYTTFHTATFAATGAGFIMRDMTIENWAGPQKHQAVALRVGADRSVVYRCDIIGY  393

Query  72    QDTLYVHSRRQFFRECDVYGTVDF  1
             QDTLYVHS+RQFFRECDVYGTVDF
Sbjct  394   QDTLYVHSQRQFFRECDVYGTVDF  417



>emb|CDP17209.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 157/431 (36%), Positives = 242/431 (56%), Gaps = 32/431 (7%)
 Frame = -3

Query  1248  ATYIYFPPVSSVWLSYHSTIDSEMQNLGRNPIMLVPVVLLAPFLSLTVFQSSAMNATTSH  1069
             A YI   PV     +   T+    + +  + ++L  ++LL     +   ++SA     +H
Sbjct  3     AYYIADLPVKQAMPATFFTMQHPSKTMAFSNVVLFLLILLPCGSKVQSQETSAYPKDQNH  62

Query  1068  D-IHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIP-EIISATVNVTVSEIKTAAANCSR  895
                  +   AC H   +  C++ L    D  ++  P  ++ A +  T++E + A  + ++
Sbjct  63    QGFETMMTQACQHVDDQTSCLANLQSRLDTWSQQNPISVLKAALENTLNEARLAVDSLTK  122

Query  894   IRRVVPDLGTMERRALHVCLELF-------SDALADLRTVLDGLENSPAKRHADLQTLLS  736
                +   +   E+ A+  C EL        + +LA++  +  G++NS      +L+  LS
Sbjct  123   FSTL--SVSYREQIAIDDCKELLDFSVSELAWSLAEMNRIRSGVKNS--HYEGNLKAWLS  178

Query  735   TAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKI-----KKEKDNrfss  571
              A++NQ TCL+GF  +++ +  F+   + Q+++ +SN LS+ T++     K  +++   +
Sbjct  179   AALSNQDTCLEGFEGTDRRLERFVRGSLTQVTQLISNVLSLYTRLHSLPFKPPRNSPNDT  238

Query  570   sfrRENRGLKDGFPKWLSRRDRALLEA-PMGKGKKHDIKADMVVAKDGSGDFKSINAALS  394
             S   +       FP+W++  D+ ++ A P G      +  D VVA DGSG ++SI  A+ 
Sbjct  239   SESVD-------FPEWMTEGDQEIVSASPKG------MHVDSVVALDGSGHYRSIAQAIY  285

Query  393   AAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTA  214
              AP  S  R++IY+K G Y+E +D  KKKT IM VGDGIG+T I GNRN   GW TFRTA
Sbjct  286   EAPSYSIRRYIIYVKRGVYHENIDTRKKKTNIMLVGDGIGQTVITGNRNFMQGWTTFRTA  345

Query  213   TVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFF  34
             TVAV G GFIA+ ISF N AGPENHQ VALR DSD S F+ CS  G+QDTLY+HS RQF+
Sbjct  346   TVAVSGKGFIARDISFRNTAGPENHQGVALRVDSDQSAFFRCSMEGHQDTLYIHSLRQFY  405

Query  33    RECDVYGTVDF  1
             REC +YGT+DF
Sbjct  406   RECSIYGTIDF  416



>ref|XP_008450601.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
isoform X2 [Cucumis melo]
Length=481

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/327 (41%), Positives = 204/327 (62%), Gaps = 18/327 (6%)
 Frame = -3

Query  960  IISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLEL--FSDA-----LADLR  802
            ++SA +  T++E + A  + ++           E  A+  C EL  FS A     LA+++
Sbjct  12   VLSAAIRATINEARQAIESITKFSTF--SFSYREEMAIEDCKELLDFSVAELAWSLAEMK  69

Query  801  TVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNA  622
             +  G   +P +   +L+  LS A++NQ TCL+GF  +++++  FI   ++Q++  +SN 
Sbjct  70   RIRAGKNEAPDE--GNLKAWLSAALSNQDTCLEGFEGTDRHIVGFIRGSLKQVTLLISNV  127

Query  621  LSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVV  442
            L++ T++         +    + +  +  FP W+   +  L+     K    ++  D +V
Sbjct  128  LALYTQLHSLPFQPPRNETMEKTKSSE--FPDWMMDSEHKLV-----KSHPRNVHVDAIV  180

Query  441  AKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRI  262
            A DGSGDF+SI  A++ AP  S+ R++IY+K G Y E +D+ +KKT IMF+GDGIG+T +
Sbjct  181  ALDGSGDFRSITEAVNEAPSYSNRRYIIYVKKGVYKENIDMKRKKTNIMFIGDGIGETIV  240

Query  261  KGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSF  82
             G+RN   GW TFRTATVAV G GFIA+ ++F N AGPENHQAVALR DSD S F+ CSF
Sbjct  241  TGSRNFLQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQAVALRVDSDQSAFFRCSF  300

Query  81   VGYQDTLYVHSRRQFFRECDVYGTVDF  1
             G+QDTLYVHS RQF+REC++YGT+D+
Sbjct  301  EGHQDTLYVHSLRQFYRECNIYGTIDY  327



>ref|XP_009596446.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Nicotiana tomentosiformis]
Length=602

 Score =   263 bits (672),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 150/386 (39%), Positives = 222/386 (58%), Gaps = 22/386 (6%)
 Frame = -3

Query  1113  LTVFQSSAMNATTSHDIHQVAHS-ACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNV  937
             +TV   +    T  H    VA S  C  + +R LC+++L + P   + S  +++  +VN+
Sbjct  61    VTVRNKTGPTPTLLHSKPTVAMSHTCSRTRFRTLCLNSLHEFPGALSASDDDLVHISVNL  120

Query  936   TVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAK-RH  760
             T+     A    S I  +   + T  R A   CLEL  +++  L   L  +     K  +
Sbjct  121   TLQRFGKALYMASDISNLY--MNTRIRSAYEDCLELLEESIDLLARSLTSVSPGAGKSNN  178

Query  759   ADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNr  580
              D+ T LS A+TNQ TC +GF + N NV+  + +++  +S  VSN+L++   +  + D  
Sbjct  179   HDVLTWLSAALTNQDTCTEGFADVNGNVKDQMTEKLRDLSELVSNSLAIFAAMNGDDDFS  238

Query  579   fsssfrRENR--GLKDG----------FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAK  436
                   R  R  G  D           FPKWL+R++R LLE P+       I+AD++V+K
Sbjct  239   GVPIQNRRRRLMGSNDAVSAKDEDFAPFPKWLNRKERMLLETPVSA-----IQADIIVSK  293

Query  435   DGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIK  259
             DG+G FK+I  A+   P+ S+ R +IY+K G Y E  + + +KKT +MF+GDG  KT I 
Sbjct  294   DGNGSFKTIAEAIKKVPEYSNRRIIIYVKTGRYEEDNLKIGRKKTNVMFIGDGKDKTVIT  353

Query  258   GNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFV  79
             G +++     TF TA+ A  G+GFI + I+FENYAGP  HQAVALR  +D++V Y C+ +
Sbjct  354   GGKSVSQNLTTFHTASFAATGAGFIVRDITFENYAGPSKHQAVALRIGADHAVVYRCNII  413

Query  78    GYQDTLYVHSRRQFFRECDVYGTVDF  1
             GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  414   GYQDTLYVHSQRQFYRECDIYGTVDF  439



>emb|CDP05068.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   263 bits (672),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 159/422 (38%), Positives = 235/422 (56%), Gaps = 46/422 (11%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSA----CDHSLYRDLCVSTLVKTP  988
             I+L  ++++A  +S  V  +    A++   +H+    A    C  + Y  LCV +L+  P
Sbjct  40    IILAAILIVASAISAAVVVALRNKASSDAALHRKPSRAISRTCSKTRYPALCVDSLLDFP  99

Query  987   DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALAD  808
                  S  +++  TVN+T+  +  A  + S I  V  D+G+  R A   CLEL +D++  
Sbjct  100   GALTASDKDLVHITVNMTLQRLGKALYDVSDIGYVAMDVGS--RSAYDDCLELLADSVDL  157

Query  807   LRTVLDGLENSPAKRHA----------------DLQTLLSTAMTNQYTCLDGFPN-SNKN  679
             L   L  +  SPA                    D+ T LS A+TNQ TC +GF      +
Sbjct  158   LARSLTTM--SPASTEGEGDGSGSSSSYVGSTQDVLTWLSAALTNQDTCTEGFGEVGGGS  215

Query  678   VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGL---------------  544
             V+  + ++++ ++  VSN L++ +    + D+          R L               
Sbjct  216   VKDQMSEKLKDLTELVSNCLAIYSAAGGDGDDFSGIPIGNRRRRLMGDDEEGYGGNHKQQ  275

Query  543   KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRF  364
             ++ FPKWL R+DR LL+ P        I+AD++V+KDG+G  K++  A+  AP+ S  R 
Sbjct  276   EEEFPKWLPRKDRRLLQVPA-----TSIQADIIVSKDGNGTVKTVGEAIKKAPEHSTRRI  330

Query  363   VIYIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGF  187
             +IY+KAG Y E  + V +KKT +MF+GDG GKT I G +++ D   TF TA+ A  G+GF
Sbjct  331   IIYVKAGKYEEDNLKVGRKKTNLMFIGDGKGKTVISGGKSIFDKVTTFHTASFAATGAGF  390

Query  186   IAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTV  7
             IA+ ++FEN+AGP  HQAVALR  +D++V Y CS VGYQDTLYVHS+RQFFRECDVYGTV
Sbjct  391   IARDMTFENWAGPSKHQAVALRVGADHAVVYRCSIVGYQDTLYVHSQRQFFRECDVYGTV  450

Query  6     DF  1
             DF
Sbjct  451   DF  452



>ref|XP_009127175.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Brassica rapa]
Length=586

 Score =   262 bits (670),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 147/354 (42%), Positives = 205/354 (58%), Gaps = 16/354 (5%)
 Frame = -3

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIR--RVVPDLG  868
             C  + Y  LC+ TL+  P        +++  + N T+     A  + S+I   ++ P + 
Sbjct  79    CSKAQYTSLCIDTLLDFPGSSTADEQQLLHISFNATLLSFSKALYSSSKISYTQMPPRV-  137

Query  867   TMERRALHVCLELFSDALADLRTVLDGLENSPA---KRHADLQTLLSTAMTNQYTCLDGF  697
                R A   CLEL  D++  L   L  +  S +   + H+D+ T LS+AMTN  TC DGF
Sbjct  138   ---RSAYDSCLELLDDSVDALSRALSSVVISSSGNDESHSDVMTWLSSAMTNHDTCTDGF  194

Query  696   PN-SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWL  520
                 N  V+  ++  V+ +S  VSN L++ +    + +    ++ +       + FP WL
Sbjct  195   EGVGNGEVKDQVVGAVKGLSEMVSNCLALFSGNVNDVNGVPVANRKLLGAEETEEFPSWL  254

Query  519   SRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGS  340
              R DR LL  P        I+AD+ V+KDG+G  K+I  A+  AP+ S  RFVIY+K+G 
Sbjct  255   KRGDRELLGTPATA-----IQADITVSKDGNGTVKTIAEAIKKAPEQSSRRFVIYVKSGR  309

Query  339   YYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFE  163
             Y E  + V +KKT +MF+GDG GKT I G +++ D   TF TAT A  G+GFI K I+FE
Sbjct  310   YEEDNLKVGRKKTNLMFIGDGKGKTVITGGKSIADDLTTFHTATFAATGAGFIVKDITFE  369

Query  162   NYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             NYAGP  HQAVALR   D++V Y C+ +GYQDTLYVHS RQFFRECD+YGTVDF
Sbjct  370   NYAGPSKHQAVALRVGGDHAVVYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDF  423



>ref|XP_008437596.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 61 [Cucumis melo]
Length=605

 Score =   263 bits (672),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 158/398 (40%), Positives = 236/398 (59%), Gaps = 27/398 (7%)
 Frame = -3

Query  1140  VVLLAPFLSLTVFQSSAMNATTSHDIH----QVAHSACDHSLYRDLCVSTLVKTPDLRAK  973
             +++ A  +S  +   S + ++  H  H    Q    AC H+LY  LC+S+L+  P  ++ 
Sbjct  53    LLIAASVVSAAILVRSRIASSQPHFPHNKPSQAISRACSHTLYPSLCLSSLLSFPGAQSA  112

Query  972   SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVL  793
              + +++  ++N+T+  +  A  + S+I  +      +   A   C+EL +DA+       
Sbjct  113   DVHDLVHISLNLTLQHLTKALYSTSQIPILQISKDPLAHSAYEDCMELLNDAIDAFSL--  170

Query  792   DGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPN-SNKNVRPFIIKRVEQISRHVSNALS  616
               L ++ A  H D+ T LS A+T   TC DGF + ++  V+  +  ++  +S  +SN+L+
Sbjct  171   -SLFSTGASNH-DIMTWLSAALTYHDTCTDGFQDVTDLGVKNEVEAKLSDLSEMISNSLA  228

Query  615   MLT------------KIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGK  472
             + +            K ++  ++   SS+  EN G  +GFP+WLS +DR LL AP+    
Sbjct  229   IFSGFGGGDLPVENRKRRRLMESGTPSSWAAENGGDHEGFPEWLSGKDRRLLAAPISA--  286

Query  471   KHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYV-DVDKKKTMIM  295
                I+AD+VVAKDGSG FK++  A+ AAP SS  R +IYIKAG Y E +  V +KKT +M
Sbjct  287   ---IQADIVVAKDGSGKFKTVAEAIEAAPSSSGRRIIIYIKAGKYEEEILKVGRKKTNLM  343

Query  294   FVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRAD  115
             FVGDG G T I G +++ D   TFRTAT A  G+G I + +SFEN AGP  HQAVALR  
Sbjct  344   FVGDGKGITVISGGKSVYDKVTTFRTATFAGSGTGIILRDMSFENTAGPSKHQAVALRLS  403

Query  114   SDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             +D++V Y C+ +GYQDTLYVHS RQFFRECD+YGT+DF
Sbjct  404   ADHAVVYRCNIIGYQDTLYVHSNRQFFRECDIYGTIDF  441



>ref|XP_008245555.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Prunus mume]
Length=545

 Score =   261 bits (667),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 143/395 (36%), Positives = 226/395 (57%), Gaps = 26/395 (7%)
 Frame = -3

Query  1134  LLAPFLSLTVFQSSAMNATTSHD----IHQVAHSACDHSLYRDLCVSTL---VKTPDLRA  976
              L+  + L+ F   +   T++ D    I  +    C     ++ C++ +   +KT     
Sbjct  6     FLSVLIILSAFSCFSYGVTSTKDPNPSIQSMVMQTCTEIEDQNSCLTNVQAELKTMAPDN  65

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
             ++   I++A +  T++E + A    ++   +   +   E+ A+  C EL   ++++L   
Sbjct  66    QNSASILTAAIRHTLNEARAAIQKITKFSSL--SISYREQLAIEDCKELLDFSVSELAWS  123

Query  795   LDGLE-----NSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHV  631
             L  +      ++      +L+  LS A++NQ TCL+GF  +++ +  F+   ++Q+++ +
Sbjct  124   LGEMNKIRGGDNNEHYEGNLKAWLSAALSNQDTCLEGFEGTDRRLEDFVRGSLKQVTQLI  183

Query  630   SNALSMLTKI-----KKEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKH  466
              N L++ T++     K  +D+    +    +    D  P W++  D+ LL +    G   
Sbjct  184   GNVLALYTQLHSLPFKPPRDHGTPVNKSSSS---DDHLPAWITEGDQELLRSNPQSG---  237

Query  465   DIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVG  286
              + AD +VA DGSG +++I  A++AAP+ S  R+VIY+K G Y E +D+ KKKT IMFVG
Sbjct  238   -VHADAIVAADGSGKYRTITEAVNAAPNYSSKRYVIYVKKGVYKENIDMKKKKTNIMFVG  296

Query  285   DGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDY  106
             DGIG+T + G RN   GW TFRTATVAV G GFIA+ ++F N AGPENHQ VALR DSD 
Sbjct  297   DGIGQTVVTGRRNFMQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQGVALRVDSDQ  356

Query  105   SVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             S F+ CS  GYQDTLY HS RQF+REC +YGT+DF
Sbjct  357   SAFFRCSMEGYQDTLYAHSLRQFYRECSIYGTIDF  391



>ref|XP_010088304.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
 gb|EXB33529.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
Length=553

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 168/399 (42%), Positives = 229/399 (57%), Gaps = 79/399 (20%)
 Frame = -3

Query  984  LRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADL  805
            +R  ++P  +   ++ T+ E+K ++ NC+ I R +     +++RAL  CLEL  D +A+L
Sbjct  1    MRRNTLPATL---LSHTLKEVKASSTNCTNIERNLRSSDPVQKRALDDCLELLDDTIAEL  57

Query  804  RTVLDGLEN--SPAKRHADLQTLLSTAMTNQYTCLDGFP-NSNKNVRPFIIKRVEQISRH  634
              V+  L +  S +K   DLQTLLS AMTNQYTC+DGF     K VR  I +R+  IS H
Sbjct  58   NDVVFDLSSRKSASKHFHDLQTLLSGAMTNQYTCVDGFDFAKGKYVRSNIQERLLTISNH  117

Query  633  VSNALSMLTKIKKE---KDNrfsssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHD  463
            VSN L M+ KIK E    +   SS    E   +K+GFP W+S +DR +L++ +     + 
Sbjct  118  VSNILVMVNKIKSEHKATNRPTSSEVFPEYGRVKNGFPTWVSSKDRRMLQSTV-----NA  172

Query  462  IKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVG-  286
             K D+VVAKDG+G+F +I  A++AAP++S+TRFVIYIKAG+Y E V+V +KKT +MFVG 
Sbjct  173  TKFDLVVAKDGTGNFTTIGEAVAAAPNNSETRFVIYIKAGAYLENVEVVRKKTNLMFVGD  232

Query  285  --------------DG--------IGKTRIKGNRNMKDG-------------WPTFRTA-  214
                          DG        +G+++ + N + +DG             W       
Sbjct  233  GIGKTVVKASRNHVDGWTTFRSATVGESQYERNGDREDGVRSAHRLPVSKLEWEVMSPLE  292

Query  213  ----------------------------TVAVGGSGFIAKGISFENYAGPENHQAVALRA  118
                                        T+AV G+GFIAKGI+FEN AGP  HQAVALR+
Sbjct  293  LLSAQAPCKSVVIEEIRKMGSLAMYIFLTLAVVGNGFIAKGITFENSAGPSKHQAVALRS  352

Query  117  DSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             SD S FY CSF+GYQDTLY HS RQF+RECDVYGT+DF
Sbjct  353  GSDLSTFYKCSFIGYQDTLYAHSLRQFYRECDVYGTIDF  391



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score =   262 bits (669),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 167/408 (41%), Positives = 234/408 (57%), Gaps = 34/408 (8%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDI------HQVAHSACDHSLYRDLCVSTLVK  994
             I LV  +LL   +   V    + N  +  D       H +  S+C  +LY DLC STL  
Sbjct  30    IALVAAILLVGAVIGIVTGVKSQNKNSGEDSEASAASHAILKSSCSSTLYPDLCFSTLA-  88

Query  993   TPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSD  820
              P    K  S  ++I  ++N+T + +        ++ +    L   E+ ALH CLE   +
Sbjct  89    APGAAKKVSSQKDVIELSLNITTTAVGHNFFAVKKLLKSRKKLTKREKVALHDCLENIDE  148

Query  819   ALADLRTVLDGL-----ENSPAKRHAD-LQTLLSTAMTNQYTCLDGFP--NSNKNVRPFI  664
              L +L   +  L     +N P  ++AD L+TL+S+A+TNQ TCLDGF   +++K VR  +
Sbjct  149   TLDELHAAVADLHEYPNKNKPLTQYADDLKTLISSAITNQETCLDGFSHDDADKKVRKVL  208

Query  663   IKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRE-NRGLKD------GFPKWLSRRDR  505
              K    + +  SNAL+M   I+   DN  +++ +   NR LK+      G+P+WLS  DR
Sbjct  209   EKGQVHVEQLCSNALAM---IRNMTDNDIANASKMNVNRKLKEEVVEEKGWPEWLSVADR  265

Query  504   ALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYV  325
              LL++         +  ++VVA DGSG++K+++ A++AAP+ S TR+VI IKAG Y E V
Sbjct  266   RLLQSST-------VTPNVVVAADGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGVYRENV  318

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPE  145
             DV KKKT IMF+GDG   T I  +RN+ DG  TF +ATVA  G  F+A+ I+F+N AGP 
Sbjct  319   DVPKKKTNIMFLGDGRTSTIITASRNVVDGSTTFNSATVAAVGEKFLARDITFQNTAGPS  378

Query  144   NHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              HQAVALR  SD S FY    + YQD+LYVHS RQFF  C V GTVDF
Sbjct  379   KHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDF  426



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 216/373 (58%), Gaps = 29/373 (8%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAK--SIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +  S+C  +LY +LC S +       AK     ++I A +N T++ ++        I 
Sbjct  55    HPIVKSSCSATLYPELCFSAVSSREGEEAKITKPKDVIEAVLNFTITTVQHNYFTLQHII  114

Query  888   RVVPDLGTMERRALHVCLELFSDALADL-RTVLD----GLENSPAKRHADLQTLLSTAMT  724
             +    L   E+ ALH CLE+  D L +L ++ LD     L  S +++  DL TLLS AMT
Sbjct  115   KTRLGLSPREKAALHDCLEMVDDTLDELHKSALDLQDYSLNKSISQQADDLITLLSAAMT  174

Query  723   NQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENR  550
             NQ TC+DGF +  ++K +R  ++    Q  R  SN L+M   IK   D   +++     R
Sbjct  175   NQETCIDGFSHDGADKKIRKGLMDGQMQAFRLCSNVLAM---IKNLTDTDMAAAASAAGR  231

Query  549   GLKDG----------FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAA  400
              L++           +P+WLS  DR LL+A         + AD+ VA DGSG++K++  A
Sbjct  232   QLREEEEEATATAIEWPEWLSAGDRRLLQAST-------VTADVTVAADGSGNYKTVGEA  284

Query  399   LSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFR  220
             +++AP+ S  R++I IKAG Y E V+V KKKT IMFVGDG   T I  +RN+ DG  TF 
Sbjct  285   VASAPERSSKRYIIRIKAGVYKENVEVPKKKTNIMFVGDGRTNTIITASRNVVDGSTTFH  344

Query  219   TATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQ  40
             +ATVAV G GF+A+ I+F+N AGP  HQAVALR  SD S FY C  + YQDTLYVHS RQ
Sbjct  345   SATVAVVGDGFLARDITFQNTAGPSKHQAVALRVGSDLSAFYRCDVLAYQDTLYVHSLRQ  404

Query  39    FFRECDVYGTVDF  1
             FF  C V GTVDF
Sbjct  405   FFVGCLVAGTVDF  417



>ref|XP_010537086.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Tarenaya hassleriana]
Length=586

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 207/366 (57%), Gaps = 30/366 (8%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  880
             Q     C  +LY  LCVS+L+  P   A    E++  +VN+T+     A  + S I  V 
Sbjct  75    QAISRVCGKTLYPSLCVSSLLDFPGSLAAGEDELVHISVNMTLQRFSKALYDSSAISSV-  133

Query  879   PDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDG  700
               +    R A   CLEL  D++ DL   L G        H+D+ T LS+AMTN  TC +G
Sbjct  134   -QMPPRVRSAYDACLELLDDSVDDLSRALSG-----GGSHSDVLTWLSSAMTNHDTCTEG  187

Query  699   FPNS-----NKNVRPFIIKRVEQISRHVSNALSM-------LTKIKKEKDNrfsssfrRE  556
             F  +     +  V+  +   V+ +S  VSN L++       L+ +  E   R       E
Sbjct  188   FDENEGFSDSGGVKGRVGGAVKDLSELVSNCLAIFSGKVGDLSAVPVENRRRRLLETEEE  247

Query  555   NRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSS  376
                     P WL +RDR LL  P  K     I+AD+VV+KDG+G  K+I  A+  AP+ S
Sbjct  248   LE-----LPIWLGKRDRELLSIPAAK-----IQADIVVSKDGTGTCKTIAEAIKKAPEHS  297

Query  375   DTRFVIYIKAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVG  199
               R VIY+KAG Y E  + V +KKT +MF+GDG GKT I G +++ D   TF TA+ A  
Sbjct  298   SRRIVIYVKAGRYEEENLKVGRKKTNVMFIGDGKGKTVITGGKSISDDLTTFHTASFAAT  357

Query  198   GSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDV  19
             G+GFIA+ ++FENYAGP  HQAVALR  +D++V Y CS +GYQD LY+HS RQFFRECD+
Sbjct  358   GAGFIARDMTFENYAGPGKHQAVALRVGADHAVVYRCSVIGYQDALYIHSNRQFFRECDI  417

Query  18    YGTVDF  1
             YGTVDF
Sbjct  418   YGTVDF  423



>emb|CDY22044.1| BnaA09g00730D [Brassica napus]
Length=405

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 190/298 (64%), Gaps = 24/298 (8%)
 Frame = -3

Query  867  TMERRALHVCLELFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNS  688
            T+  R+   CL L  D + DL T +  L+ S    H D+  LLS AMTNQ TCL+GF  S
Sbjct  29   TVHSRSTQHCLGLLDDTIFDLETAISKLQTSSLGAH-DVNMLLSDAMTNQDTCLEGFKTS  87

Query  687  N---KN------VRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG  535
                KN      +   +   + +IS ++SN+L ML KI   + +  +     E       
Sbjct  88   GIHEKNSDNTYKLTDSLKDSILKISSNLSNSLGMLQKIPGHELSPEAYEVDVE-------  140

Query  534  FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIY  355
            FP W+   D+  L AP+ K      K +++VA+DG+G+F +IN A+SAAP SS TRF+IY
Sbjct  141  FPSWVLENDKRRLHAPVEK-----TKFNLMVAQDGTGNFTTINDAVSAAPTSSVTRFMIY  195

Query  354  IKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKG  175
            IK G Y+E V++ K KT+IMFVGDGIG+T IK NR  K    TF+TATV V G GFIAK 
Sbjct  196  IKRGVYFENVEIPKNKTIIMFVGDGIGRTVIKANRR-KGNLGTFQTATVGVKGEGFIAKD  254

Query  174  ISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
            ISF N+AGP + QAVALR+ SD+S FY CSF GYQDTLYV+S +QF+RECD+YGTVDF
Sbjct  255  ISFVNFAGP-SPQAVALRSGSDHSAFYRCSFEGYQDTLYVYSGKQFYRECDIYGTVDF  311



>ref|XP_009763675.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Nicotiana sylvestris]
Length=602

 Score =   261 bits (667),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/390 (39%), Positives = 222/390 (57%), Gaps = 26/390 (7%)
 Frame = -3

Query  1113  LTVFQSSAMNATTSHDIHQVAHS-ACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNV  937
             +TV   +    T  H    VA S  C  + +  LC+S+L + P   + S  +++  +VN+
Sbjct  57    VTVRNKTGPAPTLLHSKPTVAMSRTCSRTRFTTLCLSSLHEFPGALSASDDDLVHISVNL  116

Query  936   TVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAK-RH  760
             T+     A    S I  +  D  T  R A   CLEL  +++  L   L  + +   K  +
Sbjct  117   TLQRFGKALYMASDISNLYMD--TRIRSAYEDCLELLEESIDLLARSLTSVSHGAGKSNN  174

Query  759   ADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNr  580
              D+ T LS A+TNQ TC +GF + N NV+  + +++  +S  VSN L++   +  + D  
Sbjct  175   HDVLTWLSAALTNQDTCTEGFADVNGNVKDQMTEKLRNLSELVSNCLAIFAAMNGDDDFS  234

Query  579   fsssfrRENR--GLKDG--------------FPKWLSRRDRALLEAPMGKGKKHDIKADM  448
                   R  R  G  D               FPKWL+R++R LL+ P+       I+AD+
Sbjct  235   GVPIQNRRRRLMGSTDDAGTVVSAKDEDFAPFPKWLNRKERMLLDTPVSA-----IQADI  289

Query  447   VVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYE-YVDVDKKKTMIMFVGDGIGK  271
             +V+KDG+G FK+I  A+   P  S+ R +IY+KAG Y E  + + +KKT +MF+GDG GK
Sbjct  290   IVSKDGNGTFKTIADAIKKVPQYSNRRIIIYVKAGRYEEDNLKIGRKKTNVMFIGDGKGK  349

Query  270   TRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYD  91
             T I G +++     TF TA+ A  G+GFI + I+FENYAGP  HQAVALR  +D++V Y 
Sbjct  350   TVITGGKSVSQNLTTFHTASFAATGAGFIVRDITFENYAGPSKHQAVALRIGADHAVVYR  409

Query  90    CSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             C+ +GYQDTLYVHS+RQF+RECD+YGTVDF
Sbjct  410   CNIIGYQDTLYVHSQRQFYRECDIYGTVDF  439



>ref|XP_011023723.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Populus euphratica]
Length=541

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/358 (39%), Positives = 205/358 (57%), Gaps = 21/358 (6%)
 Frame = -3

Query  1044  ACDHSLYRDLCVSTLVKTPDLRAKSIP---EIISATVNVTVSEIKTAAANCSRIRRVVPD  874
             AC H      C+S      +L+    P    II A +  T+ E + A    ++   +   
Sbjct  41    ACSHVENLSSCLSNF--QAELQKSGPPTAQSIIHAALRATLDEARRAIDTITKFNSL--S  96

Query  873   LGTMERRALHVCLELF-------SDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQY  715
             +   E+ A+  C EL        + +L ++  +  G++N       +L+  LS A++N  
Sbjct  97    ISYREQVAIEDCKELLDFSVSELAWSLMEMNKIRAGMKN--VHYEGNLKAWLSAALSNPD  154

Query  714   TCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDG  535
             TCL+GF  +++++  FI   ++Q+++ + N L + T++         +      +   D 
Sbjct  155   TCLEGFEGTDRHLENFISGSIKQVTQLIDNVLGLYTQLHILPFKPTRNDNATTTKSSSDK  214

Query  534   FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIY  355
             FP+W++  D+ LLE     G    +  D +VA DGSG +++I  A++ AP  S  R++IY
Sbjct  215   FPEWMTEGDQELLE-----GSSLGMHVDAIVALDGSGHYRTITEAINEAPSYSTRRYIIY  269

Query  354   IKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKG  175
             +K G Y E VD+ +KK+ IM VGDGIGKT + GNRN   GW TFRTATVAV G GFIA+ 
Sbjct  270   VKKGVYRENVDMKRKKSYIMLVGDGIGKTVVTGNRNFMQGWTTFRTATVAVSGKGFIARD  329

Query  174   ISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ++F N AGP NHQAVALR DSD S FY CS  GYQDTLY HS RQF+REC+++GT+D+
Sbjct  330   MTFSNTAGPLNHQAVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECEIHGTIDY  387



>emb|CDY60700.1| BnaA01g37100D [Brassica napus]
Length=556

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 155/364 (43%), Positives = 217/364 (60%), Gaps = 36/364 (10%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             H V  SAC  +LY +LC+S +  +  ++  S  ++I A++N+T + ++       ++ + 
Sbjct  58    HAVLRSACSSTLYPELCISAVATSGGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKN  117

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLSTAMTNQ  718
             +  L   E+ ALH CLE   + L +L   L+ L+  P K+    HA DL+TL+S+A+TNQ
Sbjct  118   MKGLTPREKTALHDCLETIDETLDELHETLEDLQMYPNKKTLREHAGDLKTLISSAITNQ  177

Query  717   YTCLDGFP--NSNKNVRPFIIKRVEQISRHV-SNALSMLTKIK-KEKDNrfsssfrRENR  550
              TCLDGF   +++K VR F++K      +H+ SNAL+M+  +   +  N    +    N 
Sbjct  178   ETCLDGFSHDDADKKVRKFLLK-----GQHMCSNALAMIKNMTDTDIANFELKAKLSSNN  232

Query  549   GL-KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSD  373
              L   G+P WLS  DR LL+                      G FK+I AA++AAPD+S 
Sbjct  233   QLDAKGWPTWLSAGDRRLLQG---------------------GKFKTIAAAVAAAPDNSK  271

Query  372   TRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGS  193
              R+VI+IKAG Y E V+V KKK  IMF+GDG  +T I GNRN+ DG  TF +ATVA  G 
Sbjct  272   RRYVIHIKAGVYRENVEVSKKKKNIMFMGDGRTRTIITGNRNVVDGSTTFHSATVAAVGE  331

Query  192   GFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYG  13
              F+A+ I+F+N AGP  HQAVALR  SD+S FY C  + YQDTLYVHS RQFF +C + G
Sbjct  332   RFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAG  391

Query  12    TVDF  1
             TVDF
Sbjct  392   TVDF  395



>ref|XP_007031047.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY11549.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=536

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/398 (38%), Positives = 233/398 (59%), Gaps = 35/398 (9%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLT-VFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTL-VKTPDLR  979
              L+ +++L  F ++  V  S+  N TT   I Q      +H    DLC+S +  +   L 
Sbjct  6     FLLILLMLPSFEAIPDVTPSTKQNLTTQPLIIQACTDVDNH----DLCLSNIQAELQSLG  61

Query  978   AKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELF-------SD  820
              ++   ++ A +  +++E + A    ++   +   +   E+ A+  C EL        + 
Sbjct  62    PQTPSSVLHAALRASLNEARQAIETMTKFTGL--SVSYREQIAIEDCKELLDFSVSELAW  119

Query  819   ALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQIS  640
             +LA+++ + DG  N  A+   +L+  LS A++NQ TCL+GF  ++ ++  FI   ++Q++
Sbjct  120   SLAEMKKIRDGDRN--AEYEGNLKAWLSAALSNQDTCLEGFEGTDHHLESFIRGSLKQVT  177

Query  639   RHVSNALSMLTKIK----KEKDNrfsssfrRENRGLKDGFPKWLSRRDRALLEA-PMGKG  475
             + + N L+M T++     +   N  S++   E       FP+W++  D+ LL   P G  
Sbjct  178   QLIGNVLAMYTQLHSLPFRPPRNSTSTNTSSE-------FPEWITDGDQELLRTNPSG--  228

Query  474   KKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIM  295
                 +  D VV+ D +G +++I  A++AAP  S+ R++IY+K G Y E +D+ KKKT IM
Sbjct  229   ----MHVDAVVSLDRNGHYRTITDAINAAPSYSNRRYIIYVKKGVYKENIDMKKKKTNIM  284

Query  294   FVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRAD  115
              VGDGIG+T + GNRN   GW TFRTATVAV G GFIA+ ++F N A P+NHQAVALR D
Sbjct  285   LVGDGIGQTVVTGNRNFMQGWTTFRTATVAVSGKGFIARDMTFRNTAEPQNHQAVALRVD  344

Query  114   SDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             SD S FY CS  G+QDTLY+HS RQF+REC +YGT+DF
Sbjct  345   SDQSAFYRCSMEGHQDTLYIHSLRQFYRECHIYGTIDF  382



>ref|XP_002278061.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Vitis vinifera]
Length=597

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 144/368 (39%), Positives = 214/368 (58%), Gaps = 22/368 (6%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVV  880
             Q     C  + +  LCV +L+  P        +++  ++N+T+     A    S I  + 
Sbjct  74    QAISHTCSRTRFPTLCVDSLLDFPGSLTAGERDLVHISMNMTLQRFGKALYVSSEIANLQ  133

Query  879   PDLGTMERRALHVCLELFSDALADLR----TVLDGLENSPAKRHADLQTLLSTAMTNQYT  712
              D  T  R A   CLEL  +++  L     +V  G +        D+ T LS AMTNQ T
Sbjct  134   MD--TRVRAAYEDCLELLEESVEQLSRSLTSVAGGGDGQAVGSTQDVLTWLSAAMTNQDT  191

Query  711   CLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKD--  538
             C +GF + +  V+  +++++  +S  VSN L++      + D        R  R ++D  
Sbjct  192   CTEGFDDVSGFVKDQMVEKLRDLSDLVSNCLAIFAASGGDNDFAGVPIQNRRRRLMQDSD  251

Query  537   --------GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPD  382
                     GFPKWL+RR+R+LL+ P+       I+AD++V++DG+G +K+I  A+  AP+
Sbjct  252   ISANQDSTGFPKWLTRRERSLLQMPVPA-----IQADIIVSQDGNGTYKTITEAIKKAPE  306

Query  381   SSDTRFVIYIKAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVA  205
              S  R +IY+KAG Y E  + V +KKT +MF+GDG GKT I G +++ +   TF TA+ A
Sbjct  307   YSSRRTIIYVKAGRYEENNLKVGRKKTNLMFIGDGKGKTIITGGKSVFNNLTTFHTASFA  366

Query  204   VGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFREC  25
               G+GFIA+ ++FEN+AGP  HQAVALR  +D+ V Y C+ +GYQDTLYVHS+RQFFREC
Sbjct  367   ATGAGFIARDMTFENWAGPGKHQAVALRVGADHGVVYRCNIIGYQDTLYVHSQRQFFREC  426

Query  24    DVYGTVDF  1
             D+YGTVDF
Sbjct  427   DIYGTVDF  434



>ref|XP_010043041.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Eucalyptus grandis]
Length=535

 Score =   259 bits (661),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 145/365 (40%), Positives = 215/365 (59%), Gaps = 23/365 (6%)
 Frame = -3

Query  1068  DIHQVAHSACDHSLYRDLCV-STLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRI  892
             DI  +    C+H   +  C+ +   +  +    +   ++SA +  T++E + A  + SR 
Sbjct  31    DIQSLLPQVCNHIEDQSSCLLNVQAELNNAGPANSNSVLSAALQATLNEARAAVESISRF  90

Query  891   RRVVPDLGTMERRALHVCLELF-------SDALADLRTVLDGLENSPAKRHADLQTLLST  733
               +   +   E+ A+  C EL        + ++ +++ +  G +NS      +L+  LS 
Sbjct  91    TAL--SVSYREQVAIEDCKELLDYSISEIAWSMGEMKRIQAGSKNS--HYGGNLKAWLSA  146

Query  732   AMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrREN  553
             A++NQ TCL+GF  ++  +  F+   ++Q+++ + N L+M  ++       F       +
Sbjct  147   ALSNQDTCLEGFEGTDGRLENFVRGSLKQVTQLIGNVLTMYCQLHSLP---FPPPRTNSS  203

Query  552   RGLKDGFPKWLSRRDRALLEA-PMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSS  376
              G  + FP W++  D+ LL+A P+G      +  D VVA DGSG +++I+ A+  AP  S
Sbjct  204   HGASE-FPAWMTEGDQELLKASPVG------MHVDAVVASDGSGRYRTISEAVIDAPSYS  256

Query  375   DTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGG  196
             + R+VIYIK G Y E +D+ +KKT IMFVGDGIG T I GNR+   GW TFRTATVAV G
Sbjct  257   NRRYVIYIKKGVYSENIDLKRKKTNIMFVGDGIGATIITGNRHFMQGWTTFRTATVAVSG  316

Query  195   SGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVY  16
              GFIA+ ++F N AGP NHQAVALR DSD S FY CS  GYQDTLY HS RQF+RECDV+
Sbjct  317   KGFIARDMTFRNTAGPRNHQAVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECDVH  376

Query  15    GTVDF  1
             GT+DF
Sbjct  377   GTIDF  381



>gb|EYU19641.1| hypothetical protein MIMGU_mgv1a003247mg [Erythranthe guttata]
Length=597

 Score =   260 bits (665),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 148/361 (41%), Positives = 218/361 (60%), Gaps = 22/361 (6%)
 Frame = -3

Query  1044  ACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGT  865
             AC  + Y  LCV++L+  P   A S  +++  +VN+T+ +I  A +  + I  +  D+  
Sbjct  82    ACSRTRYPTLCVNSLLDFPGALAASDKDLVHISVNMTLQKIGRALSFAAEINNL--DMDP  139

Query  864   MERRALHVCLELFSDAL----ADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGF  697
               R A   CLEL   ++      L +V  G E  PA    D+ T LS A+TNQ TC +GF
Sbjct  140   HVRSAYDDCLELLDHSVDQFSRSLTSVAPGGE--PAGSTQDVITWLSAALTNQDTCTEGF  197

Query  696   PNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKD--------NrfsssfrRENRGLK  541
                N +V+  +  R++ +S  VSN+L++        D        NR   +     R  +
Sbjct  198   DELNGDVKNQMSHRLKDLSELVSNSLAIYAAADGGGDDFSNIPIQNRRLLTSSSRRREHE  257

Query  540   DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
               FP +LS+R+R LL+ P+       I AD++V+KDG+G +K+I  A+  AP+ S+ RF+
Sbjct  258   HQFPMFLSKRERRLLDMPVTA-----INADIIVSKDGNGTYKTIAEAIKKAPEHSNRRFI  312

Query  360   IYIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFI  184
             IY++AG Y E  + V +KKT IMF+GDG GKT I G ++++D   TF TA+ A  G+GFI
Sbjct  313   IYVRAGRYEENKLKVGRKKTNIMFIGDGKGKTVISGGKSVQDKLTTFHTASFAATGAGFI  372

Query  183   AKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVD  4
             A+ I+FEN+AG   HQAVALR  +D++V Y C+ +GYQDTLY HS+RQF+R+CD+YGTVD
Sbjct  373   ARDITFENWAGASKHQAVALRVGADHAVVYRCNIIGYQDTLYTHSQRQFYRDCDIYGTVD  432

Query  3     F  1
             F
Sbjct  433   F  433



>ref|XP_006401715.1| hypothetical protein EUTSA_v10013056mg [Eutrema salsugineum]
 gb|ESQ43168.1| hypothetical protein EUTSA_v10013056mg [Eutrema salsugineum]
Length=589

 Score =   260 bits (664),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 156/396 (39%), Positives = 213/396 (54%), Gaps = 22/396 (6%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRA  976
             +++V VV    F  +    S       +    +     C  + Y +LC+ TL+  P    
Sbjct  42    LLIVAVVCFGIFAGIRAGGSDKHEPKLTRKPTREISRTCSKAQYPNLCIDTLLDFPGSLT  101

Query  975   KSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTV  796
                 E+I  + N T+     A  + S I      +    R A   CLEL  D++  L   
Sbjct  102   ADEQELIHISFNATLQSFSKALYSSSTISYT--HMPPRVRSAYDSCLELLDDSVDALSRA  159

Query  795   LDGLENSPAKRHADLQTLLSTAMTNQYTCLDGFPN----SNKNVRPFIIKRVEQISRHVS  628
             L  + +S  +  +D+ T LS+AMTN  TC DGF          V+  II  V+ +S  VS
Sbjct  160   LSSVSSSNDESRSDVMTWLSSAMTNHDTCTDGFEEIEDGGGGGVKDQIIGAVKDLSEMVS  219

Query  627   NALSMLTKIKKEKDNrfsssfrRENRGL------KDGFPKWLSRRDRALLEAPMGKGKKH  466
             N L++ +   K+     +      NR L       + FP WL RRDR LL  P       
Sbjct  220   NCLAIFSGNVKD----LTGVPVVNNRRLLGEKETTEEFPIWLKRRDRELLGTPATA----  271

Query  465   DIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEY-VDVDKKKTMIMFV  289
              I+AD+ V+KDG+G FK+I  A+  AP+ S  RFVIY+K+G Y E  + V +KKT +MF+
Sbjct  272   -IQADITVSKDGTGTFKTIAEAIKKAPEHSSRRFVIYVKSGRYEEENLKVGRKKTNLMFI  330

Query  288   GDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSD  109
             GDG GKT I G +++ D   TF TAT A  G+GFI + ++FENYAGP  HQAVALR   D
Sbjct  331   GDGKGKTVITGGKSITDDLTTFHTATFAATGAGFIVRDMTFENYAGPAKHQAVALRVGGD  390

Query  108   YSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             ++V Y C+ +GYQD LYVHS RQFFRECD+YGTVDF
Sbjct  391   HAVVYRCNIIGYQDALYVHSNRQFFRECDIYGTVDF  426



>emb|CDY52778.1| BnaCnng23230D [Brassica napus]
Length=519

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 152/350 (43%), Positives = 211/350 (60%), Gaps = 43/350 (12%)
 Frame = -3

Query  1005  TLVKTPDLRAK-SIPEIISATVNVTVSEIKTAAANCSRIRRVV-PDLGTMERRALHVCLE  832
             TL KT  L +  +  E++ AT+N T+S++  +++N S ++  +  +L   +R A   CLE
Sbjct  37    TLHKTQHLTSSGNTTELLVATLNQTISKVNFSSSNFSDLQTSLGSNLTHRDRCAFGDCLE  96

Query  831   LFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLDGF--------PNSNKNV  676
             L  D + DL   +  L+ SP      +  LLS AMTN  TCLDGF         N+N N 
Sbjct  97    LLDDTVLDLTAAISELQ-SPYPVLNSVSMLLSAAMTNTRTCLDGFASSDDDEDENTNGNS  155

Query  675   RPFII-----KRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRR  511
             + + +     + +  ISRHV  +L+ML  I  + +N               GFP W+   
Sbjct  156   KTYGVAESMRESLYNISRHVRESLAMLENIPGKLENDV-------------GFPTWV---  199

Query  510   DRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYE  331
             DR LL+ P       + + D+VV+++ +G+F +I  A+SAAP+ S+TRFVIYIK G Y+E
Sbjct  200   DRKLLQDPT-----DETRIDLVVSRNDTGNFTTIGEAVSAAPNLSETRFVIYIKCGVYFE  254

Query  330   YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAG  151
              +++ ++KTMIMF+GDGIG+T IK NR+  DGW  F +ATV V GSGFIAK ISF N AG
Sbjct  255   NIEIPREKTMIMFLGDGIGQTVIKANRSGADGWTAFNSATVGVRGSGFIAKDISFVNDAG  314

Query  150   PENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             P  HQAVALR+ SD S FY CSF  YQDT+Y      F+REC++YGTVDF
Sbjct  315   PTKHQAVALRSGSDLSAFYRCSFESYQDTIY------FYRECNIYGTVDF  358



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 219/369 (59%), Gaps = 28/369 (8%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPDL--RAKSIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +  S+C  +LY DLC S +   P       +  +II  ++N+T + ++    N   I 
Sbjct  60    HAILKSSCRSTLYPDLCYSAIATVPGAMDNLSTQKDIIEMSLNITTTAVE---HNYFTIE  116

Query  888   RVV--PDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR-----HAD-LQTLLST  733
             +++   +L   E+ ALH CLE+  + L +L    D L++ P+ +     HAD L+ L+S 
Sbjct  117   KIIGSKNLTKREKTALHDCLEMVDETLDELHKTADDLKDYPSSKKSIFQHADDLKILVSA  176

Query  732   AMTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrR  559
             AMTNQ +C+DGF   N++K+VR  ++   E + R  SNAL+M   IK   D   +    +
Sbjct  177   AMTNQESCIDGFSHDNADKDVRKKLLAGQEHVYRMCSNALAM---IKNMTDTDMAQEQYK  233

Query  558   ENRGLKDG---FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAA  388
               R +++    FP WLS  DR LL+A M       +  D+ VA DGSG + +++ A++AA
Sbjct  234   AKRRVEESSEEFPAWLSWGDRKLLQASM-------LVPDVTVAADGSGHYTTVSEAVAAA  286

Query  387   PDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATV  208
             P+ S  R++I IKAG Y E V+V KKKT IM VGDG   T I G R++ DG  TFR+A+V
Sbjct  287   PEKSHKRYIIRIKAGVYRENVNVPKKKTNIMMVGDGRINTIITGRRSVVDGSTTFRSASV  346

Query  207   AVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRE  28
             A  G GF+A+ I+F+N AGP   QAVALR  SD S FY C+ + YQDTLYVHS RQF+ +
Sbjct  347   AAVGEGFLARDITFQNTAGPSKDQAVALRVGSDKSAFYRCNIIAYQDTLYVHSLRQFYVD  406

Query  27    CDVYGTVDF  1
               + GTVDF
Sbjct  407   SLIVGTVDF  415



>ref|XP_002317777.2| hypothetical protein POPTR_0012s02170g [Populus trichocarpa]
 gb|EEE95997.2| hypothetical protein POPTR_0012s02170g [Populus trichocarpa]
Length=602

 Score =   260 bits (665),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 147/371 (40%), Positives = 217/371 (58%), Gaps = 16/371 (4%)
 Frame = -3

Query  1086  NATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAA  907
             N+ T     Q    AC  + +  LCVS+L+  P     S  +++  + N+T+  +  A  
Sbjct  76    NSLTHRKPTQAISKACSKTRFPALCVSSLLDFPGSMTASESDLVHISFNMTLLHLDKALY  135

Query  906   NCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHA--DLQTLLST  733
               S I  V  ++ T ER A   CLEL  D++  L   L  +  S     +  D+ T LS 
Sbjct  136   LSSGISYV--NMETHERSAFDDCLELLEDSIDALTRSLSTVSPSSGGGGSPEDVVTWLSA  193

Query  732   AMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEK------DNrfss  571
             A+TNQ TC +GF   N  V+  + ++++ ++  VSN L++ +             N+   
Sbjct  194   ALTNQDTCSEGFEGVNGTVKDQMTEKLKDLTELVSNCLAIFSATNGGDFSGVPIQNKRRL  253

Query  570   sfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSA  391
                  +   +D FP WL RR+R LL  P+       I+AD++V+ DGSG FK+I+ A+  
Sbjct  254   MTEDGDISEEDNFPSWLGRRERRLLGLPVSA-----IQADIIVSGDGSGTFKTISEAIKK  308

Query  390   APDSSDTRFVIYIKAGSYYE-YVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTA  214
             AP+ S+ R +IY++AG Y E  + V +KK  +MF+GDG+GKT I G+R++ +   TF TA
Sbjct  309   APEHSNRRTIIYVRAGRYVEDNLKVGRKKWNLMFIGDGMGKTIITGSRSVFNHITTFHTA  368

Query  213   TVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFF  34
             + A  G+GFIA+ ++FEN+AGP  HQAVALR  +D++V Y CS +GYQDTLYVHS RQF+
Sbjct  369   SFAATGAGFIARDMTFENWAGPAKHQAVALRVGADHAVVYRCSIIGYQDTLYVHSNRQFY  428

Query  33    RECDVYGTVDF  1
             RECD+YGTVDF
Sbjct  429   RECDIYGTVDF  439



>emb|CDX75765.1| BnaC03g38480D [Brassica napus]
Length=479

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 217/376 (58%), Gaps = 34/376 (9%)
 Frame = -3

Query  1047  SACDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLG  868
             SAC  + Y +LC+STL  +  ++  S  ++I A++N+T + ++       ++ +    L 
Sbjct  52    SACSSTRYPELCISTLATSGGVKLTSQKDVIEASLNLTTTAVEHNYFTVKKLIKKRKGLT  111

Query  867   TMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HA-DLQTLLSTAMTNQYTCLD  703
               E+ ALH CLE   + L +L   ++ L+  P K+    HA DL+TL+S+A+TNQ TCLD
Sbjct  112   PREKTALHDCLETIDETLDELHEAVEDLQLYPNKKSLREHAGDLKTLISSAITNQETCLD  171

Query  702   GFPN--SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKE--KDNrfsssfrRENRGLKD-  538
             GF +  ++K +R  ++K    +    SNAL+M+  +      +    +     NR LK+ 
Sbjct  172   GFSHDRADKKIRKALLKGQMHVEYMCSNALAMIKNMTDTDIANFELKAKLTSNNRKLKEE  231

Query  537   -----------------GFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSI  409
                              G+P WLS  DR LL+          ++AD  VA DGSG F ++
Sbjct  232   ETTVAVDIAGTRELDAEGWPTWLSAGDRGLLQGST-------VEADATVAADGSGTFTTV  284

Query  408   NAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWP  229
              AA+ AAP++S+ R+VI+IKAG Y E V+V KKK  IMF+GDG   T I  +RN+ DG  
Sbjct  285   AAAVVAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTTTIITASRNVVDGST  344

Query  228   TFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHS  49
             TF +ATVA     F+A+ I+F+N AGP  HQAVALR  SD+S FY C  + YQDTLYVHS
Sbjct  345   TFHSATVAAVDERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHS  404

Query  48    RRQFFRECDVYGTVDF  1
              RQFF  C + GTVDF
Sbjct  405   NRQFFVNCLIAGTVDF  420



>gb|KHN10485.1| Putative pectinesterase/pectinesterase inhibitor 12 [Glycine 
soja]
Length=542

 Score =   258 bits (660),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 223/372 (60%), Gaps = 19/372 (5%)
 Frame = -3

Query  1098  SSAMNATTSHDIHQVAHSACDHSLYRDLCVSTL-VKTPDLRAKSIPEIISATVNVTVSEI  922
             +S+  +TT H       S C  + Y ++C ++L +      + +I   +  ++ V +SE 
Sbjct  24    NSSNASTTIHTNLSSIKSFCTTTAYPEVCFNSLKLSISINISPNIINYLRQSLQVAISET  83

Query  921   KTAAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHADLQTL  742
              T  +N         ++   +R ++  C EL    LA L+  L G+ +S +K   D ++ 
Sbjct  84    -TKLSNLFHNVGHSKNIIEKQRGSVQDCRELHQSTLASLKRSLSGIRSSNSKNIVDARSY  142

Query  741   LSTAMTNQYTCLDGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKI-----KKEKDNrf  577
             LS A+TN+ TCL+G  +++  ++P ++K V    +HVSN+LSML K      K +K+N  
Sbjct  143   LSAALTNKNTCLEGLDSASGTMKPSLVKSVINTYKHVSNSLSMLPKPEMGTPKVKKNN--  200

Query  576   sssfrRENRGLKDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAAL  397
                    N+ LK+  PKW+S  D+ L +     G+ +D    +VVA DG+G+F +I  A+
Sbjct  201   -------NQPLKNA-PKWVSSSDQRLFQD--SDGEDYDPNEMLVVAADGTGNFSTITEAI  250

Query  396   SAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRT  217
             + AP++S  R VIY+K G Y E V++   KT IM +GDG   T I GNR++ DGW TFR+
Sbjct  251   NFAPNNSMDRIVIYVKEGIYEENVEIPSYKTNIMMLGDGSDVTFITGNRSVGDGWTTFRS  310

Query  216   ATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQF  37
             AT+AV G GF+A+ I+ EN AGPE HQAVALR ++D + FY C+  GYQDTLYVHS RQF
Sbjct  311   ATLAVSGDGFLARDIAIENSAGPEKHQAVALRVNADLAAFYRCAIYGYQDTLYVHSFRQF  370

Query  36    FRECDVYGTVDF  1
             +RECD+YGT+D+
Sbjct  371   YRECDIYGTIDY  382



>ref|XP_002875955.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52214.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=598

 Score =   259 bits (663),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 150/362 (41%), Positives = 216/362 (60%), Gaps = 20/362 (6%)
 Frame = -3

Query  1059  QVAHSACDHSLYRDLCVSTLVKTP-DLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRV  883
             Q    AC  + + +LCV +L+  P  L A S  ++I  TVN+T+     A  + + +  V
Sbjct  85    QAISKACGLTRFPELCVDSLMDFPGSLAASSSKDLIHVTVNMTLHHFSRALYSSASLSFV  144

Query  882   VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKRHADLQTLLSTAMTNQYTCLD  703
               D+    R A   C+EL  D++  L   L  + +S AK   D+ T LS A+TN  TC +
Sbjct  145   --DMPPRARSAYDSCVELLDDSVDALSRALSSVVSSSAKPQ-DVTTWLSAALTNHDTCTE  201

Query  702   GFPN-SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGL------  544
             GF    +  V+  +   ++ +S  VSN L++ +      D    +    +NR L      
Sbjct  202   GFDGVDDGGVKDHMTAAIKNLSELVSNCLAIFSA---SHDGDDFAGVPIQNRRLLGVEER  258

Query  543   KDGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRF  364
             +D FP+W+  R+R +LE P+ +     I+AD++V+KDG+G  K+I+ A+  AP +S  R 
Sbjct  259   EDKFPRWMRPREREILEMPVSQ-----IQADIIVSKDGNGTCKTISEAIKKAPQNSTRRI  313

Query  363   VIYIKAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGF  187
             +IY+KAG Y E  + V +KK  +MFVGDG GKT I G R++ D   TF TA+ A  G+GF
Sbjct  314   IIYVKAGRYEENNLKVGRKKINLMFVGDGKGKTVISGGRSIFDNITTFHTASFAATGAGF  373

Query  186   IAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTV  7
             IA+ I+FEN+AGP  HQAVALR  +D++V Y C+ +GYQDTLYVHS RQFFRECD+YGTV
Sbjct  374   IARDITFENWAGPAKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTV  433

Query  6     DF  1
             DF
Sbjct  434   DF  435



>ref|XP_010685210.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=592

 Score =   259 bits (663),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 156/399 (39%), Positives = 217/399 (54%), Gaps = 48/399 (12%)
 Frame = -3

Query  1086  NATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPDLRAKSIP---EIISATVNVTVSEIKT  916
             N   SH+ H +  ++C ++ Y DLC S +   P      I    ++I+A++N+T   ++ 
Sbjct  44    NPKLSHETHTILKASCSNTKYPDLCYSAIASAPSSTTTKISTQKDVIAASLNLTTLAVEH  103

Query  915   AAANCSRIRRVVPDLGTMERRALHVCLELFSDALADLRTVLDGL----------------  784
                   ++     +L   ER ALH CLE   + L +LR  L  L                
Sbjct  104   NFFTVEKLIETRKNLTVRERNALHDCLESIDETLDELRRTLQDLLSYTHTNNNNNNNNNN  163

Query  783   -ENSPAKRHAD-LQTLLSTAMTNQYTCLDGFPN--SNKNVRPFIIKRVEQISRHVSNALS  616
                   K +AD ++TL+S AMT+Q TCLDGF +  ++++VR  +      +    SNAL+
Sbjct  164   KRGKSLKDYADDMKTLVSAAMTDQETCLDGFSHNRADRHVRETLQSGQVHVEHMCSNALA  223

Query  615   MLTKIKKEKDNrfsssfrRENRGL-------------KDGFPKWLSRRDRALL-EAPMGK  478
             M   IK   D   ++    + R L             K G+P+W+S  D+ +L E P   
Sbjct  224   M---IKNMTDIDMAAEAATKKRQLYTDDDDDGGDHFYKFGWPRWMSSGDKRMLQEGPE--  278

Query  477   GKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMI  298
                   KAD VVA DGSGDF+SI  A+ AAPD S  R+VI IKAG Y E V+V KKK  +
Sbjct  279   ------KADAVVAADGSGDFRSIAEAVKAAPDKSKKRYVIRIKAGVYQENVEVGKKKMNL  332

Query  297   MFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRA  118
             MF+G+G  KT I G +N+ DG  TF +ATVA+ G  F+A+ ++FEN AGP  HQAVALR 
Sbjct  333   MFIGEGRTKTIITGKKNVVDGSTTFDSATVAITGDNFLARDLTFENTAGPSKHQAVALRV  392

Query  117   DSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              +D + FY C  + YQDTLYVH  RQFF +C + GTVDF
Sbjct  393   GADLAAFYQCDILAYQDTLYVHKNRQFFVKCLIAGTVDF  431



>ref|XP_011092101.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Sesamum indicum]
Length=537

 Score =   258 bits (658),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 140/360 (39%), Positives = 211/360 (59%), Gaps = 24/360 (7%)
 Frame = -3

Query  1044  ACDHSLYRDLCVSTL-VKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLG  868
             ACD    +  C   L  +      +S   ++ A +  T++E  +A+   ++   +   + 
Sbjct  36    ACDRIQNQASCFLNLQFQIKSYGRRSPDSVLRAALQHTLNEASSASEALTKFTTL--SIS  93

Query  867   TMERRALHVCLELFSDALADLRTVLDGLE------NSPAKRHADLQTLLSTAMTNQYTCL  706
               E+ A+  C EL   ++++L   +D +        SP     +L+  LS A++NQ TCL
Sbjct  94    PREQMAIDDCKELLDFSVSELAWSVDEMNRIHAGLKSP-HSEGNLKAWLSAALSNQDTCL  152

Query  705   DGFPNSNKNVRPFIIKRVEQISRHVSNALSMLTKI-----KKEKDNrfsssfrRENRGLK  541
             +GF  +++ +  FI   + Q+++ + N L++ T++     +  ++N  ++    +N    
Sbjct  153   EGFEGTDRRLEHFIRGSLSQVNQLIGNVLTLYTQMHSLPFRPPRNNSTAA----DNENRN  208

Query  540   DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFV  361
              GFP+W++  D+ LL +      ++ +  D VVA DGSG ++SI  A+  AP  S+ R+V
Sbjct  209   KGFPQWMTEGDKELLVS-----SQNGMHVDAVVAVDGSGQYRSIAQAIYEAPSYSNRRYV  263

Query  360   IYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIA  181
             IY+K G Y E +D+ KKKT IM VGDGIG+T + GNRN   GW TFRTATVAV G GF+A
Sbjct  264   IYVKKGVYKENIDMKKKKTNIMLVGDGIGQTIVTGNRNFMQGWTTFRTATVAVSGKGFLA  323

Query  180   KGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             + I+F N AGPE+HQ VALR DSD S FY CS  GYQDTLY HS RQF+REC + GT+DF
Sbjct  324   RDITFRNTAGPESHQGVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECSISGTIDF  383



>ref|XP_004302271.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22-like 
[Fragaria vesca subsp. vesca]
Length=556

 Score =   258 bits (660),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 150/408 (37%), Positives = 230/408 (56%), Gaps = 35/408 (9%)
 Frame = -3

Query  1152  MLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTL------VKT  991
              L+P++L+    SL+V    A     +  I  +    C     +  C++ +      +  
Sbjct  6     FLLPILLIT-LASLSVL---AYGEQPNPSIQSMLMQTCTQIENQSSCLTKVQAELQSIME  61

Query  990   PDL----RAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTMERRALHVCLELFS  823
             PD      A S   I+SA +  T+++ K+A    ++   +   +   E+ A+  C EL  
Sbjct  62    PDQGHQDAASSRSSILSAALRHTLNQAKSAVDMITKFNAL--SISYREQVAIEDCKELLD  119

Query  822   DALADLR---TVLDGLENSPAKRH--ADLQTLLSTAMTNQYTCLDGFPNSNKNVRPFIIK  658
              ++++L     V++ +       H   DL+  LS A++NQ TCL+GF  +++ +  FI  
Sbjct  120   FSISELAWSLGVMNRIRTGDRNVHYEGDLKAWLSAALSNQDTCLEGFEGTDRRLENFIKG  179

Query  657   RVEQISRHVSNALSMLTKI-----KKEKDNrfsssfrRENRGLKD-GFPKWLSRRDRALL  496
              ++Q+++ + N L++ T++     K  +D   ++          D  FP W+S  D+ L+
Sbjct  180   SLKQVTQLIGNVLALYTQLHDLPFKPPRDQSMNTLTIANKTSSPDHNFPAWMSEGDQELV  239

Query  495   EAPMGKGKKHD---IKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYV  325
                  K   HD   +  D VVA DG+G ++SI  A++ AP+ S  R++IY+K G Y E +
Sbjct  240   -----KSSPHDQSGMHVDSVVAADGTGKYRSITEAVNEAPNYSSRRYIIYVKKGIYRENI  294

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPE  145
             D+ KKKT IMFVGDGIG+T + G+RN   GW TFRTATVAV G GFIA+ ++F N AGP+
Sbjct  295   DMKKKKTNIMFVGDGIGQTIVTGDRNFMQGWTTFRTATVAVSGKGFIARDMTFRNTAGPQ  354

Query  144   NHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
             N+Q VALR DSD S F+ CS  G+QDTLY HS RQF+RECD+YGT+DF
Sbjct  355   NYQGVALRVDSDQSAFFRCSMEGHQDTLYAHSLRQFYRECDIYGTIDF  402



>ref|XP_008462453.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=598

 Score =   259 bits (662),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 158/377 (42%), Positives = 224/377 (59%), Gaps = 33/377 (9%)
 Frame = -3

Query  1062  HQVAHSACDHSLYRDLCVSTLVKTPD--LRAKSIPEIISATVNVTVSEIKTAAANCSRIR  889
             H +  S C  +LY D+C S + K+    L+ KS  ++I  ++N+TV   K    N  R++
Sbjct  71    HAIVKSTCSSTLYPDMCYSAISKSEGAMLKVKSQKDVIEVSINITV---KAVEENYFRVK  127

Query  888   RV--VPDLGTMERRALHVCLELFSDALADLRTVLDGLENSPAKR----HAD-LQTLLSTA  730
             ++  + ++   E+ ALH CLE   + L +L   +  L   P K+    HAD L+TLLS+A
Sbjct  128   KLCGLKNISHREKIALHDCLETIDETLDELHKAIVDLNEYPNKKSLNQHADDLKTLLSSA  187

Query  729   MTNQYTCLDGFP--NSNKNVRPFIIKRVEQISRHVSNALSMLTKIK-KEKDNrfsssfrR  559
             +TNQ TCLDGF   N++K +R  +     ++    SNAL+M+  +   +  N  +     
Sbjct  188   ITNQETCLDGFSHDNADKTLRDKLKAGQMEVEHMCSNALAMIKNMTDTDIANYEAKMGIT  247

Query  558   ENRGLKDG-----------FPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKS  412
             +NR L              +P+WLS  DR LL++         +  ++VVA DGSG+F++
Sbjct  248   KNRKLMAEEEDNNNNDEIQWPEWLSAGDRRLLQS-------SSVTPNVVVAADGSGNFRT  300

Query  411   INAALSAAPDSSDTRFVIYIKAGSYYEYVDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGW  232
             + AA++AAP+ S  R+VI IKAG Y E V+V KKKT IMF+GDG   T I G+RN+ DG 
Sbjct  301   VAAAVAAAPEKSSKRYVIRIKAGVYRENVEVPKKKTNIMFMGDGRRNTIITGSRNVVDGS  360

Query  231   PTFRTATVAVGGSGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVH  52
              TF++ATVA  G GF+A+ I+F+N AGP  HQAVALR  +D S FY C  + YQDTLYVH
Sbjct  361   TTFKSATVAAVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYQCDMLAYQDTLYVH  420

Query  51    SRRQFFRECDVYGTVDF  1
             S RQF+  C V GTVDF
Sbjct  421   SNRQFYINCLVSGTVDF  437



>ref|XP_006441080.1| hypothetical protein CICLE_v10019376mg [Citrus clementina]
 gb|ESR54320.1| hypothetical protein CICLE_v10019376mg [Citrus clementina]
Length=604

 Score =   259 bits (662),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 157/425 (37%), Positives = 228/425 (54%), Gaps = 32/425 (8%)
 Frame = -3

Query  1200  HSTIDSEMQNLGRNPIMLVPVVLLAPFLS-------LTVFQSSAMNATTSHDIHQVAHSA  1042
             H+T   +  +  R  ++L+ V+  A  ++       L   ++SA+  T  H   Q     
Sbjct  24    HATSAPQPSSRSRKKLILLSVLSFALIIASAVSAVLLVGLKTSAVGPTIGHKPTQAISRT  83

Query  1041  CDHSLYRDLCVSTLVKTPDLRAKSIPEIISATVNVTVSEIKTAAANCSRIRRVVPDLGTM  862
             C  +LY +LCVS+L+  P     S  +++  + N+T+     A    S I  +  D    
Sbjct  84    CSKTLYPNLCVSSLLNFPGSLTASEQDLVHISFNMTLQHFSRALYFTSGISYLQMD--PH  141

Query  861   ERRALHVCLELFSDALADLRTVLDG---LENSPAKRHADLQTLLSTAMTNQYTCLDGFPN  691
              R A   CLEL  D++  L   L     L      +  D+ T LS A+TN  TC +GF  
Sbjct  142   VRSAFDDCLELLDDSVDALSRSLGSVLLLPGGDINKREDVLTWLSAALTNHDTCSEGFEE  201

Query  690   SNKNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLK----------  541
              N  V+  +  +++ +S  VSN L++ +      D        R  R L           
Sbjct  202   LNGPVKDQVSDKLKDLSELVSNCLAIFSAGGDSDDFSGVPIQNRRRRLLSSSEEDDTWGE  261

Query  540   ----DGFPKWLSRRDRALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSD  373
                 D  P+W+SR  R LL  P+       I+AD++V+KDG+G  K+I  A+  AP++SD
Sbjct  262   NDDDDNVPRWVSRETRRLLSLPVPH-----IQADIIVSKDGTGTVKTIAEAIKKAPENSD  316

Query  372   TRFVIYIKAGSYYEY-VDVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGG  196
              R +IY++AG Y E  + V +KK  +MF+GDG GKT I G RN+ D   TF TA+ A  G
Sbjct  317   RRTIIYVRAGRYEESNLKVGRKKRNLMFIGDGKGKTIITGGRNVFDKLTTFHTASFAATG  376

Query  195   SGFIAKGISFENYAGPENHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVY  16
             +GFIA+ ++FEN+AGP  HQAVALR  +D++V Y C+ +GYQDTLYVHS RQF+RECD+Y
Sbjct  377   AGFIARDMTFENFAGPAKHQAVALRVGADHAVVYRCNVIGYQDTLYVHSNRQFYRECDIY  436

Query  15    GTVDF  1
             GTVDF
Sbjct  437   GTVDF  441



>ref|XP_004141734.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN45437.1| hypothetical protein Csa_7G447990 [Cucumis sativus]
Length=595

 Score =   259 bits (661),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 162/408 (40%), Positives = 239/408 (59%), Gaps = 33/408 (8%)
 Frame = -3

Query  1155  IMLVPVVLLAPFLSLTVFQSSAMNATTSHDIHQVAHSACDHSLYRDLCVSTLVKTPD--L  982
             + L   +L+   +   V  ++  ++  S + H +  S C  +LY D+C S + ++    L
Sbjct  37    VTLCSTLLIVGAVIGIVAGTTKSSSKYSGESHAIVKSTCSSTLYPDMCYSAISRSEGAML  96

Query  981   RAKSIPEIISATVNVTVSEIKTAAANCSRIRRV--VPDLGTMERRALHVCLELFSDALAD  808
             + K+  ++I  ++N+TV   K    N  R++++  + ++   ER ALH CLE   + L +
Sbjct  97    KVKNQKDVIEISINITV---KAVEENYFRVKKLCGLKNISHRERIALHDCLETIDETLDE  153

Query  807   LRTVLDGLENSPAKR----HAD-LQTLLSTAMTNQYTCLDGFP--NSNKNVRPFIIKRVE  649
             L   +  L   P K+    HAD L+TLLS+A+TNQ TCLDGF   +++KN+R  + +   
Sbjct  154   LHKAIVDLNEYPNKKSLNQHADDLKTLLSSAITNQETCLDGFSHDDADKNLRDKLKEGQM  213

Query  648   QISRHVSNALSMLTKIK-KEKDNrfsssfrRENRGL---------KDG--FPKWLSRRDR  505
             ++    SNAL+M+  +   +  N  +     +NR L          DG  +P+WLS  DR
Sbjct  214   EVEHMCSNALAMIKNMTDTDIANYEAKMGITKNRKLMAEEDDNNNDDGIQWPEWLSAGDR  273

Query  504   ALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYV  325
              LL++         +  ++VVA DGSG+F+++ AA++AAP  S  R+VI IKAG Y E V
Sbjct  274   RLLQSS-------SVTPNVVVAADGSGNFRTVAAAVAAAPVRSSKRYVIRIKAGVYRENV  326

Query  324   DVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPE  145
             +V KKKT IMF+GDG   T I G+RN+ DG  TF +AT+A  G GF+A+ I+F+N AGP 
Sbjct  327   EVPKKKTNIMFIGDGRRNTIITGSRNVVDGSTTFNSATMAAVGEGFLARDITFQNTAGPS  386

Query  144   NHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              HQAVALR  +D S FY C  + YQDTLYVHS RQF+  C V GTVDF
Sbjct  387   KHQAVALRVGADLSAFYQCDMLAYQDTLYVHSNRQFYINCLVSGTVDF  434



>ref|XP_010424662.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39 
[Camelina sativa]
Length=379

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 165/228 (72%), Gaps = 16/228 (7%)
 Frame = -3

Query  684  KNVRPFIIKRVEQISRHVSNALSMLTKIKKEKDNrfsssfrRENRGLKDGFPKWLSRRDR  505
            KN++  I+     IS ++SN+L ML  + ++  +R SS    E       +P W+S  D+
Sbjct  7    KNLKESIL----NISNNLSNSLDMLQVMSRKNPSRESSDVDVE-------YPGWVSEFDQ  55

Query  504  ALLEAPMGKGKKHDIKADMVVAKDGSGDFKSINAALSAAPDSSDTRFVIYIKAGSYYEYV  325
             LL+AP+      +   ++ VAKDG+G+F +I+AA+SAAP+SS+TRFVIYIK G Y+E V
Sbjct  56   RLLQAPV-----QETSFNLSVAKDGTGNFTTISAAVSAAPNSSETRFVIYIKGGEYFENV  110

Query  324  DVDKKKTMIMFVGDGIGKTRIKGNRNMKDGWPTFRTATVAVGGSGFIAKGISFENYAGPE  145
            +V KKKTMIMFVGDGIGKT IK NRN  DGWPTFRTATV V G GFIAK I+F N+AGP 
Sbjct  111  EVPKKKTMIMFVGDGIGKTVIKANRNCVDGWPTFRTATVGVKGKGFIAKDITFVNFAGPA  170

Query  144  NHQAVALRADSDYSVFYDCSFVGYQDTLYVHSRRQFFRECDVYGTVDF  1
              QAVALR+ SD S FY C+F GY+DTLYVHS +QF+RECD+YGT+DF
Sbjct  171  KKQAVALRSGSDLSAFYRCAFEGYEDTLYVHSAKQFYRECDIYGTIDF  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3512314477896