BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25235_g1_i1 len=1407 path=[7407:0-19 4986:20-1406]

Length=1407
                                                                      Score     E

ref|XP_007051682.1|  Programmed cell death protein 7 isoform 1          322   6e-102   
ref|XP_009592068.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    318   5e-101   
ref|XP_009787493.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    317   2e-100   
ref|XP_009592066.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    318   4e-100   
ref|XP_009787491.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    315   4e-99    
ref|XP_002279076.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    310   2e-97    Vitis vinifera
gb|KHG29252.1|  Programmed cell death 7                                 308   1e-96    
ref|XP_011093094.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    307   5e-96    
ref|XP_006339643.1|  PREDICTED: calponin homology domain-containi...    304   8e-95    
ref|XP_004229957.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    304   8e-95    
ref|XP_008232962.1|  PREDICTED: trichohyalin                            301   8e-94    
ref|XP_007218095.1|  hypothetical protein PRUPE_ppa006592mg             295   2e-91    
ref|XP_011037199.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    294   7e-91    
emb|CDP12671.1|  unnamed protein product                                293   8e-91    
ref|XP_011037213.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    291   7e-90    
gb|KDO86336.1|  hypothetical protein CISIN_1g015417mg                   290   1e-89    
ref|XP_006444931.1|  hypothetical protein CICLE_v10020434mg             290   3e-89    
gb|EYU32183.1|  hypothetical protein MIMGU_mgv1a004962mg                293   3e-89    
ref|XP_003540691.1|  PREDICTED: caldesmon-like                          288   2e-88    
gb|EYU26309.1|  hypothetical protein MIMGU_mgv1a003657mg                291   7e-88    
ref|XP_006444930.1|  hypothetical protein CICLE_v10020434mg             285   1e-87    
ref|XP_010092880.1|  Programmed cell death protein 7                    283   9e-87    
ref|XP_008384542.1|  PREDICTED: calponin homology domain-containi...    283   1e-86    
ref|XP_009338789.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    281   1e-86    
ref|XP_002320830.1|  hypothetical protein POPTR_0014s08710g             283   1e-86    Populus trichocarpa [western balsam poplar]
ref|XP_002511932.1|  conserved hypothetical protein                     283   2e-86    Ricinus communis
ref|XP_010032151.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    282   3e-86    
ref|XP_009338788.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    281   8e-86    
ref|XP_010669704.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    280   2e-85    
gb|KHN25314.1|  Programmed cell death protein 7                         280   3e-85    
gb|KDP28550.1|  hypothetical protein JCGZ_14321                         278   2e-84    
ref|XP_004306724.1|  PREDICTED: uncharacterized protein LOC101305592    278   2e-84    
ref|XP_008437979.1|  PREDICTED: tropomyosin alpha-1 chain isoform X2    275   3e-84    
ref|XP_007131925.1|  hypothetical protein PHAVU_011G052300g             275   9e-84    
ref|XP_008437978.1|  PREDICTED: tropomyosin alpha-1 chain isoform X1    274   3e-83    
ref|XP_007051683.1|  Programmed cell death protein 7 isoform 2          270   9e-83    
ref|XP_004134317.1|  PREDICTED: uncharacterized protein LOC101209659    273   1e-82    
ref|XP_010518285.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    269   2e-81    
ref|XP_002882054.1|  hypothetical protein ARALYDRAFT_483767             268   3e-81    
ref|XP_010251596.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    269   4e-81    
ref|XP_006294409.1|  hypothetical protein CARUB_v10023427mg             267   8e-81    
ref|XP_010508056.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    266   2e-80    
emb|CDY42016.1|  BnaC04g00940D                                          266   2e-80    
ref|XP_010506616.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    265   4e-80    
ref|XP_009142681.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    265   4e-80    
gb|EYU32184.1|  hypothetical protein MIMGU_mgv1a006362mg                267   5e-80    
emb|CDX79994.1|  BnaA05g01620D                                          261   1e-78    
ref|NP_850448.1|  uncharacterized protein                               258   2e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003606813.1|  Programmed cell death protein                      259   2e-77    
ref|XP_004507356.1|  PREDICTED: programmed cell death protein 7-l...    259   2e-77    
ref|XP_011093101.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    256   3e-76    
ref|XP_010925810.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    256   3e-76    
ref|XP_006397804.1|  hypothetical protein EUTSA_v10001493mg             255   3e-76    
ref|XP_006643934.1|  PREDICTED: calponin homology domain-containi...    254   2e-75    
ref|XP_003565844.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    254   2e-75    
ref|XP_008795314.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    252   2e-74    
ref|XP_004967437.1|  PREDICTED: uncharacterized protein LOC101780821    252   2e-74    
gb|EEC70217.1|  hypothetical protein OsI_00976                          251   3e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_009419319.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    251   5e-74    
ref|XP_006850934.1|  hypothetical protein AMTR_s00025p00188170          250   5e-74    
ref|XP_007051685.1|  Programmed cell death protein 7 isoform 4          249   2e-73    
ref|NP_001042465.1|  Os01g0226500                                       249   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010907430.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    249   2e-73    
ref|XP_007051684.1|  Programmed cell death protein 7 isoform 3          240   5e-71    
ref|XP_010544776.1|  PREDICTED: U11/U12 small nuclear ribonucleop...    241   9e-71    
ref|XP_006396963.1|  hypothetical protein EUTSA_v10028732mg             239   3e-70    
ref|NP_001168684.1|  uncharacterized protein LOC100382473               241   4e-70    Zea mays [maize]
emb|CDM82607.1|  unnamed protein product                                237   1e-68    
gb|ADE77667.1|  unknown                                                 225   4e-64    
gb|KDO86338.1|  hypothetical protein CISIN_1g015417mg                   213   5e-60    
gb|EAZ11108.1|  hypothetical protein OsJ_00956                          209   3e-58    Oryza sativa Japonica Group [Japonica rice]
gb|AAC62886.1|  hypothetical protein                                    192   1e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769104.1|  predicted protein                                  194   5e-52    
gb|EMS59979.1|  hypothetical protein TRIUR3_26828                       190   2e-49    
gb|EMT23559.1|  hypothetical protein F775_01827                         184   2e-48    
ref|XP_006396962.1|  hypothetical protein EUTSA_v10028732mg             177   3e-47    
ref|XP_002982955.1|  hypothetical protein SELMODRAFT_422277             163   6e-42    
ref|XP_008356930.1|  PREDICTED: uncharacterized protein LOC103420656    154   8e-39    
gb|KHN06189.1|  hypothetical protein glysoja_031631                     146   6e-36    
ref|XP_008375943.1|  PREDICTED: chromatin assembly factor 1 subun...    130   1e-31    
gb|EPS64362.1|  hypothetical protein M569_10419                         129   2e-30    
ref|NP_001132738.1|  uncharacterized protein LOC100194225               102   6e-22    Zea mays [maize]
ref|XP_008679635.1|  PREDICTED: uncharacterized protein LOC103654...    102   8e-22    
ref|XP_002981977.1|  hypothetical protein SELMODRAFT_421352           96.3    9e-19    
emb|CDY42013.1|  BnaC04g00910D                                        75.5    2e-13    
gb|AFW64960.1|  hypothetical protein ZEAMMB73_055802                  71.6    3e-10    
ref|XP_008677751.1|  PREDICTED: uncharacterized protein LOC100502...  69.7    3e-10    
ref|NP_001183771.1|  uncharacterized protein LOC100502364             69.7    4e-10    
ref|XP_002970851.1|  hypothetical protein SELMODRAFT_411484           68.9    2e-09    
dbj|BAK04294.1|  predicted protein                                    65.9    1e-08    
ref|XP_006628893.1|  PREDICTED: programmed cell death protein 7-like  65.9    4e-08    
ref|XP_009047920.1|  hypothetical protein LOTGIDRAFT_111632           60.5    4e-07    
ref|XP_007532432.1|  PREDICTED: programmed cell death protein 7       59.3    9e-07    
gb|AAH93108.2|  Programmed cell death 7                               61.2    1e-06    Danio rerio [leopard danio]
ref|NP_001003415.1|  programmed cell death protein 7                  61.2    1e-06    Danio rerio [leopard danio]
gb|ELR53342.1|  Programmed cell death protein 7                       58.9    1e-06    
ref|XP_005955773.1|  PREDICTED: programmed cell death protein 7       59.3    1e-06    
ref|XP_008706902.1|  PREDICTED: programmed cell death protein 7       58.5    2e-06    
ref|XP_007260286.1|  PREDICTED: programmed cell death protein 7       60.5    2e-06    
ref|XP_010512828.1|  PREDICTED: U11/U12 small nuclear ribonucleop...  57.0    2e-06    
ref|XP_006770891.1|  PREDICTED: programmed cell death protein 7       58.2    2e-06    
ref|XP_006141858.1|  PREDICTED: programmed cell death protein 7       58.2    3e-06    
gb|EXX78682.1|  hypothetical protein RirG_012920                      59.3    3e-06    
ref|XP_007084717.1|  PREDICTED: programmed cell death protein 7       57.8    3e-06    
ref|XP_006886720.1|  PREDICTED: programmed cell death protein 7       59.7    3e-06    
gb|ERZ96337.1|  hypothetical protein GLOINDRAFT_340698                59.3    3e-06    
ref|XP_010832909.1|  PREDICTED: programmed cell death protein 7       58.9    3e-06    
gb|KFO25991.1|  Programmed cell death protein 7                       57.8    4e-06    
ref|XP_005861190.1|  PREDICTED: programmed cell death protein 7       57.4    4e-06    
gb|EPQ04496.1|  Programmed cell death protein 7                       57.4    4e-06    
gb|EGW10981.1|  Programmed cell death protein 7                       57.0    5e-06    
gb|EKC32192.1|  Programmed cell death protein 7                       58.9    5e-06    
gb|AAH22772.2|  Pdcd7 protein                                         56.6    5e-06    Mus musculus [mouse]
ref|XP_007105223.1|  PREDICTED: programmed cell death protein 7       56.6    5e-06    
ref|XP_008308908.1|  PREDICTED: LOW QUALITY PROTEIN: programmed c...  58.5    6e-06    
ref|XP_006920617.1|  PREDICTED: programmed cell death protein 7       57.8    7e-06    
ref|XP_005900055.1|  PREDICTED: programmed cell death protein 7       57.8    7e-06    
ref|XP_004662508.1|  PREDICTED: programmed cell death protein 7       57.4    7e-06    
ref|XP_004628990.1|  PREDICTED: programmed cell death protein 7       58.2    7e-06    
ref|XP_004374725.1|  PREDICTED: programmed cell death protein 7       57.4    8e-06    
ref|XP_004010920.1|  PREDICTED: programmed cell death protein 7       57.8    8e-06    
ref|XP_007645908.1|  PREDICTED: programmed cell death protein 7 i...  57.0    8e-06    
ref|NP_001102238.1|  programmed cell death protein 7                  57.0    9e-06    Rattus norvegicus [brown rat]
ref|XP_006184072.1|  PREDICTED: programmed cell death protein 7       55.5    1e-05    
ref|XP_004712045.1|  PREDICTED: programmed cell death protein 7       57.4    1e-05    
ref|XP_005316995.1|  PREDICTED: programmed cell death protein 7       57.0    1e-05    
ref|XP_007166181.1|  PREDICTED: programmed cell death protein 7       56.6    1e-05    
ref|XP_010953640.1|  PREDICTED: programmed cell death protein 7       57.0    1e-05    
ref|XP_007608160.1|  PREDICTED: programmed cell death protein 7 i...  57.0    1e-05    
ref|XP_008834751.1|  PREDICTED: programmed cell death protein 7       57.4    1e-05    
ref|XP_010639589.1|  PREDICTED: programmed cell death protein 7       57.0    1e-05    
gb|AAD20241.1|  ES18                                                  55.8    1e-05    Homo sapiens [man]
ref|XP_006050325.1|  PREDICTED: programmed cell death protein 7       57.4    1e-05    
ref|XP_006093511.1|  PREDICTED: LOW QUALITY PROTEIN: programmed c...  57.0    1e-05    
ref|XP_006932548.1|  PREDICTED: programmed cell death protein 7       57.0    1e-05    
ref|XP_006898980.1|  PREDICTED: programmed cell death protein 7-like  57.4    1e-05    
gb|ELK05325.1|  Programmed cell death protein 7                       57.4    2e-05    
ref|XP_006209698.1|  PREDICTED: programmed cell death protein 7       56.6    2e-05    
ref|XP_006979414.1|  PREDICTED: programmed cell death protein 7       57.0    2e-05    
ref|XP_007955910.1|  PREDICTED: programmed cell death protein 7       57.4    2e-05    
ref|XP_005952353.1|  PREDICTED: programmed cell death protein 7-like  54.3    2e-05    
ref|XP_004795968.1|  PREDICTED: programmed cell death protein 7       56.6    2e-05    
ref|NP_001192378.1|  programmed cell death protein 7                  57.0    2e-05    
ref|XP_005148898.1|  PREDICTED: programmed cell death protein 7       55.1    2e-05    
ref|XP_010349959.1|  PREDICTED: programmed cell death protein 7       56.2    2e-05    
gb|EDL26088.1|  programmed cell death protein 7                       56.6    2e-05    
ref|XP_004758857.1|  PREDICTED: programmed cell death protein 7       56.6    3e-05    
ref|XP_004422073.1|  PREDICTED: programmed cell death protein 7       56.2    3e-05    
ref|XP_003418413.1|  PREDICTED: programmed cell death protein 7       56.6    3e-05    
gb|EAW77714.1|  programmed cell death 7, isoform CRA_b                53.9    3e-05    
gb|EHH63143.1|  hypothetical protein EGM_16053                        55.1    3e-05    
ref|XP_008137478.1|  PREDICTED: programmed cell death protein 7       56.2    3e-05    
gb|ERE75716.1|  programmed cell death protein 7                       55.8    3e-05    
gb|AAH92464.1|  PDCD7 protein                                         55.5    4e-05    Homo sapiens [man]
ref|XP_008054356.1|  PREDICTED: programmed cell death protein 7       55.5    4e-05    
ref|XP_010875653.1|  PREDICTED: programmed cell death protein 7       56.2    4e-05    
gb|AAI31705.1|  PDCD7 protein                                         55.1    5e-05    Homo sapiens [man]
ref|XP_006831908.1|  PREDICTED: programmed cell death protein 7       55.8    5e-05    
gb|KFO97841.1|  Programmed cell death protein 7                       54.3    5e-05    
ref|XP_010298668.1|  PREDICTED: programmed cell death protein 7       53.5    5e-05    
gb|KFO53496.1|  Programmed cell death protein 7                       53.9    5e-05    
ref|XP_008635835.1|  PREDICTED: programmed cell death protein 7       53.9    5e-05    
ref|XP_006275728.1|  PREDICTED: programmed cell death protein 7       53.5    5e-05    
ref|XP_005075597.1|  PREDICTED: programmed cell death protein 7       55.8    6e-05    
gb|KFW80328.1|  Programmed cell death protein 7                       53.9    6e-05    
ref|XP_010991856.1|  PREDICTED: programmed cell death protein 7       55.5    6e-05    
ref|XP_008296649.1|  PREDICTED: programmed cell death protein 7       55.8    6e-05    
gb|AAH16992.2|  PDCD7 protein                                         52.8    6e-05    Homo sapiens [man]
ref|XP_005348240.1|  PREDICTED: programmed cell death protein 7       55.5    6e-05    
ref|XP_005638757.1|  PREDICTED: programmed cell death protein 7       55.5    6e-05    
ref|XP_004574128.1|  PREDICTED: programmed cell death protein 7-l...  55.5    6e-05    
ref|XP_004687730.1|  PREDICTED: programmed cell death protein 7       55.5    6e-05    
ref|XP_008921399.1|  PREDICTED: programmed cell death protein 7       53.9    6e-05    
sp|Q9WTY1.1|PDCD7_MOUSE  RecName: Full=Programmed cell death prot...  55.5    6e-05    Mus musculus [mouse]
ref|XP_008951621.1|  PREDICTED: programmed cell death protein 7       55.1    6e-05    
ref|XP_009071367.1|  PREDICTED: programmed cell death protein 7       53.5    6e-05    
ref|NP_057897.2|  programmed cell death protein 7                     55.5    6e-05    Mus musculus [mouse]
ref|XP_003784477.1|  PREDICTED: programmed cell death protein 7       55.5    6e-05    
ref|XP_009962963.1|  PREDICTED: programmed cell death protein 7       53.1    7e-05    
ref|XP_009319810.1|  PREDICTED: programmed cell death protein 7       53.5    7e-05    
gb|KFW65365.1|  Programmed cell death protein 7                       53.5    7e-05    
ref|XP_004274802.1|  PREDICTED: programmed cell death protein 7       55.5    7e-05    
ref|XP_008267788.1|  PREDICTED: LOW QUALITY PROTEIN: programmed c...  55.1    7e-05    
ref|XP_004409459.1|  PREDICTED: programmed cell death protein 7       55.5    7e-05    
ref|XP_007447741.1|  PREDICTED: programmed cell death protein 7       55.5    7e-05    
ref|XP_001108617.1|  PREDICTED: programmed cell death protein 7-like  55.5    8e-05    Macaca mulatta [rhesus macaque]
ref|XP_004455560.1|  PREDICTED: programmed cell death protein 7       55.1    8e-05    
ref|XP_006020138.1|  PREDICTED: programmed cell death protein 7       52.8    8e-05    
gb|EOA97062.1|  Programmed cell death protein 7                       53.1    8e-05    
ref|XP_003480489.1|  PREDICTED: programmed cell death protein 7       55.1    8e-05    
gb|KFP70139.1|  Programmed cell death protein 7                       53.1    8e-05    
gb|KFQ47572.1|  Programmed cell death protein 7                       53.1    9e-05    
ref|XP_004877652.1|  PREDICTED: programmed cell death protein 7       54.3    9e-05    
ref|XP_009875988.1|  PREDICTED: programmed cell death protein 7       52.8    9e-05    
ref|XP_004574126.1|  PREDICTED: programmed cell death protein 7-l...  55.1    9e-05    
ref|XP_010389553.1|  PREDICTED: programmed cell death protein 7       53.1    9e-05    
ref|XP_008504395.1|  PREDICTED: programmed cell death protein 7       53.5    1e-04    
gb|KFP57330.1|  Programmed cell death protein 7                       52.8    1e-04    
ref|XP_003267042.1|  PREDICTED: programmed cell death protein 7       54.7    1e-04    
gb|KFZ49778.1|  Programmed cell death protein 7                       52.8    1e-04    
ref|XP_009003314.1|  PREDICTED: LOW QUALITY PROTEIN: programmed c...  54.7    1e-04    
gb|KFP12783.1|  Programmed cell death protein 7                       53.1    1e-04    
ref|XP_009813062.1|  PREDICTED: programmed cell death protein 7       52.8    1e-04    
ref|XP_005025574.1|  PREDICTED: programmed cell death protein 7       53.5    1e-04    
ref|XP_003969519.1|  PREDICTED: programmed cell death protein 7-like  54.7    1e-04    
gb|KFQ42762.1|  Programmed cell death protein 7                       53.5    1e-04    
gb|KFO79270.1|  Programmed cell death protein 7                       53.1    1e-04    
gb|KFP23400.1|  Programmed cell death protein 7                       52.8    1e-04    
ref|XP_009706244.1|  PREDICTED: programmed cell death protein 7       52.8    1e-04    
gb|KFQ20397.1|  Programmed cell death protein 7                       53.5    1e-04    
ref|XP_010014386.1|  PREDICTED: programmed cell death protein 7       53.1    1e-04    
ref|XP_009563397.1|  PREDICTED: programmed cell death protein 7       53.1    1e-04    
ref|XP_010359672.1|  PREDICTED: programmed cell death protein 7       54.7    1e-04    
gb|KFV06814.1|  Programmed cell death protein 7                       52.4    1e-04    
gb|KGL86687.1|  Programmed cell death protein 7                       53.5    1e-04    
gb|KFP60268.1|  Programmed cell death protein 7                       52.4    1e-04    
ref|XP_008946517.1|  PREDICTED: programmed cell death protein 7       52.0    1e-04    
ref|XP_010139911.1|  PREDICTED: programmed cell death protein 7       52.0    1e-04    
gb|KFW80100.1|  Programmed cell death protein 7                       52.4    1e-04    
ref|XP_010353800.1|  PREDICTED: programmed cell death protein 7       54.3    1e-04    
ref|NP_005698.1|  programmed cell death protein 7                     54.3    1e-04    Homo sapiens [man]
ref|XP_009885788.1|  PREDICTED: programmed cell death protein 7       53.5    1e-04    
gb|KFQ86466.1|  Programmed cell death protein 7                       52.4    2e-04    
ref|XP_002825603.1|  PREDICTED: programmed cell death protein 7       54.3    2e-04    
gb|EMC77340.1|  Programmed cell death protein 7                       52.8    2e-04    
gb|AAP88882.1|  programmed cell death 7                               51.2    2e-04    
gb|KFR02556.1|  Programmed cell death protein 7                       53.1    2e-04    
gb|KFW01742.1|  Programmed cell death protein 7                       52.8    2e-04    
ref|XP_010146236.1|  PREDICTED: programmed cell death protein 7       52.8    2e-04    
ref|XP_005424327.1|  PREDICTED: programmed cell death protein 7       53.1    2e-04    
ref|XP_004056398.1|  PREDICTED: LOW QUALITY PROTEIN: programmed c...  53.9    2e-04    
gb|AAP36059.1|  programmed cell death 7                               51.2    2e-04    Homo sapiens [man]
ref|XP_005254165.1|  PREDICTED: programmed cell death protein 7 i...  53.9    2e-04    
ref|XP_009476237.1|  PREDICTED: programmed cell death protein 7       51.6    2e-04    
ref|XP_003460819.1|  PREDICTED: LOW QUALITY PROTEIN: programmed c...  53.9    2e-04    
ref|XP_008014445.1|  PREDICTED: programmed cell death protein 7       53.9    2e-04    
ref|XP_003901116.1|  PREDICTED: programmed cell death protein 7       53.9    2e-04    
ref|XP_005559870.1|  PREDICTED: programmed cell death protein 7       53.9    2e-04    
ref|XP_009278771.1|  PREDICTED: programmed cell death protein 7       52.8    2e-04    
ref|XP_009468499.1|  PREDICTED: programmed cell death protein 7       53.1    2e-04    
gb|KFV98108.1|  Programmed cell death protein 7                       51.6    2e-04    
ref|XP_010192514.1|  PREDICTED: programmed cell death protein 7       51.2    2e-04    
ref|XP_008583516.1|  PREDICTED: programmed cell death protein 7       53.1    2e-04    
gb|KFV69941.1|  Programmed cell death protein 7                       52.8    2e-04    
gb|KFR04696.1|  Programmed cell death protein 7                       51.6    3e-04    
emb|CDQ86944.1|  unnamed protein product                              53.1    3e-04    
ref|XP_005051894.1|  PREDICTED: programmed cell death protein 7       53.1    3e-04    
ref|XP_010209033.1|  PREDICTED: programmed cell death protein 7       51.2    3e-04    
ref|XP_010570609.1|  PREDICTED: programmed cell death protein 7       53.1    3e-04    
ref|XP_009633332.1|  PREDICTED: programmed cell death protein 7       51.2    3e-04    
ref|XP_005614945.1|  PREDICTED: LOW QUALITY PROTEIN: programmed c...  53.1    3e-04    
ref|XP_009952512.1|  PREDICTED: programmed cell death protein 7       52.4    3e-04    
gb|KFV04601.1|  Programmed cell death protein 7                       52.4    3e-04    
ref|XP_009990466.1|  PREDICTED: programmed cell death protein 7       50.8    3e-04    
ref|XP_002198006.2|  PREDICTED: programmed cell death protein 7       52.8    3e-04    Taeniopygia guttata
gb|KFQ13453.1|  Programmed cell death protein 7                       52.4    3e-04    
ref|XP_010084981.1|  PREDICTED: programmed cell death protein 7       52.4    3e-04    
ref|XP_009511957.1|  PREDICTED: programmed cell death protein 7       50.8    3e-04    
ref|XP_005500988.1|  PREDICTED: programmed cell death protein 7       52.0    4e-04    
ref|XP_008529929.1|  PREDICTED: programmed cell death protein 7       52.8    4e-04    
ref|XP_009902253.1|  PREDICTED: programmed cell death protein 7       52.0    4e-04    
emb|CDS11094.1|  hypothetical protein LRAMOSA03358                    52.0    5e-04    
ref|XP_009584923.1|  PREDICTED: programmed cell death protein 7       50.4    5e-04    
ref|XP_009943731.1|  PREDICTED: programmed cell death protein 7       50.1    6e-04    
ref|XP_009088425.1|  PREDICTED: programmed cell death protein 7       52.4    6e-04    
ref|XP_007053595.1|  PREDICTED: programmed cell death protein 7       50.4    6e-04    
ref|XP_005466118.1|  PREDICTED: programmed cell death protein 7-l...  52.4    7e-04    
ref|XP_004578039.1|  PREDICTED: programmed cell death protein 7       52.4    7e-04    
ref|XP_003755706.1|  PREDICTED: programmed cell death protein 7       50.4    7e-04    
ref|XP_005242507.1|  PREDICTED: programmed cell death protein 7       49.7    7e-04    
ref|XP_004855687.1|  PREDICTED: programmed cell death protein 7       52.0    8e-04    



>ref|XP_007051682.1| Programmed cell death protein 7 isoform 1 [Theobroma cacao]
 gb|EOX95839.1| Programmed cell death protein 7 isoform 1 [Theobroma cacao]
Length=398

 Score =   322 bits (825),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 228/313 (73%), Positives = 265/313 (85%), Gaps = 16/313 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E +S+EAAN+L+S LRAQLEPFR   DE+SPWEEKSAA RL+NK++K KRNKLWRKRKRK
Sbjct  88   ESISMEAANSLMSKLRAQLEPFRYVVDEASPWEEKSAAARLANKINKSKRNKLWRKRKRK  147

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+AE L+ ER+RF+QAD+EADEWRAREIAKD+A++KVEKMKEIAK K KEE+ +LESELE
Sbjct  148  RIAEMLSKERERFDQADREADEWRAREIAKDIASRKVEKMKEIAKLKAKEEKMRLESELE  207

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRIQKLKKQG FLPEEDDKFLE+V+AAVEEEERQA+AAA T AAKDA
Sbjct  208  LVLIVEKLQELRSIRIQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQALAAADTDAAKDA  267

Query  561  ianaEESRKATQSYKPDSKD----------AKDEKEHGNNDVKDKITTSSSEKEHGNN--  704
            IA AEE+RKATQ+ KP SKD          +KD+K   N D KD  +++ ++KE G N  
Sbjct  268  IATAEETRKATQNQKPLSKDPISDQLEDKESKDQK-TPNEDEKD--SSTVTDKESGQNTS  324

Query  705  -GGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPP  881
             G G   AYDS++NLP+EFYHYY+GSN DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPP
Sbjct  325  EGHGYGGAYDSLANLPIEFYHYYHGSNTDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPP  384

Query  882  PADEIWASCLVKP  920
            PADEIWAS LV+P
Sbjct  385  PADEIWASYLVRP  397



>ref|XP_009592068.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X2 [Nicotiana tomentosiformis]
Length=351

 Score =   318 bits (815),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 224/306 (73%), Positives = 255/306 (83%), Gaps = 8/306 (3%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LSLEAANALIS LRAQLEPFR+  DE +PWEEKSAA RL+NK+ KYKRNKLWRKRKRK V
Sbjct  45   LSLEAANALISKLRAQLEPFRVITDEIAPWEEKSAALRLANKMHKYKRNKLWRKRKRKHV  104

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AEKLA E+++F+Q D EADEWRAREIAKD+A +KVEKMKEIA+ K K+E+++LESELELA
Sbjct  105  AEKLAKEQEQFDQIDMEADEWRAREIAKDIAKRKVEKMKEIAELKAKQEKKRLESELELA  164

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            LMVEKLQELRSIR+QKLKKQG FLPEEDDKFLE+V+AA EEEERQA AAA T AAKDAIA
Sbjct  165  LMVEKLQELRSIRVQKLKKQGHFLPEEDDKFLEKVRAAFEEEERQAKAAAETDAAKDAIA  224

Query  567  naEESRKATQSYKPDSKD------AKDEKEHGNNDVKDKI-TTSSSEKEHGN-NGGGGSS  722
             AEESRK  QS++P+  D      A    +    + KDK  +T  +E E G   G G +S
Sbjct  225  TAEESRKTIQSHRPEPGDLHASTGADKVNQDQKTESKDKSDSTPVNEMEKGGPEGLGSAS  284

Query  723  AYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWA  902
             +DSV+NLP+EFYHYYYGSNHD+GTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPADEIWA
Sbjct  285  LHDSVANLPLEFYHYYYGSNHDLGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPADEIWA  344

Query  903  SCLVKP  920
            S LVKP
Sbjct  345  SYLVKP  350



>ref|XP_009787493.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009787494.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X2 [Nicotiana sylvestris]
Length=351

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 227/312 (73%), Positives = 253/312 (81%), Gaps = 12/312 (4%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            S E LSLEAAN LIS LRAQLEPFR+  DE  PWEEKSAA RL NK+ KYKRNKLWRKRK
Sbjct  41   SQESLSLEAANTLISKLRAQLEPFRVITDEMVPWEEKSAAVRLVNKMHKYKRNKLWRKRK  100

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAEKLA ER++F+Q D EADEWRAREIAKD+A +KVEKMKEIAK KEK+E+++LESE
Sbjct  101  RKHVAEKLAKEREQFDQIDMEADEWRAREIAKDIAKRKVEKMKEIAKLKEKQEKKRLESE  160

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LELALMVEKLQELRSIR+QKLKKQG FLPEEDDKFLERV+AAVEEEERQA AAA T AAK
Sbjct  161  LELALMVEKLQELRSIRVQKLKKQGHFLPEEDDKFLERVRAAVEEEERQAKAAAETDAAK  220

Query  555  daianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEK----------EHGNN  704
            DAIA AEESRK  QS++ +  D       G + +    TT S +K          + G  
Sbjct  221  DAIATAEESRKTIQSHRSEPGDL--HANTGTSKINQDQTTESKDKSGSTPVNEMEKGGPE  278

Query  705  GGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPP  884
            G G +S +DSV+NLP+EFYHYYYGSNHD+GTLIEVRRTWD+YIRPGGSRIPGHWVQPPPP
Sbjct  279  GLGSASLHDSVANLPLEFYHYYYGSNHDLGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPP  338

Query  885  ADEIWASCLVKP  920
            ADEIWAS LVKP
Sbjct  339  ADEIWASYLVKP  350



>ref|XP_009592066.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009592067.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X1 [Nicotiana tomentosiformis]
Length=410

 Score =   318 bits (814),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 224/306 (73%), Positives = 255/306 (83%), Gaps = 8/306 (3%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LSLEAANALIS LRAQLEPFR+  DE +PWEEKSAA RL+NK+ KYKRNKLWRKRKRK V
Sbjct  104  LSLEAANALISKLRAQLEPFRVITDEIAPWEEKSAALRLANKMHKYKRNKLWRKRKRKHV  163

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AEKLA E+++F+Q D EADEWRAREIAKD+A +KVEKMKEIA+ K K+E+++LESELELA
Sbjct  164  AEKLAKEQEQFDQIDMEADEWRAREIAKDIAKRKVEKMKEIAELKAKQEKKRLESELELA  223

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            LMVEKLQELRSIR+QKLKKQG FLPEEDDKFLE+V+AA EEEERQA AAA T AAKDAIA
Sbjct  224  LMVEKLQELRSIRVQKLKKQGHFLPEEDDKFLEKVRAAFEEEERQAKAAAETDAAKDAIA  283

Query  567  naEESRKATQSYKPDSKD------AKDEKEHGNNDVKDKI-TTSSSEKEHGN-NGGGGSS  722
             AEESRK  QS++P+  D      A    +    + KDK  +T  +E E G   G G +S
Sbjct  284  TAEESRKTIQSHRPEPGDLHASTGADKVNQDQKTESKDKSDSTPVNEMEKGGPEGLGSAS  343

Query  723  AYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWA  902
             +DSV+NLP+EFYHYYYGSNHD+GTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPADEIWA
Sbjct  344  LHDSVANLPLEFYHYYYGSNHDLGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPADEIWA  403

Query  903  SCLVKP  920
            S LVKP
Sbjct  404  SYLVKP  409



>ref|XP_009787491.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009787492.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 227/312 (73%), Positives = 253/312 (81%), Gaps = 12/312 (4%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            S E LSLEAAN LIS LRAQLEPFR+  DE  PWEEKSAA RL NK+ KYKRNKLWRKRK
Sbjct  100  SQESLSLEAANTLISKLRAQLEPFRVITDEMVPWEEKSAAVRLVNKMHKYKRNKLWRKRK  159

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAEKLA ER++F+Q D EADEWRAREIAKD+A +KVEKMKEIAK KEK+E+++LESE
Sbjct  160  RKHVAEKLAKEREQFDQIDMEADEWRAREIAKDIAKRKVEKMKEIAKLKEKQEKKRLESE  219

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LELALMVEKLQELRSIR+QKLKKQG FLPEEDDKFLERV+AAVEEEERQA AAA T AAK
Sbjct  220  LELALMVEKLQELRSIRVQKLKKQGHFLPEEDDKFLERVRAAVEEEERQAKAAAETDAAK  279

Query  555  daianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEK----------EHGNN  704
            DAIA AEESRK  QS++ +  D       G + +    TT S +K          + G  
Sbjct  280  DAIATAEESRKTIQSHRSEPGDL--HANTGTSKINQDQTTESKDKSGSTPVNEMEKGGPE  337

Query  705  GGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPP  884
            G G +S +DSV+NLP+EFYHYYYGSNHD+GTLIEVRRTWD+YIRPGGSRIPGHWVQPPPP
Sbjct  338  GLGSASLHDSVANLPLEFYHYYYGSNHDLGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPP  397

Query  885  ADEIWASCLVKP  920
            ADEIWAS LVKP
Sbjct  398  ADEIWASYLVKP  409



>ref|XP_002279076.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Vitis vinifera]
 emb|CBI40446.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 252/304 (83%), Gaps = 2/304 (1%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            S EL S+EAANAL+S LR QLEPFR+ ADE+SPWEEKSAA RL+NK+ K KRNK WRK+K
Sbjct  96   SQELCSVEAANALMSKLRFQLEPFRVIADETSPWEEKSAAVRLANKIHKSKRNKRWRKKK  155

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK +AE LA ER+RF+QAD+EADEWR REIAKD+A +KVEKMKEIAK K KEER+ LESE
Sbjct  156  RKHIAEMLAKERERFDQADQEADEWRVREIAKDIAKRKVEKMKEIAKLKAKEERKALESE  215

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LE+ L+V+KLQELRSIRIQKLKKQG FLPEEDDKFLE+V+AAVEEEERQAMAAA T AAK
Sbjct  216  LEMVLIVDKLQELRSIRIQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQAMAAADTDAAK  275

Query  555  daianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKIT-TSSSEKE-HGNNGGGGSSAY  728
            DAIA AEE R+     + D +DA   K   NN+ +DKIT T  +EKE H + G     AY
Sbjct  276  DAIATAEEFRRNLTGCEHDLEDANSTKNVENNESQDKITETVLTEKENHRSEGRSHGGAY  335

Query  729  DSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASC  908
            DSV++LP+EFYHYY+GSN DMGTLIEVRR WD+YIRPGGSR+PGHWVQPPPPADEIWAS 
Sbjct  336  DSVASLPIEFYHYYHGSNTDMGTLIEVRRAWDAYIRPGGSRMPGHWVQPPPPADEIWASY  395

Query  909  LVKP  920
            LV P
Sbjct  396  LVHP  399



>gb|KHG29252.1| Programmed cell death 7 [Gossypium arboreum]
Length=398

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 222/311 (71%), Positives = 257/311 (83%), Gaps = 12/311 (4%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            ELLSLEAANAL+S LRAQLEPFR  ADE  PWEEKSA  RL+NK+ K KRN LWRKRKRK
Sbjct  88   ELLSLEAANALMSKLRAQLEPFRYVADEGIPWEEKSAVARLTNKIKKSKRNNLWRKRKRK  147

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+AE LA E ++F+QAD+EADEWRAREIAKD+A++KVEKMKEIAK K KEE+++LESELE
Sbjct  148  RIAELLAKEHEQFDQADREADEWRAREIAKDIASRKVEKMKEIAKLKAKEEKKRLESELE  207

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L LMVEKLQELRS+RIQKLKKQG FLPEEDDKFLE+V+AAVEEEERQA+AAA T AAKDA
Sbjct  208  LVLMVEKLQELRSMRIQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQALAAADTDAAKDA  267

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEK--------EHGNN---G  707
            IA AEE+RKATQ+ +P S D   ++   N + KD+IT +  +K        E G N   G
Sbjct  268  IATAEETRKATQNQRPLSNDPMTDQLE-NKERKDQITPNEDKKGSGTVTDMESGKNKLEG  326

Query  708  GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPA  887
             G +  YD ++NLP+EFYHYY+GSN DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPA
Sbjct  327  HGYTWTYDPLTNLPIEFYHYYHGSNSDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPA  386

Query  888  DEIWASCLVKP  920
            D+IWAS LV+P
Sbjct  387  DDIWASYLVRP  397



>ref|XP_011093094.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X1 [Sesamum indicum]
Length=408

 Score =   307 bits (787),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 213/310 (69%), Positives = 253/310 (82%), Gaps = 10/310 (3%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E +SL  ANA++S LR QLEPFR+  DE+SPWEEKSAA+RL++K+ KYKRNKLWR+RKRK
Sbjct  98   ESMSLNVANAIMSKLRFQLEPFRVITDENSPWEEKSAAKRLADKMQKYKRNKLWRRRKRK  157

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+AE L+ ER++F+Q DKEADEWRAREIAKD+A +KVEKM EIAK K KEE+++LE+ELE
Sbjct  158  RIAENLSREREQFDQIDKEADEWRAREIAKDIAQRKVEKMNEIAKLKAKEEKKRLEAELE  217

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRS RIQKLK+QG FLPEEDDKFLERV+AAVEEEERQ MAAA   AAKDA
Sbjct  218  LVLIVEKLQELRSFRIQKLKRQGHFLPEEDDKFLERVRAAVEEEERQTMAAAFPDAAKDA  277

Query  561  ianaEESRKATQSYKPDSKDA-------KDEKEHGNNDVKDKITTSSSEKEH---GNNGG  710
            IA AEESRK  QS+ PD ++        ++ ++  N    ++++   + KE      NG 
Sbjct  278  IATAEESRKHIQSHAPDMEEPGLNNSGYRESQDQENETANERVSNVVAPKEFRKVDTNGP  337

Query  711  GGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPAD  890
            G SS Y+SV+NLPMEFYHYY+GSN DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPAD
Sbjct  338  GSSSVYNSVANLPMEFYHYYHGSNTDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPAD  397

Query  891  EIWASCLVKP  920
            EIWAS LVKP
Sbjct  398  EIWASYLVKP  407



>ref|XP_006339643.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006339644.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
isoform X2 [Solanum tuberosum]
Length=411

 Score =   304 bits (779),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 224/316 (71%), Positives = 252/316 (80%), Gaps = 20/316 (6%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            S E LSLEAANAL+S LRAQLEPFR+  DE +PWEEKSA   L+NK+ KYKRNKLWRKRK
Sbjct  101  SQESLSLEAANALMSKLRAQLEPFRVITDEMAPWEEKSATVGLANKMHKYKRNKLWRKRK  160

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK +AEKLA ER++++Q D EADEWRAREIAKD+A +KVEKMKEIAK K KEE+R+LESE
Sbjct  161  RKHIAEKLAKEREQYDQIDMEADEWRAREIAKDIAKRKVEKMKEIAKLKAKEEKRRLESE  220

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LELAL+VEKLQELRS+R+QKLKKQG FLPEEDDKFLE+V+AAVEEEERQA AAA T AAK
Sbjct  221  LELALIVEKLQELRSMRVQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQAKAAADTAAAK  280

Query  555  daianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKIT-------------TSSSEKEH  695
            DAIA AE SRK  QS +P+  D      H N D  DKI              T  +E E 
Sbjct  281  DAIATAEVSRKTIQSQRPEPGDL-----HANTD-DDKINPDQMTVDKDKSGPTPVNELEK  334

Query  696  -GNNGGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQ  872
             G+ G G +S +DSV+NLPMEFYHYYYGSNHD+GTLIEVRRTWD+YIRPGGSRIPGHWVQ
Sbjct  335  VGSKGLGSASLHDSVANLPMEFYHYYYGSNHDLGTLIEVRRTWDAYIRPGGSRIPGHWVQ  394

Query  873  PPPPADEIWASCLVKP  920
            PPPPAD IWAS L KP
Sbjct  395  PPPPADAIWASYLAKP  410



>ref|XP_004229957.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Solanum lycopersicum]
Length=411

 Score =   304 bits (779),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 224/316 (71%), Positives = 252/316 (80%), Gaps = 20/316 (6%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            S E LSLEAANAL+S LRAQLEPFR+  DE +PWEEKSA   L+NK+ KYKRNKLWRKRK
Sbjct  101  SQEFLSLEAANALMSKLRAQLEPFRVITDEMAPWEEKSATVGLANKMHKYKRNKLWRKRK  160

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAEKLA ER++++Q D EADEWRAREIAKD+A +KVEKMKEIAK K KEE+++LESE
Sbjct  161  RKHVAEKLAKEREQYDQIDMEADEWRAREIAKDIAKRKVEKMKEIAKLKAKEEKKRLESE  220

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LELAL+VEKLQELRSIR+QKLKKQG FLPEEDDKFLE+V+AAVEEEERQA AAA T AAK
Sbjct  221  LELALIVEKLQELRSIRVQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQAKAAADTAAAK  280

Query  555  daianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKIT-------------TSSSEKEH  695
            DAIA AE SRK  QS +P+  D      H N    DKI+             T  +E E 
Sbjct  281  DAIATAEVSRKTIQSQRPEPGDL-----HANTG-DDKISPDQMTVDNDKSGPTPVNELEK  334

Query  696  -GNNGGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQ  872
             G+ G G +S +DSV+NLPMEFYHYYYGSNHD+GTLIEVRRTWD+YIRPGGSRIPGHWVQ
Sbjct  335  VGSKGLGSASLHDSVANLPMEFYHYYYGSNHDLGTLIEVRRTWDAYIRPGGSRIPGHWVQ  394

Query  873  PPPPADEIWASCLVKP  920
            PPPPAD IWAS L KP
Sbjct  395  PPPPADAIWASYLAKP  410



>ref|XP_008232962.1| PREDICTED: trichohyalin [Prunus mume]
Length=391

 Score =   301 bits (770),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 203/301 (67%), Positives = 244/301 (81%), Gaps = 11/301 (4%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LS+EAANAL++ LR +L PFR    E  PWEEKSAA RLSNK+ K KRNK WRK KRKR+
Sbjct  96   LSVEAANALMAKLRVELAPFRAITHEMCPWEEKSAALRLSNKIRKCKRNKRWRKAKRKRI  155

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE  A ER+RFE+AD+EADEWRAREIAKD+A +K+E M +IAK K KEER++LESELE  
Sbjct  156  AEMSAKERERFEEADREADEWRAREIAKDIAKRKMEDMGKIAKLKAKEERKRLESELETV  215

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VEKLQELRSIRI+KLKKQG FLPEEDDKFLERV+AA EEEE+Q + AA   AAKDAIA
Sbjct  216  LIVEKLQELRSIRIEKLKKQGHFLPEEDDKFLERVRAAAEEEEQQVIMAADMDAAKDAIA  275

Query  567  naEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSS-SEKEHG---NNGGGGSSAYDS  734
              E+SRK T++++PDSKD        ++D+ + + +S+ + KE G   + G G S AYD+
Sbjct  276  TVEQSRKTTENFRPDSKDQ-------SSDITNAVPSSAVTNKEPGKQVSQGEGYSGAYDA  328

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLV  914
            V+NLP+EFYHYY+GSN DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPAD+IWAS LV
Sbjct  329  VANLPIEFYHYYHGSNTDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPADDIWASYLV  388

Query  915  K  917
            +
Sbjct  389  Q  389



>ref|XP_007218095.1| hypothetical protein PRUPE_ppa006592mg [Prunus persica]
 gb|EMJ19294.1| hypothetical protein PRUPE_ppa006592mg [Prunus persica]
Length=404

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 201/307 (65%), Positives = 240/307 (78%), Gaps = 10/307 (3%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LS+EAANAL++ L  +L PFR    E  PWEEKSAA RLSNK+ K KRNK WRK KRKR+
Sbjct  96   LSVEAANALMAKLGVELAPFRAITHEMCPWEEKSAALRLSNKIRKCKRNKRWRKAKRKRI  155

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE  A ER+RFE+AD+EADEWRAREIAKD+A +K+E M +IAK K KEER++LESELE  
Sbjct  156  AEMSAKERERFEEADREADEWRAREIAKDIAKRKMEDMGKIAKLKAKEERKRLESELETV  215

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VEKLQELRSIRI+KLKKQG FLPEEDDKFLERV+AAVEEEE+Q + AA   AAKDAIA
Sbjct  216  LIVEKLQELRSIRIEKLKKQGHFLPEEDDKFLERVRAAVEEEEQQVIMAADMDAAKDAIA  275

Query  567  naEESRKATQSYKPDSKD----------AKDEKEHGNNDVKDKITTSSSEKEHGNNGGGG  716
              E+SRK T++++PDSKD          +KD+     + V     T+    +  + G G 
Sbjct  276  TVEQSRKTTENFRPDSKDQSSDRGESRESKDQTISITDAVPSSAVTNKEPGKQVSQGEGY  335

Query  717  SSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEI  896
            S AYD+V+NLP+EFYHYY+GSN DMGTLIEVRRTWD+Y+RPGGSRIPGHWVQPPPPAD+I
Sbjct  336  SGAYDAVANLPIEFYHYYHGSNTDMGTLIEVRRTWDAYLRPGGSRIPGHWVQPPPPADDI  395

Query  897  WASCLVK  917
            WAS LV+
Sbjct  396  WASYLVQ  402



>ref|XP_011037199.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X1 [Populus euphratica]
Length=410

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 217/310 (70%), Positives = 248/310 (80%), Gaps = 11/310 (4%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LS+ AANAL+S LRAQLEPFR+  D+++PWEEKS A RLSNK+ K KRNKLWRKRKR+
Sbjct  101  ESLSVNAANALMSRLRAQLEPFRVIIDDATPWEEKSMAARLSNKILKSKRNKLWRKRKRQ  160

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R AE    E ++F+QAD+  DEWRAREIA+D A  KVEKMKEIAK K KEER++LESELE
Sbjct  161  RAAEIRTKEHEQFDQADRVVDEWRAREIARDAAQLKVEKMKEIAKLKAKEERKRLESELE  220

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRIQK+KKQG FLPEEDDKFLERV+AAVEEEERQAMAAA T AAK A
Sbjct  221  LVLVVEKLQELRSIRIQKMKKQGHFLPEEDDKFLERVRAAVEEEERQAMAAAETDAAKGA  280

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSE----------KEHGNNGG  710
            IA AEESRK  QS  P SKDA D+K+ G  +  D+I  S+             E G+ G 
Sbjct  281  IATAEESRKTIQSGGPHSKDASDDKD-GMKESNDEINKSTDNLGSGAAPGPSGEKGSKGQ  339

Query  711  GGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPAD  890
                AYDSV+NLP+EFYHYY+GSN+DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPAD
Sbjct  340  LYGGAYDSVANLPIEFYHYYHGSNNDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPAD  399

Query  891  EIWASCLVKP  920
            +IWAS LV+P
Sbjct  400  DIWASHLVRP  409



>emb|CDP12671.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   293 bits (751),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 215/313 (69%), Positives = 246/313 (79%), Gaps = 18/313 (6%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            S E+++LEAANAL S LR QLEPFR+ AD  +PWEEKSAA +LS+KL KYKRNK WRKRK
Sbjct  90   SQEMIALEAANALTSRLRVQLEPFRVVADVKAPWEEKSAAVKLSDKLRKYKRNKRWRKRK  149

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            R +VAE LA ER++F++ DKEADEWRA EIAK++A +KVEK+KEIAK K KEE++ LESE
Sbjct  150  RMQVAENLAKEREQFDRIDKEADEWRAGEIAKEIAKRKVEKLKEIAKLKAKEEKKTLESE  209

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LEL L+VEKLQELRS+RIQKLKKQG FLPEEDDKFLERV+AAVEEEERQAMAAA T AAK
Sbjct  210  LELMLIVEKLQELRSLRIQKLKKQGHFLPEEDDKFLERVRAAVEEEERQAMAAADTEAAK  269

Query  555  daianaEESRKATQSYKPDSKDAKDEKEHGNNDVKD-----------KITTSSSEKEHGN  701
            DAIA AEESR   Q+  PDS     EK   NN   D            + T ++ +  G 
Sbjct  270  DAIATAEESR--IQNRGPDS-----EKPSKNNKTVDMMLESEDRRDSTVVTGNASRPRGT  322

Query  702  NGGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPP  881
             G   + AYDS++NLPMEFYHYYYGS  DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPP
Sbjct  323  EGQSSTVAYDSMANLPMEFYHYYYGSKTDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPP  382

Query  882  PADEIWASCLVKP  920
            P+DE WAS LVKP
Sbjct  383  PSDETWASYLVKP  395



>ref|XP_011037213.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X2 [Populus euphratica]
Length=410

 Score =   291 bits (746),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 216/310 (70%), Positives = 247/310 (80%), Gaps = 11/310 (4%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LS+ AANAL+S LRAQLEPFR+  D+++PWEEKS A RLSNK+ K KRNKLWRKRKR+
Sbjct  101  ESLSVNAANALMSRLRAQLEPFRVIIDDATPWEEKSMAARLSNKILKSKRNKLWRKRKRQ  160

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R AE      ++F+QAD+  DEWRAREIA+D A  KVEKMKEIAK K KEER++LESELE
Sbjct  161  RAAEIRTKVHEQFDQADRVVDEWRAREIARDAAQLKVEKMKEIAKLKAKEERKRLESELE  220

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRIQK+KKQG FLPEEDDKFLERV+AAVEEEERQAMAAA T AAK A
Sbjct  221  LVLVVEKLQELRSIRIQKMKKQGHFLPEEDDKFLERVRAAVEEEERQAMAAAETDAAKGA  280

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSE----------KEHGNNGG  710
            IA AEESRK  QS  P SKDA D+K+ G  +  D+I  S+             E G+ G 
Sbjct  281  IATAEESRKTIQSGGPHSKDASDDKD-GMKESNDEINKSTDNLGSGAAPGPSGEKGSKGQ  339

Query  711  GGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPAD  890
                AYDSV+NLP+EFYHYY+GSN+DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPAD
Sbjct  340  LYGGAYDSVANLPIEFYHYYHGSNNDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPAD  399

Query  891  EIWASCLVKP  920
            +IWAS LV+P
Sbjct  400  DIWASHLVRP  409



>gb|KDO86336.1| hypothetical protein CISIN_1g015417mg [Citrus sinensis]
 gb|KDO86337.1| hypothetical protein CISIN_1g015417mg [Citrus sinensis]
Length=403

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 215/308 (70%), Positives = 244/308 (79%), Gaps = 15/308 (5%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LS+EAAN  +  LR QLEPFR  ADE++PWEEKSAA RL+NK  K KRNKLWRKRKRK V
Sbjct  100  LSVEAANYFMGKLRVQLEPFRFVADETTPWEEKSAAIRLANKARKSKRNKLWRKRKRKCV  159

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE LA + +RFEQAD+EADEWRAREIAKD+A +KVEKM EIAK K +EE++KLESELEL 
Sbjct  160  AEMLAKKHERFEQADREADEWRAREIAKDMAKRKVEKMNEIAKLKAREEKKKLESELELV  219

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VEKLQELRSIRI+KLKKQG FLPEEDDKFLERV+AAVEEEERQA+AAA T AA+DAIA
Sbjct  220  LVVEKLQELRSIRIRKLKKQGHFLPEEDDKFLERVRAAVEEEERQALAAADTDAARDAIA  279

Query  567  naEESRKATQSYKPDSKDAKDEKEHGNNDV----KDKITTSSSEKEHGNNGGGGS-----  719
             AEESRKA Q+ +P  KD         +DV    KD ++ S   +E  +N   GS     
Sbjct  280  TAEESRKAIQNSEPLLKDG-----SCIDDVIKENKDGVSESKYLRETSDNADKGSVRPGY  334

Query  720  -SAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEI  896
               YD VSNLPMEFYHYY+GSN D+GTLI VRRTWD+YIRPGGSRIPGHWVQPPPP+DEI
Sbjct  335  AGVYDHVSNLPMEFYHYYHGSNTDVGTLIGVRRTWDAYIRPGGSRIPGHWVQPPPPSDEI  394

Query  897  WASCLVKP  920
            WAS LV P
Sbjct  395  WASYLVMP  402



>ref|XP_006444931.1| hypothetical protein CICLE_v10020434mg [Citrus clementina]
 ref|XP_006444932.1| hypothetical protein CICLE_v10020434mg [Citrus clementina]
 ref|XP_006491201.1| PREDICTED: stress response protein NST1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006491202.1| PREDICTED: stress response protein NST1-like isoform X2 [Citrus 
sinensis]
 gb|ESR58171.1| hypothetical protein CICLE_v10020434mg [Citrus clementina]
 gb|ESR58172.1| hypothetical protein CICLE_v10020434mg [Citrus clementina]
Length=403

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 214/308 (69%), Positives = 244/308 (79%), Gaps = 15/308 (5%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LS+EAAN  +  LR QLEPFR  ADE++PWEEKSAA RL+NK  K KRNKLWRKRKRK V
Sbjct  100  LSVEAANYFMGKLRVQLEPFRFVADETTPWEEKSAAIRLANKARKSKRNKLWRKRKRKCV  159

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE LA + +RFEQAD+EADEWRAREIAKD+A +KVEKM EIAK K +EE++KLESELEL 
Sbjct  160  AEMLAKKHERFEQADREADEWRAREIAKDMAKRKVEKMNEIAKLKAREEKKKLESELELV  219

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VEKLQELRSIRI+KLKKQG FLPEEDDKFLERV+AAVEEEERQA+AAA T AA+DAIA
Sbjct  220  LVVEKLQELRSIRIRKLKKQGHFLPEEDDKFLERVRAAVEEEERQALAAADTDAARDAIA  279

Query  567  naEESRKATQSYKPDSKDAKDEKEHGNNDV----KDKITTSSSEKEHGNNGGGGSS----  722
             AEESRKA Q+ +P  KD         +DV    KD ++ S   +E  +N   GS     
Sbjct  280  TAEESRKAIQNSEPLLKDG-----SCIDDVIKENKDGVSESKYLRETSDNADKGSGRPGY  334

Query  723  --AYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEI  896
               YD VSNLPMEFYHYY+GSN+D+GTLI VRRTWD+YIRPGG RIPGHWVQPPPP+DEI
Sbjct  335  AGVYDHVSNLPMEFYHYYHGSNNDVGTLIGVRRTWDAYIRPGGGRIPGHWVQPPPPSDEI  394

Query  897  WASCLVKP  920
            WAS LV P
Sbjct  395  WASYLVMP  402



>gb|EYU32183.1| hypothetical protein MIMGU_mgv1a004962mg [Erythranthe guttata]
Length=502

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 210/310 (68%), Positives = 253/310 (82%), Gaps = 14/310 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LSL AANA++S LR QLEP+R+  DE+SPWEEKSA +RL++K++KYKRNKLWR+RKR+
Sbjct  196  ESLSLNAANAVMSKLRYQLEPYRVVTDENSPWEEKSAVKRLADKMEKYKRNKLWRRRKRR  255

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+A+ LA ER++F++ DKEADEWRARE+AKD A +KV+KMKEIAK K KEE+++LESELE
Sbjct  256  RIAQNLAKEREQFDRLDKEADEWRAREMAKDAAQRKVDKMKEIAKVKAKEEKKRLESELE  315

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRI+KLKKQG F PEEDDKFLE+V+AAVEEEERQ+MAAA T AAKDA
Sbjct  316  LVLIVEKLQELRSIRIEKLKKQGHFFPEEDDKFLEQVRAAVEEEERQSMAAADTDAAKDA  375

Query  561  ianaEESRKATQSYKPDSKDA----------KDEKEHGNNDVKDKITTSSSEKEHGNNGG  710
            IANAEESRK   S+ P S++           +D+K    N+   K+  +   ++   +G 
Sbjct  376  IANAEESRKHVDSHVPGSEELGLSNFEHIKNQDQKNETANEKDSKLAATKESRKIDTSG-  434

Query  711  GGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPAD  890
               SAYDSVSNLPMEFYHYY+GSN DMGTLIEVRR WD+Y+RPGGSRIPGHWVQPPPPAD
Sbjct  435  ---SAYDSVSNLPMEFYHYYHGSNTDMGTLIEVRRMWDAYLRPGGSRIPGHWVQPPPPAD  491

Query  891  EIWASCLVKP  920
            EIWAS LVKP
Sbjct  492  EIWASYLVKP  501



>ref|XP_003540691.1| PREDICTED: caldesmon-like [Glycine max]
Length=406

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 208/308 (68%), Positives = 248/308 (81%), Gaps = 6/308 (2%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            S E L++EAAN+L+S LRAQLEPFR  ADE+SPWEEKSA  RL+NK++K KRNKLWRK+K
Sbjct  98   SQESLAVEAANSLMSRLRAQLEPFRYVADEASPWEEKSAVARLANKVNKSKRNKLWRKKK  157

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RKRV E LA E ++FEQ D+EADEW ARE AK++AN KV KMKEIAK K KEE++K+E+E
Sbjct  158  RKRVVEMLAKEHEQFEQIDREADEWIAREHAKEIANSKVLKMKEIAKSKAKEEKKKVEAE  217

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            +EL L+VEKLQELRSIRIQKLKKQG FLPEEDDKFLE+V+AAVEEEER+A+AA  T AAK
Sbjct  218  IELLLVVEKLQELRSIRIQKLKKQGHFLPEEDDKFLEKVQAAVEEEEREALAAVETDAAK  277

Query  555  daianaEESRKATQSYKPDSK------DAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGG  716
            DAIA AEESRKA Q+    SK      + K+ KE     V ++ + +  EK+    G   
Sbjct  278  DAIATAEESRKAIQNQGKLSKGSNYDSEVKERKELTVQSVTEEGSGAVDEKKSSKIGQIS  337

Query  717  SSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEI  896
              AYD ++NLP+EFYHYY+GSN+DMGTLIEVRR WD+YIRPGGSRIPGHWVQPPPPA+EI
Sbjct  338  GGAYDPLANLPIEFYHYYHGSNNDMGTLIEVRRGWDAYIRPGGSRIPGHWVQPPPPANEI  397

Query  897  WASCLVKP  920
            WAS LV+P
Sbjct  398  WASYLVRP  405



>gb|EYU26309.1| hypothetical protein MIMGU_mgv1a003657mg [Erythranthe guttata]
Length=571

 Score =   291 bits (745),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 212/311 (68%), Positives = 253/311 (81%), Gaps = 15/311 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LSL AANA++S LR QLEP+R+  DE+SPWEEKSA +RL++K++KYKRNKLWR+RKR+
Sbjct  264  ESLSLNAANAVMSKLRYQLEPYRVVMDENSPWEEKSAVKRLADKMEKYKRNKLWRRRKRR  323

Query  201  rVAEKLA-MERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesel  377
            R+A+ LA +ER++F++ DKEADEWRARE+AKD A +KVEKMKEIAK K KEE+++LESEL
Sbjct  324  RIAQNLAKVEREQFDRLDKEADEWRAREMAKDAAQRKVEKMKEIAKVKAKEEKKRLESEL  383

Query  378  elALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakd  557
            EL L+VEKLQEL SIRI+KLKKQG F PEEDDKFLERV+AAVEEEERQ+MAAA T AAKD
Sbjct  384  ELVLIVEKLQELHSIRIEKLKKQGHFFPEEDDKFLERVRAAVEEEERQSMAAADTDAAKD  443

Query  558  aianaEESRKATQSYKPDSKD----------AKDEKEHGNNDVKDKITTSSSEKEHGNNG  707
            AIANAEESRK   S+ PDS++           +D+K    N+   K+  +   ++    G
Sbjct  444  AIANAEESRKHVNSHAPDSEERGLSNFQHIKNQDQKNETANEKDSKLVATKESRKIDTTG  503

Query  708  GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPA  887
                SAYDSV NLPMEFYHYY+GSN DMGTLIEVRRTWD+Y+RPGGSRIPGHWVQPPPPA
Sbjct  504  ----SAYDSVCNLPMEFYHYYHGSNTDMGTLIEVRRTWDAYLRPGGSRIPGHWVQPPPPA  559

Query  888  DEIWASCLVKP  920
            DEIWAS LVKP
Sbjct  560  DEIWASYLVKP  570



>ref|XP_006444930.1| hypothetical protein CICLE_v10020434mg [Citrus clementina]
 ref|XP_006444933.1| hypothetical protein CICLE_v10020434mg [Citrus clementina]
 gb|ESR58170.1| hypothetical protein CICLE_v10020434mg [Citrus clementina]
 gb|ESR58173.1| hypothetical protein CICLE_v10020434mg [Citrus clementina]
Length=402

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 214/308 (69%), Positives = 244/308 (79%), Gaps = 16/308 (5%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LS+EAAN  +  LR QLEPFR  ADE++PWEEKSAA RL+NK  K KRNKLWRKRKRK V
Sbjct  100  LSVEAANYFMGKLRVQLEPFRFVADETTPWEEKSAAIRLANKARKSKRNKLWRKRKRKCV  159

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE LA + +RFEQAD+EADEWRAREIAKD+A +KVEKM EIAK K +EE++KLESELEL 
Sbjct  160  AEMLA-KHERFEQADREADEWRAREIAKDMAKRKVEKMNEIAKLKAREEKKKLESELELV  218

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VEKLQELRSIRI+KLKKQG FLPEEDDKFLERV+AAVEEEERQA+AAA T AA+DAIA
Sbjct  219  LVVEKLQELRSIRIRKLKKQGHFLPEEDDKFLERVRAAVEEEERQALAAADTDAARDAIA  278

Query  567  naEESRKATQSYKPDSKDAKDEKEHGNNDV----KDKITTSSSEKEHGNNGGGGSS----  722
             AEESRKA Q+ +P  KD         +DV    KD ++ S   +E  +N   GS     
Sbjct  279  TAEESRKAIQNSEPLLKDGS-----CIDDVIKENKDGVSESKYLRETSDNADKGSGRPGY  333

Query  723  --AYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEI  896
               YD VSNLPMEFYHYY+GSN+D+GTLI VRRTWD+YIRPGG RIPGHWVQPPPP+DEI
Sbjct  334  AGVYDHVSNLPMEFYHYYHGSNNDVGTLIGVRRTWDAYIRPGGGRIPGHWVQPPPPSDEI  393

Query  897  WASCLVKP  920
            WAS LV P
Sbjct  394  WASYLVMP  401



>ref|XP_010092880.1| Programmed cell death protein 7 [Morus notabilis]
 gb|EXB52698.1| Programmed cell death protein 7 [Morus notabilis]
Length=409

 Score =   283 bits (725),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 213/309 (69%), Positives = 244/309 (79%), Gaps = 11/309 (4%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LS+EAAN L+S LR QLEPFR   DE   WEEKS   RL+NK+ K KRNKLWRKRKRKR+
Sbjct  100  LSVEAANCLMSKLRFQLEPFRAVTDEMCQWEEKSVVVRLANKIQKSKRNKLWRKRKRKRI  159

Query  207  AEKLAM-ERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselel  383
            AE  AM ER +++QAD+EADEWRAREIA D+A +K+EKMKEIAK K KEER KLESELEL
Sbjct  160  AEMRAMVERAKYDQADQEADEWRAREIANDLAKRKMEKMKEIAKLKAKEERNKLESELEL  219

Query  384  ALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdai  563
             L+VEKLQELRSIRI KLKKQG FLPEEDDKFLERV+AAVEEEERQA+AA  T  AKDAI
Sbjct  220  VLIVEKLQELRSIRIHKLKKQGHFLPEEDDKFLERVQAAVEEEERQAIAAVDTDYAKDAI  279

Query  564  anaEESRKATQSYKPDSKD-AKDEKEHGNNDVKDKIT------TSSSEKEHGNNG---GG  713
            A AEESRK T +  PDS+D + D      N+V+D  +      ++  EKE G  G     
Sbjct  280  ATAEESRKTTYNLVPDSEDLSTDRAIIAENNVQDTPSKNDGDPSAPVEKESGKQGLETQV  339

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADE  893
             S AYDSV+NLP+EFYHYY+GSN+DMGTLIEVRRTWD+YIRPGGS IPGHWV+PPPPA+E
Sbjct  340  HSGAYDSVANLPIEFYHYYHGSNNDMGTLIEVRRTWDAYIRPGGSCIPGHWVEPPPPANE  399

Query  894  IWASCLVKP  920
            IWAS LV+P
Sbjct  400  IWASYLVRP  408



>ref|XP_008384542.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
[Malus domestica]
Length=403

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 246/308 (80%), Gaps = 10/308 (3%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LSLEAANAL++ L+ +LEPFR+   E  PWEEKSA  RL+NK+ K KRNK WRK KRKR+
Sbjct  95   LSLEAANALMAKLQVELEPFRMITHEMCPWEEKSAVVRLANKMRKTKRNKRWRKAKRKRI  154

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE +A ER+RFE+AD+EADEWRAREIAKD+A +K+E MK+IAK K KEER++LESELE  
Sbjct  155  AEMIAEERERFEEADREADEWRAREIAKDIAKRKMEDMKKIAKLKAKEERKRLESELETV  214

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VEKLQ+LRSIRI+KLKKQG FLPEEDDKFLE+V+AAVEEEE+Q + AA   AAKDAIA
Sbjct  215  LIVEKLQQLRSIRIEKLKKQGHFLPEEDDKFLEKVRAAVEEEEQQVILAADMDAAKDAIA  274

Query  567  naEESRKATQSYKPDSKD-------AKDEKEHGNNDVKDKITTSSSEKEHG---NNGGGG  716
              E+SRK T++ +PDSKD        K+ K+          +TS + K++G   + G G 
Sbjct  275  TVEQSRKITENVRPDSKDESSDRDETKESKDQTTPSTNAGTSTSVTNKDYGKQVSQGEGH  334

Query  717  SSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEI  896
            S AYD+V NLP+EFYHYY+GSN DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPAD+I
Sbjct  335  SGAYDAVVNLPIEFYHYYHGSNTDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPADDI  394

Query  897  WASCLVKP  920
            WAS LV+P
Sbjct  395  WASYLVQP  402



>ref|XP_009338789.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X2 [Pyrus x bretschneideri]
Length=346

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 202/308 (66%), Positives = 247/308 (80%), Gaps = 10/308 (3%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LS+EAANAL++ L+ +LEPFR+   E  PWEEKSA  RL+NK+ K KRNK WRK KRKR+
Sbjct  38   LSVEAANALMAKLQVELEPFRMITHEMCPWEEKSAVVRLANKMHKTKRNKRWRKAKRKRI  97

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE +A ER+RFE+AD+EADEWRAREIAKD+A +K+E MK+IAK K KEER++LESELE  
Sbjct  98   AEMIAEERERFEEADREADEWRAREIAKDIAKRKMEDMKKIAKLKAKEERKRLESELETV  157

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VEKLQ+LRSIRI+KLKKQG FLPEEDDK+LE+V+AAVEEEE+Q + AA   AAKDAIA
Sbjct  158  LIVEKLQQLRSIRIEKLKKQGHFLPEEDDKYLEKVRAAVEEEEQQVILAADMDAAKDAIA  217

Query  567  naEESRKATQSYKPDSKD-------AKDEKEHGNNDVKDKITTSSSEKEHG---NNGGGG  716
              E+SRK T++ +PDSKD        K+ K+          +TS + K++G   + G G 
Sbjct  218  TVEQSRKITENVRPDSKDESSDRDETKESKDQTTPSTNAGTSTSVTNKDYGKQVSQGEGH  277

Query  717  SSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEI  896
            S AYD+V+NLP+EFYHYY+GSN DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPAD+I
Sbjct  278  SGAYDAVANLPIEFYHYYHGSNTDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPADDI  337

Query  897  WASCLVKP  920
            WAS LV+P
Sbjct  338  WASYLVQP  345



>ref|XP_002320830.1| hypothetical protein POPTR_0014s08710g [Populus trichocarpa]
 gb|EEE99145.1| hypothetical protein POPTR_0014s08710g [Populus trichocarpa]
Length=398

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 211/303 (70%), Positives = 238/303 (79%), Gaps = 9/303 (3%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LS+ AANAL+S L+AQLEPFR+  D+ +PWEEKS A RLSNK+ K KRNKLWRKRKR+
Sbjct  101  ESLSVNAANALMSRLKAQLEPFRVIIDDVTPWEEKSMAARLSNKILKSKRNKLWRKRKRQ  160

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R AE      ++F+QAD+ ADEWRAREIAKD A  KVEKMKEIAK K KEER++LESELE
Sbjct  161  RAAEIHTKVHEQFDQADRVADEWRAREIAKDAAQLKVEKMKEIAKLKAKEERKRLESELE  220

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRIQKLKKQG FLPEEDDKFLERV+AAVEEEERQAMAAA T AAK A
Sbjct  221  LVLVVEKLQELRSIRIQKLKKQGHFLPEEDDKFLERVRAAVEEEERQAMAAAETDAAKGA  280

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGG---SSAYD  731
            IA AEESRK  QS      D   E     N+  D + + +     G  G  G     AYD
Sbjct  281  IATAEESRKTIQS------DGMKESNDEINESTDNLGSGAVPGPSGEKGSKGQVYGGAYD  334

Query  732  SVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCL  911
            SV+NLP+EFYHYY+GSN+DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPAD+IWAS L
Sbjct  335  SVANLPIEFYHYYHGSNNDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPADDIWASYL  394

Query  912  VKP  920
            V+P
Sbjct  395  VRP  397



>ref|XP_002511932.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50601.1| conserved hypothetical protein [Ricinus communis]
Length=413

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 213/309 (69%), Positives = 245/309 (79%), Gaps = 12/309 (4%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LSL+AAN+L+S LRAQLEPFR   DE+SPWEEKSA  RL  K+ K KRNKLWRKRKRK
Sbjct  105  ESLSLDAANSLMSKLRAQLEPFRSLVDEASPWEEKSALVRLHEKMLKSKRNKLWRKRKRK  164

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            RVAE  A + ++F+QAD+EADE RAREIAKD A  K+ KMKEIAK K KEER++LESELE
Sbjct  165  RVAEMRAKKPEQFDQADREADECRAREIAKDAAQLKMAKMKEIAKLKAKEERKRLESELE  224

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L LMVEKLQELRSIRIQKLKKQG FLP+EDD+FLERV+AAVEEEERQA+AAA T AAK A
Sbjct  225  LVLMVEKLQELRSIRIQKLKKQGHFLPKEDDEFLERVRAAVEEEERQAVAAADTDAAKGA  284

Query  561  ianaEESRKATQSYKP----------DSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGG  710
            IA AEESRKA QS  P          ++K++K +     + V   + T  SE+     G 
Sbjct  285  IATAEESRKAIQSLAPISKNSNADNGETKESKSKVTESKDSVDSVVVTGPSEER--AEGQ  342

Query  711  GGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPAD  890
              S AYDSV+NLP+EFYHYY+GSN+DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPA+
Sbjct  343  SYSGAYDSVANLPVEFYHYYHGSNNDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPAN  402

Query  891  EIWASCLVK  917
            EIWAS LV+
Sbjct  403  EIWASYLVR  411



>ref|XP_010032151.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Eucalyptus grandis]
 gb|KCW51553.1| hypothetical protein EUGRSUZ_J01063 [Eucalyptus grandis]
 gb|KCW51554.1| hypothetical protein EUGRSUZ_J01063 [Eucalyptus grandis]
Length=411

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 205/310 (66%), Positives = 247/310 (80%), Gaps = 10/310 (3%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E+ SLEAA++LI  L AQLEPFR  ADE+SPWEEKSA  RLS+KL K +RNKLWRKRKR+
Sbjct  101  EMRSLEAASSLILKLSAQLEPFRAVADEASPWEEKSAVHRLSSKLSKSRRNKLWRKRKRR  160

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            RVAE+   ER+RF+QAD++ADEWRAREIAKD+A +K+EKMKEIAK K KEERR+LESELE
Sbjct  161  RVAEQQLKERERFDQADQDADEWRAREIAKDIARRKIEKMKEIAKLKAKEERRRLESELE  220

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRS+R++KLKKQG FLPEED++FLERV+ AVEEEE QA  AA   AA+DA
Sbjct  221  LVLIVEKLQELRSMRVRKLKKQGHFLPEEDNEFLERVRVAVEEEESQARIAADADAARDA  280

Query  561  ianaEESRK---ATQSYKPDSKDAKDEKEHGNNDVKDK------ITTSSSE-KEHGNNGG  710
            IA AEESRK   AT+S   D  D   +K    +++ D+      +T S +E K+   +G 
Sbjct  281  IATAEESRKTADATESDLKDQNDVTHQKLENKDEITDEEGNISSLTGSHNEYKKEAPDGK  340

Query  711  GGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPAD  890
                +YD+++NLP+EFYHYY+GSN DMGTLIEVRRTWD Y+R GGSRIPGHWVQPPPPAD
Sbjct  341  THIGSYDALANLPIEFYHYYHGSNTDMGTLIEVRRTWDVYLRRGGSRIPGHWVQPPPPAD  400

Query  891  EIWASCLVKP  920
            E+WAS LVKP
Sbjct  401  EVWASYLVKP  410



>ref|XP_009338788.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   281 bits (718),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 202/308 (66%), Positives = 247/308 (80%), Gaps = 10/308 (3%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LS+EAANAL++ L+ +LEPFR+   E  PWEEKSA  RL+NK+ K KRNK WRK KRKR+
Sbjct  95   LSVEAANALMAKLQVELEPFRMITHEMCPWEEKSAVVRLANKMHKTKRNKRWRKAKRKRI  154

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE +A ER+RFE+AD+EADEWRAREIAKD+A +K+E MK+IAK K KEER++LESELE  
Sbjct  155  AEMIAEERERFEEADREADEWRAREIAKDIAKRKMEDMKKIAKLKAKEERKRLESELETV  214

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VEKLQ+LRSIRI+KLKKQG FLPEEDDK+LE+V+AAVEEEE+Q + AA   AAKDAIA
Sbjct  215  LIVEKLQQLRSIRIEKLKKQGHFLPEEDDKYLEKVRAAVEEEEQQVILAADMDAAKDAIA  274

Query  567  naEESRKATQSYKPDSKD-------AKDEKEHGNNDVKDKITTSSSEKEHG---NNGGGG  716
              E+SRK T++ +PDSKD        K+ K+          +TS + K++G   + G G 
Sbjct  275  TVEQSRKITENVRPDSKDESSDRDETKESKDQTTPSTNAGTSTSVTNKDYGKQVSQGEGH  334

Query  717  SSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEI  896
            S AYD+V+NLP+EFYHYY+GSN DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPAD+I
Sbjct  335  SGAYDAVANLPIEFYHYYHGSNTDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPADDI  394

Query  897  WASCLVKP  920
            WAS LV+P
Sbjct  395  WASYLVQP  402



>ref|XP_010669704.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010669708.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Beta vulgaris subsp. vulgaris]
Length=410

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 246/309 (80%), Gaps = 12/309 (4%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            +L+S+E AN ++S LR  LEPFR+  D+  PWEEKS+  RLS+K++K KRNKLWRK+KR+
Sbjct  103  QLISVEVANGVMSKLRFLLEPFRVVTDDGIPWEEKSSVVRLSDKINKSKRNKLWRKKKRR  162

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            RVAE LA + ++FE+ ++EADEWRA+EIAKD+A QKVEKMK IAK+K KEER+KL++EL+
Sbjct  163  RVAELLAKKGEQFEKLNREADEWRAKEIAKDMAQQKVEKMKGIAKQKAKEERKKLKAELD  222

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LALMVEKLQELRSIRIQKLKKQG FLPEEDDKFLERV+AAVEEEERQA AAA T AAKDA
Sbjct  223  LALMVEKLQELRSIRIQKLKKQGHFLPEEDDKFLERVQAAVEEEERQAKAAAATDAAKDA  282

Query  561  ianaEESRKATQSYKPD-----SKDAKDEKEHGNNDVKDKI-----TTSSSEKEHGNNGG  710
            IA AEESRK TQ  K D     SKD  DEKE   +  K  +     T+  SEK+  +   
Sbjct  283  IAAAEESRKVTQGTKLDTEDENSKDDGDEKEEQRSQSKSGLASHASTSKDSEKQGFDRLN  342

Query  711  GGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPAD  890
             G  AYD V+NLP EFYHYY+GS  DMGTLIEVRR WD+YIRPGGSRIPGHWVQPPPPAD
Sbjct  343  HG--AYDYVANLPPEFYHYYHGSTTDMGTLIEVRRAWDAYIRPGGSRIPGHWVQPPPPAD  400

Query  891  EIWASCLVK  917
            ++WAS LV+
Sbjct  401  DVWASYLVQ  409



>gb|KHN25314.1| Programmed cell death protein 7 [Glycine soja]
Length=406

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 209/308 (68%), Positives = 248/308 (81%), Gaps = 6/308 (2%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            S E L++EAAN+L+S LRAQLEPFR  ADE+SPWEEKSA  RL+NK++K KRNKLWRK+K
Sbjct  98   SQESLAVEAANSLMSRLRAQLEPFRYVADEASPWEEKSAVARLANKVNKSKRNKLWRKKK  157

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RKRV E LA E ++FEQ D+EADEW ARE AK++AN KV KMKEIAK K KEE++K+E+E
Sbjct  158  RKRVVEMLAKEHEQFEQIDREADEWIAREHAKEIANSKVLKMKEIAKSKAKEEKKKVEAE  217

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LEL L+VEKLQELRSIRIQKLKKQG FLPEEDDKFLE+V+AAVEEEER+A+AA  T AAK
Sbjct  218  LELLLVVEKLQELRSIRIQKLKKQGHFLPEEDDKFLEKVQAAVEEEEREALAAVETDAAK  277

Query  555  daianaEESRKATQSYKPDSK------DAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGG  716
            DAIA AEESRKA Q+    SK      + K+ KE     V ++ + +  EK+    G   
Sbjct  278  DAIATAEESRKAIQNQGKLSKGSNYDSEVKERKEPTVQSVTEEGSGAVDEKKSSKIGQIS  337

Query  717  SSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEI  896
              AYD ++NLP+EFYHYY+GSN+DMGTLIEVRR WD+YIRPGGSRIPGHWVQPPPPA+EI
Sbjct  338  GGAYDPLANLPIEFYHYYHGSNNDMGTLIEVRRGWDAYIRPGGSRIPGHWVQPPPPANEI  397

Query  897  WASCLVKP  920
            WAS LV+P
Sbjct  398  WASYLVRP  405



>gb|KDP28550.1| hypothetical protein JCGZ_14321 [Jatropha curcas]
Length=422

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 239/320 (75%), Gaps = 21/320 (7%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LSL+AA +L+S LRAQLEPFR   DE+S WE+KS A RLSNK+ K KRNKLWRK+KRK
Sbjct  102  ESLSLDAACSLMSKLRAQLEPFRPLIDEASNWEDKSVAIRLSNKMLKSKRNKLWRKKKRK  161

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+AE  A  +++F+QAD+EAD+W AREIAKD A  KV KMKEIAK K KEER++LESELE
Sbjct  162  RIAEMGAKVQEQFDQADREADDWMAREIAKDAAQLKVGKMKEIAKLKVKEERKRLESELE  221

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQ----------ama  530
            L L+VEKLQELRS+RIQKLKKQG FLPEEDDKFLERV+AAVEEEERQ            A
Sbjct  222  LVLIVEKLQELRSMRIQKLKKQGHFLPEEDDKFLERVRAAVEEEERQAIAAADTDAAKDA  281

Query  531  aagtgaakdaianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSE--------  686
             A    ++    N+EESRK+TQ++ P SKD+ D+   G  ++K K+  S           
Sbjct  282  IATAEESRKTSQNSEESRKSTQNHGPISKDSSDDN-VGTKEIKGKVIESKDNIGSGAVTG  340

Query  687  --KEHGNNGGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPG  860
              +E G      S  YDSV+NLP EFYHYY+GSN+DMGTLIEVRRTWD+YIRPGGSRIPG
Sbjct  341  PSEERGTKVQSYSKTYDSVANLPTEFYHYYHGSNNDMGTLIEVRRTWDAYIRPGGSRIPG  400

Query  861  HWVQPPPPADEIWASCLVKP  920
            HWVQ PPPAD+IWAS LV+P
Sbjct  401  HWVQAPPPADDIWASYLVRP  420



>ref|XP_004306724.1| PREDICTED: uncharacterized protein LOC101305592 [Fragaria vesca 
subsp. vesca]
Length=432

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 241/307 (79%), Gaps = 8/307 (3%)
 Frame = +3

Query  24   LLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkr  203
            L S+EAAN++++ LR ++EPFR    E  PWEEKSAA RLSNK+ K KRNK WRKRKRKR
Sbjct  125  LRSVEAANSVMAKLRVEIEPFRSITHEMCPWEEKSAAVRLSNKICKSKRNKGWRKRKRKR  184

Query  204  VAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselel  383
            +AE +A ER+ F++AD++ADEWRAREIA+D+A +K+E MK+IA  K KEER++LESELE 
Sbjct  185  IAEMIAKEREGFDEADRKADEWRAREIAQDIAKRKMEDMKKIASLKAKEERKRLESELET  244

Query  384  ALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdai  563
             L+VEKLQELRSIRI+K+KKQG  LP+E+DKF+ERV+A VEEE+ QA+ AA   AA+DAI
Sbjct  245  VLIVEKLQELRSIRIEKMKKQGHLLPKENDKFVERVQARVEEEDHQAILAADMDAARDAI  304

Query  564  anaEESRKATQSYKPDS-KDAKDEKEHGNNDVKDKI----TTSSSEKEHGNN---GGGGS  719
            A AE+SR  T++++PDS  + K E E         I    +T+ + KE G       G S
Sbjct  305  ATAEKSRNTTENFRPDSINNNKGENEESKGQTIQSINESESTAIANKESGKQVLQREGVS  364

Query  720  SAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIW  899
             AYD+V+NLPMEFYHYY+GSN DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPAD+IW
Sbjct  365  GAYDAVANLPMEFYHYYHGSNTDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPADDIW  424

Query  900  ASCLVKP  920
            AS L++P
Sbjct  425  ASYLLQP  431



>ref|XP_008437979.1| PREDICTED: tropomyosin alpha-1 chain isoform X2 [Cucumis melo]
Length=347

 Score =   275 bits (702),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 239/305 (78%), Gaps = 15/305 (5%)
 Frame = +3

Query  30   SLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrVA  209
            S+EAA  L+  LRAQL+PFR+  DESS WE    A RLS KL K KRNK WRKRKRKR+A
Sbjct  45   SVEAAAGLMEKLRAQLQPFRLDTDESSLWE----AVRLSGKLSKAKRNKQWRKRKRKRIA  100

Query  210  EKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelAL  389
            E LA ER+ F+Q D EADEWRAREIAKD+A +KVEKMKEIA+ K KEE++KL+SELELAL
Sbjct  101  ESLAKERESFDQVDMEADEWRAREIAKDIAKRKVEKMKEIARIKAKEEKKKLDSELELAL  160

Query  390  MVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaian  569
            +VEKLQELRSIRIQKLKKQG FLPEEDDKFLE+V+AAVEEEERQA+AAA T AAKDAIA 
Sbjct  161  IVEKLQELRSIRIQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQALAAADTDAAKDAIAT  220

Query  570  aEESRKATQSYKPDSKD---AKDEKE----HGNNDVKDKITTSSSEKEHGNNGG---GGS  719
            AE SRK   +Y P+S+D   A D  E      +    DK++ +S+ KE G   G   G  
Sbjct  221  AEVSRKTVPTY-PESRDPDSATDRSEERIDQRSAGADDKVSNTSTNKEPGKQFGEVQGYG  279

Query  720  SAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIW  899
              YD  +NLPMEFYHYYYGSN DMGTLIEVRR+WD++IRPGGSRIPGHWV+PPPPADEIW
Sbjct  280  RMYDYAANLPMEFYHYYYGSNTDMGTLIEVRRSWDAFIRPGGSRIPGHWVEPPPPADEIW  339

Query  900  ASCLV  914
            A+ LV
Sbjct  340  AAYLV  344



>ref|XP_007131925.1| hypothetical protein PHAVU_011G052300g [Phaseolus vulgaris]
 gb|ESW03919.1| hypothetical protein PHAVU_011G052300g [Phaseolus vulgaris]
Length=407

 Score =   275 bits (704),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 205/308 (67%), Positives = 247/308 (80%), Gaps = 6/308 (2%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            S E  ++EAAN+L+S LRAQLEPFR  ADE+SPWEEKSA  RL+NK++K KRNKLWRK+K
Sbjct  99   SLESFAVEAANSLMSKLRAQLEPFRYVADETSPWEEKSAVARLANKVNKSKRNKLWRKKK  158

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RKRVAE +A E ++FEQ D+EAD+W ARE AK++AN KV KMKEIAK K KEE++KLE+E
Sbjct  159  RKRVAELIAKEHEKFEQMDREADDWIAREKAKEIANSKVLKMKEIAKSKAKEEKKKLEAE  218

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LEL L+VEKLQELRSIRIQ+LKKQG FLPEEDDKFL+RV+AAVEEEER+A+AA    AAK
Sbjct  219  LELLLVVEKLQELRSIRIQRLKKQGHFLPEEDDKFLDRVQAAVEEEEREALAALEADAAK  278

Query  555  daianaEESRKATQSYKPDSKDAKDEKEHGNN------DVKDKITTSSSEKEHGNNGGGG  716
            +AIA AEESRKA Q+    SK + D+ E  +N       V ++ + +  E +    G   
Sbjct  279  EAIATAEESRKAIQNQGKLSKGSNDDSEVKDNTEQIDPSVTEEGSGAFDENKSSKIGQIS  338

Query  717  SSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEI  896
              AYD ++NLP+EFYHYYYGSN+DMGTLIEVRR WD+YIRPGGSRIPGHWVQPPPPA+EI
Sbjct  339  GGAYDPLANLPIEFYHYYYGSNNDMGTLIEVRRGWDAYIRPGGSRIPGHWVQPPPPANEI  398

Query  897  WASCLVKP  920
            WAS LV+P
Sbjct  399  WASYLVRP  406



>ref|XP_008437978.1| PREDICTED: tropomyosin alpha-1 chain isoform X1 [Cucumis melo]
Length=406

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 239/305 (78%), Gaps = 15/305 (5%)
 Frame = +3

Query  30   SLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrVA  209
            S+EAA  L+  LRAQL+PFR+  DESS WE    A RLS KL K KRNK WRKRKRKR+A
Sbjct  104  SVEAAAGLMEKLRAQLQPFRLDTDESSLWE----AVRLSGKLSKAKRNKQWRKRKRKRIA  159

Query  210  EKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelAL  389
            E LA ER+ F+Q D EADEWRAREIAKD+A +KVEKMKEIA+ K KEE++KL+SELELAL
Sbjct  160  ESLAKERESFDQVDMEADEWRAREIAKDIAKRKVEKMKEIARIKAKEEKKKLDSELELAL  219

Query  390  MVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaian  569
            +VEKLQELRSIRIQKLKKQG FLPEEDDKFLE+V+AAVEEEERQA+AAA T AAKDAIA 
Sbjct  220  IVEKLQELRSIRIQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQALAAADTDAAKDAIAT  279

Query  570  aEESRKATQSYKPDSKD---AKDEKE----HGNNDVKDKITTSSSEKEHGNNGG---GGS  719
            AE SRK   +Y P+S+D   A D  E      +    DK++ +S+ KE G   G   G  
Sbjct  280  AEVSRKTVPTY-PESRDPDSATDRSEERIDQRSAGADDKVSNTSTNKEPGKQFGEVQGYG  338

Query  720  SAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIW  899
              YD  +NLPMEFYHYYYGSN DMGTLIEVRR+WD++IRPGGSRIPGHWV+PPPPADEIW
Sbjct  339  RMYDYAANLPMEFYHYYYGSNTDMGTLIEVRRSWDAFIRPGGSRIPGHWVEPPPPADEIW  398

Query  900  ASCLV  914
            A+ LV
Sbjct  399  AAYLV  403



>ref|XP_007051683.1| Programmed cell death protein 7 isoform 2 [Theobroma cacao]
 gb|EOX95840.1| Programmed cell death protein 7 isoform 2 [Theobroma cacao]
Length=324

 Score =   270 bits (690),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 205/288 (71%), Positives = 241/288 (84%), Gaps = 16/288 (6%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E +S+EAAN+L+S LRAQLEPFR   DE+SPWEEKSAA RL+NK++K KRNKLWRKRKRK
Sbjct  38   ESISMEAANSLMSKLRAQLEPFRYVVDEASPWEEKSAAARLANKINKSKRNKLWRKRKRK  97

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+AE L+ ER+RF+QAD+EADEWRAREIAKD+A++KVEKMKEIAK K KEE+ +LESELE
Sbjct  98   RIAEMLSKERERFDQADREADEWRAREIAKDIASRKVEKMKEIAKLKAKEEKMRLESELE  157

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRIQKLKKQG FLPEEDDKFLE+V+AAVEEEERQA+AAA T AAKDA
Sbjct  158  LVLIVEKLQELRSIRIQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQALAAADTDAAKDA  217

Query  561  ianaEESRKATQSYKPDSKD----------AKDEKEHGNNDVKDKITTSSSEKEHGNN--  704
            IA AEE+RKATQ+ KP SKD          +KD+K   N D KD  +++ ++KE G N  
Sbjct  218  IATAEETRKATQNQKPLSKDPISDQLEDKESKDQK-TPNEDEKD--SSTVTDKESGQNTS  274

Query  705  -GGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGG  845
             G G   AYDS++NLP+EFYHYY+GSN DMGTLIEVRRTWD+YIRPGG
Sbjct  275  EGHGYGGAYDSLANLPIEFYHYYHGSNTDMGTLIEVRRTWDAYIRPGG  322



>ref|XP_004134317.1| PREDICTED: uncharacterized protein LOC101209659 [Cucumis sativus]
 ref|XP_004155887.1| PREDICTED: uncharacterized LOC101209659 [Cucumis sativus]
 gb|KGN56473.1| hypothetical protein Csa_3G121010 [Cucumis sativus]
Length=408

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 207/305 (68%), Positives = 238/305 (78%), Gaps = 15/305 (5%)
 Frame = +3

Query  30   SLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrVA  209
            S+EAA  L+  LRAQL PFR+  DESS WE    A RLS KL K KRNK WRKRKRKRVA
Sbjct  106  SVEAAAGLMEKLRAQLHPFRLDTDESSLWE----AVRLSGKLSKAKRNKQWRKRKRKRVA  161

Query  210  EKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelAL  389
            E LA ER+ F+Q D EADEWRAREIAKD+A +KVEKM EIA+ K KEE++KL+SELELAL
Sbjct  162  ESLAKERESFDQVDLEADEWRAREIAKDIAKRKVEKMNEIARIKAKEEKKKLDSELELAL  221

Query  390  MVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaian  569
            +VEKLQELRSIRIQKLKKQG FLPEEDDKFLE+V+AAVEEEERQA+AAA T AAKDAIA 
Sbjct  222  IVEKLQELRSIRIQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQALAAADTDAAKDAIAT  281

Query  570  aEESRKATQSYKPDSKD---AKDEKEHGNND----VKDKITTSSSEKEHGNNGG---GGS  719
            AE SRK   +Y P+S+D   A D  E  N+       +K++ +S+ KE G   G   G  
Sbjct  282  AEVSRKTVPTY-PESRDPDSATDRSEERNDQRSAGADEKVSNTSTNKEPGKQFGELQGYG  340

Query  720  SAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIW  899
              YD  +NLPMEFYHYYYGSN DMGTLIEVRR+WD++IRPGGSRIPGHWV+PPPP+DEIW
Sbjct  341  RMYDYAANLPMEFYHYYYGSNTDMGTLIEVRRSWDAFIRPGGSRIPGHWVEPPPPSDEIW  400

Query  900  ASCLV  914
            A+ LV
Sbjct  401  AAYLV  405



>ref|XP_010518285.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein-like 
[Camelina sativa]
Length=405

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 181/298 (61%), Positives = 225/298 (76%), Gaps = 14/298 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E+LS+EAAN+L+STLRAQLEPFR   DE++PWEEKSAA RL+ KL K KRNKLW+KRKR+
Sbjct  95   EILSVEAANSLMSTLRAQLEPFRFVVDENTPWEEKSAAVRLTCKLKKSKRNKLWKKRKRR  154

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             VAE  A E +RFEQAD+EADEWR +E+AKD+AN+KV++MK I K K + ERR+LE ELE
Sbjct  155  CVAEMRAKEPERFEQADREADEWREKEMAKDMANRKVDEMKAIEKVKARRERRRLEPELE  214

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG FLPEEDDKF E V+AAVE+EE Q  +       ++ 
Sbjct  215  LALIVEEMQELRSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEENQVQSLTNAETEENV  274

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVS  740
            IA+ E++   T      +K +KD  +  +N V      ++ EK     G G     D++S
Sbjct  275  IASEEDTTLTT-----SNKISKDTTDKESNTV-----AATCEKTIEALGNG----CDNIS  320

Query  741  NLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLV  914
            NLP+EFYHYYYGSN DMG LIE+RR WDSY+  GGSRIPGHWVQP PPA+EIWASCLV
Sbjct  321  NLPVEFYHYYYGSNFDMGRLIEIRREWDSYLSHGGSRIPGHWVQPSPPANEIWASCLV  378



>ref|XP_002882054.1| hypothetical protein ARALYDRAFT_483767 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58313.1| hypothetical protein ARALYDRAFT_483767 [Arabidopsis lyrata subsp. 
lyrata]
Length=385

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 225/298 (76%), Gaps = 15/298 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E+LS+EAAN+L+STLR+QLEPFR   DE+SPWEEKSAA RL+ K+ K KRNKLW+KRKR+
Sbjct  95   EMLSVEAANSLMSTLRSQLEPFRFVVDENSPWEEKSAAIRLTCKMKKSKRNKLWKKRKRR  154

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             VAE  A E +RFEQAD+EADEWR +E+AKD+AN+KV++MK I K K K ERR+LE ELE
Sbjct  155  CVAEMRAKEPERFEQADREADEWREKEMAKDMANRKVDEMKAIEKIKAKRERRRLEPELE  214

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRSIRI+KLKKQG FLPEEDDKF E V+AAVE+EE QA +   T   ++ 
Sbjct  215  LALIVEEMQELRSIRIEKLKKQGHFLPEEDDKFFESVRAAVEQEETQAQSLINTETEENV  274

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVS  740
            IA+ E++     +    +K  KD  +  NN        +S EK       G     D++S
Sbjct  275  IASEEDT-----TLTASNKTNKDTDKDSNN------IAASCEKTMKAPKNGC----DNIS  319

Query  741  NLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLV  914
            NLP+EFYHYYYGSN DMG LIE+RR WD+Y+ PGGSRIPGHWVQP PPA+EIWASCL+
Sbjct  320  NLPVEFYHYYYGSNFDMGKLIEIRREWDAYLSPGGSRIPGHWVQPSPPANEIWASCLL  377



>ref|XP_010251596.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Nelumbo nucifera]
 ref|XP_010251597.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Nelumbo nucifera]
Length=410

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 243/313 (78%), Gaps = 14/313 (4%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E L+LEAAN+L S++++QLEPF     ++S WEE SAA +++N++ K KRNK WRKRKRK
Sbjct  98   ESLTLEAANSLCSSVKSQLEPFNSLISQTSSWEEMSAAVKVANRIQKSKRNKHWRKRKRK  157

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             +AE L+ E +RF+QAD+EADEWRAREIAK +A +KVEKMKEIAK K  EER++LESELE
Sbjct  158  FIAEMLSKECERFDQADQEADEWRAREIAKGIARRKVEKMKEIAKLKANEERQRLESELE  217

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VE+L+ELRSIRIQK+KKQG FLPEEDDKF+ERV++AVEEEERQA AAA T AA+DA
Sbjct  218  LVLIVERLRELRSIRIQKMKKQGHFLPEEDDKFIERVRSAVEEEERQAAAAAETDAARDA  277

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEK-------------EHGN  701
            IA AEESR+  QS + D +D  +  + G  + +D +  ++SE              E  +
Sbjct  278  IATAEESRRIIQSSRSDPRDVSN-SQGGGMESQDSLIETASEGGPGAARDQQRESDEQVS  336

Query  702  NGGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPP  881
             G G    YDS++NLP+EFYHYY+G N DMGTLIEVR+TWD+YIRPGGSRIPGHWVQPPP
Sbjct  337  EGQGFGRTYDSIANLPVEFYHYYHGGNTDMGTLIEVRKTWDAYIRPGGSRIPGHWVQPPP  396

Query  882  PADEIWASCLVKP  920
            PA+EIWAS L+ P
Sbjct  397  PANEIWASYLIGP  409



>ref|XP_006294409.1| hypothetical protein CARUB_v10023427mg [Capsella rubella]
 gb|EOA27307.1| hypothetical protein CARUB_v10023427mg [Capsella rubella]
Length=380

 Score =   267 bits (682),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 216/298 (72%), Gaps = 18/298 (6%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E+LS+EAAN+L+STLRAQLEPF+   DE++PWEEKSA  RL+ KL K KRNKLW+K+KR+
Sbjct  95   EILSVEAANSLMSTLRAQLEPFKFVVDENTPWEEKSAVVRLTCKLKKSKRNKLWKKQKRR  154

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             VAE  A E +RFEQAD+EADEWR  E+AKD+AN+KV++MK I K K + ERR+LE ELE
Sbjct  155  CVAEMRAKEPERFEQADQEADEWRENEMAKDMANRKVDEMKAIEKVKARRERRRLEPELE  214

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG FLPEEDDKF E V+AAVE+EE Q  +          
Sbjct  215  LALIVEEMQELRSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEENQVQSLT--------  266

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVS  740
                  + +  ++   D +D    K   N D +     +S EK     G G     +++S
Sbjct  267  ------NTETVENVMVDEEDTTSNKISKNTDKESNTVATSCEKTMDAPGNGC----ENIS  316

Query  741  NLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLV  914
            NLP+EFYHYYYGSN DMG LIE+RR WD+Y+ PGGSRIPG WVQP PPA+EIWASCLV
Sbjct  317  NLPVEFYHYYYGSNFDMGRLIEIRREWDAYLSPGGSRIPGQWVQPSPPANEIWASCLV  374



>ref|XP_010508056.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein-like 
[Camelina sativa]
Length=386

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 178/298 (60%), Positives = 225/298 (76%), Gaps = 14/298 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E+LS+EAAN+L+STLRAQLEPFR   DE++PWEEKSAA RL+ KL K  RNKLW+KRKR+
Sbjct  95   EILSVEAANSLMSTLRAQLEPFRFVVDENTPWEEKSAAVRLTCKLKKSNRNKLWKKRKRR  154

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             VAE  A E +RF+QAD+EADEWR +E+AKD+AN+KV++MK I K K + ERR+LE ELE
Sbjct  155  CVAEMRAKEPERFKQADREADEWREKEMAKDMANRKVDEMKAIEKVKARRERRRLEPELE  214

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG FLPEEDDKF E V+AAVE+EE Q  +   T   ++ 
Sbjct  215  LALIVEEMQELRSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEENQVQSLTNTETEENV  274

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVS  740
            IA+ E++   T      +K +KD  +  +N V      ++ EK     G G     +++S
Sbjct  275  IASEEDTTLTT-----SNKISKDTTDKESNTV-----AATCEKTMEALGNGC----ENIS  320

Query  741  NLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLV  914
            NLP+EFYHYYYGSN DMG LIE+RR WD+Y+  GGSRIPGHWVQP PPA+EIWASCLV
Sbjct  321  NLPVEFYHYYYGSNFDMGRLIEIRREWDAYLSHGGSRIPGHWVQPSPPANEIWASCLV  378



>emb|CDY42016.1| BnaC04g00940D [Brassica napus]
Length=384

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 221/300 (74%), Gaps = 13/300 (4%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LS+EAAN+L+STLRAQLEPFR A DE+SPWEEKSAA RLS ++ K KRNKLW+K+KR+
Sbjct  93   EKLSVEAANSLMSTLRAQLEPFRFAVDENSPWEEKSAAVRLSCRMKKSKRNKLWKKKKRR  152

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             +AE  A E +RFEQAD+EADEWR +E+AKD+AN+KV++MK I K K K ERR+LE ELE
Sbjct  153  CLAEMRAKEPERFEQADREADEWREKEMAKDMANKKVDEMKAIEKVKAKRERRRLEPELE  212

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QEL S+RI+KLKKQG FLPEEDDKF E V+AAVE+EE QA +       ++ 
Sbjct  213  LALIVEEMQELHSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEENQAQSVINMEIEENV  272

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDV-KDKITTSSSEKEHGNNGGGGSSAYDSV  737
            I + E + + T +            E  N D  K+  T +++  E            D+V
Sbjct  273  IPSEEGTTQTTGN------------EIINKDTDKESNTVAAASCEKTVEAPPPDKGVDNV  320

Query  738  SNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLVK  917
            SNLP+E YHYYYGSN DMG LIE+RR WD+Y+ PGGSRIPGHWVQP PPADEIWASCLVK
Sbjct  321  SNLPVECYHYYYGSNLDMGRLIEIRREWDAYLSPGGSRIPGHWVQPSPPADEIWASCLVK  380



>ref|XP_010506616.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Camelina sativa]
Length=386

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 225/298 (76%), Gaps = 14/298 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E+LS+EAAN+L+STLRAQLEPFR   DE++PWEEKSAA RL+ KL K +RNKLW+KRKR+
Sbjct  95   EMLSVEAANSLMSTLRAQLEPFRFVVDENTPWEEKSAAVRLTCKLKKSQRNKLWKKRKRR  154

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             VAE  A E +RFEQA +EADEWR +E+AKD+AN+KV++MK I K K + ERR+LE ELE
Sbjct  155  CVAEMRAKEPERFEQAVREADEWREKEMAKDMANRKVDEMKAIEKVKARRERRRLEPELE  214

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG FLPEEDDKF E V+AAVE+EE Q  +   T   ++ 
Sbjct  215  LALIVEEMQELRSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEENQVQSLTNTETEENV  274

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVS  740
            IA+ E++   T      +K +KD  +  +N V      ++ EK     G G     D++S
Sbjct  275  IASEEDTTLNT-----SNKISKDTTDKESNTV-----AATCEKTIEALGNGC----DNIS  320

Query  741  NLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLV  914
            NLP+EFYHYYYGSN DMG LIE+RR WDSY+  GGSRIPGHWVQP PPA+EIWASCLV
Sbjct  321  NLPVEFYHYYYGSNFDMGRLIEIRREWDSYLSHGGSRIPGHWVQPSPPANEIWASCLV  378



>ref|XP_009142681.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Brassica rapa]
Length=377

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 228/299 (76%), Gaps = 12/299 (4%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LS+EAAN+L+STLRAQLEPFR   DESSPWEEKSAA RLS ++ K KRNKLW+K+KR+
Sbjct  87   EKLSVEAANSLMSTLRAQLEPFRFVVDESSPWEEKSAAARLSCRMKKSKRNKLWKKKKRR  146

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             VAE  A E +RFEQAD+EADEWR +E+AKD+AN+KV++MK I K K K ERR+LE ELE
Sbjct  147  CVAEMRAKEPERFEQADREADEWREKEMAKDMANRKVDEMKAIEKVKAKRERRRLEPELE  206

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG FLPEEDDKF E V+AAVE+EE QA +   T A ++A
Sbjct  207  LALIVEEMQELRSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEENQAPSVTNTEAEENA  266

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVS  740
            IA+ E++   T     D+K    + +   NDV      +S EK   +      S  ++VS
Sbjct  267  IASVEDTNLTT-----DNKIINKDMDKEINDV----AAASCEK---SIEAPLDSGCENVS  314

Query  741  NLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLVK  917
            NLP+E YHYYYGSN DMG LIE+RR WD+Y+ PGGSRIPGHWVQP PPA+EIWASCLVK
Sbjct  315  NLPVECYHYYYGSNLDMGRLIEIRRDWDAYLSPGGSRIPGHWVQPSPPANEIWASCLVK  373



>gb|EYU32184.1| hypothetical protein MIMGU_mgv1a006362mg [Erythranthe guttata]
Length=447

 Score =   267 bits (682),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 208/348 (60%), Positives = 249/348 (72%), Gaps = 52/348 (15%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LSL AANA++S LR QLE +R+  DE+SPWEEKSA +RL++K++KYKRNKLWR+RKR+
Sbjct  103  ESLSLNAANAVMSKLRYQLELYRVVTDENSPWEEKSAVKRLADKMEKYKRNKLWRRRKRR  162

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+A+ LA ER++F++ DKEADEWRARE+AKD A +KVEKMKEIAK K KEE+++LESELE
Sbjct  163  RIAQNLAKEREQFDRLDKEADEWRAREVAKDAAQRKVEKMKEIAKVKAKEEKKRLESELE  222

Query  381  lALMVEKLQELRSIRIQKLKKQG-------------------------------------  449
            L L+VEKLQELRS RI+KLKKQG                                     
Sbjct  223  LVLIVEKLQELRSFRIEKLKKQGSKNRYPFHRFNPPFSIIRKGTEPLIRKGTEPLNLQLL  282

Query  450  -RFLPEEDDKFLervkaaveeeerQamaaagtgaakdaianaEESRKATQSYKPDSKDA-  623
              F PEEDDKFLE+V+AAVEEEERQ+MAAA T AAKDAIANAEESRK   S+ PDS++  
Sbjct  283  GHFFPEEDDKFLEQVRAAVEEEERQSMAAADTDAAKDAIANAEESRKHVNSHAPDSEELG  342

Query  624  ---------KDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVSNLPMEFYHYYYG  776
                     +D+K    N+   K+  +   ++    G    SAYDSV NLPMEFYHYY+G
Sbjct  343  LSNFQHIKNQDQKNETANEKDSKLVATKESRKIDTTG----SAYDSVCNLPMEFYHYYHG  398

Query  777  SNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLVKP  920
            SN DMGTLIEVRRTWD+Y+RP GSRIPGHWVQPPPP DEIWAS LVKP
Sbjct  399  SNTDMGTLIEVRRTWDAYLRPRGSRIPGHWVQPPPPTDEIWASYLVKP  446



>emb|CDX79994.1| BnaA05g01620D [Brassica napus]
Length=385

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 179/299 (60%), Positives = 222/299 (74%), Gaps = 11/299 (4%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LS+EAAN+L+ TLRAQLEPFR   DESSPWEEKSAA RLS ++ K KRNKLW+K+KR+
Sbjct  94   EKLSVEAANSLMCTLRAQLEPFRFVVDESSPWEEKSAAARLSCRMKKSKRNKLWKKKKRR  153

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             VAE  A E +RFEQAD+EADEWR +E+AKD+AN+KV++MK I K K K ERR+LE ELE
Sbjct  154  CVAEMRAKEPERFEQADQEADEWREKEMAKDMANRKVDEMKAIEKVKAKRERRRLEPELE  213

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG F PEEDDKF + V+AAVE+EE QA +   T   ++ 
Sbjct  214  LALIVEEMQELRSLRIEKLKKQGHFFPEEDDKFFDSVRAAVEQEENQAQSVINTENEENV  273

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVS  740
            IA+ E++   T     D+K   ++ +  +N V         E    +NG       D+VS
Sbjct  274  IASEEDTNLTT-----DNKIINNDTDKESNTVLGAACEKKIEAPPPDNG------VDNVS  322

Query  741  NLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLVK  917
            NLP+E YHYYYGSN DMG LIE+RR WD+Y+ PGGSRIPGHWVQP  PA+EIWASCLVK
Sbjct  323  NLPVECYHYYYGSNLDMGRLIEIRREWDAYLSPGGSRIPGHWVQPSAPANEIWASCLVK  381



>ref|NP_850448.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_973696.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8VYD3.1|U1159_ARATH RecName: Full=U11/U12 small nuclear ribonucleoprotein 59 kDa 
protein; Short=U11/U12 snRNP 59 kDa protein; Short=U11/U12-59K 
[Arabidopsis thaliana]
 gb|AAL59984.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20058.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10655.1| uncharacterized protein AT2G46200 [Arabidopsis thaliana]
 gb|AEC10656.1| uncharacterized protein AT2G46200 [Arabidopsis thaliana]
Length=382

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 221/299 (74%), Gaps = 17/299 (6%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E+LS++AAN+L+STLRAQLEPFR   DE+SPWEEKSAA RL+ K+ K  RNKLW+KRKR+
Sbjct  92   EMLSVDAANSLMSTLRAQLEPFRFVVDENSPWEEKSAAVRLTCKMKKSIRNKLWKKRKRR  151

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
              AE  A E +RFEQAD+EADEWR +E+AKD+AN+KV++MK I K K K ER++LE ELE
Sbjct  152  CAAEMRAKEPERFEQADREADEWREKEMAKDMANRKVDEMKAIEKIKAKRERKRLEPELE  211

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG FLPEEDDKF E V+AAVE+EE QA +   T   +  
Sbjct  212  LALIVEEMQELRSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEENQAQSLINTETEEHV  271

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDV-KDKITTSSSEKEHGNNGGGGSSAYDSV  737
            IA+ EE+   T S K             NND  KD  T ++S +        G    D++
Sbjct  272  IAS-EENTTLTTSNK------------TNNDTDKDSNTNAASCERTMKAPDNGC---DNI  315

Query  738  SNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLV  914
            SNLP+E YHYYYGSN DMG LIE+RR WD+Y+  GGSRIPGHWVQP PPA+EIWASCLV
Sbjct  316  SNLPVEVYHYYYGSNIDMGRLIEIRREWDAYLSAGGSRIPGHWVQPSPPANEIWASCLV  374



>ref|XP_003606813.1| Programmed cell death protein [Medicago truncatula]
 gb|AES89010.1| Ras protein Rab7, putative [Medicago truncatula]
Length=415

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 203/311 (65%), Positives = 245/311 (79%), Gaps = 15/311 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E +++E AN+L+  L+AQLEPFR  ADE+SPWEEKSA  + +NK+ K KRNKLWRK+KRK
Sbjct  105  EAMAVEEANSLMLKLKAQLEPFRYVADEASPWEEKSAVAKFTNKVHKSKRNKLWRKKKRK  164

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+AE LA E ++F+Q D+EADEWRAREIAK++A+ KV+KM EI + K KEE++KLESELE
Sbjct  165  RIAEMLAKEHEQFDQIDREADEWRAREIAKEIASIKVKKMNEIGELKVKEEKKKLESELE  224

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L LM EKL+ELRSIRIQKLKKQG FLPEEDDKF ERV+AAVEEEER+A+AAA T AAKDA
Sbjct  225  LLLMEEKLKELRSIRIQKLKKQGHFLPEEDDKFFERVQAAVEEEEREALAAAETDAAKDA  284

Query  561  ianaEESRKATQSYKPDSKDAKDEKE--HGNNDVKDKIT----------TSSSEKEHGNN  704
            IA AEESRKA Q+    SK++ DE +    N  +   +T           SS+    G N
Sbjct  285  IATAEESRKAMQNQGKLSKESNDESQIKENNGQIVHSVTEEGLDATDEKKSSNIASEGQN  344

Query  705  GGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPP  884
             GG   AYD ++NLP+EFYHYY+GSN+DMGTLIEVRR WD+YIRPGGSRIPGHWVQPPPP
Sbjct  345  YGG---AYDPLANLPIEFYHYYHGSNNDMGTLIEVRRGWDAYIRPGGSRIPGHWVQPPPP  401

Query  885  ADEIWASCLVK  917
            A+EIWAS LV+
Sbjct  402  ANEIWASYLVR  412



>ref|XP_004507356.1| PREDICTED: programmed cell death protein 7-like isoform X1 [Cicer 
arietinum]
 ref|XP_004507357.1| PREDICTED: programmed cell death protein 7-like isoform X2 [Cicer 
arietinum]
Length=413

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 201/308 (65%), Positives = 237/308 (77%), Gaps = 9/308 (3%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E L++EAAN+L+  LRAQLEPFR  ADE SPWEEKSA  R +NK+ K KRNKL RK+KRK
Sbjct  104  EALAVEAANSLMLKLRAQLEPFRYVADEVSPWEEKSAVARFTNKVHKSKRNKLRRKKKRK  163

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
              AE LA ERD+F+Q D+EADEWR REIAK++A+ KV KMKEIAK K KEE++KLESELE
Sbjct  164  HTAEMLAKERDQFDQIDREADEWRDREIAKEIASSKVTKMKEIAKLKAKEEKKKLESELE  223

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRIQK+KKQG FLPEEDDKFLERV+AA EEEER+A+AAA T AAKDA
Sbjct  224  LLLVVEKLQELRSIRIQKMKKQGHFLPEEDDKFLERVQAAAEEEEREALAAAETDAAKDA  283

Query  561  ianaEESRKATQSYKPDSKDAKDEKE---------HGNNDVKDKITTSSSEKEHGNNGGG  713
            IA AEESRKA ++ +  SK +  E E         HG  +     T      E  + G  
Sbjct  284  IATAEESRKAIKNQEKLSKGSNTESEIKENNEQIVHGGTEEGFVATDEKKPSEIASEGQN  343

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADE  893
               AYD ++NLP+EFYHYY+GSN+DMGTLI+VRR WD+YI+PGGSRIP  WVQPPPPA+E
Sbjct  344  YGGAYDPLANLPIEFYHYYHGSNNDMGTLIQVRREWDAYIQPGGSRIPVRWVQPPPPANE  403

Query  894  IWASCLVK  917
            IWAS LV+
Sbjct  404  IWASYLVR  411



>ref|XP_011093101.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
isoform X2 [Sesamum indicum]
Length=391

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 190/287 (66%), Positives = 231/287 (80%), Gaps = 10/287 (3%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E +SL  ANA++S LR QLEPFR+  DE+SPWEEKSAA+RL++K+ KYKRNKLWR+RKRK
Sbjct  98   ESMSLNVANAIMSKLRFQLEPFRVITDENSPWEEKSAAKRLADKMQKYKRNKLWRRRKRK  157

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+AE L+ ER++F+Q DKEADEWRAREIAKD+A +KVEKM EIAK K KEE+++LE+ELE
Sbjct  158  RIAENLSREREQFDQIDKEADEWRAREIAKDIAQRKVEKMNEIAKLKAKEEKKRLEAELE  217

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRS RIQKLK+QG FLPEEDDKFLERV+AAVEEEERQ MAAA   AAKDA
Sbjct  218  LVLIVEKLQELRSFRIQKLKRQGHFLPEEDDKFLERVRAAVEEEERQTMAAAFPDAAKDA  277

Query  561  ianaEESRKATQSYKPDSKDA-------KDEKEHGNNDVKDKITTSSSEKEH---GNNGG  710
            IA AEESRK  QS+ PD ++        ++ ++  N    ++++   + KE      NG 
Sbjct  278  IATAEESRKHIQSHAPDMEEPGLNNSGYRESQDQENETANERVSNVVAPKEFRKVDTNGP  337

Query  711  GGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSR  851
            G SS Y+SV+NLPMEFYHYY+GSN DMGTLIEVRRTWD+YIRPGGS+
Sbjct  338  GSSSVYNSVANLPMEFYHYYHGSNTDMGTLIEVRRTWDAYIRPGGSK  384



>ref|XP_010925810.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein-like 
[Elaeis guineensis]
Length=433

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 196/311 (63%), Positives = 234/311 (75%), Gaps = 16/311 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E L++EAA ++ STL+ QL PF +  +++SPWEE+S A +L+ KL K +RNK W+KRKRK
Sbjct  123  ESLAMEAACSIFSTLKNQLIPFCVITNQASPWEERSVAVKLAQKLQKSRRNKCWKKRKRK  182

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             VAE +  ER+ +E+AD+EADEWR REIAKD+A +KVEKMKEIAK K  EE+R+LESELE
Sbjct  183  HVAELINKEREDYEKADQEADEWRMREIAKDIARRKVEKMKEIAKVKANEEKRRLESELE  242

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRIQKLKKQG FLPEEDDKFLERV+AAVEEEERQA AAA T AAKDA
Sbjct  243  LVLIVEKLQELRSIRIQKLKKQGHFLPEEDDKFLERVQAAVEEEERQAAAAADTNAAKDA  302

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHG--NNDVKDKI-----------TTSSSEKEHGN  701
            IA AEESRKA  S   ++ D   +K     N D  D I             S  +   G 
Sbjct  303  IATAEESRKAIHSASSEANDVDHDKGEVMVNQDQVDGIEGERSSDLNANLKSEQQNVEGQ  362

Query  702  NGGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPP  881
            + GGG   YD V+NLP EFYHYY+GS++DMGTLIEVR+ WD+YIRPGGSRIPGHW+Q PP
Sbjct  363  SCGGG---YDFVANLPFEFYHYYHGSSNDMGTLIEVRKMWDAYIRPGGSRIPGHWIQLPP  419

Query  882  PADEIWASCLV  914
            PAD +WAS LV
Sbjct  420  PADGVWASYLV  430



>ref|XP_006397804.1| hypothetical protein EUTSA_v10001493mg [Eutrema salsugineum]
 gb|ESQ39257.1| hypothetical protein EUTSA_v10001493mg [Eutrema salsugineum]
Length=385

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 181/299 (61%), Positives = 219/299 (73%), Gaps = 15/299 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LS+EAAN LISTLRAQLEPFR   DE+ PWEEKSAA RL+ K+ K KRNKLWRKRKR+
Sbjct  95   ETLSVEAANTLISTLRAQLEPFRFVIDENCPWEEKSAAVRLTCKMKKSKRNKLWRKRKRQ  154

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
              AE  A E +RFEQAD+EADEWR +E+AKD+AN KV++MK I K K K ER++LE ELE
Sbjct  155  CAAEMRAKEPERFEQADREADEWREKEMAKDMANIKVDEMKAIEKVKVKRERKRLEPELE  214

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG FLPEEDDKF E V+AAVE+EE QA +   T   ++ 
Sbjct  215  LALIVEEMQELRSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEETQAKSLTNTETKENV  274

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVS  740
            IA+ E++  AT     +  D   +KE G       +  +S EK       GG    D+VS
Sbjct  275  IASEEDTPLATS----NKIDKDIDKESG-------MVAASCEKSMEAPDSGG----DNVS  319

Query  741  NLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLVK  917
            NLP+E YHYYYGSN DM  LIE+RR WD+Y+ P GSRIP +WVQP PPA+EIWASCLVK
Sbjct  320  NLPVEMYHYYYGSNFDMSRLIEIRREWDAYLSPVGSRIPRNWVQPSPPANEIWASCLVK  378



>ref|XP_006643934.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
isoform X1 [Oryza brachyantha]
Length=425

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 194/311 (62%), Positives = 233/311 (75%), Gaps = 9/311 (3%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E L+ +AAN L S L+  L P   A ++  PWEE SA  RLS KL K KRNK WR++K
Sbjct  114  THESLATDAANYLCSQLQNLLAPIYPAVNQGGPWEEMSAMIRLSQKLQKSKRNKRWRRKK  173

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    E   +++ D+EADEWRAR+IAKD+A +KVE MK+IAK+K  EER++LESE
Sbjct  174  RKHVAELYQKEHADYDRIDQEADEWRARQIAKDIAQRKVENMKQIAKKKANEERKRLESE  233

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LELALMVEKLQELRSIR+QKLKKQG FLP+EDDK+LERVKAAVEEEERQA +AA T AAK
Sbjct  234  LELALMVEKLQELRSIRVQKLKKQGHFLPDEDDKYLERVKAAVEEEERQAASAARTDAAK  293

Query  555  daianaEESRKATQ---SYKPDSKDAKD----EKEHGNNDVKDKITTSSSEKEHGNNG--  707
            DAI  AEESRKA Q   S +  S+ AK     E+      + D+   +S + EH N+   
Sbjct  294  DAILTAEESRKAVQCTDSREDGSEQAKSASTLEQNQIEAGISDRSHHASQKTEHENHKDE  353

Query  708  GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPA  887
            G G   YDSVS+LP EFYHYY+GS++DMGTLIEVRR WDS+IR GGSRIPGHWVQPPPP+
Sbjct  354  GKGHGHYDSVSSLPFEFYHYYHGSSYDMGTLIEVRRMWDSFIRTGGSRIPGHWVQPPPPS  413

Query  888  DEIWASCLVKP  920
            DE+WAS LV+P
Sbjct  414  DEVWASYLVQP  424



>ref|XP_003565844.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Brachypodium distachyon]
 ref|XP_010230644.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Brachypodium distachyon]
 ref|XP_010230645.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Brachypodium distachyon]
 ref|XP_010230646.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Brachypodium distachyon]
 ref|XP_010230647.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Brachypodium distachyon]
 ref|XP_010230648.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Brachypodium distachyon]
 ref|XP_010230649.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Brachypodium distachyon]
 ref|XP_010230650.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Brachypodium distachyon]
Length=430

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 232/314 (74%), Gaps = 15/314 (5%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E L+ +AAN L S L+  L P   A ++  PWEE+SA  RL+ KL K KRNK WRKRK
Sbjct  119  THESLATDAANYLCSQLQHLLAPISPAINQGGPWEERSAMVRLAQKLQKSKRNKRWRKRK  178

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    E   F++ D+EADEWRAR+IA D+A +KVE MK+IAK+K  EER++LESE
Sbjct  179  RKHVAELFQKEHADFDRIDQEADEWRARQIANDIAKRKVESMKQIAKKKANEERKRLESE  238

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LELALMVEKLQELRSIR+QKLKKQG FLPEEDDK+LERVKAAVEEEERQA  AA T +AK
Sbjct  239  LELALMVEKLQELRSIRVQKLKKQGHFLPEEDDKYLERVKAAVEEEERQAATAARTDSAK  298

Query  555  daianaEESRKATQSYKPDSKDAKD--------EKEHGNNDVKDKITTSSSEKEH-GNN-  704
            DAI  AEESRKA+   K   +D  +        E+  G+  + D+   +S   +H G N 
Sbjct  299  DAILTAEESRKASH-LKTSQEDGSEQPKSGLTPEQNQGDASISDRSDCASQNTQHEGQNV  357

Query  705  --GGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPP  878
               G G S  +SV+NLP EFYHYY+GS++DMGTLIEVRR WDS+IRPGGSRIPGHWVQPP
Sbjct  358  EIKGLGHS--ESVTNLPFEFYHYYHGSSYDMGTLIEVRRMWDSFIRPGGSRIPGHWVQPP  415

Query  879  PPADEIWASCLVKP  920
            PPADE+WAS LV+P
Sbjct  416  PPADEVWASYLVQP  429



>ref|XP_008795314.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Phoenix dactylifera]
 ref|XP_008795388.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Phoenix dactylifera]
 ref|XP_008795467.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Phoenix dactylifera]
 ref|XP_008795541.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Phoenix dactylifera]
 ref|XP_008795615.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Phoenix dactylifera]
 ref|XP_008795690.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Phoenix dactylifera]
 ref|XP_008795760.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Phoenix dactylifera]
 ref|XP_008795827.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Phoenix dactylifera]
Length=433

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 191/312 (61%), Positives = 236/312 (76%), Gaps = 18/312 (6%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E  ++EAA+++ STL+ QL PF +  +++S WEE+  A +L+ KL K +RN+ W+KRKRK
Sbjct  122  ETFAMEAASSIFSTLKNQLTPFSVITNQASSWEERLVAVKLAQKLQKSRRNQRWKKRKRK  181

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            RVAE +  ER+ +E+AD+EADEWR REIA D+A +K EK+KEIAK K  EE+R+LESELE
Sbjct  182  RVAELIRKEREGYEKADQEADEWRMREIANDIARRKAEKLKEIAKLKANEEKRRLESELE  241

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRIQKLKKQG FLPEEDDKFLERV+AAVEEEERQA AAA T AAKDA
Sbjct  242  LVLIVEKLQELRSIRIQKLKKQGHFLPEEDDKFLERVQAAVEEEERQAAAAADTNAAKDA  301

Query  561  ianaEESRKATQSYKPDSKDAK--------DEKEHG------NNDVKDKITTSSSEKEHG  698
            IA AEESRKA  S   ++ D          +E + G      ++D+   +  S  +K  G
Sbjct  302  IATAEESRKAIHSANSEANDVNHNKGVVVVNEDQLGGIEGERSSDLNANLK-SEQQKVEG  360

Query  699  NNGGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPP  878
             N GGG   YD V+NLP EFYHYY+GS++DMGTLIEVR+ WD+YIRPGGSRIPGHWVQPP
Sbjct  361  QNCGGG---YDFVANLPFEFYHYYHGSSNDMGTLIEVRKMWDAYIRPGGSRIPGHWVQPP  417

Query  879  PPADEIWASCLV  914
             P+DE+WAS LV
Sbjct  418  QPSDEVWASYLV  429



>ref|XP_004967437.1| PREDICTED: uncharacterized protein LOC101780821 [Setaria italica]
Length=424

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 188/311 (60%), Positives = 231/311 (74%), Gaps = 9/311 (3%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E ++ +AAN L   L+  L P   A ++S PWEE+SA  RL+ KL K KRNK WRKRK
Sbjct  113  THESMATDAANYLCHQLQHLLAPISSAINQSGPWEERSAMVRLAQKLQKAKRNKRWRKRK  172

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    E   +++ D+EADEWRA++IAKD+A +KVE MK+IA++K  EER++LESE
Sbjct  173  RKHVAELFQKECADYDRIDQEADEWRAKQIAKDIAKRKVESMKQIARKKANEERKRLESE  232

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LELALMVEKLQELRSIR+QK+KKQG FLPEEDDK+LERVKAAVEEEERQA  AA T A K
Sbjct  233  LELALMVEKLQELRSIRVQKMKKQGHFLPEEDDKYLERVKAAVEEEERQAATAARTDAVK  292

Query  555  daianaEESRKATQS--YKPDSKDA-----KDEKEHGNNDVKDKITTSSSEKEHGNNG--  707
            DAI  AEESRKA Q+  +  D  +       ++K  G+  + +K   +S + EH  +   
Sbjct  293  DAILTAEESRKAPQNENHHEDGSEQFRSGPTEDKNQGDVGISEKNDQASQKTEHVGHKVE  352

Query  708  GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPA  887
            G G   +D VSNLP EFYHYY+GS++DMGTLIEVRR WDS+IRPGGSRIPGHWVQPPPP+
Sbjct  353  GKGHVHHDPVSNLPFEFYHYYHGSSYDMGTLIEVRRMWDSFIRPGGSRIPGHWVQPPPPS  412

Query  888  DEIWASCLVKP  920
            DE+WAS LV P
Sbjct  413  DEVWASYLVHP  423



>gb|EEC70217.1| hypothetical protein OsI_00976 [Oryza sativa Indica Group]
Length=436

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 194/318 (61%), Positives = 235/318 (74%), Gaps = 9/318 (3%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E L+ +AAN L S ++  L P   A ++  PWEE+SA  RL+ KL K KRNK WRKR+
Sbjct  119  THESLATDAANYLCSQIQNLLAPIYPAVNQRGPWEERSAMIRLAQKLQKSKRNKRWRKRE  178

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    E   +++ D+EADEWRAR+IAKD+A +KVE MK+IAK+K  EER++LESE
Sbjct  179  RKHVAELFQKEHADYDRIDQEADEWRARQIAKDMAQRKVENMKQIAKKKANEERKRLESE  238

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LELALMVEKLQELRS+R+QK+KKQG FLPEEDDK+LERVKAAVEEEERQA +AA T AAK
Sbjct  239  LELALMVEKLQELRSMRVQKMKKQGHFLPEEDDKYLERVKAAVEEEERQAASAARTDAAK  298

Query  555  daianaEESRKATQ---SYKPDSKDAKD----EKEHGNNDVKDKITTSSSEKEH--GNNG  707
            DAI  AEESRKA Q   S + DS  AK     E+   +  +  +   +S + EH    + 
Sbjct  299  DAILTAEESRKAVQCSNSREDDSDQAKSAPTLEQNQRDPGISGRNHHASQKTEHELHKDD  358

Query  708  GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPA  887
              G   YDSVS+LP EFYHYY+GS++DMGTLIEVRR WDS+IR GGSRIPGHWVQPPPPA
Sbjct  359  SKGHGHYDSVSSLPFEFYHYYHGSSYDMGTLIEVRRMWDSFIRAGGSRIPGHWVQPPPPA  418

Query  888  DEIWASCLVKP*INSTST  941
            DE+WAS LV+P   S ST
Sbjct  419  DEVWASYLVQPNCPSNST  436



>ref|XP_009419319.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Musa acuminata subsp. malaccensis]
Length=427

 Score =   251 bits (640),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 192/305 (63%), Positives = 233/305 (76%), Gaps = 5/305 (2%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LS+EAAN L+STL+ QL P      ++ PWEEKSAA + +NKL K KRNKLW+K+KRK
Sbjct  122  ESLSMEAANTLLSTLKYQLVPLNGITSQAIPWEEKSAAVKFANKLQKSKRNKLWKKKKRK  181

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            RVAE     R+ +++AD +ADEWRAREIA D+A +KVE MKEIAK K +EER++LESELE
Sbjct  182  RVAELARKLREDYDKADHDADEWRAREIANDMARRKVESMKEIAKLKSREERKRLESELE  241

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQEL SIRIQKLKKQG F+PEEDDKFLERV+AAVEEEERQA AAA T AAKDA
Sbjct  242  LFLVVEKLQELHSIRIQKLKKQGHFIPEEDDKFLERVRAAVEEEERQAAAAADTHAAKDA  301

Query  561  ianaEESRKA-----TQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSA  725
            IA AEESRK      T++   D  + +  K  G ++    +  +   ++  +   G  S 
Sbjct  302  IATAEESRKVMQNAITEANSIDEIEGEPSKTKGQSERSLVMDANMKSEQQKDEALGWGSG  361

Query  726  YDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWAS  905
            YDSVSNLP EF HYY+GS++DMGTLIEVRRTWD+YIRPGGSRIPGHWV+PPPPAD +WAS
Sbjct  362  YDSVSNLPFEFLHYYHGSSNDMGTLIEVRRTWDAYIRPGGSRIPGHWVRPPPPADAVWAS  421

Query  906  CLVKP  920
             L++P
Sbjct  422  YLIQP  426



>ref|XP_006850934.1| hypothetical protein AMTR_s00025p00188170 [Amborella trichopoda]
 gb|ERN12515.1| hypothetical protein AMTR_s00025p00188170 [Amborella trichopoda]
Length=410

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 233/313 (74%), Gaps = 21/313 (7%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LSLE+AN+L   L  QL  F    +E+S WE++SAA +L+NK+ K KRN+ WRK KRK V
Sbjct  95   LSLESANSLFLNLETQLVRFSAITEETSSWEQRSAAIKLANKIQKSKRNRRWRKNKRKHV  154

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE    ER R+++AD+ ADEWRAREIAKD+A +K+E MK IAK K  EER+KLESELEL 
Sbjct  155  AEMRLKERARYDEADQAADEWRAREIAKDIARRKMENMKAIAKVKANEERKKLESELELV  214

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VEKLQELRSIRIQKL+KQG FLPEEDDKFLERV+ AVEEEERQA AAA T AAKDAIA
Sbjct  215  LIVEKLQELRSIRIQKLQKQGHFLPEEDDKFLERVRVAVEEEERQAAAAADTCAAKDAIA  274

Query  567  naEESRKAT-------------QSYKPDSKDAKDE---KEHGNNDVKDKITTSSSEKE-H  695
             AEESR+A               SYK   + +  +   KE G + + D+  ++ SE+   
Sbjct  275  IAEESRQAVLTGGSDVNKHLDMDSYKTGERASSGQFTNKECGKS-LSDRTPSNGSEQRLE  333

Query  696  GNNGGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQP  875
            G   GGG   YDSV+NLP+EFYHYY+GSN D+GTLIEVRRTWD+YIRPGGSRIPGHWV+P
Sbjct  334  GKTFGGG---YDSVTNLPIEFYHYYHGSNTDIGTLIEVRRTWDAYIRPGGSRIPGHWVEP  390

Query  876  PPPADEIWASCLV  914
            P PAD+IWAS LV
Sbjct  391  PLPADDIWASYLV  403



>ref|XP_007051685.1| Programmed cell death protein 7 isoform 4 [Theobroma cacao]
 gb|EOX95842.1| Programmed cell death protein 7 isoform 4 [Theobroma cacao]
Length=419

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 213/382 (56%), Positives = 251/382 (66%), Gaps = 83/382 (22%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E +S+EAAN+L+S LRAQLEPFR   DE+SPWEEKSAA RL+NK++K KRNKLWRKRKRK
Sbjct  38   ESISMEAANSLMSKLRAQLEPFRYVVDEASPWEEKSAAARLANKINKSKRNKLWRKRKRK  97

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+AE L+ ER+RF+QAD+EADEWRAREIAKD+A++KVEKMKEIAK K KEE+ +LESELE
Sbjct  98   RIAEMLSKERERFDQADREADEWRAREIAKDIASRKVEKMKEIAKLKAKEEKMRLESELE  157

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRIQKLKKQG FLPEEDDKFLE+V+AAVEEEERQA+AAA T AAKDA
Sbjct  158  LVLIVEKLQELRSIRIQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQALAAADTDAAKDA  217

Query  561  ianaEESRKATQSYKPDSKD----------AKDEKEHGNNDVKDKITTSSSEK-------  689
            IA AEE+RKATQ+ KP SKD          +KD+K   N D KD  T +  E        
Sbjct  218  IATAEETRKATQNQKPLSKDPISDQLEDKESKDQK-TPNEDEKDSSTVTDKESGQNTSEG  276

Query  690  --------------------EHGNNGGGGS----------SAYDSVSNLPMEFYH--YYY  773
                                 HG+N   G+           + DS+ +  M F+   Y  
Sbjct  277  HGYGGAYDSLANLPIEFYHYYHGSNTDMGTLIEVCSSTFLQSLDSLLHRTMFFFQAVYMV  336

Query  774  GSN-----HDMGT----------------------------LIEVRRTWDSYIRPGGSRI  854
             SN     + M                               ++VRRTWD+YIRPGGSRI
Sbjct  337  ASNCWQFVYSMTMSGVSLMADAYTSICIQLHFHNNLLLLNLHVQVRRTWDAYIRPGGSRI  396

Query  855  PGHWVQPPPPADEIWASCLVKP  920
            PGHWVQPPPPADEIWAS LV+P
Sbjct  397  PGHWVQPPPPADEIWASYLVRP  418



>ref|NP_001042465.1| Os01g0226500 [Oryza sativa Japonica Group]
 dbj|BAD81508.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD81551.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04379.1| Os01g0226500 [Oryza sativa Japonica Group]
Length=435

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 194/318 (61%), Positives = 234/318 (74%), Gaps = 9/318 (3%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E L+ +AAN L S ++  L P   A ++  PWEE+ A  RL+ KL K KRNK WRKRK
Sbjct  118  THESLATDAANYLCSQIQNLLAPIYPAVNQGGPWEERYAMIRLAQKLQKSKRNKRWRKRK  177

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    E   +++ D+EADEWRAR+IAKD+A +KVE MK+IAK+K  EER++LESE
Sbjct  178  RKHVAELFQKEHADYDRIDQEADEWRARQIAKDMAQRKVENMKQIAKKKANEERKRLESE  237

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LELALMVEKLQELRS+R+QK+KKQG FLPEEDDK+LERVKAAVEEEERQA +AA T AAK
Sbjct  238  LELALMVEKLQELRSMRVQKMKKQGHFLPEEDDKYLERVKAAVEEEERQAASAARTDAAK  297

Query  555  daianaEESRKATQ---SYKPDSKDAKD----EKEHGNNDVKDKITTSSSEKEH--GNNG  707
            DAI  AEESRKA Q   S + DS  AK     E+   +  +  +   +S + EH    + 
Sbjct  298  DAILTAEESRKAVQCSNSREDDSDQAKSAPTLEQNQRDPGISGRNHHASQKTEHELHKDD  357

Query  708  GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPA  887
              G   YDSVS+LP EFYHYY+GS++DMGTLIEVRR WDS+IR GGSRIPGHWVQPPPPA
Sbjct  358  SKGHGHYDSVSSLPFEFYHYYHGSSYDMGTLIEVRRMWDSFIRAGGSRIPGHWVQPPPPA  417

Query  888  DEIWASCLVKP*INSTST  941
            DE+WAS LV+P   S ST
Sbjct  418  DEVWASYLVQPNCPSNST  435



>ref|XP_010907430.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein-like 
[Elaeis guineensis]
 ref|XP_010907432.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein-like 
[Elaeis guineensis]
Length=433

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 232/313 (74%), Gaps = 20/313 (6%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E L++EAA ++ STL+ QL PF +  +++S WEE+S A +L+ KL K +RNK W+KRKRK
Sbjct  123  ESLAMEAACSIFSTLKKQLIPFCVITNQASLWEERSVAVKLAQKLQKSRRNKCWKKRKRK  182

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            RVAE +  ER+ +E+AD+EADEWR REIAKD+A  KVEKMKEIAK K  EE+R+LESELE
Sbjct  183  RVAELINKEREDYEKADQEADEWRMREIAKDIARCKVEKMKEIAKLKANEEKRRLESELE  242

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRS RIQKLKKQG FLPEEDDKFLERV+AAVEEEERQA AAA T AAKDA
Sbjct  243  LVLIVEKLQELRSFRIQKLKKQGHFLPEEDDKFLERVQAAVEEEERQAAAAADTNAAKDA  302

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDV-KDKI--------------TTSSSEKEH  695
            IA  +ESRKA  S   +  D   +K  G   V +DK+                S   K  
Sbjct  303  IATVQESRKAIHSVSSEENDVNHDK--GEVIVNQDKVGGIEGERSSDLNANVKSEQPKVE  360

Query  696  GNNGGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQP  875
            G + GGG   +D V+NLP EFYHYY+GS++DMGTLIEVR+ WD+YIRPGGSRIPGHW+QP
Sbjct  361  GQSCGGG---HDFVANLPFEFYHYYHGSSNDMGTLIEVRKVWDAYIRPGGSRIPGHWIQP  417

Query  876  PPPADEIWASCLV  914
            PPP DE+W S LV
Sbjct  418  PPPTDEVWESYLV  430



>ref|XP_007051684.1| Programmed cell death protein 7 isoform 3 [Theobroma cacao]
 gb|EOX95841.1| Programmed cell death protein 7 isoform 3 [Theobroma cacao]
Length=334

 Score =   240 bits (612),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 193/275 (70%), Positives = 228/275 (83%), Gaps = 16/275 (6%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E +S+EAAN+L+S LRAQLEPFR   DE+SPWEEKSAA RL+NK++K KRNKLWRKRKRK
Sbjct  38   ESISMEAANSLMSKLRAQLEPFRYVVDEASPWEEKSAAARLANKINKSKRNKLWRKRKRK  97

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            R+AE L+ ER+RF+QAD+EADEWRAREIAKD+A++KVEKMKEIAK K KEE+ +LESELE
Sbjct  98   RIAEMLSKERERFDQADREADEWRAREIAKDIASRKVEKMKEIAKLKAKEEKMRLESELE  157

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            L L+VEKLQELRSIRIQKLKKQG FLPEEDDKFLE+V+AAVEEEERQA+AAA T AAKDA
Sbjct  158  LVLIVEKLQELRSIRIQKLKKQGHFLPEEDDKFLEKVRAAVEEEERQALAAADTDAAKDA  217

Query  561  ianaEESRKATQSYKPDSKD----------AKDEKEHGNNDVKDKITTSSSEKEHGNN--  704
            IA AEE+RKATQ+ KP SKD          +KD+K   N D KD  +++ ++KE G N  
Sbjct  218  IATAEETRKATQNQKPLSKDPISDQLEDKESKDQK-TPNEDEKD--SSTVTDKESGQNTS  274

Query  705  -GGGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIE  806
             G G   AYDS++NLP+EFYHYY+GSN DMGTLIE
Sbjct  275  EGHGYGGAYDSLANLPIEFYHYYHGSNTDMGTLIE  309



>ref|XP_010544776.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein 
[Tarenaya hassleriana]
Length=383

 Score =   241 bits (614),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 164/308 (53%), Positives = 205/308 (67%), Gaps = 28/308 (9%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LS+EAAN L+S L AQL+PFR   DE+SPWEE+S+   L +K+ K KRNKLWRKRKR+ V
Sbjct  97   LSVEAANLLMSKLSAQLDPFRFVVDENSPWEERSSVVGLVSKMQKSKRNKLWRKRKRQCV  156

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            A++ A E ++FEQA++EADEWRAR++AKD+AN+KVE+MK I K K K ER++LE ELELA
Sbjct  157  AQERAKEHEQFEQANREADEWRARKMAKDMANRKVEEMKAIEKVKAKRERKRLEPELELA  216

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VE+LQ+LRS+RI+KLKKQG FLPEEDDKF                            A
Sbjct  217  LIVEELQKLRSLRIEKLKKQGYFLPEEDDKFF----------------------ESVRAA  254

Query  567  naEESRKATQSYKPDS-KDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGG-----GSSAY  728
              +E  +A  S   D   D    +E G N   D     +   E  N G       G    
Sbjct  255  VEQEENQAQSSINTDGDNDVATAEEPGKNTESDVPIRDNETSEDMNEGSSTALDIGKKGQ  314

Query  729  DSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASC  908
            ++V+NLP++FYHYYYGS+HD+  LIEVRR WD+YIR GGSRIPGHWV P PPA+EIWAS 
Sbjct  315  ENVANLPLDFYHYYYGSDHDISRLIEVRREWDAYIRHGGSRIPGHWVLPSPPANEIWASY  374

Query  909  LVKP*INS  932
            +VKP  NS
Sbjct  375  MVKPNGNS  382



>ref|XP_006396963.1| hypothetical protein EUTSA_v10028732mg [Eutrema salsugineum]
 gb|ESQ38416.1| hypothetical protein EUTSA_v10028732mg [Eutrema salsugineum]
Length=381

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 215/298 (72%), Gaps = 15/298 (5%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LS+EAAN+L+ TLR QLEPF    +E+ PWEEKSAA RL+ K+ K KRNKLW+KRKR+
Sbjct  92   ETLSVEAANSLMPTLRTQLEPFSFVVNENCPWEEKSAAVRLTCKMKKSKRNKLWKKRKRR  151

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            RVAE  A E +RFE AD+EADEWR +E+AKD+AN+KV++MK I K K K ERR+LE ELE
Sbjct  152  RVAELRAKEPERFEHADQEADEWREKEMAKDMANRKVDEMKAIEKIKAKRERRRLEPELE  211

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG FLPEEDDKF E V+AAVE+EE QA     T   ++ 
Sbjct  212  LALIVEEMQELRSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEETQAQFLTNTENEENV  271

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVS  740
            I + E+    T      +K+ KD  +  N         +SSEK        G    D+VS
Sbjct  272  ITSEEDITLTT-----GNKNNKDTDKESN------AVAASSEKTMEAPYNVG----DNVS  316

Query  741  NLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLV  914
            +LP+E YHYYYGSN +MG LIE+RR WD+Y+   GSRIPG+WVQP PPA+EIWASCLV
Sbjct  317  SLPVEMYHYYYGSNFEMGRLIEIRREWDAYLSTRGSRIPGNWVQPSPPANEIWASCLV  374



>ref|NP_001168684.1| uncharacterized protein LOC100382473 [Zea mays]
 gb|ACN29188.1| unknown [Zea mays]
 gb|AFW80463.1| ras protein Rab7 isoform 1 [Zea mays]
 gb|AFW80464.1| hypothetical protein ZEAMMB73_603386 [Zea mays]
Length=446

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 233/313 (74%), Gaps = 13/313 (4%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E ++ +AAN L   L+  L P   A  +S PWEE+SA  RL+ KL K KRNK WR+R+
Sbjct  133  THESMATDAANYLCHQLQHLLGPISSATSQSGPWEERSAMVRLTQKLQKSKRNKRWRQRR  192

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    ER  +++ D+EADEWRA++IAKD+A ++VE M++IA++K  EER++LESE
Sbjct  193  RKHVAELFQKERADYDRVDREADEWRAKQIAKDIAKRRVESMQQIARKKTNEERKRLESE  252

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LELALMVEKLQELRSIR+QK+KKQG FLPEEDDK+LERVKAAVEEEERQA +AA T A K
Sbjct  253  LELALMVEKLQELRSIRVQKMKKQGHFLPEEDDKYLERVKAAVEEEERQAASAARTDAVK  312

Query  555  daianaEESRKATQ--------SYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNG-  707
            DAI  AEESRK  Q        S +P S  ++DE + G+  + ++   +S + EH + G 
Sbjct  313  DAILTAEESRKPLQYTNSQEGGSEQPKSGPSEDE-DQGDGGMSERNDQASQKTEHEDEGH  371

Query  708  ---GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPP  878
               G G   +D VSNLP EFYHYY+GS++DMGTLIEVRR WDS+IRPGGSRIPGHWV PP
Sbjct  372  RFEGKGHGHHDPVSNLPFEFYHYYHGSDYDMGTLIEVRRMWDSFIRPGGSRIPGHWVPPP  431

Query  879  PPADEIWASCLVK  917
            PPADE+WAS LV+
Sbjct  432  PPADEVWASYLVQ  444



>emb|CDM82607.1| unnamed protein product [Triticum aestivum]
Length=444

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 228/310 (74%), Gaps = 11/310 (4%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E L+ +AAN L S L+  L P   A ++  PW E+SA   L+ KL K KRNK WRKRKRK
Sbjct  135  ESLATDAANYLCSQLQHLLAPISSAINQDGPWAERSAMVSLTQKLQKSKRNKRWRKRKRK  194

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             VAE    E   F++ D+EADEWRAR+IA D+A +KVE MK+IAK+K  EER++LESELE
Sbjct  195  HVAELFQKESAEFDRIDQEADEWRARQIANDIAKRKVESMKQIAKKKANEERKRLESELE  254

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LALMVEKLQELRS+R++KLKKQG FLPEEDDK+LERVKAAVEEEERQA  AA T AAKDA
Sbjct  255  LALMVEKLQELRSVRVEKLKKQGHFLPEEDDKYLERVKAAVEEEERQAATAARTDAAKDA  314

Query  561  ianaEESRKATQSY--------KPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGG-  713
            I  AEESRKA            +P S  A ++K+ G+  + ++   +S + EH       
Sbjct  315  ILTAEESRKAAHHTTAQEDGLGQPKSGSAPEQKQ-GDASISERSDHASQKTEHDGQKVEI  373

Query  714  -GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPAD  890
             G +  +S++NLP EFYHYY+GS++D+GTLIEVRR WDS+IRPGGSRIPG+WVQPPPPA+
Sbjct  374  EGPAHSESLTNLPFEFYHYYHGSSYDLGTLIEVRRMWDSFIRPGGSRIPGNWVQPPPPAN  433

Query  891  EIWASCLVKP  920
            E+WAS LV+P
Sbjct  434  EVWASYLVQP  443



>gb|ADE77667.1| unknown [Picea sitchensis]
Length=455

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 180/312 (58%), Positives = 225/312 (72%), Gaps = 11/312 (4%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            +   ++LEA  A+  +L+  L PF +   ++  WEE++   R+++K  K KRN+ WRK++
Sbjct  128  THHCMALEAGKAVQLSLQNLLAPFDVLMHQTGRWEERATMVRITDKRLKVKRNRRWRKKR  187

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            R+  AE    E +R+E+AD+EADEWRAREIAKD+A +KVEKMKEIAK K  EE+R+LESE
Sbjct  188  RQLAAETRRKEDERYEKADREADEWRAREIAKDIARRKVEKMKEIAKIKSNEEKRRLESE  247

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
            LEL L+VEKLQELRSIRIQKLKKQG FLPEEDDKFLERV+AAVEEEERQA AAA T AA 
Sbjct  248  LELVLIVEKLQELRSIRIQKLKKQGHFLPEEDDKFLERVRAAVEEEERQAAAAADTSAAT  307

Query  555  daianaEESRKA-----TQSYKPDSKDAKDEKEHGNNDV-KDKITTSSSEKEHGNNG---  707
            +AIANAEESRK      T + K +  +    +    N + K  + +  S+   G++    
Sbjct  308  NAIANAEESRKGMGTIGTGARKEELTNLIQRQTSKENTIDKGLVVSDKSDDAPGDDKKSQ  367

Query  708  --GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPP  881
              G  S+ +D    LP EFYHYY+GSN DMGTLIEVRRTWD++I PGGSRIP HWVQPPP
Sbjct  368  PEGNKSAVHDLFGGLPAEFYHYYHGSNADMGTLIEVRRTWDAFIMPGGSRIPAHWVQPPP  427

Query  882  PADEIWASCLVK  917
            PADEIWAS LV+
Sbjct  428  PADEIWASYLVQ  439



>gb|KDO86338.1| hypothetical protein CISIN_1g015417mg [Citrus sinensis]
Length=407

 Score =   213 bits (543),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 182/271 (67%), Positives = 209/271 (77%), Gaps = 15/271 (6%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LS+EAAN  +  LR QLEPFR  ADE++PWEEKSAA RL+NK  K KRNKLWRKRKRK V
Sbjct  100  LSVEAANYFMGKLRVQLEPFRFVADETTPWEEKSAAIRLANKARKSKRNKLWRKRKRKCV  159

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE LA + +RFEQAD+EADEWRAREIAKD+A +KVEKM EIAK K +EE++KLESELEL 
Sbjct  160  AEMLAKKHERFEQADREADEWRAREIAKDMAKRKVEKMNEIAKLKAREEKKKLESELELV  219

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            L+VEKLQELRSIRI+KLKKQG FLPEEDDKFLERV+AAVEEEERQA+AAA T AA+DAIA
Sbjct  220  LVVEKLQELRSIRIRKLKKQGHFLPEEDDKFLERVRAAVEEEERQALAAADTDAARDAIA  279

Query  567  naEESRKATQSYKPDSKDAKDEKEHGNNDV----KDKITTSSSEKEHGNNGGGGS-----  719
             AEESRKA Q+ +P  KD         +DV    KD ++ S   +E  +N   GS     
Sbjct  280  TAEESRKAIQNSEPLLKDG-----SCIDDVIKENKDGVSESKYLRETSDNADKGSVRPGY  334

Query  720  -SAYDSVSNLPMEFYHYYYGSNHDMGTLIEV  809
               YD VSNLPMEFYHYY+GSN D+GTLI V
Sbjct  335  AGVYDHVSNLPMEFYHYYHGSNTDVGTLIGV  365



>gb|EAZ11108.1| hypothetical protein OsJ_00956 [Oryza sativa Japonica Group]
Length=434

 Score =   209 bits (532),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 176/318 (55%), Positives = 218/318 (69%), Gaps = 10/318 (3%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E L+ +AAN L S ++  L P   A ++  PWEE+ A  RL+ KL K KRNK WRKRK
Sbjct  118  THESLATDAANYLCSQIQNLLAPIYPAVNQGGPWEERYAMIRLAQKLQKSKRNKRWRKRK  177

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    E   +++ D+EADEWRAR+IAKD+A +KVE MK+IAK+K  EER++LESE
Sbjct  178  RKHVAELFQKEHADYDRIDQEADEWRARQIAKDMAQRKVENMKQIAKKKANEERKRLESE  237

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaak  554
                +  E+L+ +    I  +   G FLPEEDDK+LERVKAAVEEEERQA +AA T AAK
Sbjct  238  AW-IIGFERLKSIMPSAICSVDGIGHFLPEEDDKYLERVKAAVEEEERQAASAARTDAAK  296

Query  555  daianaEESRKATQ---SYKPDSKDAKD----EKEHGNNDVKDKITTSSSEKEH--GNNG  707
            DAI  AEESRKA Q   S + DS  AK     E+   +  +  +   +S + EH    + 
Sbjct  297  DAILTAEESRKAVQCSNSREDDSDQAKSAPTLEQNQRDPGISGRNHHASQKTEHELHKDD  356

Query  708  GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPA  887
              G   YDSVS+LP EFYHYY+GS++DMGTLIEVRR WDS+IR GGSRIPGHWVQPPPPA
Sbjct  357  SKGHGHYDSVSSLPFEFYHYYHGSSYDMGTLIEVRRMWDSFIRAGGSRIPGHWVQPPPPA  416

Query  888  DEIWASCLVKP*INSTST  941
            DE+WAS LV+P   S ST
Sbjct  417  DEVWASYLVQPNCPSNST  434



>gb|AAC62886.1| hypothetical protein [Arabidopsis thaliana]
Length=342

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 188/264 (71%), Gaps = 17/264 (6%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E+LS++AAN+L+STLRAQLEPFR   DE+SPWEEKSAA RL+ K+ K  RNKLW+KRKR+
Sbjct  92   EMLSVDAANSLMSTLRAQLEPFRFVVDENSPWEEKSAAVRLTCKMKKSIRNKLWKKRKRR  151

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
              AE  A E +RFEQAD+EADEWR +E+AKD+AN+KV++MK I K K K ER++LE ELE
Sbjct  152  CAAEMRAKEPERFEQADREADEWREKEMAKDMANRKVDEMKAIEKIKAKRERKRLEPELE  211

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG FLPEEDDKF E V+AAVE+EE Q   +      ++ 
Sbjct  212  LALIVEEMQELRSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEENQ-AQSLINTETEEH  270

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDV-KDKITTSSSEKEHGNNGGGGSSAYDSV  737
            +  +EE+   T S K             NND  KD  T ++S +        G    D++
Sbjct  271  VIASEENTTLTTSNK------------TNNDTDKDSNTNAASCERTMKAPDNGC---DNI  315

Query  738  SNLPMEFYHYYYGSNHDMGTLIEV  809
            SNLP+E YHYYYGSN DMG LIEV
Sbjct  316  SNLPVEVYHYYYGSNIDMGRLIEV  339



>ref|XP_001769104.1| predicted protein [Physcomitrella patens]
 gb|EDQ66078.1| predicted protein [Physcomitrella patens]
Length=483

 Score =   194 bits (492),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 203/311 (65%), Gaps = 14/311 (5%)
 Frame = +3

Query  30   SLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrVA  209
            ++EAA  L + +   L P   A      WE  +AA RL  K DK +R++ WRKRKR+R+A
Sbjct  160  TVEAALELQNRVTNLLAPLEGALGAPEGWEHAAAAARLRTKRDKIQRSRRWRKRKRQRIA  219

Query  210  EKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelAL  389
            E    E++ FE+AD   DEWRAREIAK +A  K+EKMKE+A++K KE+R +LE+ELE+ L
Sbjct  220  ETHRKEQESFEEADHNVDEWRAREIAKSIARSKMEKMKEVAEKKAKEDRARLEAELEMVL  279

Query  390  MVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaian  569
            MVEKLQELR++RIQKLKKQG F P+EDDKF++RV+AAV+EEERQA AAA   AA  AIA 
Sbjct  280  MVEKLQELRALRIQKLKKQGCFFPDEDDKFMDRVRAAVQEEERQAAAAADFRAAAAAIAI  339

Query  570  aEESRKATQSYKPDSKDAKDEK---------EHGNNDVK-----DKITTSSSEKEHGNNG  707
            A ++ K T      SK   D +         E  +N V+       +  ++    +  N 
Sbjct  340  AAKAAKVTGQVSTASKADGDRQLEIQLEETSERDSNTVRIDPADQNVVETTISSSNAQNA  399

Query  708  GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPA  887
             G  +       LP EF+H+YYGS  D+G LIEVRR WD+Y+ PGGSRIPGHWV+ PPPA
Sbjct  400  QGIGATIQEAYKLPAEFHHFYYGSQVDLGALIEVRRAWDAYLMPGGSRIPGHWVEAPPPA  459

Query  888  DEIWASCLVKP  920
            D IWA+ LV+P
Sbjct  460  DAIWATYLVQP  470



>gb|EMS59979.1| hypothetical protein TRIUR3_26828 [Triticum urartu]
Length=681

 Score =   190 bits (482),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 155/313 (50%), Positives = 200/313 (64%), Gaps = 36/313 (12%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E L+ +AAN L S L+  L P   A ++  PW EK+A   L+ KL K KRNK WRKRK
Sbjct  311  THESLATDAANYLCSQLQHLLAPISSAINQDGPWAEKTAMVSLAQKLQKSKRNKRWRKRK  370

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    E   F++ D+EADEWRAR+IA D+A +KVE MK+                
Sbjct  371  RKHVAELFQKESAEFDRVDQEADEWRARQIANDIAKRKVESMKQ----------------  414

Query  375  lelALMVEKLQELRSIRIQKLKKQ-GRFLPEEDDKFLervkaaveeeerQamaaagtgaa  551
                +  +K  E R    ++L+ +   FLPEEDDK+LERVKAAVEEEERQA  AA T AA
Sbjct  415  ----IAKKKANEER----KRLESEVSHFLPEEDDKYLERVKAAVEEEERQAATAARTDAA  466

Query  552  kdaianaEESRKATQSY--------KPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNG  707
            KDAI  AEESRKA  +         +P S  A  E+  G+  + ++   +S + EH +  
Sbjct  467  KDAILTAEESRKAAHNTTAQEDGLGQPKSGSAP-EQNQGDASISERSDHASQKTEHDDQK  525

Query  708  G--GGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPP  881
                G +  +S++NLP EFYHYY+GS++D+GTLIEVRR WDS+IRPGGSRIPGHWVQPPP
Sbjct  526  VEIKGPAHSESLTNLPFEFYHYYHGSSYDLGTLIEVRRMWDSFIRPGGSRIPGHWVQPPP  585

Query  882  PADEIWASCLVKP  920
            PA+++WAS LV+P
Sbjct  586  PANDVWASYLVQP  598



>gb|EMT23559.1| hypothetical protein F775_01827 [Aegilops tauschii]
Length=528

 Score =   184 bits (468),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 168/323 (52%), Positives = 209/323 (65%), Gaps = 25/323 (8%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E L+ +AAN L S L+  L P   A ++  PW EKSA   L+ KL K KRNK WRKRK
Sbjct  168  THESLATDAANYLCSQLQHLLAPISSAINQDGPWAEKSAMVSLAQKLQKSKRNKRWRKRK  227

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    E   F++ D+EADEWRAR+I+ D+A +KVE MK+IAK+K  EER++LESE
Sbjct  228  RKHVAELFQKESAEFDRIDQEADEWRARQISNDIAKRKVESMKQIAKKKANEERKRLESE  287

Query  375  lelALMVEKLQELRSIRIQKLKKQGR---------FLPEEDDKFLervkaaveeeerQam  527
              L +      +       +    GR         FLPEEDDK+LERVKAAVEEEERQA 
Sbjct  288  YYL-IPTNYFLKTNLPFTARACSNGRETTGAPLCHFLPEEDDKYLERVKAAVEEEERQAA  346

Query  528  aaagtgaakdaianaEESRKATQSY--------KPDSKDAKDEKEHGNNDVKDKITTSSS  683
             AA T AAKDAI  AEESRKA            +P S  A  E+  G+  + ++   +S 
Sbjct  347  TAARTDAAKDAILTAEESRKAAHHTTAQEDGLGQPKSGSAP-EQNQGDASISERSDHASQ  405

Query  684  EKEHGNNG----GGGSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSR  851
            + EH        G G S  +S++NLP EFYHYY+GS++D+GTLIEVRR WDS+IRPGGSR
Sbjct  406  KTEHDGQKVEIKGPGHS--ESLTNLPFEFYHYYHGSSYDLGTLIEVRRMWDSFIRPGGSR  463

Query  852  IPGHWVQPPPPADEIWASCLVKP  920
            IPGHWVQPPPPA+E+WAS LV+P
Sbjct  464  IPGHWVQPPPPANEVWASYLVQP  486



>ref|XP_006396962.1| hypothetical protein EUTSA_v10028732mg [Eutrema salsugineum]
 gb|ESQ38415.1| hypothetical protein EUTSA_v10028732mg [Eutrema salsugineum]
Length=363

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 187/266 (70%), Gaps = 19/266 (7%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E LS+EAAN+L+ TLR QLEPF    +E+ PWEEKSAA RL+ K+ K KRNKLW+KRKR+
Sbjct  92   ETLSVEAANSLMPTLRTQLEPFSFVVNENCPWEEKSAAVRLTCKMKKSKRNKLWKKRKRR  151

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
            RVAE  A E +RFE AD+EADEWR +E+AKD+AN+KV++MK I K K K ERR+LE ELE
Sbjct  152  RVAELRAKEPERFEHADQEADEWREKEMAKDMANRKVDEMKAIEKIKAKRERRRLEPELE  211

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakda  560
            LAL+VE++QELRS+RI+KLKKQG FLPEEDDKF E V+AAVE+EE QA     T   ++ 
Sbjct  212  LALIVEEMQELRSLRIEKLKKQGHFLPEEDDKFFESVRAAVEQEETQAQFLTNTENEENV  271

Query  561  ianaEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEK--EHGNNGGGGSSAYDS  734
            I + E+    T      +K+ KD  +  N         +SSEK  E   N G      D+
Sbjct  272  ITSEEDITLTT-----GNKNNKDTDKESN------AVAASSEKTMEAPYNVG------DN  314

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVR  812
            VS+LP+E YHYYYGSN +MG LIE R
Sbjct  315  VSSLPVEMYHYYYGSNFEMGRLIETR  340



>ref|XP_002982955.1| hypothetical protein SELMODRAFT_422277 [Selaginella moellendorffii]
 gb|EFJ16200.1| hypothetical protein SELMODRAFT_422277 [Selaginella moellendorffii]
Length=337

 Score =   163 bits (412),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 155/280 (55%), Gaps = 50/280 (18%)
 Frame = +3

Query  75   LEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrVAEKLAMERDRFEQADK  254
            L P +   D ++ WE+ +A  +   +  K K N+  RK KR+  AEK  M    FE+AD+
Sbjct  102  LLPLQGVVDGTAAWEQLTAVAKFRERRMKLKSNRKRRKIKRQHEAEKRRMADKLFEEADR  161

Query  255  EADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelALMVEKLQELRSIRIQK  434
            +A+EWR REIA+D+A +K                     ++E+ L+VEKLQELRS+R+QK
Sbjct  162  QAEEWRTREIARDIAKKK---------------------QMEMVLLVEKLQELRSLRVQK  200

Query  435  LKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaianaEESRKATQSYKPDS  614
            LKKQG   PE+DD F+E V+AAVE EERQA                     AT    P +
Sbjct  201  LKKQGHLFPEDDDAFMESVRAAVEAEERQAAG-------------------ATAEALPAN  241

Query  615  KDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVSNLPMEFYHYYYGSNHDMG  794
             +A++      N +K+     S+ K          ++ +    LP + Y YYYGS  DMG
Sbjct  242  AEARNPSTDDENTIKEAPPQPSNTK----------TSEEPDQRLPADLYRYYYGSRIDMG  291

Query  795  TLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLV  914
            TLIEVRR WD+YI P GSRIPGHWVQP  P+ E WASCL+
Sbjct  292  TLIEVRRGWDTYIVPVGSRIPGHWVQPVAPSSEAWASCLI  331



>ref|XP_008356930.1| PREDICTED: uncharacterized protein LOC103420656 [Malus domestica]
Length=315

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 87/125 (70%), Gaps = 10/125 (8%)
 Frame = +3

Query  576  ESRKATQSYKPDSKD-------AKDEKEHGNNDVKDKITTSSSEKEHG---NNGGGGSSA  725
            E  K     KPDSKD        K+ K+          +TS + K++G   + G G S A
Sbjct  190  EDMKKIAKLKPDSKDESSDRDETKESKDQTTPSTNAGTSTSVTNKDYGKQVSQGEGHSGA  249

Query  726  YDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWAS  905
            YD+V NLP+EFYHYY+GSN DMGTLIEVRRTWD+YIRPGGSRIPGHWVQPPPPAD+IWAS
Sbjct  250  YDAVVNLPIEFYHYYHGSNTDMGTLIEVRRTWDAYIRPGGSRIPGHWVQPPPPADDIWAS  309

Query  906  CLVKP  920
             LV+P
Sbjct  310  YLVQP  314


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LSLEAANAL++ L+ +LEPFR+   E  PWEEKSA  RL+NK+ K KRNK WRK KRKR+
Sbjct  95   LSLEAANALMAKLQVELEPFRMITHEMCPWEEKSAVVRLANKMRKTKRNKRWRKAKRKRI  154

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKV  311
            AE +A ER+RFE+AD+EADEWRAREIAKD+A +K+
Sbjct  155  AEMIAEERERFEEADREADEWRAREIAKDIAKRKM  189



>gb|KHN06189.1| hypothetical protein glysoja_031631 [Glycine soja]
Length=350

 Score =   146 bits (369),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 122/162 (75%), Gaps = 6/162 (4%)
 Frame = +3

Query  447  GRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaianaEESRKATQSYKPDSKDAK  626
            G FLPEEDDKFLE+V+AAVEEEER+A+AA  T AAKDAIA AEESRKA Q+    SK   
Sbjct  190  GHFLPEEDDKFLEKVQAAVEEEEREALAAVETDAAKDAIATAEESRKAIQNQGKLSKRGN  249

Query  627  DEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAY----DSVSNLPMEFYHYYYGSNHDMG  794
            D+ E    + K++I  S +E+  G      SS      D ++NLP+EFYHYY+GSN+DMG
Sbjct  250  DDSE--VKESKEQIVHSVTEEGSGAVDEKKSSKIGQISDPLANLPIEFYHYYHGSNNDMG  307

Query  795  TLIEVRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLVKP  920
            TLIEVRR W++YIRPGGSRIPGHWVQP PPA+EIWAS LV+P
Sbjct  308  TLIEVRRGWNAYIRPGGSRIPGHWVQPLPPANEIWASYLVRP  349



>ref|XP_008375943.1| PREDICTED: chromatin assembly factor 1 subunit A-like, partial 
[Malus domestica]
Length=212

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            LSLEAANAL++ L+ +LEPFR+   E  PWEEKSA  RL+NK+ K KRNK WRK KRKR+
Sbjct  38   LSLEAANALMAKLQVELEPFRMITHEMCPWEEKSAVVRLANKMRKTKRNKRWRKAKRKRI  97

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelA  386
            AE +A ER+RFE+AD+EADEWRAREIAKD+A +K+E MK+IAK K KEER++LESELE  
Sbjct  98   AEMIAEERERFEEADREADEWRAREIAKDIAKRKMEDMKKIAKLKAKEERKRLESELETV  157

Query  387  LMVEKLQELRSIRIQKLKKQGRFLPEEDDKFL  482
            L+VEKLQ+LRSIRI+KLKKQG FLPEEDDKFL
Sbjct  158  LIVEKLQQLRSIRIEKLKKQGHFLPEEDDKFL  189



>gb|EPS64362.1| hypothetical protein M569_10419, partial [Genlisea aurea]
Length=295

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrk  200
            E ++++AAN+ +S LR QLEPFRI  DE +PWEEK A +   +K++K+KRNKLWRKRKRK
Sbjct  62   ESIAIDAANSTLSKLRVQLEPFRIITDEKTPWEEKCALKSSVDKMEKHKRNKLWRKRKRK  121

Query  201  rVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklesele  380
             +AE LA E + F + DK A+EWR+RE AKD+A  KV+KMKEIAK K K+ ++ L+SELE
Sbjct  122  AIAENLAREHENFNEKDKAANEWRSRETAKDIAQLKVDKMKEIAKLKTKQGKKSLQSELE  181

Query  381  lALMVEKLQELRSIRIQKLKKQGRFLPEEDDKFL  482
            L LM+EK+QELR +R++KLKKQGRF P+EDD+F+
Sbjct  182  LVLMIEKVQELRKLRVEKLKKQGRFFPDEDDRFV  215


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = +3

Query  714  GSSAYDSVSNLPM-EFYHYYYGSNHDMGTLIEVRRTWDSYIRPGG  845
             SS+ D V  L   EFYHYY+GS+ D+GTLIEVRR WD+++R GG
Sbjct  251  SSSSCDYVHQLLHPEFYHYYHGSSTDLGTLIEVRRQWDAFLRAGG  295



>ref|NP_001132738.1| uncharacterized protein LOC100194225 [Zea mays]
 ref|XP_008679632.1| PREDICTED: uncharacterized protein LOC103654569 isoform X1 [Zea 
mays]
 ref|XP_008679633.1| PREDICTED: uncharacterized protein LOC103654569 isoform X1 [Zea 
mays]
 ref|XP_008679634.1| PREDICTED: uncharacterized protein LOC103654569 isoform X1 [Zea 
mays]
 ref|XP_008661471.1| PREDICTED: uncharacterized protein LOC100194225 isoform X1 [Zea 
mays]
 ref|XP_008661472.1| PREDICTED: uncharacterized protein LOC100194225 isoform X1 [Zea 
mays]
 gb|ACF81717.1| unknown [Zea mays]
 gb|ACG35278.1| hypothetical protein [Zea mays]
Length=176

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E ++ +AAN L   L+  L P   A  +S PWEE+SA  RL+ KL K KRNK WR+R+
Sbjct  7    THESMATDAANYLCHQLQHLLGPISSATSQSGPWEERSAMVRLTQKLQKSKRNKRWRQRR  66

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK V E    ER  +++ D+EADEWRA++IAKD+A Q+VE M++IA++K   ER++LESE
Sbjct  67   RKHVEELFQKERADYDRVDQEADEWRAKQIAKDIAKQRVESMQQIARKKTNVERKRLESE  126

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFL  458
            LELALMVEKLQELRSIR+QK+KKQ  +L
Sbjct  127  LELALMVEKLQELRSIRVQKMKKQDPYL  154



>ref|XP_008679635.1| PREDICTED: uncharacterized protein LOC103654569 isoform X2 [Zea 
mays]
 ref|XP_008661473.1| PREDICTED: uncharacterized protein LOC100194225 isoform X2 [Zea 
mays]
Length=172

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E ++ +AAN L   L+  L P   A  +S PWEE+SA  RL+ KL K KRNK WR+R+
Sbjct  7    THESMATDAANYLCHQLQHLLGPISSATSQSGPWEERSAMVRLTQKLQKSKRNKRWRQRR  66

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK V E    ER  +++ D+EADEWRA++IAKD+A Q+VE M++IA++K   ER++LESE
Sbjct  67   RKHVEELFQKERADYDRVDQEADEWRAKQIAKDIAKQRVESMQQIARKKTNVERKRLESE  126

Query  375  lelALMVEKLQELRSIRIQKLKKQGRFL  458
            LELALMVEKLQELRSIR+QK+KKQ  +L
Sbjct  127  LELALMVEKLQELRSIRVQKMKKQDPYL  154



>ref|XP_002981977.1| hypothetical protein SELMODRAFT_421352 [Selaginella moellendorffii]
 gb|EFJ17070.1| hypothetical protein SELMODRAFT_421352 [Selaginella moellendorffii]
Length=322

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 116/245 (47%), Gaps = 52/245 (21%)
 Frame = +3

Query  75   LEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrVAEKLAMERDRFEQADK  254
            L P +   D ++ WE+ +A  +   +  K K N+  RK KR+  AEK  M     E+AD+
Sbjct  102  LLPLQGVVDGTAAWEQLTAVAKFRERRMKLKSNRKRRKIKRQHEAEKRRMADKLLEEADR  161

Query  255  EADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelALMVEKLQELRSIRIQK  434
            +A+EWR RE A+D+A +K                     ++E+ L+VEKLQELRS+R+QK
Sbjct  162  QAEEWRTREFARDIAKKK---------------------QMEMVLLVEKLQELRSLRVQK  200

Query  435  LKKQGRFLPEEDDKFLervkaaveeeerQamaaagtgaakdaianaEESRKATQSYKPDS  614
            LKKQG   PE+DD F+                              E  R A ++ +  +
Sbjct  201  LKKQGHLFPEDDDAFM------------------------------EGVRAAVEAEERQA  230

Query  615  KDAKDEKEHGNNDVKDKIT-TSSSEKEHGNNGGGGSSAYDSVSNLPMEFYHYYYGSNHDM  791
              A DE    N + ++  T   ++ KE         ++ +    LP + Y YYYGS  DM
Sbjct  231  AGAADEALPANAEARNPSTDDENTIKEAPPQPSNTKTSEEPDQRLPADLYRYYYGSRIDM  290

Query  792  GTLIE  806
            GTLIE
Sbjct  291  GTLIE  295



>emb|CDY42013.1| BnaC04g00910D [Brassica napus]
Length=54

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  807  VRRTWDSYIRPGGSRIPGHWVQPPPPADEIWASCLVK  917
            +RR WD+Y+ PGGSRIPGHWVQP PPA+EIWASCLVK
Sbjct  11   IRREWDAYLSPGGSRIPGHWVQPTPPANEIWASCLVK  47



>gb|AFW64960.1| hypothetical protein ZEAMMB73_055802 [Zea mays]
Length=364

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E ++ +AAN L   L+  L P   A  +S PWEE+S   RL+ KL K KRNK WR+R+
Sbjct  7    THESMATDAANYLCHQLQHLLGPISSATSQSGPWEERSVMVRLTQKLQKSKRNKWWRQRR  66

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKV  311
            RK VAE    ER  +++ D+EADEWRA++IAKD+A ++V
Sbjct  67   RKHVAELFQKERADYDRVDQEADEWRAKQIAKDIAKRRV  105



>ref|XP_008677751.1| PREDICTED: uncharacterized protein LOC100502364 isoform X1 [Zea 
mays]
Length=226

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 98/147 (67%), Gaps = 2/147 (1%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E ++ +AAN L   L+  L P   A  +S PWEE+S   RL+ KL K KRNK WR+R+
Sbjct  7    THESMATDAANYLCHQLQHLLGPISSATSQSGPWEERSVMVRLTQKLQKSKRNKWWRQRR  66

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    ER  +++ D+EADEWRA++IAKD+A ++VE M++IA++K  EER++LESE
Sbjct  67   RKHVAELFQKERADYDRVDQEADEWRAKQIAKDIAKRRVESMQQIARKKTNEERKRLESE  126

Query  375  lelALMVEKLQELRSIRIQKLKKQGRF  455
               A + E  +  RS+R+ + ++   F
Sbjct  127  QSAACLQENFR--RSVRVLQFRRCSSF  151



>ref|NP_001183771.1| uncharacterized protein LOC100502364 [Zea mays]
 gb|ACR38259.1| unknown [Zea mays]
Length=213

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 98/147 (67%), Gaps = 2/147 (1%)
 Frame = +3

Query  15   SFELLSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrk  194
            + E ++ +AAN L   L+  L P   A  +S PWEE+S   RL+ KL K KRNK WR+R+
Sbjct  7    THESMATDAANYLCHQLQHLLGPISSATSQSGPWEERSVMVRLTQKLQKSKRNKWWRQRR  66

Query  195  rkrVAEKLAMERDRFEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrklese  374
            RK VAE    ER  +++ D+EADEWRA++IAKD+A ++VE M++IA++K  EER++LESE
Sbjct  67   RKHVAELFQKERADYDRVDQEADEWRAKQIAKDIAKRRVESMQQIARKKTNEERKRLESE  126

Query  375  lelALMVEKLQELRSIRIQKLKKQGRF  455
               A + E  +  RS+R+ + ++   F
Sbjct  127  QSAACLQENFR--RSVRVLQFRRCSSF  151



>ref|XP_002970851.1| hypothetical protein SELMODRAFT_411484 [Selaginella moellendorffii]
 gb|EFJ28177.1| hypothetical protein SELMODRAFT_411484 [Selaginella moellendorffii]
Length=325

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 21/81 (26%)
 Frame = +3

Query  237  FEQADKEADEWRAREIAKDVANQKVekmkeiakrkekeerrkleselelALMVEKLQELR  416
            FE+  ++A+EWR REIA+D+A ++                     ++E+ L+VEKLQELR
Sbjct  236  FEEPYRQAEEWRTREIARDIAKKR---------------------QMEMVLVVEKLQELR  274

Query  417  SIRIQKLKKQGRFLPEEDDKF  479
            S+R+QKLKKQG   PE+DD F
Sbjct  275  SLRVQKLKKQGHLFPEDDDAF  295



>dbj|BAK04294.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +3

Query  27   LSLEAANALISTLRAQLEPFRIAADESSPWEEKSAAQRLSNKLDkykrnklwrkrkrkrV  206
            L+ +AAN L S L+  L P   A ++  PW E+SA   L+ KL K KRNK WRKRKRK V
Sbjct  148  LATDAANYLCSQLQHLLAPISSAINQDGPWAERSAMVSLAQKLQKSKRNKRWRKRKRKHV  207

Query  207  AEKLAMERDRFEQADKEADEWRAREIAKDVANQKV  311
            AE    E   F++ D+EADEWRAR+IA D+A +KV
Sbjct  208  AELFQKESAEFDKIDQEADEWRARQIANDIAKRKV  242



>ref|XP_006628893.1| PREDICTED: programmed cell death protein 7-like [Lepisosteus 
oculatus]
Length=590

 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 4/58 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCLVK  917
            F  YY  + H +  LI++RR WD Y+     P GS IP  WV P PP+DE+WA+ LVK
Sbjct  531  FRQYYLQAEHSLHALIQIRREWDQYLVPVGHPDGSFIPHGWVLPEPPSDEVWATALVK  588



>ref|XP_009047920.1| hypothetical protein LOTGIDRAFT_111632, partial [Lottia gigantea]
 gb|ESP01286.1| hypothetical protein LOTGIDRAFT_111632, partial [Lottia gigantea]
Length=237

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYIR----PGGSRIPGHWVQPPPPADEIWASCL  911
            FY YY  +N +  + +++R++WD YI      G SRIP  WV PP P+++ WA  L
Sbjct  180  FYQYYNQANENFTSFLQIRQSWDCYIVENYVSGSSRIPDGWVLPPLPSNDTWAKYL  235



>ref|XP_007532432.1| PREDICTED: programmed cell death protein 7 [Erinaceus europaeus]
Length=205

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS +P  WV PP P++++WA
Sbjct  140  LAHLLQPFQQYYLQAEHSLPALIQIRHDWDQYLVPADHPKGSSVPQGWVLPPLPSNDVWA  199

Query  903  SCLVKP  920
            + +  P
Sbjct  200  TAVKLP  205



>gb|AAH93108.2| Programmed cell death 7 [Danio rerio]
Length=508

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 4/58 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCLVK  917
            F  YY  +   +  LIE+RR WD ++     P G+ IP  W+ P PPADEIWA+ L K
Sbjct  451  FLDYYTQAERSLPALIEIRREWDQFLVSVDHPDGTSIPNGWIVPEPPADEIWATALEK  508



>ref|NP_001003415.1| programmed cell death protein 7 [Danio rerio]
 gb|AAT68065.1| PCD7/ES18-like [Danio rerio]
Length=508

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 4/58 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCLVK  917
            F  YY  +   +  LIE+RR WD ++     P G+ IP  W+ P PPADEIWA+ L K
Sbjct  451  FLDYYTQAERSLPALIEIRREWDQFLVSVDHPDGTSIPNGWIVPEPPADEIWATALEK  508



>gb|ELR53342.1| Programmed cell death protein 7, partial [Bos mutus]
Length=239

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P GS IP  WV PP P+++IWA
Sbjct  174  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGSSIPQGWVLPPLPSNDIWA  233

Query  903  SCL  911
            + +
Sbjct  234  TAV  236



>ref|XP_005955773.1| PREDICTED: programmed cell death protein 7, partial [Pantholops 
hodgsonii]
Length=247

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P GS IP  WV PP P+++IWA
Sbjct  182  LTHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGSSIPQGWVLPPLPSNDIWA  241

Query  903  SCL  911
            + +
Sbjct  242  TAV  244



>ref|XP_008706902.1| PREDICTED: programmed cell death protein 7, partial [Ursus maritimus]
Length=233

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP 
Sbjct  161  GDPAEFPLAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPL  220

Query  882  PADEIWASCL  911
            P+++IWA+ +
Sbjct  221  PSNDIWATAI  230



>ref|XP_007260286.1| PREDICTED: programmed cell death protein 7 [Astyanax mexicanus]
Length=546

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 4/58 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCLVK  917
            F  YY  + H +  LI++RR WD ++     P G+ IP  WV P PPAD++WA+ L K
Sbjct  489  FQEYYTQAEHSLPVLIQIRREWDQFLVPVDHPDGTSIPPCWVLPDPPADDVWATALEK  546



>ref|XP_010512828.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 59 kDa protein-like 
[Camelina sativa]
Length=130

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  21   ELLSLEAANALISTLRAQLEPFRIAADESSPWEEKS  128
            E+LS+EAAN+L+STLRAQLEPFR   DE++PW ++S
Sbjct  95   EILSVEAANSLMSTLRAQLEPFRFVVDENTPWXKES  130



>ref|XP_006770891.1| PREDICTED: programmed cell death protein 7, partial [Myotis davidii]
Length=218

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  153  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPEGNSVPQGWVLPPLPSNDIWA  212

Query  903  SCLVKP  920
            + +  P
Sbjct  213  TAIKLP  218



>ref|XP_006141858.1| PREDICTED: programmed cell death protein 7, partial [Tupaia chinensis]
Length=240

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (58%), Gaps = 4/66 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ IP  WV PP P+++IWA
Sbjct  175  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFIPQGWVLPPLPSNDIWA  234

Query  903  SCLVKP  920
            + +  P
Sbjct  235  TAIKLP  240



>gb|EXX78682.1| hypothetical protein RirG_012920 [Rhizophagus irregularis DAOM 
197198w]
Length=407

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI-RPGGSRIPGHWVQPPPPADEIWASCLV  914
             Y Y++ +  D+  L+ +RR WD YI   G S IP  +V P PPA+ IWASCL 
Sbjct  352  VYEYWHQAEFDLDNLVLIRRQWDVYISETGSSCIPPTFVDPSPPANYIWASCLT  405



>ref|XP_007084717.1| PREDICTED: programmed cell death protein 7 [Panthera tigris altaica]
Length=231

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  166  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  225

Query  903  SCL  911
            + +
Sbjct  226  TAI  228



>ref|XP_006886720.1| PREDICTED: programmed cell death protein 7 [Elephantulus edwardii]
Length=485

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P GS +P  WV PP P+++IWA
Sbjct  420  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGSSVPQGWVLPPLPSNDIWA  479

Query  903  SCL  911
            + L
Sbjct  480  TAL  482



>gb|ERZ96337.1| hypothetical protein GLOINDRAFT_340698 [Rhizophagus irregularis 
DAOM 181602]
Length=403

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI-RPGGSRIPGHWVQPPPPADEIWASCLV  914
             Y Y++ +  D+  L+ +RR WD YI   G S IP  +V P PPA+ IWASCL 
Sbjct  348  VYEYWHQAEFDLDNLVLIRRQWDVYISETGSSCIPPTFVDPSPPANYIWASCLT  401



>ref|XP_010832909.1| PREDICTED: programmed cell death protein 7 [Bison bison bison]
Length=317

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P GS IP  WV PP P+++IWA
Sbjct  252  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGSSIPQGWVLPPLPSNDIWA  311

Query  903  SCL  911
            + +
Sbjct  312  TAV  314



>gb|KFO25991.1| Programmed cell death protein 7, partial [Fukomys damarensis]
Length=238

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD ++ P     GS +P  WV PP P+++IWA
Sbjct  173  LAHLLQPFRQYYLQAEHSVPALIQIRHDWDQFLVPADHPKGSSVPQGWVLPPLPSNDIWA  232

Query  903  SCL  911
            S +
Sbjct  233  STV  235



>ref|XP_005861190.1| PREDICTED: programmed cell death protein 7, partial [Myotis brandtii]
Length=220

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  155  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPEGNSVPQGWVLPPLPSNDIWA  214

Query  903  SCL  911
            + +
Sbjct  215  TAI  217



>gb|EPQ04496.1| Programmed cell death protein 7, partial [Myotis brandtii]
Length=218

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  153  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPEGNSVPQGWVLPPLPSNDIWA  212

Query  903  SCL  911
            + +
Sbjct  213  TAI  215



>gb|EGW10981.1| Programmed cell death protein 7 [Cricetulus griseus]
Length=196

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  131  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPIPSNDIWA  190

Query  903  SCL  911
            + +
Sbjct  191  TAV  193



>gb|EKC32192.1| Programmed cell death protein 7 [Crassostrea gigas]
Length=379

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 84/180 (47%), Gaps = 21/180 (12%)
 Frame = +3

Query  390  MVEKLQELRSIRIQKLKKQGRFL-PEEDDKFLervkaaveeeerQamaaagtgaakdaia  566
            +++ +Q+LR +R  +LK+QG    P  D+KF E +    E  ++Q               
Sbjct  212  LLKGIQKLRKLRSDRLKQQGVHTNPASDEKFKEVMDEQFETVKKQKDIYLA---------  262

Query  567  naEESRKATQSYKPDSKDAKDEKEHGNNDVKDKITTSSSEKEHGNNGGGGSSAYDSVSNL  746
               E R      + + +++K EKE    +  +K+      K       G S ++      
Sbjct  263  ---EERALRVMLETEHEESK-EKEREQQEKLNKLKKERENKRTEEILFGKSESFSGED--  316

Query  747  PMEFYHYYYG-SNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            PM  +H YY  +N++  + I++R  WD ++     PGG+RIP H+V P  P+ + WAS L
Sbjct  317  PMLLFHQYYDQANYNYDSFIQIRCDWDRFVIPDSAPGGTRIPTHFVTPAEPSSDQWASAL  376



>gb|AAH22772.2| Pdcd7 protein, partial [Mus musculus]
Length=187

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  122  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  181

Query  903  SCL  911
            + +
Sbjct  182  TAI  184



>ref|XP_007105223.1| PREDICTED: programmed cell death protein 7 [Physeter catodon]
Length=199

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  134  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHRKGNYVPQGWVLPPLPSNDIWA  193

Query  903  SCL  911
            + +
Sbjct  194  TAI  196



>ref|XP_008308908.1| PREDICTED: LOW QUALITY PROTEIN: programmed cell death protein 
7 [Cynoglossus semilaevis]
Length=403

 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            V  L   F +YY  + H +  L+++RR WD +I     P GS +P  WV P PP+D+ WA
Sbjct  335  VDLLLQPFRNYYTQAEHSLHALVQIRRDWDGFIVGADHPEGSSVPQSWVIPDPPSDKDWA  394

Query  903  SCL  911
              L
Sbjct  395  VAL  397



>ref|XP_006920617.1| PREDICTED: programmed cell death protein 7, partial [Pteropus 
alecto]
Length=296

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  231  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  290

Query  903  SCL  911
            + +
Sbjct  291  TAI  293



>ref|XP_005900055.1| PREDICTED: programmed cell death protein 7 [Bos mutus]
Length=308

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P GS IP  WV PP P+++IWA
Sbjct  243  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGSSIPQGWVLPPLPSNDIWA  302

Query  903  SCL  911
            + +
Sbjct  303  TAV  305



>ref|XP_004662508.1| PREDICTED: programmed cell death protein 7, partial [Jaculus 
jaculus]
Length=278

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  213  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  272

Query  903  SCL  911
            + +
Sbjct  273  TAI  275



>ref|XP_004628990.1| PREDICTED: programmed cell death protein 7 [Octodon degus]
Length=415

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS +P  WV PP P++++WA
Sbjct  350  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPADHPKGSSVPQGWVLPPLPSNDVWA  409

Query  903  SCL  911
            S +
Sbjct  410  SAM  412



>ref|XP_004374725.1| PREDICTED: programmed cell death protein 7 [Trichechus manatus 
latirostris]
Length=291

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  226  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  285

Query  903  SCL  911
            + +
Sbjct  286  TAI  288



>ref|XP_004010920.1| PREDICTED: programmed cell death protein 7 [Ovis aries]
Length=306

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P GS IP  WV PP P+++IWA
Sbjct  241  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGSSIPQGWVLPPLPSNDIWA  300

Query  903  SCL  911
            + +
Sbjct  301  TAV  303



>ref|XP_007645908.1| PREDICTED: programmed cell death protein 7 isoform X1, partial 
[Cricetulus griseus]
Length=254

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  189  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPIPSNDIWA  248

Query  903  SCL  911
            + +
Sbjct  249  TAV  251



>ref|NP_001102238.1| programmed cell death protein 7 [Rattus norvegicus]
 gb|EDL95821.1| programmed cell death protein 7 (predicted) [Rattus norvegicus]
Length=254

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ IP  WV PP P+++IWA
Sbjct  189  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSIPQGWVLPPLPSNDIWA  248

Query  903  SCL  911
            + +
Sbjct  249  TAV  251



>ref|XP_006184072.1| PREDICTED: programmed cell death protein 7 [Camelus ferus]
Length=171

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  106  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  165

Query  903  SCL  911
            + +
Sbjct  166  TAI  168



>ref|XP_004712045.1| PREDICTED: programmed cell death protein 7 [Echinops telfairi]
Length=320

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            F  YY  + H +  LI++R  WD Y+     P GS IP  WV PP P+++IWA+ +
Sbjct  262  FRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGSSIPQGWVLPPLPSNDIWATAI  317



>ref|XP_005316995.1| PREDICTED: programmed cell death protein 7 [Ictidomys tridecemlineatus]
Length=259

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  194  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  253

Query  903  SCL  911
            + +
Sbjct  254  TAI  256



>ref|XP_007166181.1| PREDICTED: programmed cell death protein 7, partial [Balaenoptera 
acutorostrata scammoni]
Length=251

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  186  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  245

Query  903  SCL  911
            + +
Sbjct  246  TAI  248



>ref|XP_010953640.1| PREDICTED: programmed cell death protein 7, partial [Camelus 
bactrianus]
Length=282

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  217  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  276

Query  903  SCL  911
            + +
Sbjct  277  TAI  279



>ref|XP_007608160.1| PREDICTED: programmed cell death protein 7 isoform X2 [Cricetulus 
griseus]
Length=284

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 4/61 (7%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  219  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPIPSNDIWA  278

Query  903  S  905
            +
Sbjct  279  T  279



>ref|XP_008834751.1| PREDICTED: programmed cell death protein 7 [Nannospalax galili]
Length=379

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  314  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  373

Query  903  SCL  911
            + +
Sbjct  374  TAI  376



>ref|XP_010639589.1| PREDICTED: programmed cell death protein 7 [Fukomys damarensis]
Length=312

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD ++ P     GS +P  WV PP P+++IWA
Sbjct  247  LAHLLQPFRQYYLQAEHSVPALIQIRHDWDQFLVPADHPKGSSVPQGWVLPPLPSNDIWA  306

Query  903  SCL  911
            S +
Sbjct  307  STV  309



>gb|AAD20241.1| ES18 [Homo sapiens]
Length=218

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  153  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  212

Query  903  SCL  911
            + +
Sbjct  213  TAV  215



>ref|XP_006050325.1| PREDICTED: programmed cell death protein 7 [Bubalus bubalis]
Length=432

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV PP P+++IWA
Sbjct  367  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGSSIPQGWVLPPLPSNDIWA  426

Query  903  SCL  911
            + +
Sbjct  427  TAV  429



>ref|XP_006093511.1| PREDICTED: LOW QUALITY PROTEIN: programmed cell death protein 
7 [Myotis lucifugus]
Length=300

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  235  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPEGNSVPQGWVLPPLPSNDIWA  294

Query  903  SCL  911
            + +
Sbjct  295  TAI  297



>ref|XP_006932548.1| PREDICTED: programmed cell death protein 7 [Felis catus]
Length=322

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  257  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  316

Query  903  SCL  911
            + +
Sbjct  317  TAI  319



>ref|XP_006898980.1| PREDICTED: programmed cell death protein 7-like [Elephantulus 
edwardii]
Length=488

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  423  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPEGNSVPQGWVLPPLPSNDIWA  482

Query  903  SCL  911
            + L
Sbjct  483  TAL  485



>gb|ELK05325.1| Programmed cell death protein 7 [Pteropus alecto]
Length=480

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  415  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  474

Query  903  SCL  911
            + +
Sbjct  475  TAI  477



>ref|XP_006209698.1| PREDICTED: programmed cell death protein 7 [Vicugna pacos]
Length=326

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  261  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  320

Query  903  SCL  911
            + +
Sbjct  321  TAI  323



>ref|XP_006979414.1| PREDICTED: programmed cell death protein 7 [Peromyscus maniculatus 
bairdii]
Length=375

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  310  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPIPSNDIWA  369

Query  903  SCL  911
            + +
Sbjct  370  TAV  372



>ref|XP_007955910.1| PREDICTED: programmed cell death protein 7 [Orycteropus afer 
afer]
Length=488

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ IP  WV PP P+++IWA
Sbjct  423  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSIPQGWVLPPLPSNDIWA  482

Query  903  SCL  911
            S +
Sbjct  483  SAV  485



>ref|XP_005952353.1| PREDICTED: programmed cell death protein 7-like [Haplochromis 
burtoni]
Length=134

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            F  YY  + H +  LI VR+ WD+ +     PG S +P  WV P PP+D+ WAS L
Sbjct  69   FRDYYSQAEHSLPALIHVRKEWDTCLVAVDHPGSSSVPQSWVLPNPPSDQAWASAL  124



>ref|XP_004795968.1| PREDICTED: programmed cell death protein 7 [Mustela putorius 
furo]
Length=355

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  290  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  349

Query  903  SCL  911
            + +
Sbjct  350  TAI  352



>ref|NP_001192378.1| programmed cell death protein 7 [Bos taurus]
 tpg|DAA25814.1| TPA: programmed cell death 7-like [Bos taurus]
Length=487

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV PP P+++IWA
Sbjct  422  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGSSIPQGWVLPPLPSNDIWA  481

Query  903  SCL  911
            + +
Sbjct  482  TAV  484



>ref|XP_005148898.1| PREDICTED: programmed cell death protein 7 [Melopsittacus undulatus]
Length=195

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P D+ WA
Sbjct  132  LAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSSIPPGWVLPSLPTDDTWA  191

Query  903  SCL  911
            + +
Sbjct  192  TAV  194



>ref|XP_010349959.1| PREDICTED: programmed cell death protein 7 [Saimiri boliviensis 
boliviensis]
Length=301

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ IP  WV PP P+++IWA
Sbjct  236  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFIPQGWVLPPLPSNDIWA  295

Query  903  SCL  911
            + +
Sbjct  296  TAV  298



>gb|EDL26088.1| programmed cell death protein 7 [Mus musculus]
Length=373

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  308  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  367

Query  903  SCL  911
            + +
Sbjct  368  TAI  370



>ref|XP_004758857.1| PREDICTED: programmed cell death protein 7 [Mustela putorius 
furo]
Length=405

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  340  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  399

Query  903  SCL  911
            + +
Sbjct  400  TAI  402



>ref|XP_004422073.1| PREDICTED: programmed cell death protein 7 [Ceratotherium simum 
simum]
Length=370

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            + +L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  305  LVHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  364

Query  903  SCL  911
            + +
Sbjct  365  TAI  367



>ref|XP_003418413.1| PREDICTED: programmed cell death protein 7 [Loxodonta africana]
Length=489

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  424  LAHLLQPFRQYYLQAEHSVPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  483

Query  903  SCL  911
            + +
Sbjct  484  TAI  486



>gb|EAW77714.1| programmed cell death 7, isoform CRA_b [Homo sapiens]
Length=171

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  106  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  165

Query  903  SCL  911
            + +
Sbjct  166  TAV  168



>gb|EHH63143.1| hypothetical protein EGM_16053 [Macaca fascicularis]
Length=257

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  192  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  251

Query  903  SCL  911
            + +
Sbjct  252  TAV  254



>ref|XP_008137478.1| PREDICTED: programmed cell death protein 7 [Eptesicus fuscus]
Length=399

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  334  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPEGNSVPQGWVLPPLPSNDIWA  393

Query  903  SCL  911
            + +
Sbjct  394  TAI  396



>gb|ERE75716.1| programmed cell death protein 7 [Cricetulus griseus]
Length=345

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 4/65 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  106  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPIPSNDIWA  165

Query  903  SCLVK  917
            + + K
Sbjct  166  TAVPK  170



>gb|AAH92464.1| PDCD7 protein, partial [Homo sapiens]
Length=278

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  213  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  272

Query  903  SCL  911
            + +
Sbjct  273  TAV  275



>ref|XP_008054356.1| PREDICTED: programmed cell death protein 7 [Tarsius syrichta]
Length=282

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (56%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P GS IP  WV P  P+ +IWA
Sbjct  217  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGSFIPQGWVLPLLPSSDIWA  276

Query  903  SCL  911
            + L
Sbjct  277  TAL  279



>ref|XP_010875653.1| PREDICTED: programmed cell death protein 7 [Esox lucius]
Length=617

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            F  YY  +   +  LI++RR WD Y+     P G+ IP  WV P PP DE+WA+ L
Sbjct  554  FLEYYTQAEGSLTALIQIRREWDQYLVSVDHPDGTAIPQDWVIPEPPTDEVWATAL  609



>gb|AAI31705.1| PDCD7 protein, partial [Homo sapiens]
Length=270

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  205  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  264

Query  903  SCL  911
            + +
Sbjct  265  TAV  267



>ref|XP_006831908.1| PREDICTED: programmed cell death protein 7, partial [Chrysochloris 
asiatica]
Length=411

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  346  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  405

Query  903  SCL  911
            + +
Sbjct  406  TAI  408



>gb|KFO97841.1| Programmed cell death protein 7, partial [Calypte anna]
Length=227

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD ++ P     GS IP  WV P  
Sbjct  157  GDPAEFPLAHLLQPFREYYLQAEHSVAALIQIRHEWDRFLVPADHPEGSCIPPGWVLPSL  216

Query  882  PADEIWASCL  911
            P ++ WA+ +
Sbjct  217  PTNDTWATAV  226



>ref|XP_010298668.1| PREDICTED: programmed cell death protein 7, partial [Balearica 
regulorum gibbericeps]
 gb|KFO04545.1| Programmed cell death protein 7, partial [Balearica regulorum 
gibbericeps]
Length=193

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  189

Query  903  SCL  911
            S +
Sbjct  190  SAV  192



>gb|KFO53496.1| Programmed cell death protein 7, partial [Corvus brachyrhynchos]
Length=205

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  
Sbjct  135  GDPAEFPLAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSL  194

Query  882  PADEIWASCL  911
            P ++ WA+ +
Sbjct  195  PTNDTWATAV  204



>ref|XP_008635835.1| PREDICTED: programmed cell death protein 7 [Corvus brachyrhynchos]
Length=202

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  
Sbjct  132  GDPAEFPLAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSL  191

Query  882  PADEIWASCL  911
            P ++ WA+ +
Sbjct  192  PTNDTWATAV  201



>ref|XP_006275728.1| PREDICTED: programmed cell death protein 7 [Alligator mississippiensis]
Length=197

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            + +L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P PP  + WA
Sbjct  134  LGHLLRPFQQYYLQAEHSVPVLIQIRHEWDRYLVPADHPEGSCIPPGWVLPAPPTSDTWA  193

Query  903  SCL  911
            + +
Sbjct  194  TAV  196



>ref|XP_005075597.1| PREDICTED: programmed cell death protein 7 [Mesocricetus auratus]
Length=485

 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  420  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPIPSNDIWA  479

Query  903  SCL  911
            + +
Sbjct  480  TAV  482



>gb|KFW80328.1| Programmed cell death protein 7, partial [Manacus vitellinus]
Length=216

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  
Sbjct  146  GDPAEFPLAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSL  205

Query  882  PADEIWASCL  911
            P ++ WA+ +
Sbjct  206  PTNDTWATAV  215



>ref|XP_010991856.1| PREDICTED: programmed cell death protein 7, partial [Camelus 
dromedarius]
Length=413

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  348  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  407

Query  903  SCL  911
            + +
Sbjct  408  TAI  410



>ref|XP_008296649.1| PREDICTED: programmed cell death protein 7 [Stegastes partitus]
Length=536

 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            F  YY  + H    LI+VRR WD ++     P GS IP  W+ P PP+D+ WAS L
Sbjct  471  FTEYYRQAEHSEYALIQVRREWDMFVVAADHPDGSSIPQSWILPDPPSDQAWASAL  526



>gb|AAH16992.2| PDCD7 protein, partial [Homo sapiens]
Length=146

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  81   LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  140

Query  903  SCL  911
            + +
Sbjct  141  TAV  143



>ref|XP_005348240.1| PREDICTED: programmed cell death protein 7 [Microtus ochrogaster]
Length=445

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  L+++R  WD Y+     P G+ IP  WV PP P+++IWA
Sbjct  380  LAHLLQPFRQYYLQAEHSLPALLQIRHDWDQYLVPSDHPKGNSIPQGWVLPPVPSNDIWA  439

Query  903  SCL  911
            + +
Sbjct  440  TAV  442



>ref|XP_005638757.1| PREDICTED: programmed cell death protein 7 [Canis lupus familiaris]
Length=501

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  436  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  495

Query  903  SCL  911
            + +
Sbjct  496  TAI  498



>ref|XP_004574128.1| PREDICTED: programmed cell death protein 7-like isoform X3 [Maylandia 
zebra]
Length=488

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            F  YY  + H +  LI VR+ WD+ +     PG S +P  WV P PP+D+ WAS L
Sbjct  423  FRDYYSQAEHSLPALIHVRKEWDTCLVAVDHPGSSSVPQSWVLPNPPSDQAWASAL  478



>ref|XP_004687730.1| PREDICTED: programmed cell death protein 7 [Condylura cristata]
Length=488

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            ++ L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  423  LTQLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  482

Query  903  SCL  911
            + +
Sbjct  483  TAI  485



>ref|XP_008921399.1| PREDICTED: programmed cell death protein 7, partial [Manacus 
vitellinus]
Length=217

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  
Sbjct  147  GDPAEFPLAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSL  206

Query  882  PADEIWASCL  911
            P ++ WA+ +
Sbjct  207  PTNDTWATAV  216



>sp|Q9WTY1.1|PDCD7_MOUSE RecName: Full=Programmed cell death protein 7; AltName: Full=ES18 
[Mus musculus]
 gb|AAD20240.1| ES18 [Mus musculus]
Length=482

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  417  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  476

Query  903  SCL  911
            + +
Sbjct  477  TAI  479



>ref|XP_008951621.1| PREDICTED: programmed cell death protein 7 [Pan paniscus]
Length=377

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  312  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  371

Query  903  SCL  911
            + +
Sbjct  372  TAV  374



>ref|XP_009071367.1| PREDICTED: programmed cell death protein 7, partial [Acanthisitta 
chloris]
Length=201

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  
Sbjct  131  GDPAEFPLTHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSL  190

Query  882  PADEIWASCL  911
            P  + WA+ +
Sbjct  191  PTSDTWATAV  200



>ref|NP_057897.2| programmed cell death protein 7 [Mus musculus]
 dbj|BAE33014.1| unnamed protein product [Mus musculus]
 gb|AAI66005.1| Programmed cell death 7 [synthetic construct]
Length=484

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  419  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  478

Query  903  SCL  911
            + +
Sbjct  479  TAI  481



>ref|XP_003784477.1| PREDICTED: programmed cell death protein 7 [Otolemur garnettii]
Length=482

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 38/63 (60%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H + +LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  417  LAHLLQPFRQYYLQAEHSLPSLIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  476

Query  903  SCL  911
            + +
Sbjct  477  TAI  479



>ref|XP_009962963.1| PREDICTED: programmed cell death protein 7, partial [Tyto alba]
 gb|KFV48206.1| Programmed cell death protein 7, partial [Tyto alba]
Length=193

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>ref|XP_009319810.1| PREDICTED: programmed cell death protein 7 [Pygoscelis adeliae]
Length=217

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  154  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSVPTNDTWA  213

Query  903  SCL  911
            + +
Sbjct  214  TAV  216



>gb|KFW65365.1| Programmed cell death protein 7, partial [Pygoscelis adeliae]
Length=215

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  152  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSVPTNDTWA  211

Query  903  SCL  911
            + +
Sbjct  212  TAV  214



>ref|XP_004274802.1| PREDICTED: programmed cell death protein 7 [Orcinus orca]
Length=487

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  422  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  481

Query  903  SCL  911
            + +
Sbjct  482  TAI  484



>ref|XP_008267788.1| PREDICTED: LOW QUALITY PROTEIN: programmed cell death protein 
7 [Oryctolagus cuniculus]
Length=448

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  383  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  442

Query  903  SCL  911
            + +
Sbjct  443  TAI  445



>ref|XP_004409459.1| PREDICTED: programmed cell death protein 7 [Odobenus rosmarus 
divergens]
Length=486

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  421  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  480

Query  903  SCL  911
            + +
Sbjct  481  TAI  483



>ref|XP_007447741.1| PREDICTED: programmed cell death protein 7 [Lipotes vexillifer]
Length=473

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  408  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  467

Query  903  SCL  911
            + +
Sbjct  468  TAI  470



>ref|XP_001108617.1| PREDICTED: programmed cell death protein 7-like [Macaca mulatta]
Length=488

 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  423  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  482

Query  903  SCL  911
            + L
Sbjct  483  TAL  485



>ref|XP_004455560.1| PREDICTED: programmed cell death protein 7 [Dasypus novemcinctus]
Length=482

 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  417  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSNHPKGNSVPQGWVLPPLPSNDIWA  476

Query  903  SCL  911
            + +
Sbjct  477  TAI  479



>ref|XP_006020138.1| PREDICTED: programmed cell death protein 7 [Alligator sinensis]
Length=169

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            + +L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P PP  + WA
Sbjct  106  LGHLLRPFKQYYLQAEHSVPVLIQIRHEWDRYLVPADHPEGSCIPPGWVLPAPPTSDTWA  165

Query  903  SCL  911
            + +
Sbjct  166  TAV  168



>gb|EOA97062.1| Programmed cell death protein 7, partial [Anas platyrhynchos]
Length=194

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  131  LADLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  190

Query  903  SCL  911
            + +
Sbjct  191  TAV  193



>ref|XP_003480489.1| PREDICTED: programmed cell death protein 7 [Sus scrofa]
Length=484

 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  419  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWA  478

Query  903  SCL  911
            + +
Sbjct  479  TAI  481



>gb|KFP70139.1| Programmed cell death protein 7, partial [Acanthisitta chloris]
Length=195

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  
Sbjct  125  GDPAEFPLTHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSL  184

Query  882  PADEIWASCL  911
            P  + WA+ +
Sbjct  185  PTSDTWATAV  194



>gb|KFQ47572.1| Programmed cell death protein 7, partial [Pelecanus crispus]
Length=193

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPTLPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>ref|XP_004877652.1| PREDICTED: programmed cell death protein 7 [Heterocephalus glaber]
Length=294

 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 35/63 (56%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD ++ P     GS +P  WV P  P+ +IWA
Sbjct  229  LAHLLQPFRQYYLQAEHSVPALIQIRHDWDQFLVPADHPKGSSVPQGWVLPALPSSDIWA  288

Query  903  SCL  911
            S +
Sbjct  289  SAV  291



>ref|XP_009875988.1| PREDICTED: programmed cell death protein 7, partial [Apaloderma 
vittatum]
 gb|KFP82130.1| Programmed cell death protein 7, partial [Apaloderma vittatum]
Length=193

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>ref|XP_004574126.1| PREDICTED: programmed cell death protein 7-like isoform X1 [Maylandia 
zebra]
Length=517

 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            F  YY  + H +  LI VR+ WD+ +     PG S +P  WV P PP+D+ WAS L
Sbjct  452  FRDYYSQAEHSLPALIHVRKEWDTCLVAVDHPGSSSVPQSWVLPNPPSDQAWASAL  507



>ref|XP_010389553.1| PREDICTED: programmed cell death protein 7 [Corvus cornix cornix]
Length=200

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  
Sbjct  130  GDPAEFPLAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSL  189

Query  882  PADEIWASCL  911
            P ++ WA+ +
Sbjct  190  PTNDTWATAV  199



>ref|XP_008504395.1| PREDICTED: programmed cell death protein 7 [Calypte anna]
Length=229

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD ++ P     GS IP  WV P  
Sbjct  159  GDPAEFPLAHLLQPFREYYLQAEHSVAALIQIRHEWDRFLVPADHPEGSCIPPGWVLPSL  218

Query  882  PADEIWASCL  911
            P ++ WA+ +
Sbjct  219  PTNDTWATAV  228



>gb|KFP57330.1| Programmed cell death protein 7, partial [Cathartes aura]
Length=193

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>ref|XP_003267042.1| PREDICTED: programmed cell death protein 7 [Nomascus leucogenys]
Length=405

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  340  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  399

Query  903  SCL  911
            + +
Sbjct  400  TAV  402



>gb|KFZ49778.1| Programmed cell death protein 7, partial [Podiceps cristatus]
Length=193

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPAEHPEGSCIPPGWVLPSLPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>ref|XP_009003314.1| PREDICTED: LOW QUALITY PROTEIN: programmed cell death protein 
7 [Callithrix jacchus]
Length=486

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ IP  WV PP P+++IWA
Sbjct  421  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFIPQGWVLPPLPSNDIWA  480

Query  903  SCL  911
            + +
Sbjct  481  TAV  483



>gb|KFP12783.1| Programmed cell death protein 7, partial [Egretta garzetta]
Length=206

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  143  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSGIPPGWVLPSLPTNDTWA  202

Query  903  SCL  911
            + +
Sbjct  203  TAV  205



>ref|XP_009813062.1| PREDICTED: programmed cell death protein 7, partial [Gavia stellata]
 gb|KFV55736.1| Programmed cell death protein 7, partial [Gavia stellata]
Length=193

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>ref|XP_005025574.1| PREDICTED: programmed cell death protein 7 [Anas platyrhynchos]
Length=252

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  189  LADLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  248

Query  903  SCL  911
            + +
Sbjct  249  TAV  251



>ref|XP_003969519.1| PREDICTED: programmed cell death protein 7-like [Takifugu rubripes]
Length=488

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 4/59 (7%)
 Frame = +3

Query  747  PMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            P  F  YY  +   +G+L+++R  WD ++     P GS IP +W+ P  P+DE WAS L
Sbjct  424  PQPFIDYYNQAECTVGSLLQIRSEWDMFVVAADHPDGSSIPQNWIMPDQPSDEAWASSL  482



>gb|KFQ42762.1| Programmed cell death protein 7, partial [Nestor notabilis]
Length=231

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  168  LAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSSIPPGWVLPSLPTNDTWA  227

Query  903  SCL  911
            + +
Sbjct  228  TAV  230



>gb|KFO79270.1| Programmed cell death protein 7, partial [Cuculus canorus]
Length=212

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  149  LAHLLQPFREYYLQAEHSVAALIQIRHEWDRYLVPADHPEGSCIPPGWVLPSLPTNDTWA  208

Query  903  SCL  911
            + +
Sbjct  209  TAV  211



>gb|KFP23400.1| Programmed cell death protein 7, partial [Colius striatus]
Length=193

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>ref|XP_009706244.1| PREDICTED: programmed cell death protein 7 [Cariama cristata]
Length=202

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  139  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPILPTNDTWA  198

Query  903  SCL  911
            + +
Sbjct  199  TAV  201



>gb|KFQ20397.1| Programmed cell death protein 7, partial [Mesitornis unicolor]
Length=234

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  171  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  230

Query  903  SCL  911
            + +
Sbjct  231  TAV  233



>ref|XP_010014386.1| PREDICTED: programmed cell death protein 7, partial [Nestor notabilis]
Length=230

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  167  LAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSSIPPGWVLPSLPTNDTWA  226

Query  903  SCL  911
            + +
Sbjct  227  TAV  229



>ref|XP_009563397.1| PREDICTED: programmed cell death protein 7 [Cuculus canorus]
Length=220

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  157  LAHLLQPFREYYLQAEHSVAALIQIRHEWDRYLVPADHPEGSCIPPGWVLPSLPTNDTWA  216

Query  903  SCL  911
            + +
Sbjct  217  TAV  219



>ref|XP_010359672.1| PREDICTED: programmed cell death protein 7 [Rhinopithecus roxellana]
Length=489

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  424  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  483

Query  903  SCL  911
            + +
Sbjct  484  TAV  486



>gb|KFV06814.1| Programmed cell death protein 7, partial [Tauraco erythrolophus]
Length=193

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSHPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>gb|KGL86687.1| Programmed cell death protein 7, partial [Charadrius vociferus]
Length=266

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  203  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  262

Query  903  SCL  911
            + +
Sbjct  263  TAV  265



>gb|KFP60268.1| Programmed cell death protein 7, partial [Cariama cristata]
Length=193

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPILPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>ref|XP_008946517.1| PREDICTED: programmed cell death protein 7 [Merops nubicus]
Length=169

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  106  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSSIPPGWVLPSLPTNDTWA  165

Query  903  SCL  911
            + +
Sbjct  166  TAV  168



>ref|XP_010139911.1| PREDICTED: programmed cell death protein 7 [Buceros rhinoceros 
silvestris]
Length=169

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  106  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADPPEGSCIPPGWVLPSLPTNDTWA  165

Query  903  SCL  911
            S +
Sbjct  166  SAV  168



>gb|KFW80100.1| Programmed cell death protein 7, partial [Phalacrocorax carbo]
Length=193

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>ref|XP_010353800.1| PREDICTED: programmed cell death protein 7 [Rhinopithecus roxellana]
Length=489

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  424  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  483

Query  903  SCL  911
            + +
Sbjct  484  TAV  486



>ref|NP_005698.1| programmed cell death protein 7 [Homo sapiens]
 ref|XP_009427629.1| PREDICTED: programmed cell death protein 7 [Pan troglodytes]
 sp|Q8N8D1.1|PDCD7_HUMAN RecName: Full=Programmed cell death protein 7; AltName: Full=ES18; 
Short=hES18 [Homo sapiens]
 dbj|BAC04915.1| unnamed protein product [Homo sapiens]
 tpg|DAA05494.1| TPA_exp: U11/U12 snRNP 59K [Homo sapiens]
 gb|EAW77713.1| programmed cell death 7, isoform CRA_a [Homo sapiens]
Length=485

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  420  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  479

Query  903  SCL  911
            + +
Sbjct  480  TAV  482



>ref|XP_009885788.1| PREDICTED: programmed cell death protein 7 [Charadrius vociferus]
Length=268

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  205  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  264

Query  903  SCL  911
            + +
Sbjct  265  TAV  267



>gb|KFQ86466.1| Programmed cell death protein 7, partial [Phoenicopterus ruber 
ruber]
Length=193

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P  + WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPTLPTSDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>ref|XP_002825603.1| PREDICTED: programmed cell death protein 7 [Pongo abelii]
Length=487

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  422  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  481

Query  903  SCL  911
            + +
Sbjct  482  TAV  484



>gb|EMC77340.1| Programmed cell death protein 7, partial [Columba livia]
Length=236

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  173  LAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  232

Query  903  SCL  911
            + +
Sbjct  233  TAV  235



>gb|AAP88882.1| programmed cell death 7 [synthetic construct]
Length=111

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 33/56 (59%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA+ +
Sbjct  52   FRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAV  107



>gb|KFR02556.1| Programmed cell death protein 7, partial [Nipponia nippon]
Length=266

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  203  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPTLPTNDTWA  262

Query  903  SCL  911
            + +
Sbjct  263  TAV  265



>gb|KFW01742.1| Programmed cell death protein 7, partial [Eurypyga helias]
Length=243

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P  + WA
Sbjct  180  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTSDTWA  239

Query  903  SCL  911
            + +
Sbjct  240  TAV  242



>ref|XP_010146236.1| PREDICTED: programmed cell death protein 7, partial [Eurypyga 
helias]
Length=242

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P  + WA
Sbjct  179  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTSDTWA  238

Query  903  SCL  911
            + +
Sbjct  239  TAV  241



>ref|XP_005424327.1| PREDICTED: programmed cell death protein 7 [Geospiza fortis]
Length=259

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  
Sbjct  189  GDPAEFPLAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSL  248

Query  882  PADEIWASCL  911
            P  + WA+ +
Sbjct  249  PTSDTWATAV  258



>ref|XP_004056398.1| PREDICTED: LOW QUALITY PROTEIN: programmed cell death protein 
7 [Gorilla gorilla gorilla]
Length=491

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  426  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  485

Query  903  SCL  911
            + +
Sbjct  486  TAV  488



>gb|AAP36059.1| programmed cell death 7 [Homo sapiens]
Length=110

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 33/56 (59%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA+ +
Sbjct  52   FRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAV  107



>ref|XP_005254165.1| PREDICTED: programmed cell death protein 7 isoform X1 [Homo sapiens]
Length=406

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     G+ +P  WV PP P+++IWA
Sbjct  341  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  400

Query  903  SCL  911
            + +
Sbjct  401  TAV  403



>ref|XP_009476237.1| PREDICTED: programmed cell death protein 7 [Pelecanus crispus]
Length=169

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  106  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPTLPTNDTWA  165

Query  903  SCL  911
            + +
Sbjct  166  TAV  168



>ref|XP_003460819.1| PREDICTED: LOW QUALITY PROTEIN: programmed cell death protein 
7 [Cavia porcellus]
Length=420

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS +P  WV P  P+++IWA
Sbjct  355  LAHLLQPFRQYYLQAEHSLPALIQIRHDWDQYLVPADHPKGSSVPQGWVLPTIPSNDIWA  414

Query  903  SCL  911
            S +
Sbjct  415  SAV  417



>ref|XP_008014445.1| PREDICTED: programmed cell death protein 7 [Chlorocebus sabaeus]
Length=486

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  421  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  480

Query  903  SCL  911
            + +
Sbjct  481  TAV  483



>ref|XP_003901116.1| PREDICTED: programmed cell death protein 7 [Papio anubis]
Length=486

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  421  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  480

Query  903  SCL  911
            + +
Sbjct  481  TAV  483



>ref|XP_005559870.1| PREDICTED: programmed cell death protein 7 [Macaca fascicularis]
Length=488

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+     P G+ +P  WV PP P+++IWA
Sbjct  423  LAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWA  482

Query  903  SCL  911
            + +
Sbjct  483  TAV  485



>ref|XP_009278771.1| PREDICTED: programmed cell death protein 7, partial [Aptenodytes 
forsteri]
 gb|KFM08351.1| Programmed cell death protein 7, partial [Aptenodytes forsteri]
Length=254

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS +P  WV P  P ++ WA
Sbjct  191  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCVPPGWVLPSLPTNDTWA  250

Query  903  SCL  911
            + +
Sbjct  251  TAV  253



>ref|XP_009468499.1| PREDICTED: programmed cell death protein 7 [Nipponia nippon]
Length=294

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  231  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPTLPTNDTWA  290

Query  903  SCL  911
            + +
Sbjct  291  TAV  293



>gb|KFV98108.1| Programmed cell death protein 7, partial [Fulmarus glacialis]
Length=193

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWASCL  911
            F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA+ +
Sbjct  137  FREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWATAV  192



>ref|XP_010192514.1| PREDICTED: programmed cell death protein 7 [Mesitornis unicolor]
Length=169

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  106  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  165

Query  903  SCL  911
            + +
Sbjct  166  TAV  168



>ref|XP_008583516.1| PREDICTED: programmed cell death protein 7 [Galeopterus variegatus]
Length=338

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 35/63 (56%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  +   +  LI++R  WD Y+     P GS +P  WV PP P+ +IWA
Sbjct  273  LAHLLQPFRQYYLQAELSLPALIQIRHDWDQYLVPSDHPKGSSVPQGWVLPPLPSSDIWA  332

Query  903  SCL  911
            + +
Sbjct  333  TAI  335



>gb|KFV69941.1| Programmed cell death protein 7, partial [Picoides pubescens]
Length=264

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  
Sbjct  194  GDPAEFPLAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSL  253

Query  882  PADEIWASCL  911
            P +  WA+ +
Sbjct  254  PTNGTWATAV  263



>gb|KFR04696.1| Programmed cell death protein 7, partial [Opisthocomus hoazin]
Length=193

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI +R  WD ++ P     GS IP  WV P  P ++ WA
Sbjct  130  LAHLLQPFREYYLQAEHSVAALIRIRHEWDQFLVPADHPEGSSIPPGWVLPSLPTNDTWA  189

Query  903  SCL  911
            + +
Sbjct  190  TAV  192



>emb|CDQ86944.1| unnamed protein product [Oncorhynchus mykiss]
Length=368

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (54%), Gaps = 4/56 (7%)
 Frame = +3

Query  756  FYHYYYGSNHDMGTLIEVRRTWDSYI----RPGGSRIPGHWVQPPPPADEIWASCL  911
            F  YY  +   +  LI++RR WD  +     P G+ +P  WV P  P DEIWA+ L
Sbjct  305  FREYYTQAERSLPALIQIRREWDLCLVSVDHPDGTTVPQDWVLPQCPTDEIWATAL  360



>ref|XP_005051894.1| PREDICTED: programmed cell death protein 7, partial [Ficedula 
albicollis]
Length=305

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +3

Query  714  GSSAYDSVSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPP  881
            G  A   +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  
Sbjct  235  GDPAEFPLAHLLQPFRDYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSL  294

Query  882  PADEIWASCL  911
            P ++ WA+ +
Sbjct  295  PTNDTWATAV  304



>ref|XP_010209033.1| PREDICTED: programmed cell death protein 7 [Colius striatus]
Length=169

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  106  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  165

Query  903  SCL  911
            + +
Sbjct  166  TAV  168



>ref|XP_010570609.1| PREDICTED: programmed cell death protein 7, partial [Haliaeetus 
leucocephalus]
Length=308

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  245  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSCIPPGWVLPSLPTNDTWA  304

Query  903  SCL  911
            + +
Sbjct  305  TAV  307



>ref|XP_009633332.1| PREDICTED: programmed cell death protein 7 [Egretta garzetta]
Length=169

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +3

Query  735  VSNLPMEFYHYYYGSNHDMGTLIEVRRTWDSYIRPG----GSRIPGHWVQPPPPADEIWA  902
            +++L   F  YY  + H +  LI++R  WD Y+ P     GS IP  WV P  P ++ WA
Sbjct  106  LAHLLQPFREYYLQAEHSVAALIQIRHEWDQYLVPADHPEGSGIPPGWVLPSLPTNDTWA  165

Query  903  SCL  911
            + +
Sbjct  166  TAV  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3756859799544