BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25233_g3_i2 len=1662 path=[1487:0-69 1557:70-75 1563:76-144
1632:145-184 1672:185-257 1745:258-308 1796:309-433 1921:434-454
1942:455-478 1966:479-529 2017:530-536 2024:537-561 11475:562-582
2070:583-637 2125:638-675 2163:676-678 2166:679-704 4504:705-845
4645:846-862 4662:863-932 11630:933-996 4796:997-1027
11693:1028-1028 7734:1029-1036 4836:1037-1061 11717:1062-1062
11718:1063-1064 4864:1065-1071 4871:1072-1100 11083:1101-1104
4904:1105-1139 4939:1140-1193 11790:1194-1205 5005:1206-1206
5006:1207-1224 11817:1225-1232 10375:1233-1240 5040:1241-1316
10280:1317-1370 10334:1371-1371 5171:1372-1421 8050:1422-1661]

Length=1662
                                                                      Score     E

ref|XP_004235055.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    573   0.0      
ref|XP_010318075.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    563   0.0      
ref|XP_006361975.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       515   6e-175   
gb|AGX93066.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    515   1e-174   
gb|AIE12477.1|  UGT4                                                    512   9e-174   
ref|XP_010277669.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    508   9e-172   
gb|AGX93071.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    507   2e-171   
gb|AGX93072.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    506   3e-171   
sp|U3U992.1|UGT8_CATRO  RecName: Full=7-deoxyloganetic acid gluco...    506   3e-171   
gb|AGX93065.1|  7-deoxyloganetic acid UDP-glucosyltransferase           506   4e-171   
gb|AGX93069.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    501   2e-169   
ref|XP_011038346.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    501   2e-169   
ref|XP_010262684.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    500   7e-169   
gb|AGX93068.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    498   5e-168   
emb|CDP05611.1|  unnamed protein product                                497   1e-167   
ref|XP_006435573.1|  hypothetical protein CICLE_v10031368mg             497   1e-167   
emb|CDP05607.1|  unnamed protein product                                496   3e-167   
gb|ACS87994.1|  UDP-glucosyltransferase family 1 protein                495   5e-167   Citrus sinensis [apfelsine]
ref|XP_006379615.1|  hypothetical protein POPTR_0008s06270g             495   5e-167   
gb|AGX93067.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    495   8e-167   
ref|XP_007009133.1|  UDP-glucosyltransferase family 1 protein           493   5e-166   
ref|XP_010658496.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    492   1e-165   
ref|XP_002276823.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    491   1e-165   Vitis vinifera
ref|XP_011076758.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    491   2e-165   
ref|XP_002281029.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    491   2e-165   Vitis vinifera
gb|EYU19962.1|  hypothetical protein MIMGU_mgv1a005720mg                490   5e-165   
ref|XP_007009131.1|  UDP-glucosyltransferase family 1 protein           489   2e-164   
ref|XP_009597174.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    489   2e-164   
gb|AGX93070.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    487   6e-164   
ref|XP_002276617.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    487   9e-164   Vitis vinifera
ref|XP_002276771.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    485   3e-163   Vitis vinifera
ref|XP_002280624.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    484   1e-162   Vitis vinifera
ref|XP_009597175.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    484   1e-162   
ref|XP_002276555.2|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    482   3e-161   Vitis vinifera
ref|XP_006435572.1|  hypothetical protein CICLE_v10031404mg             480   4e-161   
gb|KDO69253.1|  hypothetical protein CISIN_1g011848mg                   480   5e-161   
ref|XP_010650643.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    478   2e-160   
ref|XP_002280470.2|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    478   2e-160   Vitis vinifera
ref|XP_010262685.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    478   4e-160   
ref|XP_010650608.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    477   6e-160   
ref|XP_007009132.1|  UDP-glucosyltransferase family 1 protein           474   1e-158   
ref|XP_002280528.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    473   2e-158   Vitis vinifera
ref|XP_009802463.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    470   5e-157   
ref|XP_011100060.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    467   8e-156   
ref|XP_009590620.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    468   2e-155   
ref|XP_009608691.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    466   2e-155   
ref|XP_006435571.1|  hypothetical protein CICLE_v10031408mg             465   2e-155   
ref|XP_006486448.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       465   3e-155   
gb|KDP44850.1|  hypothetical protein JCGZ_01350                         465   5e-155   
gb|KDO69252.1|  hypothetical protein CISIN_1g011848mg                   464   6e-155   
gb|AIS39472.1|  flavonoid UDP-glucosyltransferase 3                     464   9e-155   
ref|XP_009800319.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    461   1e-153   
gb|KDO69251.1|  hypothetical protein CISIN_1g011832mg                   461   1e-153   
ref|XP_011084978.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    461   3e-153   
ref|XP_008464643.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       459   1e-152   
ref|XP_007158356.1|  hypothetical protein PHAVU_002G145900g             458   1e-152   
gb|EYU19963.1|  hypothetical protein MIMGU_mgv1a005336mg                458   2e-152   
gb|EYU19961.1|  hypothetical protein MIMGU_mgv1a005050mg                458   2e-152   
ref|XP_009795416.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    456   9e-152   
ref|XP_006355679.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       456   1e-151   
ref|XP_004150246.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       455   3e-151   
ref|XP_004239922.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    455   3e-151   
ref|XP_009613526.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    453   2e-150   
ref|XP_011076757.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    452   3e-150   
ref|XP_006355680.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       452   3e-150   
ref|XP_004149949.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       452   4e-150   
emb|CDP19643.1|  unnamed protein product                                451   4e-150   
ref|XP_006355163.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       447   2e-148   
ref|XP_006367215.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       447   2e-148   
ref|XP_011084983.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    449   3e-148   
ref|XP_004171873.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       447   4e-148   
ref|XP_006367216.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       446   5e-148   
emb|CBI31575.3|  unnamed protein product                                445   3e-147   
ref|XP_011084985.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    444   1e-146   
ref|XP_007158359.1|  hypothetical protein PHAVU_002G146200g             443   1e-146   
ref|XP_003517688.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       443   2e-146   
gb|KDO61155.1|  hypothetical protein CISIN_1g037374mg                   439   2e-145   
ref|XP_011085130.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    439   3e-145   
emb|CDP16024.1|  unnamed protein product                                439   7e-145   
dbj|BAK55741.1|  UDP-glucose glucosyltransferase                        439   9e-145   
ref|XP_010032069.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    437   2e-144   
ref|XP_010318076.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    437   2e-144   
emb|CDP04614.1|  unnamed protein product                                436   1e-143   
ref|XP_007158358.1|  hypothetical protein PHAVU_002G146100g             435   2e-143   
dbj|BAK55740.1|  UDP-glucose glucosyltransferase                        434   5e-143   
ref|XP_008785471.1|  PREDICTED: UDP-glycosyltransferase 85A4-like       433   1e-142   
emb|CDP19644.1|  unnamed protein product                                433   1e-142   
gb|KHG01935.1|  UDP-glycosyltransferase 85A1                            446   6e-142   
dbj|BAP90373.1|  UDP-glycose: glycosyltransferase UGT709H1              431   1e-141   
ref|XP_010674283.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    429   3e-141   
ref|XP_008464907.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    429   3e-141   
ref|XP_007009137.1|  UDP-glucosyltransferase family 1 protein, pu...    428   4e-141   
gb|KHN04919.1|  UDP-glycosyltransferase 85A3                            429   6e-141   
ref|XP_004172562.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       428   1e-140   
ref|XP_010923186.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    428   1e-140   
ref|XP_010674287.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    427   2e-140   
ref|XP_010032068.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    427   2e-140   
ref|XP_003517692.2|  PREDICTED: UDP-glycosyltransferase 85A3-like       427   4e-140   
ref|XP_008464906.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    426   4e-140   
ref|XP_004162780.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       426   7e-140   
ref|XP_004235101.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    426   8e-140   
gb|KGN50614.1|  hypothetical protein Csa_5G196570                       425   2e-139   
ref|XP_004150245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       425   2e-139   
gb|KGN50615.1|  UDP-glucosyltransferase family 1 protein                424   2e-139   
ref|XP_008811497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       425   3e-139   
ref|XP_010923185.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    423   7e-139   
ref|XP_009804549.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    423   8e-139   
ref|XP_009589440.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    421   8e-138   
ref|XP_010923184.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    421   8e-138   
ref|XP_008359771.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       420   2e-137   
ref|XP_008388093.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       420   2e-137   
ref|XP_006362115.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       419   2e-137   
ref|XP_006361974.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       415   3e-137   
ref|XP_002530397.1|  UDP-glucuronosyltransferase, putative              418   5e-137   Ricinus communis
gb|AGZ84549.1|  glycosyltransferase KGT31                               418   6e-137   
ref|XP_008785470.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       418   9e-137   
ref|XP_010666054.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    418   1e-136   
ref|XP_010674284.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    416   4e-136   
ref|XP_004512576.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       414   2e-135   
ref|XP_003613025.1|  UDP-glucuronosyltransferase 1-1                    412   9e-135   
emb|CAN77812.1|  hypothetical protein VITISV_010344                     416   6e-134   Vitis vinifera
ref|XP_009589441.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    410   1e-133   
ref|XP_008370121.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       410   1e-133   
ref|XP_009781211.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    405   2e-133   
emb|CDP14405.1|  unnamed protein product                                403   4e-133   
ref|XP_010688868.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    409   8e-133   
ref|XP_010032067.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    409   8e-133   
dbj|BAB86920.1|  glucosyltransferase-2                                  407   9e-133   Vigna angularis [azuki bean]
ref|XP_006481394.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       406   2e-132   
ref|XP_008353149.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       407   2e-132   
ref|XP_008388092.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       406   4e-132   
gb|KHG01936.1|  UDP-glycosyltransferase 85A1                            419   5e-132   
ref|XP_006429244.1|  hypothetical protein CICLE_v10013877mg             405   5e-132   
ref|XP_004231996.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    405   8e-132   
ref|XP_010316061.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    404   2e-131   
ref|XP_006357782.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       404   2e-131   
ref|XP_010905381.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    404   3e-131   
gb|KHN04913.1|  UDP-glycosyltransferase 85A2                            402   7e-131   
gb|AFJ53009.1|  UDP-glycosyltransferase 1                               402   1e-130   
ref|XP_003613028.1|  Cis-zeatin O-glucosyltransferase                   401   2e-130   
dbj|BAB86929.1|  glucosyltransferase-11                                 400   3e-130   Vigna angularis [azuki bean]
ref|XP_003613026.1|  UDP-glucuronosyltransferase 1-6                    400   5e-130   
ref|XP_009346996.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    399   3e-129   
ref|XP_006357780.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       397   8e-129   
ref|XP_010316060.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    396   1e-128   
gb|KDO43669.1|  hypothetical protein CISIN_1g011792mg                   395   6e-128   
ref|XP_006423294.1|  hypothetical protein CICLE_v10030404mg             394   1e-127   
ref|XP_007026848.1|  UDP-glucosyl transferase 85A3, putative isof...    394   2e-127   
emb|CAN68538.1|  hypothetical protein VITISV_039646                     392   4e-127   Vitis vinifera
gb|AFJ53008.1|  UDP-glycosyltransferase 1                               393   5e-127   
gb|EPS60746.1|  hypothetical protein M569_14056                         391   8e-127   
ref|XP_009759439.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    391   2e-126   
ref|XP_006379614.1|  hypothetical protein POPTR_0008s06270g             387   2e-126   
ref|XP_007026847.1|  UDP-glucosyl transferase 85A3, putative isof...    391   3e-126   
gb|KDO58004.1|  hypothetical protein CISIN_1g037999mg                   389   4e-126   
gb|KDO38335.1|  hypothetical protein CISIN_1g044936mg                   389   7e-126   
emb|CDO99846.1|  unnamed protein product                                387   1e-125   
gb|KHG08953.1|  hypothetical protein F383_15475                         389   2e-125   
dbj|BAB86930.1|  glucosyltransferase-12                                 387   3e-125   Vigna angularis [azuki bean]
ref|XP_011000049.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    387   1e-124   
gb|AIE12478.1|  UGT5                                                    386   1e-124   
emb|CDP05613.1|  unnamed protein product                                383   3e-124   
ref|XP_004302685.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       385   4e-124   
ref|XP_011014019.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    385   6e-124   
ref|XP_006373896.1|  hypothetical protein POPTR_0016s10010g             384   9e-124   
gb|AFK79038.1|  glycosyltransferase UGT6                                384   2e-123   
ref|XP_011014018.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    384   2e-123   
gb|KDO38337.1|  hypothetical protein CISIN_1g011531mg                   380   3e-122   
ref|XP_006429243.1|  hypothetical protein CICLE_v10011602mg             379   1e-121   
ref|XP_007026849.1|  UDP-glucosyl transferase 85A3, putative            377   3e-121   
dbj|BAM63146.1|  uncharacterized glucosyltransferase 2                  377   5e-121   
ref|XP_010674285.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    379   8e-121   
emb|CAN67315.1|  hypothetical protein VITISV_036458                     375   3e-120   Vitis vinifera
ref|XP_010674282.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    374   5e-119   
gb|KDO69249.1|  hypothetical protein CISIN_1g0487532mg                  364   9e-119   
ref|XP_010666049.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    369   2e-117   
ref|XP_008467017.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       362   2e-117   
emb|CBI36709.3|  unnamed protein product                                365   6e-117   
gb|AFJ53007.1|  UDP-glycosyltransferase 1                               365   2e-116   
ref|XP_007026845.1|  UDP-glucosyl transferase 85A3, putative isof...    364   5e-116   
ref|XP_004173134.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    355   5e-115   
ref|XP_010044032.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    361   8e-115   
ref|XP_007026850.1|  UDP-glucosyl transferase 85A4-like protein i...    360   5e-114   
ref|XP_007026851.1|  UDP-Glycosyltransferase superfamily protein ...    359   9e-114   
gb|AFJ53010.1|  UDP-glycosyltransferase 1                               357   2e-113   
gb|EPS61663.1|  hypothetical protein M569_13131                         355   7e-113   
ref|XP_009594030.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    352   1e-112   
ref|XP_004305167.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       355   2e-112   
ref|XP_010676681.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    355   4e-112   
ref|XP_008346926.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       346   5e-109   
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             346   8e-109   
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             345   2e-108   
ref|XP_007207791.1|  hypothetical protein PRUPE_ppa025605mg             344   3e-108   
ref|XP_007207618.1|  hypothetical protein PRUPE_ppa019804mg             343   6e-108   
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       343   7e-108   
gb|AFK34769.1|  unknown                                                 342   1e-107   
emb|CBI36705.3|  unnamed protein product                                339   2e-107   
ref|XP_007207170.1|  hypothetical protein PRUPE_ppa022102mg             342   3e-107   
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      343   3e-107   
dbj|BAJ98857.1|  predicted protein                                      341   4e-107   
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             341   4e-107   
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       340   9e-107   
ref|XP_007206751.1|  hypothetical protein PRUPE_ppa025141mg             339   3e-106   
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  339   4e-106   
gb|EAZ03904.1|  hypothetical protein OsI_26038                          339   5e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_004957723.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       338   6e-106   
ref|XP_007026846.1|  UDP-glucosyl transferase 85A3, putative isof...    336   1e-105   
ref|NP_001175206.1|  Os07g0489950                                       337   3e-105   
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  336   4e-105   
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    336   5e-105   
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       336   6e-105   
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             336   6e-105   
ref|XP_003563101.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    336   7e-105   
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       335   9e-105   
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g             335   2e-104   
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    335   2e-104   
ref|XP_008242286.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       334   2e-104   
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       334   2e-104   
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       334   2e-104   
gb|EAZ03912.1|  hypothetical protein OsI_26045                          334   4e-104   Oryza sativa Indica Group [Indian rice]
gb|AFK33787.1|  unknown                                                 333   4e-104   
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       333   5e-104   
emb|CBI31568.3|  unnamed protein product                                328   6e-104   
gb|KHN42553.1|  UDP-glycosyltransferase 85A2                            333   1e-103   
gb|ACJ84649.1|  unknown                                                 332   1e-103   Medicago truncatula
gb|EMT06489.1|  Cytokinin-O-glucosyltransferase 2                       332   1e-103   
ref|NP_001059664.1|  Os07g0486700                                       332   1e-103   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC57706.1|  putative glucosyltransferase-2                         332   2e-103   Oryza sativa Japonica Group [Japonica rice]
gb|KHG03787.1|  hypothetical protein F383_26945                         326   2e-103   
ref|XP_009413574.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    332   2e-103   
ref|XP_004299647.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       332   2e-103   
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       332   2e-103   
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    330   8e-103   
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            330   1e-102   
ref|XP_008242262.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       328   2e-102   
gb|AFK37311.1|  unknown                                                 329   2e-102   
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       329   2e-102   
ref|XP_003520949.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       328   3e-102   
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            328   4e-102   
gb|KGN54319.1|  hypothetical protein Csa_4G303180                       328   4e-102   
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      328   5e-102   
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    328   6e-102   Vitis vinifera
ref|XP_004489451.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       328   6e-102   
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                            327   9e-102   
gb|EAZ39840.1|  hypothetical protein OsJ_24281                          327   1e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008229788.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       327   1e-101   
ref|XP_004305165.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       328   1e-101   
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       327   1e-101   
ref|NP_001059665.1|  Os07g0487100                                       327   1e-101   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB86928.1|  glucosyltransferase-10                                 327   1e-101   Vigna angularis [azuki bean]
ref|XP_008450117.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       327   1e-101   
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    326   2e-101   
gb|ACF88457.1|  unknown                                                 326   2e-101   Zea mays [maize]
ref|XP_004299648.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       326   3e-101   
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       326   4e-101   
emb|CDO97432.1|  unnamed protein product                                325   4e-101   
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                    326   4e-101   
ref|NP_001148991.1|  cytokinin-O-glucosyltransferase 2                  325   5e-101   Zea mays [maize]
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    326   5e-101   
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    325   5e-101   
ref|XP_003576916.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    326   6e-101   
ref|XP_006658565.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       326   6e-101   
ref|XP_003560194.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    325   6e-101   
gb|ACD03242.1|  UDP-glycosyltransferase UGT709A10                       325   7e-101   Avena strigosa
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    325   7e-101   
dbj|BAG80542.1|  glycosyltransferase                                    324   1e-100   Lycium barbarum [goji berry]
dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          324   2e-100   
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  324   2e-100   
ref|XP_007133898.1|  hypothetical protein PHAVU_010G001300g             324   2e-100   
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    323   2e-100   Vitis vinifera
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    324   2e-100   
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             323   2e-100   
ref|NP_001048164.1|  Os02g0755600                                       324   2e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008386170.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       323   3e-100   
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       323   3e-100   
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       323   5e-100   
ref|XP_006853219.1|  hypothetical protein AMTR_s00038p00218410          323   5e-100   
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       322   8e-100   
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    322   8e-100   
ref|NP_001175205.1|  Os07g0489200                                       322   8e-100   
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             322   9e-100   
ref|XP_003560193.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    322   1e-99    
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    322   1e-99    
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                            322   1e-99    
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                        322   1e-99    
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          321   2e-99    
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             321   2e-99    
ref|XP_004299645.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       322   2e-99    
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       322   2e-99    
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like       322   2e-99    
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       321   2e-99    
ref|XP_003522179.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       321   2e-99    
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    321   2e-99    
gb|ADV71371.1|  glycosyltransferase GT14M03                             321   3e-99    
gb|EYU18466.1|  hypothetical protein MIMGU_mgv1a005711mg                321   3e-99    
gb|AIL51400.1|  glycosyltransferase                                     321   3e-99    
gb|EEC74033.1|  hypothetical protein OsI_08990                          324   3e-99    
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              321   4e-99    
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    321   4e-99    
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    320   4e-99    
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    320   5e-99    
ref|XP_011008547.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    320   6e-99    
gb|AFK38894.1|  unknown                                                 320   6e-99    
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    320   6e-99    
ref|XP_008358180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       320   7e-99    
ref|XP_002462875.1|  hypothetical protein SORBIDRAFT_02g033580          321   8e-99    
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             320   9e-99    
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         320   1e-98    
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    320   1e-98    
ref|XP_004300654.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       320   1e-98    
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    320   1e-98    
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    320   1e-98    
ref|XP_006853218.1|  hypothetical protein AMTR_s00038p00217680          320   1e-98    
ref|XP_011087902.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    319   1e-98    
ref|XP_010937419.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    319   1e-98    
gb|EAZ03903.1|  hypothetical protein OsI_26037                          319   1e-98    
gb|KHN24338.1|  UDP-glycosyltransferase 85A3                            318   1e-98    
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    319   1e-98    
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       319   1e-98    
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         319   1e-98    
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     319   2e-98    
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    319   2e-98    
ref|XP_008219458.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       318   3e-98    
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    318   3e-98    
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    318   3e-98    
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            318   3e-98    
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         318   4e-98    
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             318   4e-98    
ref|XP_004303932.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       318   4e-98    
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             318   5e-98    
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             318   6e-98    
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            317   6e-98    
gb|KDP43115.1|  hypothetical protein JCGZ_26648                         317   7e-98    
ref|NP_001059671.1|  Os07g0490100                                       317   7e-98    
ref|XP_007148402.1|  hypothetical protein PHAVU_006G205500g             317   8e-98    
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    317   1e-97    
emb|CDY38225.1|  BnaC05g17420D                                          317   1e-97    
emb|CDP01076.1|  unnamed protein product                                317   1e-97    
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   1e-97    
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         317   1e-97    
gb|EPS63474.1|  hypothetical protein M569_11308                         316   1e-97    
ref|XP_009110142.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       317   1e-97    
gb|EEC82058.1|  hypothetical protein OsI_26044                          317   1e-97    
ref|XP_008229476.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    317   1e-97    
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   1e-97    
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   1e-97    
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   1e-97    
ref|XP_011009482.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   2e-97    
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   2e-97    
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    316   2e-97    
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    316   2e-97    
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   2e-97    
ref|XP_008234165.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       316   2e-97    
ref|XP_002322563.2|  hypothetical protein POPTR_0016s02260g             316   2e-97    
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       316   2e-97    
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    316   2e-97    
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     316   2e-97    
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       316   3e-97    
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    316   3e-97    
ref|XP_008386313.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       316   3e-97    
ref|XP_004489447.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       316   3e-97    
ref|XP_010658655.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    307   3e-97    
ref|XP_004306404.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       315   3e-97    
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    315   4e-97    
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             315   4e-97    
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    315   4e-97    
ref|XP_007207189.1|  hypothetical protein PRUPE_ppa017055mg             315   4e-97    
ref|XP_006853259.1|  hypothetical protein AMTR_s00038p00231120          315   5e-97    
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              315   5e-97    
ref|XP_008229473.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       315   5e-97    
ref|XP_011014733.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    315   5e-97    
gb|ABR18044.1|  unknown                                                 315   6e-97    
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    315   6e-97    
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    315   6e-97    
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    315   6e-97    
gb|EMT24598.1|  Cytokinin-O-glucosyltransferase 2                       315   6e-97    
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             317   6e-97    
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       314   7e-97    
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       315   7e-97    
ref|XP_010041627.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    315   7e-97    
ref|XP_002322559.2|  hypothetical protein POPTR_0016s02220g             315   7e-97    
gb|ABR16342.1|  unknown                                                 315   7e-97    
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    315   8e-97    
emb|CDY41486.1|  BnaA08g20880D                                          315   8e-97    
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    315   8e-97    
gb|AHL38933.1|  glycosyltransferase                                     314   9e-97    
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    314   9e-97    
ref|XP_002462874.1|  hypothetical protein SORBIDRAFT_02g033570          314   1e-96    
gb|AFJ52995.1|  UDP-glycosyltransferase 1                               315   1e-96    
ref|XP_002322567.2|  hypothetical protein POPTR_0016s02230g             314   1e-96    
ref|XP_008229475.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    314   1e-96    
ref|XP_008789350.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    314   1e-96    
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             314   1e-96    
gb|KDP41399.1|  hypothetical protein JCGZ_15806                         314   1e-96    
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    314   1e-96    
ref|XP_006649062.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       314   2e-96    
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    314   2e-96    
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    314   2e-96    
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    314   2e-96    
ref|XP_002285779.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   2e-96    
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             314   2e-96    
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   3e-96    
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       313   3e-96    
ref|XP_002323978.2|  hypothetical protein POPTR_0017s07940g             313   3e-96    
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   3e-96    
ref|XP_002525853.1|  UDP-glucuronosyltransferase, putative              313   3e-96    
ref|XP_002308829.1|  hypothetical protein POPTR_0006s02310g             313   3e-96    
ref|XP_007133982.1|  hypothetical protein PHAVU_010G009000g             313   3e-96    
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       313   4e-96    
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                    313   4e-96    
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       313   4e-96    
ref|XP_010063159.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   4e-96    
gb|KFK44333.1|  hypothetical protein AALP_AA1G244500                    313   4e-96    
ref|XP_010039828.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   4e-96    
gb|AIF76151.1|  UDP-glucosyltransferase UGT85U2                         312   5e-96    
ref|XP_008229739.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       313   5e-96    
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   5e-96    
ref|NP_001059667.1|  Os07g0489300                                       311   5e-96    
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             312   5e-96    
ref|XP_008342288.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       312   7e-96    
gb|KFK44334.1|  hypothetical protein AALP_AA1G244600                    312   7e-96    
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       311   9e-96    
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         312   1e-95    
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             312   1e-95    
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    312   1e-95    
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       311   1e-95    
ref|XP_007141201.1|  hypothetical protein PHAVU_008G175600g             311   1e-95    
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   1e-95    
ref|XP_008811180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       311   1e-95    
ref|XP_003598165.1|  Cytokinin-O-glucosyltransferase                    311   1e-95    
dbj|BAD93690.1|  glycosyltransferase                                    311   2e-95    
ref|XP_009370709.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   2e-95    
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   2e-95    
ref|XP_008237171.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       311   2e-95    
ref|XP_011008546.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   2e-95    
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      311   2e-95    
ref|XP_008229477.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    311   2e-95    
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg             311   2e-95    
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     311   2e-95    
gb|AEB61489.1|  UDP-glucosyltransferase                                 311   2e-95    
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   2e-95    
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             311   2e-95    
ref|XP_011009478.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   2e-95    
ref|XP_008242242.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       310   3e-95    
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g             311   3e-95    
ref|XP_010063153.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   3e-95    
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    321   3e-95    
emb|CDX91674.1|  BnaC08g05930D                                          310   3e-95    
ref|XP_007199429.1|  hypothetical protein PRUPE_ppa026557mg             311   3e-95    
dbj|BAK02647.1|  predicted protein                                      311   3e-95    
gb|KHN33502.1|  UDP-glycosyltransferase 85A2                            310   3e-95    
ref|XP_010030030.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    310   4e-95    
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    310   4e-95    
ref|XP_002322561.2|  hypothetical protein POPTR_0016s02260g             310   4e-95    
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             310   4e-95    
ref|XP_003547073.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       310   4e-95    
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       310   5e-95    
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    310   5e-95    
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                       310   5e-95    
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    310   5e-95    
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       310   5e-95    
ref|XP_010063161.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    310   6e-95    
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              310   6e-95    
ref|XP_004155500.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       310   6e-95    
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       310   6e-95    
ref|XP_003592231.1|  Cytokinin-O-glucosyltransferase                    310   6e-95    
ref|XP_004957721.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       309   6e-95    
ref|XP_007047909.1|  UDP-glucosyl transferase 85A2                      309   8e-95    
gb|ABV68925.1|  mandelonitrile glucosyltransferase UGT85A19             309   8e-95    
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       310   8e-95    
gb|EAZ39846.1|  hypothetical protein OsJ_24286                          307   9e-95    
ref|XP_011092429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    309   9e-95    
gb|KCW70354.1|  hypothetical protein EUGRSUZ_F03599                     309   9e-95    
ref|XP_003545683.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       309   9e-95    
ref|XP_007227474.1|  hypothetical protein PRUPE_ppa004968mg             309   1e-94    
dbj|BAG80547.1|  glycosyltransferase                                    309   1e-94    
ref|XP_006388804.1|  hypothetical protein POPTR_0098s00310g             309   1e-94    
ref|XP_002308828.2|  hypothetical protein POPTR_0006s02330g             309   1e-94    
ref|XP_003618657.1|  Cytokinin-O-glucosyltransferase                    309   1e-94    
ref|XP_011016624.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    310   1e-94    
ref|XP_008219457.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       309   1e-94    
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                    309   1e-94    
ref|XP_002323974.2|  hypothetical protein POPTR_0017s07880g             309   1e-94    
gb|ABW96222.1|  glucosyltransferase                                     309   2e-94    
ref|XP_009349617.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    309   2e-94    
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       309   2e-94    
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    309   2e-94    
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             308   2e-94    
gb|ACU24374.1|  unknown                                                 308   2e-94    
emb|CDO97426.1|  unnamed protein product                                308   2e-94    
gb|KHN33534.1|  UDP-glycosyltransferase 85A2                            308   2e-94    
ref|XP_002323187.1|  hypothetical protein POPTR_0016s02180g             308   2e-94    
ref|XP_011014888.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    308   2e-94    
ref|XP_002891115.1|  predicted protein                                  308   3e-94    
ref|XP_003618637.1|  Cytokinin-O-glucosyltransferase                    308   3e-94    
gb|AIF76152.1|  UDP-glucosyltransferase UGT85U1                         308   3e-94    
ref|XP_010477497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       308   3e-94    
ref|XP_008811178.1|  PREDICTED: UDP-glycosyltransferase 85A7-like...    308   3e-94    
ref|XP_008455195.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       308   3e-94    
ref|XP_009364608.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    308   4e-94    



>ref|XP_004235055.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=468

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/461 (61%), Positives = 349/461 (76%), Gaps = 12/461 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++IFP PAQ H+NSMLKLA LL L+NF +TF V  + H RLL  TDV S RF + F LQ
Sbjct  6     HVIIFPFPAQGHVNSMLKLAQLLSLSNFQVTFLVTVDTHDRLLNHTDVLS-RFGSEFHLQ  64

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALD  412
               P GI    +N+++    L DSL +I KPFL+++IA +  +    TC I+D ++S+A D
Sbjct  65    PLPHGISMDVMNTRDGLSILYDSLNKIAKPFLREFIAYSPVT----TCLIADGILSMAGD  120

Query  413   VSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRV  592
             V+EE  NLP+ YFR  SA +FW+YF +PDL + GELP+K N  D + +TKVKGMEDFLR 
Sbjct  121   VAEE-INLPIIYFRTASASSFWSYFCMPDLIQVGELPLKENAKDLT-LTKVKGMEDFLRG  178

Query  593   RDLSPFCRDEDLAV----LYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIG  760
             RDL  FC+  D+      +  TE R   +ARGLILNTFEDLEGPILSQIRT  PNVYTIG
Sbjct  179   RDLPSFCQASDVTSPDFRIVMTETRQTPRARGLILNTFEDLEGPILSQIRTVCPNVYTIG  238

Query  761   PLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWY  940
             P+HAHLKA L +KST SNSL QEDE+CM+WLD+Q PKSVIYVSFGS++ +T+++L+EFWY
Sbjct  239   PVHAHLKAKLVTKSTSSNSLWQEDESCMSWLDTQPPKSVIYVSFGSVAGLTKEELLEFWY  298

Query  941   GLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGF  1120
             G+VNS +KFLWVMR DL+ G++ ++  IP EL++GTKA GY+  W PQE VL H A+GGF
Sbjct  299   GIVNSEQKFLWVMRPDLIIGQERKDE-IPVELEQGTKARGYMADWVPQEKVLAHRAIGGF  357

Query  1121  LTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRE  1300
             LTHSGWNSTLESI  GVPMICWP FADQQ NSRFVGEVWK+GLD+KD CDR  + K I +
Sbjct  358   LTHSGWNSTLESIVEGVPMICWPRFADQQVNSRFVGEVWKMGLDIKDTCDRDIIAKSITD  417

Query  1301  LMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             LMEKR GEF +R ENM  LAK+A++EGGSSY N D L+QD+
Sbjct  418   LMEKRNGEFSQRTENMASLAKKAVNEGGSSYINLDRLMQDI  458



>ref|XP_010318075.1| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetic acid glucosyltransferase-like 
[Solanum lycopersicum]
Length=469

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/464 (61%), Positives = 349/464 (75%), Gaps = 11/464 (2%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++IFP PAQ H+NSMLKLA LL L+NFHITF V  + H RLL  TDV S RF + F LQ
Sbjct  6     HVIIFPFPAQGHVNSMLKLAQLLSLSNFHITFLVTVDTHDRLLNHTDVLS-RFGSGFHLQ  64

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALD  412
               P GI    +N+++    L +SL +I K FL+++I  N +S  P TC I+D ++S+A D
Sbjct  65    PLPHGISMDVMNTRDGLSILYNSLNKIAKLFLREFIV-NMNS--PVTCLIADGILSMAGD  121

Query  413   VSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRV  592
             V++E  NLP+ YFR ISACAFW+YF +P L +AG+LP+K N +D   +TKVKGME+FLR 
Sbjct  122   VAQE-INLPLIYFRTISACAFWSYFCIPHLIQAGQLPLKENAMDLI-LTKVKGMENFLRG  179

Query  593   RDLSPFCRDEDLAV----LYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIG  760
             RDL   CR  D+      +  TE     +ARGLILNT EDLEGPILSQI+T  PNVYTIG
Sbjct  180   RDLPSVCRASDVTRPDFRILMTETLQTPRARGLILNTIEDLEGPILSQIQTVCPNVYTIG  239

Query  761   PLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWY  940
             P+HAHLKA LA+ ST SNSL QEDE+CM+WLD+Q PKSVIYVSFGSI+ +T+++L+EF Y
Sbjct  240   PVHAHLKAKLATTSTSSNSLWQEDESCMSWLDTQPPKSVIYVSFGSIAGLTKEELLEFXY  299

Query  941   GLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGF  1120
             GLVNS +KFLWVMRSDL+ G++ ++  IP EL++GTKA GY+  W PQE VL H A+GGF
Sbjct  300   GLVNSEQKFLWVMRSDLIIGQERKDE-IPVELEQGTKARGYMADWVPQEKVLAHKAIGGF  358

Query  1121  LTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRE  1300
             LTHSGWNSTLESI  GVPMICWP FADQQ NSRF+GEVWK+GLD+KD CDR  + K +RE
Sbjct  359   LTHSGWNSTLESIVEGVPMICWPRFADQQVNSRFIGEVWKMGLDIKDTCDRDIIAKSVRE  418

Query  1301  LMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKV  1432
             LMEKR GEF +R E M  LAK+AI+EGGSS  N D LIQD+  V
Sbjct  419   LMEKRNGEFSQRTEQMASLAKKAINEGGSSCINLDRLIQDIRSV  462



>ref|XP_006361975.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Solanum tuberosum]
Length=470

 Score =   515 bits (1326),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 261/457 (57%), Positives = 320/457 (70%), Gaps = 54/457 (12%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++IFP PAQ H+NSMLKLA LL L+NF ITF V  + H  LL  TDV S RF + F LQ
Sbjct  6     HVIIFPFPAQGHVNSMLKLAQLLSLSNFDITFLVTLDTHDHLLNHTDVIS-RFGSGFLLQ  64

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALD  412
             + P GI    +N+++    L DSL +I KPFL+++I  +     P TC I+D L+S+A D
Sbjct  65    ALPHGISMDVMNTRDGISMLYDSLNKIAKPFLREFITYS-----PVTCLIADGLLSLAGD  119

Query  413   VSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRV  592
             V++E  NLP+ YFR  SA +FW+YF +PDL + GELP+K                     
Sbjct  120   VAKE-INLPIIYFRTASASSFWSYFCMPDLIQVGELPLK---------------------  157

Query  593   RDLSPFCRDEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHA  772
                                      ARGLILNTFEDLEGPILSQIRT  PNVYTIG +HA
Sbjct  158   -------------------------ARGLILNTFEDLEGPILSQIRTVCPNVYTIGAVHA  192

Query  773   HLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVN  952
             HLKA LA+KST SNSL QEDE+ M+WLD+Q PKSVIYVSFGS++ +T+++L+EFWYGLVN
Sbjct  193   HLKAKLATKSTSSNSLWQEDESWMSWLDTQPPKSVIYVSFGSVAGLTKEELLEFWYGLVN  252

Query  953   SGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHS  1132
             S +KFLWVMR DL+ G++ ++  IP EL++GTKA GY+  W PQE VL H A+GGFLTHS
Sbjct  253   SEQKFLWVMRPDLIIGREKKDE-IPVELEQGTKARGYMADWVPQEKVLAHRAIGGFLTHS  311

Query  1133  GWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEK  1312
             GWNSTLESI  GVPMICWP FADQQ NSRFVGEVWK+GLD+KD CDR  + K IR+LMEK
Sbjct  312   GWNSTLESIVEGVPMICWPRFADQQVNSRFVGEVWKMGLDIKDTCDRDIIAKSIRDLMEK  371

Query  1313  RKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R GEF +R E+M  LAK+A++EGGSSY N D LIQD+
Sbjct  372   RNGEFSQRTEHMASLAKKAVNEGGSSYINLDRLIQDI  408



>gb|AGX93066.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Lonicera 
japonica]
Length=489

 Score =   515 bits (1326),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 256/476 (54%), Positives = 340/476 (71%), Gaps = 25/476 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+L+FPLP Q H+NSMLKLA LL LA+  ++F V    H RLL  T+++S RF+    FR
Sbjct  11    HVLVFPLPIQGHVNSMLKLAELLCLADLDVSFMVSDFSHTRLLRHTNIES-RFSKYPGFR  69

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN----RDSGLPFTCFISDLL  394
              Q+   G+ D    + E  +++  S++ +  P  K+ + ++     +   P TC I+D +
Sbjct  70    FQTISDGLPDDHPRAGEKIMDIMPSIKNVTGPLFKKMMEESGCLVAEGRRPVTCIIADGV  129

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A D++EE   +P+ YFR +SAC+FW  + + +L EA E+P+KGNG+D   +T V GM
Sbjct  130   LSFAGDLAEEK-GIPLIYFRTVSACSFWACYCMEELIEADEIPVKGNGMDLL-VTSVPGM  187

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             + FLR RDL  FCR  D+      +  +E+R   +A+  I+N+FEDLEGPI+S IRT+ P
Sbjct  188   DGFLRRRDLPGFCRVNDINEPKLQIIKSESRQTPRAQAAIVNSFEDLEGPIISHIRTQIP  247

Query  743   NVYTIGPLHAHLKATLASKSTH-----------SNSLLQEDETCMAWLDSQEPKSVIYVS  889
              +Y +GPLHAHLK+ LA K+             + S  +ED TC+ WL+SQ+PKSVIYVS
Sbjct  248   RLYPLGPLHAHLKSRLALKTNQPLKTDQSSSSSTGSFWEEDRTCVDWLNSQQPKSVIYVS  307

Query  890   FGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIV  1069
             FGSI+V+TR QL+EFWYGLVNSG+KFLWVMR D +AGK+ E S IP EL+EGTKA G++V
Sbjct  308   FGSITVVTRGQLLEFWYGLVNSGQKFLWVMRPDSIAGKEGE-SQIPVELEEGTKARGFMV  366

Query  1070  GWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGL  1249
             GWAPQE VLDH A+GGF THSGWNSTLES+ AGVPMICWP+FADQ  NSRFVGEVWK+GL
Sbjct  367   GWAPQEEVLDHPAIGGFFTHSGWNSTLESVYAGVPMICWPYFADQMINSRFVGEVWKLGL  426

Query  1250  DMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             DMKD CDR ++EK++RELME RK E+LERA  M  LAK+++SEGGSSYCN D +++
Sbjct  427   DMKDSCDRITIEKMVRELMEVRKDEYLERAGQMAALAKKSVSEGGSSYCNLDRMVE  482



>gb|AIE12477.1| UGT4 [Panax ginseng]
Length=478

 Score =   512 bits (1319),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 264/470 (56%), Positives = 327/470 (70%), Gaps = 21/470 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q  +NSM KLA LL LA  HITF V   IH RLL  TD+ S RF     FR
Sbjct  10    HVLIFPLPLQGPVNSMFKLAELLCLAGIHITFLVTDFIHTRLLRYTDIHS-RFNRYPGFR  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR---DSGLPFTCFISDLLV  397
             L++   G+ +       + +EL DSL+   KP  K+ +       D G P TC I+D ++
Sbjct  69    LETISDGMPEDHPRGDRI-MELFDSLKTNTKPLFKELLTTGSLGSDKGRPITCIIADGIM  127

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
                 DV+ E   +P+ Y R ISAC  W +F LP+L EAGELP  G+ +D+ PI  V G E
Sbjct  128   GFTCDVANE-IGIPIIYVRTISACCLWVFFCLPNLIEAGELPFNGDDLDT-PIKSVPGTE  185

Query  578   DFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
             + LR+RDL  FCR  D+      LY TE +   +A GLILNTFEDLEGPILSQ+RT  PN
Sbjct  186   NSLRIRDLPSFCRSGDICHPSIQLYKTERQELRRAYGLILNTFEDLEGPILSQMRTVCPN  245

Query  746   VYTIGPLHAHLKATLASKSTH----SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
             +Y IGPLH HLK  LA++ST     SNSL +ED++C+ WLDSQ PKSVIYVSFGS++++T
Sbjct  246   LYPIGPLHTHLKTKLAAESTSPAISSNSLWKEDKSCITWLDSQPPKSVIYVSFGSLAIMT  305

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             R QLMEFW+GLVNSG KFLWV+R D VAG    +S IP+E+ EGTK  GYIVGWAPQE V
Sbjct  306   RDQLMEFWHGLVNSGCKFLWVIRPDSVAG----DSQIPAEVAEGTKERGYIVGWAPQEEV  361

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H +VGGFLTHSGWNSTLES+  G PMICWP+F DQQ NSRFV E WK+GLDMKD CDR
Sbjct  362   LAHPSVGGFLTHSGWNSTLESVIEGKPMICWPYFMDQQVNSRFVEEFWKLGLDMKDTCDR  421

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
                EK++++LM +R+ EF++ A+ M +L K+ +SEGGSSYCN D LI+D+
Sbjct  422   VIFEKMVKDLMVERRDEFMKSADQMARLGKKCLSEGGSSYCNLDRLIEDI  471



>ref|XP_010277669.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=497

 Score =   508 bits (1308),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 261/468 (56%), Positives = 329/468 (70%), Gaps = 14/468 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+++FP+P Q H+NSMLKL+ LL L   H+TF    +IH RLL  T+V S RF     F 
Sbjct  21    HVVVFPIPVQGHVNSMLKLSELLSLTGIHVTFLTFEHIHRRLLRFTNVTS-RFARWPGFH  79

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR---DSGLPFTCFISDLLV  397
               + P  +     NS    +E  DSL+    P L++ +  NR   D   P TC I+D  +
Sbjct  80    FATIPSDLPFDHPNSGPQLMEFFDSLKITSIPPLREMLVSNRRESDVRPPVTCIIADGTL  139

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             S  +DV++E  N+PV YFR ISAC+FW YFS+P L EAGELP  G+     PIT V GME
Sbjct  140   SFTIDVAQE-LNIPVIYFRTISACSFWAYFSIPKLVEAGELPFGGDADMDCPITCVPGME  198

Query  578   DFLRVRDLSPFCRDEDLAVLY----YTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
              FLR RDL  F R  +L+  +      E     +A  LILNTFE+LEGPILSQIR+  P 
Sbjct  199   SFLRRRDLPNFLRTNNLSDRFLQFIMAETLNTTRASALILNTFEELEGPILSQIRSHCPK  258

Query  746   VYTIGPLHAHLKATLA--SKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             +YTIGPLHA L+  +A  S S  SNSL +E+++C+ WLDS+  +SV+YVSFGSI+V+TR+
Sbjct  259   LYTIGPLHALLQTQIADFSPSVSSNSLWEENKSCIRWLDSKPLRSVVYVSFGSITVMTRE  318

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             ++MEFW+GLVNSGK FLWV+R DL+AGK+ E+  I +EL EGT+  GYIVGWAPQE VL 
Sbjct  319   EIMEFWHGLVNSGKWFLWVIRPDLLAGKEGEDQ-ILTELVEGTRERGYIVGWAPQEEVLA  377

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H AVGGFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV EVWK+GLDMKD CDR  
Sbjct  378   HPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQVNSRFVSEVWKLGLDMKDTCDRWK  437

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             VE +++ELMEK+  E L+ A+ M KLA+ ++SEGGSS CN+D LI+D+
Sbjct  438   VELMVKELMEKKMDEMLKSADKMAKLARMSVSEGGSSSCNWDKLIKDI  485



>gb|AGX93071.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Vinca 
minor]
Length=482

 Score =   507 bits (1305),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 255/472 (54%), Positives = 328/472 (69%), Gaps = 18/472 (4%)
 Frame = +2

Query  44    FIGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR-  220
             F  H+LIFPLP Q H+NSML+LA LL LA   ITF V    H RL+  T+V S RF    
Sbjct  8     FPPHVLIFPLPIQGHVNSMLRLAELLCLAKLDITFVVSDFSHNRLIKHTNVAS-RFARYP  66

Query  221   -FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR----DSGLPFTCFIS  385
              F+ Q+   G+ D    + E  +++  S + +  P  K+ + +N      +  P TC I+
Sbjct  67    GFQFQTISDGLPDDHPRAGEKVMDILPSTKNVTGPLFKRMMIENNCFASSTRRPTTCIIA  126

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
             D ++S A D +EE   +P+ YFR +SACAFW  FS+P+L E+G++PIKGNG+D   +  V
Sbjct  127   DGVLSFAGDFAEEN-GVPLIYFRTVSACAFWACFSMPELIESGDIPIKGNGMDLL-VKGV  184

Query  566   KGMEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRT  733
              GME FLR RDL  FCR  D++     +  TE R   +A+  ILNTFEDLEGPILSQIR 
Sbjct  185   AGMETFLRRRDLPGFCRVNDMSEPKLQIIKTETRQTTRAQAAILNTFEDLEGPILSQIRK  244

Query  734   KYPNVYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSI  901
               P ++TIGP H+HL + L ++    S  S S  +ED +C+ WLDSQ P+SV+YVSFGSI
Sbjct  245   HIPRLFTIGPSHSHLNSRLETQNIKTSISSGSFWEEDRSCVDWLDSQPPRSVLYVSFGSI  304

Query  902   SVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAP  1081
             +V+TR QL+EFW+GLVNSG +FLWVMR D + GKD E   +P EL+EGTK  GY+VGWAP
Sbjct  305   TVVTRAQLLEFWHGLVNSGHRFLWVMRPDSIMGKDGENR-VPHELEEGTKERGYMVGWAP  363

Query  1082  QEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKD  1261
             QE VL+H A+GGF TH GWNSTLESI AGVPMICWP+FADQ  NSRFV E+WK+GLDMKD
Sbjct  364   QEEVLNHSAIGGFFTHCGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKD  423

Query  1262  VCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
              CDR  + K++RELME +K EF+ERA+ M KLA++A+SEGGSSY N D L++
Sbjct  424   SCDREIIVKMVRELMEVKKDEFMERADEMAKLARKAVSEGGSSYSNLDALVE  475



>gb|AGX93072.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Catharanthus 
longifolius]
Length=482

 Score =   506 bits (1303),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 261/473 (55%), Positives = 336/473 (71%), Gaps = 19/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSML+LA LL LA   ITF V    H+RL+  T+V S RF     F+
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLIKHTNVAS-RFARYPGFQ  69

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR----DSGLPFTCFISDLL  394
              Q    G+ D    + E  +++  S + +  P  KQ + +N+     +  P TC I+D +
Sbjct  70    FQPISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGV  129

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A D ++E   +P+ YFR +SAC+FW  F +P+L E+G++PIKGNG+D   +  V GM
Sbjct  130   LSFAGDFAQEK-GIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNGMDLI-VKSVPGM  187

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL  FCR  D+      +  TE R   +A+  ILNTFEDLEGPILSQIR   P
Sbjct  188   ETFLRRRDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIRKHMP  247

Query  743   NVYTIGPLHAHLKATLASKSTH----SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
              ++TIGP H+HL + L +K+      S S  +ED +C+ WLD+Q P+SV+YVSFGSI+V+
Sbjct  248   RLFTIGPSHSHLTSRLETKNIKTLISSGSFWEEDRSCVDWLDAQPPRSVLYVSFGSITVV  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR QL+EFWYGLVNSG++FLWVMR D + GKD + S IP++L+EGTKA GY+VGWAPQE 
Sbjct  308   TRDQLLEFWYGLVNSGQRFLWVMRPDSIMGKDGQ-SQIPADLEEGTKARGYMVGWAPQEE  366

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL+H A+GGFLTHSGWNSTLESI AGVPMICWP+FADQ  NSRFV E+WK+GLDMKD CD
Sbjct  367   VLNHPAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCD  426

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIK  1429
             R ++ K++RELME RK EFL+RA++M KLAKEA+SEGGSSY N D L+ D IK
Sbjct  427   RETIMKMVRELMEIRKDEFLQRADHMAKLAKEAVSEGGSSYSNLDGLV-DYIK  478



>sp|U3U992.1|UGT8_CATRO RecName: Full=7-deoxyloganetic acid glucosyltransferase; AltName: 
Full=UDP-glucose glucosyltransferase 8; Short=CrUGT8; AltName: 
Full=UDP-glycosyltransferase 709C2 [Catharanthus roseus]
 dbj|BAO01109.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=482

 Score =   506 bits (1303),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 261/473 (55%), Positives = 336/473 (71%), Gaps = 19/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSML+LA LL LA   ITF V    H+RL+  T+V S RF     F+
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLIKHTNVAS-RFARYPGFQ  69

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR----DSGLPFTCFISDLL  394
              Q    G+ D    + E  +++  S + +  P  KQ + +N+     +  P TC I+D +
Sbjct  70    FQPISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGV  129

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A D ++E   +P+ YFR +SAC+FW  F +P+L E+G++PIKGNG+D   +  V GM
Sbjct  130   LSFAGDFAQEK-GIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNGMDLI-VKSVPGM  187

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL  FCR  D+      +  TE R   +A+  ILNTFEDLEGPILSQIR   P
Sbjct  188   ETFLRRRDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIRKHMP  247

Query  743   NVYTIGPLHAHLKATLASKSTH----SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
              ++TIGP H+HL + L +K+      S S  +ED +C+ WLD+Q P+SV+YVSFGSI+V+
Sbjct  248   RLFTIGPSHSHLTSRLETKNIKTLISSGSFWEEDRSCVDWLDAQPPRSVLYVSFGSITVV  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR QL+EFWYGLVNSG++FLWVMR D + GKD + S IP++L+EGTKA GY+VGWAPQE 
Sbjct  308   TRDQLLEFWYGLVNSGQRFLWVMRPDSIMGKDGQ-SQIPADLEEGTKARGYMVGWAPQEE  366

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL+H A+GGFLTHSGWNSTLESI AGVPMICWP+FADQ  NSRFV E+WK+GLDMKD CD
Sbjct  367   VLNHPAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCD  426

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIK  1429
             R ++ K++RELME RK EFL+RA++M KLAKEA+SEGGSSY N D L+ D IK
Sbjct  427   RETIVKMVRELMEIRKDEFLQRADHMAKLAKEAVSEGGSSYSNLDGLV-DYIK  478



>gb|AGX93065.1| 7-deoxyloganetic acid UDP-glucosyltransferase [Catharanthus roseus]
 gb|AGX93073.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Catharanthus 
ovalis]
 gb|AHK60835.1| 7-deoxyloganetic acid-O-glucosyl transferase [Catharanthus roseus]
Length=482

 Score =   506 bits (1302),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 261/473 (55%), Positives = 336/473 (71%), Gaps = 19/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSML+LA LL LA   ITF V    H+RL+  T+V S RF     F+
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLIKHTNVAS-RFARYPGFQ  69

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR----DSGLPFTCFISDLL  394
              Q    G+ D    + E  +++  S + +  P  KQ + +N+     +  P TC I+D +
Sbjct  70    FQPISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGV  129

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A D ++E   +P+ YFR +SAC+FW  F +P+L E+G++PIKGNG+D   +  V GM
Sbjct  130   LSFAGDFAQEK-GIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNGMDLI-VKSVPGM  187

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL  FCR  D+      +  TE R   +A+  ILNTFEDLEGPILSQIR   P
Sbjct  188   ETFLRRRDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIRKHMP  247

Query  743   NVYTIGPLHAHLKATLASKSTH----SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
              ++TIGP H+HL + L +K+      S S  +ED +C+ WLD+Q P+SV+YVSFGSI+V+
Sbjct  248   RLFTIGPSHSHLTSRLETKNIKTLISSGSFWEEDRSCVDWLDAQPPRSVLYVSFGSITVV  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR QL+EFWYGLVNSG++FLWVMR D + GKD + S IP++L+EGTKA GY+VGWAPQE 
Sbjct  308   TRDQLLEFWYGLVNSGQRFLWVMRPDSIMGKDGQ-SQIPADLEEGTKARGYMVGWAPQEE  366

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL+H A+GGFLTHSGWNSTLESI AGVPMICWP+FADQ  NSRFV E+WK+GLDMKD CD
Sbjct  367   VLNHPAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCD  426

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIK  1429
             R ++ K++RELME RK EFL+RA++M KLAKEA+SEGGSSY N D L+ D IK
Sbjct  427   RETIVKMVRELMEIRKDEFLQRADHMAKLAKEAVSEGGSSYSNLDGLV-DYIK  478



>gb|AGX93069.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Rauvolfia 
serpentina]
Length=482

 Score =   501 bits (1291),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/469 (55%), Positives = 328/469 (70%), Gaps = 18/469 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSML+LA LL LA   ITF V    H+RL+  TDV S RF     FR
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELLCLAELDITFVVSEFSHSRLIKHTDVAS-RFARYPGFR  69

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR----DSGLPFTCFISDLL  394
              Q+   G+ D    + E  +++  S + +  P  KQ + +       +  P TC I+D +
Sbjct  70    FQTISDGLADDHPRAGERVMDILPSTKNVTGPLFKQMMLEKNCFASATRRPITCIIADGV  129

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A D +EE   +P+ YFR +SAC+FW  F +P+L EAG++PIKGNG+D + +  V GM
Sbjct  130   LSFAGDFAEEK-GIPLIYFRTVSACSFWACFCMPELIEAGDIPIKGNGMDLT-VKSVPGM  187

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL  FCR  D+      +  TE R   +A+  ILNTFEDLEGP LSQIR   P
Sbjct  188   ETFLRRRDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPTLSQIRKHMP  247

Query  743   NVYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
              ++TIGP H+HL + L ++    S  S S  +ED +C+ WLDSQ P+SV+YVSFGSI+V+
Sbjct  248   RLFTIGPSHSHLTSRLETRNIKTSISSGSFWEEDRSCVDWLDSQPPRSVLYVSFGSITVV  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR QL+EFW+GLV+SG++FLWVMR D + GKD E   IP EL+EGT+A GY+VGWAPQE 
Sbjct  308   TRDQLLEFWHGLVDSGQRFLWVMRPDSILGKDGENQ-IPPELEEGTRARGYMVGWAPQEE  366

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H A+GGFLTHSGWNSTLESI  GVPMICWP+FADQ  NSRFV E+WK+GLDMKD CD
Sbjct  367   VLYHPAIGGFLTHSGWNSTLESIVVGVPMICWPYFADQMINSRFVSELWKIGLDMKDTCD  426

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             R ++ K++RELME RK EFL+RA+ M KLA+ A+SEGGSSYCN D L++
Sbjct  427   RDTIVKMVRELMEHRKDEFLQRADQMAKLARMAVSEGGSSYCNLDGLVE  475



>ref|XP_011038346.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Populus 
euphratica]
Length=481

 Score =   501 bits (1290),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 250/467 (54%), Positives = 325/467 (70%), Gaps = 15/467 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSMLKLA LL LA  +ITF    + H  L   T+++  RFT    F+
Sbjct  10    HVLIFPLPCQGHVNSMLKLAELLSLAGINITFLNSEHNHELLARHTNIED-RFTKYPGFQ  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+      S +  +EL D+++ + KP  K+ + + +    P  C I D ++   
Sbjct  69    FQTIADGLPVDHPRSGDRLMELFDAMKVVAKPIFKKILLETKP---PVNCIIGDGVLGFV  125

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
              DV+ E   +P+ YFR ISAC+FW YFS+ D+ E G+LPI+GN      ITKV GME FL
Sbjct  126   GDVAIEV-GVPIIYFRTISACSFWAYFSISDIIEGGQLPIRGNEDMDRLITKVPGMETFL  184

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR  D+     +L   E R + +A+ LILNTFEDLEGPILS IRT+ P VY+
Sbjct  185   RCRDLPGFCRVSDMTHPNLLLVMNETRQSPRAKALILNTFEDLEGPILSHIRTQCPEVYS  244

Query  755   IGPLHAHLKATLASKSTHS----NSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             IGPLH HL+A L++K+  S    NSL + D +CM WLD+Q  KSV+YVSFGSI+V+TR Q
Sbjct  245   IGPLHEHLQAKLSAKNEKSCQSSNSLREIDRSCMTWLDNQPEKSVLYVSFGSITVMTRHQ  304

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
             L+EFWYGLV+S K+FLWV+R D +A K+ E   IP E++EGT+  G+I GW PQE VL H
Sbjct  305   LLEFWYGLVSSKKRFLWVIRPDSIATKNGEFEKIPVEVEEGTRDRGFIAGWVPQEEVLAH  364

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              A+ GFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFVGEVWK+GLDMKD CDR  V
Sbjct  365   KAIAGFLTHSGWNSTLESIVAGVPMICWPYFADQQVNSRFVGEVWKLGLDMKDQCDREIV  424

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             EK++ +LM +R+ EF+  A  M +L+++++ EGGSSYCN + LI+D+
Sbjct  425   EKMVNDLMVERREEFVRSATRMAELSRKSVREGGSSYCNLNRLIEDI  471



>ref|XP_010262684.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   500 bits (1287),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 253/471 (54%), Positives = 328/471 (70%), Gaps = 14/471 (3%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--R  220
             + H+L+ PLP Q H+N M+KL+ LL LA FH+TF    +IH RLL  T+++S RF     
Sbjct  7     VPHVLLCPLPVQGHINPMIKLSELLSLAGFHVTFLTSEHIHRRLLRFTNLNSSRFARCPG  66

Query  221   FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR---DSGLPFTCFISDL  391
             F   + P G+      S    VEL DSL+    P L++ +  NR   D   P TC I+D 
Sbjct  67    FHFATIPDGLPFDHPRSGPQLVELFDSLKLTSIPLLREMLVSNRWGSDVRPPVTCIIADG  126

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
             L+S  +DV+EE  N+P+  FR  SAC+FW YF +P L EAGELP  G+     P+T V G
Sbjct  127   LLSFTIDVAEE-LNIPIISFRTTSACSFWAYFCIPKLVEAGELPFGGDADMDCPVTCVPG  185

Query  572   MEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             ME FLR RDL  FCR  +L         TE   A +A  LILNT+EDLEGPILS+IR+  
Sbjct  186   MESFLRRRDLPSFCRTNNLGERPFQFLVTENLNATRASALILNTYEDLEGPILSRIRSHC  245

Query  740   PNVYTIGPLHAHLKATLASKSTHSNS---LLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             P +YTIGPLHA LK+ LA  S   +S   L +E+++C+ WLDS+  +SV+YVSFGS++ +
Sbjct  246   PKLYTIGPLHALLKSQLADSSHSVSSSSSLWEENKSCITWLDSKALRSVVYVSFGSLATM  305

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR +++EFW+GLVNSGK FLWV+RSDL++ K+ E+  I +EL +GT+  GYIVGWAPQE 
Sbjct  306   TRDEVLEFWHGLVNSGKPFLWVIRSDLLSVKEGEDE-ILTELVKGTRERGYIVGWAPQEE  364

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNSTLES+ AGVPMICWP  ADQQ NSRFV E+W++GLDMKD CD
Sbjct  365   VLAHPAVGGFLTHSGWNSTLESVYAGVPMICWPKLADQQVNSRFVSEMWRLGLDMKDTCD  424

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R  VE +++E+ME+++ E ++ AENM KLA+ ++SEGGSS CNFD LIQD+
Sbjct  425   RLKVELMVKEVMEQKRDEMMKSAENMAKLARMSVSEGGSSSCNFDKLIQDI  475



>gb|AGX93068.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Amsonia 
hubrichtii]
Length=482

 Score =   498 bits (1282),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 253/469 (54%), Positives = 332/469 (71%), Gaps = 18/469 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSML+LA LL LA   ITF V    H+RL+  T++ S RF     F+
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLVKHTNIAS-RFARYPGFQ  69

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR----DSGLPFTCFISDLL  394
              Q+   G+ D    + E  +++  + + +  P  KQ + +       +  P TC I+D +
Sbjct  70    FQTISDGLPDDHPRAGERVMDILPATKNVTGPLFKQMMVEKNFFATTTRRPITCIIADGV  129

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A D +EE   +P+ YFR +SAC+FW  F +P+L EAG++PIKGNG+D   +  V GM
Sbjct  130   LSFAGDFAEET-GIPLIYFRTVSACSFWACFCMPELIEAGDIPIKGNGMDLI-VKSVPGM  187

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL  FCR  D+      +  TE R   +A+  ILNTFEDLEGPILSQIR   P
Sbjct  188   ECFLRRRDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIRKHMP  247

Query  743   NVYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
              ++TIGP H+HL + L SK    S  S S  +ED +C+ WLD+Q PKSV+YVSFGSI+V+
Sbjct  248   RLFTIGPSHSHLTSRLESKNIKTSISSGSFWEEDRSCVDWLDAQPPKSVLYVSFGSITVV  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR QL+EFW+GLVNSG++FLWVMR D + G+D + S IP+EL+EGTKA GY+VGWAPQE 
Sbjct  308   TRDQLLEFWHGLVNSGQRFLWVMRPDSIMGEDGK-SQIPAELEEGTKARGYMVGWAPQEE  366

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL+H A+GGF THSGWNSTLESI +GVPMICWP+FADQ  NSRFV E+WK+GLDMKD CD
Sbjct  367   VLNHPAIGGFFTHSGWNSTLESIVSGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCD  426

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             R ++EK++RELME RK EFL+R++++ KLA++A+ EGGSSY N D L++
Sbjct  427   RDAIEKMVRELMEVRKDEFLQRSDHIAKLARKAVGEGGSSYANLDGLVE  475



>emb|CDP05611.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   497 bits (1280),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 269/483 (56%), Positives = 339/483 (70%), Gaps = 27/483 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFP  AQ H+NSMLKLA LL LA  +ITF V  NIH RLL  TDV S RF+    F 
Sbjct  10    HVLIFPFQAQGHVNSMLKLAELLCLAGINITFLVSYNIHNRLLRHTDVVS-RFSKYPGFN  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL-----PFTCFISDL  391
             L  +P    +  +++ +  +EL  SL+ + KPFL+++++++   G       F+  I+D 
Sbjct  69    LDHYPDAYDESKIHTAQQIMELYSSLQSVVKPFLREFMSKDPAHGTGKNRSRFSSIIADG  128

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
             ++S+ALDV+EE   LP+ YFR ISA AFWTYF +P L EAGELP  G+ ++   I  VKG
Sbjct  129   ILSLALDVAEE-IGLPLIYFRTISAGAFWTYFCIPQLVEAGELPFPGDDMNIR-IENVKG  186

Query  572   MEDFLRVRDLSPFCRDEDLAV----LYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             ME FLR  DL  FCR  DL      L   E     +A+GLILNTFEDLEG ILS +RT  
Sbjct  187   MEGFLRRCDLPSFCRVSDLTSPDLSLLLRETLQTPRAKGLILNTFEDLEGSILSHVRTYC  246

Query  740   PNVYTIGPLHAHLKATL-------ASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGS  898
             PN+YTIGPLHAHLK  L        + +++SNSL QED++C+ WLD+Q PKSV+YVSFGS
Sbjct  247   PNLYTIGPLHAHLKTRLQLQVANSNNSNSNSNSLWQEDKSCIKWLDNQPPKSVLYVSFGS  306

Query  899   ISVITRQQLMEFWYGLVNSGKKFLWVMRSDLV---AGKD---DEESPIPSELKEGTKANG  1060
             I+VITR++L EFW+G+VNSG KFLWV+R D +   AG D     +S    EL+E TK  G
Sbjct  307   ITVITREKLHEFWHGIVNSGVKFLWVIRPDSIKAEAGDDVLKTTKSTPEMELEEATKERG  366

Query  1061  YIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWK  1240
              +VGWAPQE VL H A+GGFLTHSGWNSTLESIA GVPMICWP+FADQQ NSRFVGEVWK
Sbjct  367   CMVGWAPQEEVLAHPAIGGFLTHSGWNSTLESIAEGVPMICWPYFADQQPNSRFVGEVWK  426

Query  1241  VGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQD  1420
             +GLD+KD CDR  VEK I++LM +RK EFL RA+ M K+A++++ EGGSS+CN   LI D
Sbjct  427   IGLDIKDTCDRVIVEKAIKDLMVERKDEFLHRADEMAKMARKSVEEGGSSFCNLVRLIDD  486

Query  1421  MIK  1429
             ++K
Sbjct  487   IVK  489



>ref|XP_006435573.1| hypothetical protein CICLE_v10031368mg [Citrus clementina]
 ref|XP_006486447.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
 gb|ESR48813.1| hypothetical protein CICLE_v10031368mg [Citrus clementina]
Length=484

 Score =   497 bits (1279),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 250/463 (54%), Positives = 318/463 (69%), Gaps = 11/463 (2%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LI+PLPA  H+NSMLKLA LL  A   ITF    + H RL+  +     R+     F+
Sbjct  17    HVLIWPLPALGHVNSMLKLAELLSHAGIKITFLNSEHYHERLVRHSSDVFSRYMNLPGFQ  76

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      + + F EL +SL  +  P LK  +    D+  P  C ISD L+S A
Sbjct  77    FKTITDGLPKDHPQTVDNFHELLNSLASVTPPLLKDMLT---DAKSPVHCIISDGLMSFA  133

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +DV+++   +P+ YFR +SACAFW YF +P++ +AGELPIKGN      I  V GME FL
Sbjct  134   IDVAKQ-VGIPIIYFRTVSACAFWAYFCIPEIIDAGELPIKGNEDMDRLIKHVPGMEKFL  192

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR ED       L  +E R +V+A GL+LNTFEDLEGP+LSQIR   P +YT
Sbjct  193   RCRDLPSFCRAEDPMDMNLQLVVSETRSSVRADGLVLNTFEDLEGPVLSQIRAHCPKIYT  252

Query  755   IGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEF  934
             IGPL+AHLKA +   +  SNSL + D +C+AWLD+Q  KSVI+VSFGS++V+ R QL+EF
Sbjct  253   IGPLNAHLKARIPENTHSSNSLWEVDRSCIAWLDNQPSKSVIFVSFGSVAVMQRDQLIEF  312

Query  935   WYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVG  1114
             WYGLVNS K+FLWV+R DL++GKD E   IP EL + TK  GYI GW PQE VL H AVG
Sbjct  313   WYGLVNSHKRFLWVIRPDLISGKDGENQ-IPKELDKATKERGYIAGWVPQEEVLGHKAVG  371

Query  1115  GFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLI  1294
             GFLTH GWNSTLESI A +PMICWP FADQQ NSRFV EVWK+GLDMKD+CDR  VEK++
Sbjct  372   GFLTHCGWNSTLESIVARMPMICWPSFADQQINSRFVDEVWKLGLDMKDLCDRKIVEKMV  431

Query  1295  RELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              EL+ +R+  F++ A+ M  LA ++++EGGSSYCN D LI D+
Sbjct  432   NELLVERRAAFMKSADRMANLAIKSVNEGGSSYCNLDHLINDI  474



>emb|CDP05607.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   496 bits (1278),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 267/485 (55%), Positives = 337/485 (69%), Gaps = 29/485 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFP PAQ H+NSMLKLA LL LA  +ITF V +NIH RLL  T+V S RF+    F 
Sbjct  10    HVLIFPFPAQGHVNSMLKLAELLCLAGINITFLVSNNIHNRLLRHTNVVS-RFSKYPGFH  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL-----PFTCFISDL  391
             L  +P    +  ++  +  ++LC +L+ + KPFLK+ ++++   G      PF+C I D 
Sbjct  69    LDHYPDAYDESKVHIAQEIMDLCTALQSVVKPFLKELLSKDPAHGTRKDRPPFSCIIVDG  128

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
              +S+ALDV+EE   LP+  FR ISA AFWTYF +P L EAGELP  G+ ++  PI  VKG
Sbjct  129   FLSLALDVAEE-IGLPLICFRTISAGAFWTYFCIPRLVEAGELPFPGDEMNL-PIENVKG  186

Query  572   MEDFLRVRDLSPFCRDEDLAV----LYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             ME FLR  DL  F R  DL      L   EA    +A+GLILNTFEDLEG ILS  RT  
Sbjct  187   MEGFLRRCDLPSFLRVGDLTNPDFNLLLKEALQTPRAKGLILNTFEDLEGCILSHFRTHC  246

Query  740   PNVYTIGPLHAHLKATLASKSTHSNS-----LLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
             PN+YTIGPLHAHL+A L  +  +SN+     L +ED++C+ WLD+Q PKSV+YVSFGSI+
Sbjct  247   PNLYTIGPLHAHLRARLQLQEANSNNSNSNSLWEEDKSCIKWLDNQPPKSVLYVSFGSIA  306

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLV----------AGKDDEESPIPSELKEGTKA  1054
             +ITR+ L+EFW+G+VNSG +FLWV+R + V          + K   +S    EL+E TK 
Sbjct  307   IITRETLLEFWHGIVNSGVRFLWVIRPNSVNVGLGDDVLDSTKSKSKSTPEMELEEATKE  366

Query  1055  NGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEV  1234
              G +VGWAPQE VL H A+GGFLTHSGWNSTLESIA GVPMICWP FADQQ NSRFVGE+
Sbjct  367   RGCMVGWAPQEDVLAHPAIGGFLTHSGWNSTLESIAEGVPMICWPCFADQQPNSRFVGEI  426

Query  1235  WKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             WK+GLDMKD CDR  VEK++R+LM +RK EFL RA+ M KLA+++I EGGSS+CN   LI
Sbjct  427   WKIGLDMKDTCDRVIVEKMVRDLMVERKDEFLHRADEMAKLARKSIEEGGSSFCNLVRLI  486

Query  1415  QDMIK  1429
              D++K
Sbjct  487   DDIVK  491



>gb|ACS87994.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis]
Length=484

 Score =   495 bits (1275),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 250/463 (54%), Positives = 317/463 (68%), Gaps = 11/463 (2%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LI+PLPA  H+NSMLKLA LL  A   ITF    + H RL+  +     R+     F+
Sbjct  17    HVLIWPLPALGHVNSMLKLAELLSHAGIKITFLNSEHYHERLVRHSSDVFSRYMNLPGFQ  76

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      + + F EL +SL  +  P LK  +    D+  P  C ISD L+S A
Sbjct  77    FKTITDGLPKDHPQTVDNFHELLNSLASVTPPLLKDMLT---DAKSPVHCIISDGLMSFA  133

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +DV+++   +P+ YFR +SACAFW YF +P++ +AGELPIKGN      I  V GME FL
Sbjct  134   IDVAKQ-VGIPIIYFRTVSACAFWAYFCIPEIIDAGELPIKGNEDMDRLIKHVPGMEKFL  192

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR ED       L  +E R +V+A GL+LNTFEDLEGP+LSQIR   P +YT
Sbjct  193   RCRDLPSFCRAEDPMNMNLQLVVSETRSSVRADGLVLNTFEDLEGPVLSQIRAHCPKIYT  252

Query  755   IGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEF  934
             IGPL+AHLKA +   +  SNSL + D  C+AWLD+Q  KSVI+VSFGS++V+ R QL+EF
Sbjct  253   IGPLNAHLKARIPENTHSSNSLWEVDRGCIAWLDNQPSKSVIFVSFGSVAVMQRDQLIEF  312

Query  935   WYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVG  1114
             WYGLVNS K+FLWV+R DL++GKD E   IP EL + TK  GYI GW PQE VL H AVG
Sbjct  313   WYGLVNSHKRFLWVIRPDLISGKDGENQ-IPKELDKATKERGYIAGWVPQEEVLGHKAVG  371

Query  1115  GFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLI  1294
             GFLTH GWNSTLESI A +PMICWP FADQQ NSRFV EVWK+GLDMKD+CDR  VEK++
Sbjct  372   GFLTHCGWNSTLESIVARMPMICWPSFADQQINSRFVDEVWKLGLDMKDLCDRKIVEKMV  431

Query  1295  RELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              EL+ +R+  F++ A+ M  LA ++++EGGSSYCN D LI D+
Sbjct  432   NELLVERRAAFMKSADRMANLAIKSVNEGGSSYCNLDRLINDI  474



>ref|XP_006379615.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
 gb|ERP57412.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
Length=481

 Score =   495 bits (1275),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 247/467 (53%), Positives = 322/467 (69%), Gaps = 15/467 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSMLKLA LL LA  +ITF    + H  L   T+++  RFT    F+
Sbjct  10    HVLIFPLPCQGHVNSMLKLAELLSLAGINITFLNSEHNHELLARYTNIED-RFTKYPGFQ  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+      S    +EL ++++ + KP  K+ + + +    P  C I D ++   
Sbjct  69    FQTIADGLPVDHPRSGGKLMELFEAMKLVTKPVFKKILLETKP---PVNCIIGDGILGFV  125

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
              DV+ E   +P  YFR +SAC+FW YFS+ D+ E G+LPI+GN      ITKV GME FL
Sbjct  126   GDVAIEV-GVPFIYFRTVSACSFWAYFSIFDIIEGGQLPIRGNEDMDRLITKVPGMETFL  184

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR  D+     +L   E R + +A+ LILNTFEDLEGP++SQIRT  P +Y+
Sbjct  185   RCRDLPSFCRVSDMTHPNLLLVMNETRQSPRAKALILNTFEDLEGPLMSQIRTHCPEIYS  244

Query  755   IGPLHAHLKATLASKSTHS----NSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             IGPLH HL+A L++K+  S    NSL + D +CM WLD+Q  KSV+YVSFGS +V+TR Q
Sbjct  245   IGPLHEHLQAKLSAKNEKSCQSSNSLREIDRSCMTWLDNQPEKSVLYVSFGSFTVMTRHQ  304

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
             L+EFWYGLV+S K+FLWV+R D +A KD E   IP E++EGTK  G+I GW PQE VL H
Sbjct  305   LLEFWYGLVSSKKRFLWVIRPDSIATKDGEFEKIPVEVEEGTKERGFIAGWVPQEEVLAH  364

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              A+ GFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFVGEVWK+GLDMKD CDR  V
Sbjct  365   KAIAGFLTHSGWNSTLESIVAGVPMICWPYFADQQVNSRFVGEVWKLGLDMKDQCDREIV  424

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             EK++ +LM +R+ EF+  A  M +L+++++ EGGSSYCN + LI+D+
Sbjct  425   EKMVNDLMVERREEFVRSATRMAELSRKSVREGGSSYCNLNRLIEDI  471



>gb|AGX93067.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Cinchona 
calisaya]
Length=483

 Score =   495 bits (1274),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 248/469 (53%), Positives = 327/469 (70%), Gaps = 18/469 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSML+LA LL L++  ITF V    H RLL  T V + RF     FR
Sbjct  12    HVLIFPLPIQGHVNSMLRLAELLCLSDLDITFIVSEFSHNRLLKHTSV-ALRFARYPGFR  70

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR----DSGLPFTCFISDLL  394
              Q+   G+ D    + E  +++  +++ +  P  K+ + +       +  P TC I+D +
Sbjct  71    FQTISDGLPDDHPRAGEQVMDIMPAIKNVTGPLFKRMMIEKNCFASANRRPITCIIADGV  130

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A D +E+   +P+ YFR +SAC+FW  F +P L EAG++P+KG G+D  P+  V GM
Sbjct  131   LSFAGDFAEQK-RIPLVYFRTVSACSFWACFCMPQLIEAGDIPVKGEGMDL-PVKSVPGM  188

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL  FCR  D+      +   E R   +A+  ILNTFEDLEGPIL++IR   P
Sbjct  189   EGFLRRRDLPGFCRVNDINEPKLQIIKNETRQTPRAQAAILNTFEDLEGPILAEIRKYMP  248

Query  743   NVYTIGPLHAHLKATLASKSTH----SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
              +YTIGP H+ L A L +++T     S S  +ED +C+ WL+SQ PKSVIYVSFGSI+V+
Sbjct  249   RLYTIGPSHSQLTARLEAQNTKTSISSGSFWEEDRSCIEWLNSQPPKSVIYVSFGSITVV  308

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR+QL+EFW GLVNSG++FLWVMR D + GKD E S IP+EL++GTK  GY+VGWAPQE 
Sbjct  309   TREQLLEFWCGLVNSGQRFLWVMRPDSLMGKDGE-SQIPAELEKGTKERGYMVGWAPQEE  367

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL+H A+GGF THSGWNSTLESI  GVPMICWP+FADQ  NSRFV EVWK+GLDMKD CD
Sbjct  368   VLNHSAIGGFFTHSGWNSTLESIVTGVPMICWPYFADQMINSRFVSEVWKIGLDMKDTCD  427

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             R  +EK++R+LM+ RK EF +RA++M KLA++A++EGGSSY N D L++
Sbjct  428   RIIIEKMVRDLMDVRKDEFSQRADDMAKLARKAVNEGGSSYQNLDALVE  476



>ref|XP_007009133.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17943.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=481

 Score =   493 bits (1268),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 250/467 (54%), Positives = 318/467 (68%), Gaps = 15/467 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSM KLA LL L  F +TF    + H RL+  T+V S  F +   F 
Sbjct  12    HVLIFPLPLQGHVNSMFKLAELLALTGFKVTFLYSEHNHGRLVKYTNV-SAHFASYPGFE  70

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++ P G+ D    S + F+E+  ++    K  L++ +    +   P  C I D  +   
Sbjct  71    FRTVPDGLPDDHPRSGDWFLEMYYAMETKAKLSLREMLL---NINPPVDCIIGDGFLGFV  127

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             LDV++E   +PV+YFR  SAC FW Y+S+PD+ +AGE+PI+G    +  IT V GME FL
Sbjct  128   LDVAKE-LGIPVFYFRTSSACCFWAYYSIPDIIQAGEIPIRGIEDMNRLITTVPGMETFL  186

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR  D+A     L   + R + QA  LILNTFEDL+ PILS IRTK P+VYT
Sbjct  187   RCRDLPSFCRASDMANSTIQLVVEQTRKSPQAHALILNTFEDLDRPILSHIRTKCPHVYT  246

Query  755   IGPLHA----HLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             IGP+HA     LKA   + S  SNSL + D  C++WLD Q  +SV+YVSFGSI++ +R+Q
Sbjct  247   IGPIHALLNTRLKAKRGASSQFSNSLWEVDRNCISWLDKQPKQSVVYVSFGSITIPSREQ  306

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
             L E WYGLVNS ++FLWV+R + V GKD +   +P EL EGTK  G IVGWAPQE VL+H
Sbjct  307   LTELWYGLVNSKRRFLWVVRPNSVTGKDGQGEDVPVELLEGTKERGCIVGWAPQEEVLNH  366

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              AVGGFLTHSGWNSTLES+ AGVPMICWP+FADQQ NSRFV EVWK+GLDMKDVCDR  V
Sbjct  367   PAVGGFLTHSGWNSTLESVVAGVPMICWPYFADQQVNSRFVSEVWKLGLDMKDVCDRKVV  426

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             EK++ +LM  R+ EF++ A  M KLAKE+++ GGSSYCN D LI+D+
Sbjct  427   EKMVNDLMMDRREEFVKSAAEMAKLAKESVNVGGSSYCNLDRLIEDI  473



>ref|XP_010658496.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=480

 Score =   492 bits (1266),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 252/469 (54%), Positives = 319/469 (68%), Gaps = 16/469 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+L+FP P Q H+NSMLKLA LL LA   ITF      H+RLL  T++   RFT    FR
Sbjct  9     HVLVFPFPIQGHVNSMLKLAELLSLAGLRITFLNSYYTHSRLLRYTNI-LDRFTRYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLLV  397
              Q+   G+      + E  ++L + L+   KP  ++ +    Q  D+  P  C I+D ++
Sbjct  68    FQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIM  127

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             S  +D++ E   +P+  FR ISAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  128   SFTIDIANEV-GIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  578   DFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
              FLR RDL    R    D++  +L   E +   +A  LILNTFEDLEGPIL QIR   P 
Sbjct  186   GFLRKRDLPSLIRVSNLDDERLLLVTKETQQTPRAYALILNTFEDLEGPILGQIRNHCPK  245

Query  746   VYTIGPLHAHLKATLASKST---HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
              YTIGPLHAHL+  LAS+ST    SNSL QED +C+AWL+ Q  KSVIYVSFGS++VITR
Sbjct  246   TYTIGPLHAHLETRLASESTTSQSSNSLRQEDRSCIAWLNRQPSKSVIYVSFGSVTVITR  305

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +QL+EF YGLVNSG +FLWV+R+D +A ++D E   P+EL EG K   YIV WAPQE VL
Sbjct  306   KQLIEFCYGLVNSGSRFLWVIRTDSLA-EEDGERQTPAELLEGAKERSYIVEWAPQEEVL  364

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H AVGGFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV  VWK+G DMKD CDR 
Sbjct  365   AHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSDMKDTCDRL  424

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              VEK++R+LME+R+ E L+ A+ M   A++ +SEGGSSYCN   LI+++
Sbjct  425   IVEKMVRDLMEERRDELLKTADMMATRARKCVSEGGSSYCNLSSLIEEI  473



>ref|XP_002276823.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=480

 Score =   491 bits (1265),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 251/469 (54%), Positives = 319/469 (68%), Gaps = 16/469 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             H+LIFP PAQ H+NSMLKLA LL +A  H+TF        RLL  TD+ + RF+    FR
Sbjct  9     HVLIFPFPAQGHVNSMLKLAELLSVAGLHVTFLNSEYNQHRLLLHTDIQT-RFSGYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLLV  397
              Q+   G+      + E  ++L + L+   KP  ++ +    Q  D+  P  C I+D ++
Sbjct  68    FQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIM  127

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             S  +D++ E   +P+  FR ISAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  128   SFTIDIANEV-GIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  578   DFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
              FLR RDL    R    D++  +L   E +   +A  LILNTFEDLEGPIL QIR   P 
Sbjct  186   GFLRKRDLPSLIRVSNLDDEGLLLVMKETQQTPRAHALILNTFEDLEGPILGQIRNHCPK  245

Query  746   VYTIGPLHAHLKATLASKST---HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             +YTIGPLHAHLK  LAS+ST    SNS  QED +C+AWLD Q  KSVIYVSFGS++VI+R
Sbjct  246   IYTIGPLHAHLKTRLASESTTSQSSNSFRQEDRSCIAWLDHQPSKSVIYVSFGSLTVISR  305

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +QL+EF +GLVNSG +FLWV+R+D +A ++D E   P+EL EG K   YIV WAPQE VL
Sbjct  306   KQLIEFCHGLVNSGSRFLWVIRTDSLA-EEDGEHQTPAELMEGAKERSYIVEWAPQEEVL  364

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H AVGGFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV  VWK+G DMKD CDR 
Sbjct  365   AHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSDMKDTCDRL  424

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              VEK++R+LME+RK E L+ A+ M   A++ +SEGGSSYCN   L+ ++
Sbjct  425   IVEKMVRDLMEERKDELLKTADKMATRARKCVSEGGSSYCNLSSLVDEI  473



>ref|XP_011076758.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=475

 Score =   491 bits (1263),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 256/467 (55%), Positives = 330/467 (71%), Gaps = 20/467 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q  +NS LKLA LL LA+  +TF V  +IHARLL  +++ + RF++   FR
Sbjct  9     HVLIFPLPLQGPVNSTLKLAELLCLAHIDVTFLVTDHIHARLLRHSNIQT-RFSSYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
             +Q+   G+ + A    + F+EL DSL+   KP  K+ +   R  G  F+C I+D ++   
Sbjct  68    IQTISDGLPE-AHPRGDRFLELFDSLKSKTKPLFKEVL---RCGG--FSCVIADGILGFT  121

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
              DV+ E   +P++Y R ISA   W +F +P + EAGE+P +G+ +D   +  V GME +L
Sbjct  122   CDVANE-VRVPIFYIRTISAACLWVFFCIPKIIEAGEIPFEGDDLDIL-VKSVPGMERYL  179

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR  DLA     LY TE+    +A GLILNTFE+LEGPIL+++R+  PN+YT
Sbjct  180   RRRDLPSFCRSGDLADPNIQLYKTESEENPRAYGLILNTFEELEGPILAEMRSMCPNIYT  239

Query  755   IGPLHAHLKATLASKSTH----SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             IGPLHAHLKA LA+K+T     SNSL +ED +C+AWLDSQ PKSVIYVSFGS++V T  Q
Sbjct  240   IGPLHAHLKAKLAAKATSPTAFSNSLWEEDRSCIAWLDSQPPKSVIYVSFGSLAVTTSNQ  299

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
             LMEFW+GLVNSG++FLWV+R D +A K   ES +P EL + TK  GYIVGW PQE VL H
Sbjct  300   LMEFWHGLVNSGQRFLWVIRPDSIAAKS-WESEVPVELSKATKERGYIVGWTPQEEVLAH  358

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              +VGGFLTHSGWNSTLESI  GVPMICWP+F DQQ NSR V E WK+GLDMKD CDRS +
Sbjct  359   PSVGGFLTHSGWNSTLESIYEGVPMICWPYFIDQQVNSRLVEEAWKLGLDMKDTCDRSII  418

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             EK++R LM+  K +FLERA+ M K AK  +S GGSS+ NF+ L++D+
Sbjct  419   EKMVRSLMDVGKEKFLERADQMAKSAKRCLSNGGSSHNNFERLVEDI  465



>ref|XP_002281029.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=475

 Score =   491 bits (1263),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 253/466 (54%), Positives = 316/466 (68%), Gaps = 13/466 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             H+L+FP P Q H+NSMLKLA LL LA   ITF      H+RLL  T++   RFT    FR
Sbjct  9     HVLVFPFPIQGHVNSMLKLAELLSLAGLRITFLNSDYTHSRLLRYTNI-LDRFTRYAGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+      +     ++ D ++   KP  ++ I     S  P TC I+D ++  A
Sbjct  68    FQTISDGLPLDHPRTGVQLKDMFDGMKATTKPLFREMIMSWCRSSDPVTCIIADGIMGFA  127

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +DV  E   +P   FR  S CAFW YFSLP L EAGE+P K + +D   +T V GME FL
Sbjct  128   IDVGNEV-GVPTISFRTSSPCAFWAYFSLPQLIEAGEVPFKDDDMDQL-VTSVPGMEGFL  185

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR +D       L   E R   +A  LILNTFEDL+G  LSQIR+  P +YT
Sbjct  186   RRRDLPSFCRTKDANDPNLQLVMIETRQTPRADALILNTFEDLDGATLSQIRSHCPKLYT  245

Query  755   IGPLHAHLKATLASKSTHS---NSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQL  925
             IGPLHAHLK+ LAS++T S   NSL +ED+ C+ WLD Q  KSVIYVSFGS++VIT+++L
Sbjct  246   IGPLHAHLKSRLASETTASQFSNSLWEEDKRCIPWLDRQPSKSVIYVSFGSLTVITKEEL  305

Query  926   MEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHL  1105
             MEFW+GLVNSG +FLWV+R D +  KD E  P P++L E TK  G IVGW PQE VL H 
Sbjct  306   MEFWHGLVNSGSRFLWVIRPDSLTEKDGEFQP-PAQLWEVTKERGQIVGWVPQEEVLAHP  364

Query  1106  AVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVE  1285
             AVGGFLT+SGWNST+ESI AGVPMICWP+FADQQ NSRFV  VWK+G+DMKD CDR ++E
Sbjct  365   AVGGFLTYSGWNSTIESIFAGVPMICWPYFADQQVNSRFVSHVWKLGMDMKDTCDRVTIE  424

Query  1286  KLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             K++R+LMEKR+ EF + AE M KLA+ ++SEGGSSYCNF  LI+ +
Sbjct  425   KMVRDLMEKRRTEFTKSAEAMAKLARSSLSEGGSSYCNFSRLIESI  470



>gb|EYU19962.1| hypothetical protein MIMGU_mgv1a005720mg [Erythranthe guttata]
Length=473

 Score =   490 bits (1261),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 253/468 (54%), Positives = 326/468 (70%), Gaps = 21/468 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q  +NSMLKLA LL LA+ H+TF V   I+ARL   +++ + RF++   F 
Sbjct  10    HVLIFPLPLQGPVNSMLKLAELLCLADLHVTFLVTDYIYARLQRHSNIQT-RFSSYPGFH  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
             +++   G+ +      + F+EL +SL    KP  K  ++ N   G   +C I+D ++   
Sbjct  69    IRTISDGLPENHPRGDK-FLELFESLMTNTKPLFKDMLS-NGSLGSRVSCIIADGILGFT  126

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
              DV+ +   +P++Y R ISA   W +F LP+L +AG+LP +G+ +D + +  V GME +L
Sbjct  127   CDVANQ-IRVPIFYVRTISAACLWVFFRLPELIQAGDLPFQGDDLDVA-VKSVPGMERYL  184

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR  D++     +Y  E+    +A GLILNTFEDLEGPIL+++RT  PN+YT
Sbjct  185   RRRDLPSFCRSADISDPIIEMYKAESTENARAYGLILNTFEDLEGPILNEMRTICPNIYT  244

Query  755   IGPLHAHLKATLASKSTH-----SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             IGPLHAHLKA LA+ ST      SNSL +ED TCM WLDSQ PKSVIYVSFGS++V+T  
Sbjct  245   IGPLHAHLKAQLAANSTSAPPAFSNSLWEEDRTCMTWLDSQPPKSVIYVSFGSLAVMTND  304

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             QLMEFWYGLVNSG+KFLWV+R D ++G +     IP EL +GT+  GYIVGWAPQE VL 
Sbjct  305   QLMEFWYGLVNSGQKFLWVIRPDSISGYE-----IPVELSQGTRERGYIVGWAPQEEVLA  359

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H AVGGFLTHSGWNSTLES+  GVPMICWP+F DQQ NSR V E WK+GLDMKD CDRS 
Sbjct  360   HRAVGGFLTHSGWNSTLESVYEGVPMICWPYFMDQQVNSRLVEEEWKLGLDMKDTCDRSL  419

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             +EK I+ LME RK EFL RA++M K AK +++EGGSS+ N   LI D+
Sbjct  420   IEKTIKNLMEVRKDEFLLRADDMAKSAKTSLTEGGSSFSNLKRLIDDI  467



>ref|XP_007009131.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17941.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=479

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 246/472 (52%), Positives = 319/472 (68%), Gaps = 20/472 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+L+FPLPAQ H+NSMLKLA L  LA   +TF    + H RL+  TDV   RF    RF+
Sbjct  12    HVLLFPLPAQGHVNSMLKLAELFALAGLEVTFLNSDHNHERLVRHTDV-GFRFAKYPRFK  70

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++ P G+ +        F+EL +S+    KP L++ + +      P  C I D  + + 
Sbjct  71    FETIPDGLREDHPRLGVSFMELFESMELRTKPILREMLVKINP---PVDCIIGDGALGLV  127

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             LDV++E   +P++ FR ISA   W YF++PD+ EAGELPI+GN      IT+V GME FL
Sbjct  128   LDVADE-LGIPIFQFRTISASGIWAYFAIPDMIEAGELPIRGNEDMDRLITRVPGMETFL  186

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCRD D+      L   E R  + A GLILNTFEDLEG ILS +R+K P +YT
Sbjct  187   RCRDLPSFCRDSDMTDSNLQLIAKETRKNLSAPGLILNTFEDLEGAILSHMRSKCPKIYT  246

Query  755   IGPLHAHLKATLASKS-----THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             +GPLH HL   LA  +        NSL + D +C++WLD Q  +SV+YVSFGSI+V++R+
Sbjct  247   VGPLHLHLNTRLAETNGTMVHQSPNSLWEVDRSCLSWLDEQPKESVVYVSFGSIAVLSRE  306

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             Q+MEFW+GLVNS K+FLWV R D +     E+  IP+EL EGTK  GY+VGWAPQE VL 
Sbjct  307   QIMEFWFGLVNSRKRFLWVFRPDFMP----EKGSIPAELVEGTKQRGYMVGWAPQEEVLA  362

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H A+GGFLTHSGWNSTLES+ AGVPMICWP+FADQQ NSRFV EVWK+GLDMKDVCDR  
Sbjct  363   HCAIGGFLTHSGWNSTLESLVAGVPMICWPYFADQQLNSRFVSEVWKLGLDMKDVCDRRV  422

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             VEK++ +L+  ++ EF++ +  + KLAK  ++ GGSSYCN D LI+D+  +N
Sbjct  423   VEKMVNDLIVDKREEFVKSSAEIAKLAKACVNVGGSSYCNLDRLIEDIRSMN  474



>ref|XP_009597174.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 254/481 (53%), Positives = 324/481 (67%), Gaps = 27/481 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLA-NFHITFFVPSNIHARLLALTDVDS--GRFTTRF  223
             H++IFP PA  H++ ML LA LL L+ N H+TF    +IH RLL  TD+ S  GRF   F
Sbjct  10    HVVIFPFPALGHVHPMLNLAELLSLSSNIHVTFINALSIHNRLLRCTDLQSRFGRFPG-F  68

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQ-YIAQNRDSGL---------PFT  373
             R ++   G+ DG  ++ +  + +  SLR   KP LK+ ++  N + G          P T
Sbjct  69    RFKTINLGLGDGLPHTSDDIMAVLKSLRTTAKPLLKELFLLDNCELGTTDKIIGQVPPVT  128

Query  374   CFISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP  553
             C ISD ++ IAL+V+EE   +P ++FR  SA +FW Y+ +P L  AGELP  GN +D+ P
Sbjct  129   CLISDGILIIALEVAEE-RGIPTFHFRTSSASSFWAYYCIPQLIHAGELPFSGNDLDT-P  186

Query  554   ITKVKGMEDFLRVRDLSPFCRDEDLAVLYYTEARL----AVQARGLILNTFEDLEGPILS  721
             I  VKGME FLR RDL  FCR ++L    +   R      ++ +GLI NTFE LEGPIL 
Sbjct  187   IANVKGMESFLRRRDLPSFCRVDNLGEGTFQCVRSVTLSTLRTKGLIFNTFEGLEGPILD  246

Query  722   QIRTKYPNVYTIGPLHAHLKATLAS----KSTHSNSLLQEDETCMAWLDSQEPKSVIYVS  889
             QIR   PN+YTIGPLHAHLK  LAS    KS  SN L +ED +C+ WLD Q  +SV+YVS
Sbjct  247   QIRVDIPNIYTIGPLHAHLKNKLASESKGKSISSNGLWEEDRSCLKWLDEQPSRSVLYVS  306

Query  890   FGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIV  1069
             FGS+  +T+ +L EFW+GLVNSG++FLWV+R D++  KDD    +  ELKEG K NGYIV
Sbjct  307   FGSVITLTKHELTEFWHGLVNSGQQFLWVIRHDVIKDKDD---VLEVELKEGRKENGYIV  363

Query  1070  GWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGL  1249
              WAPQE VL H ++GGFLTHSGWNSTLES+   VPMICWP  ADQQ NSRFVGEVWK+GL
Sbjct  364   SWAPQEEVLAHPSIGGFLTHSGWNSTLESLYEAVPMICWPQLADQQVNSRFVGEVWKLGL  423

Query  1250  DMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIK  1429
             D+KD CDR  +EK++ ELME R+ EFL+RA  M KLA+ ++SEGGSS  N D LIQD+  
Sbjct  424   DLKDTCDRVIIEKMVSELMEARRNEFLQRANEMTKLARASVSEGGSSTRNLDRLIQDIYS  483

Query  1430  V  1432
             +
Sbjct  484   I  484



>gb|AGX93070.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Tabernaemontana 
elegans]
Length=482

 Score =   487 bits (1254),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 252/468 (54%), Positives = 324/468 (69%), Gaps = 18/468 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSML+LA LL LA   ITF V    H+RLL  T+V S RF     F+
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELLCLAELDITFIVSEFSHSRLLKHTNVAS-RFARYPGFQ  69

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR----DSGLPFTCFISDLL  394
              Q    G+ D    + E  +++  S + +  P  KQ + +       +  P TC I+D +
Sbjct  70    FQGISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVEKNFFASATRRPITCMIADGV  129

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S   D +E    + + YFR +SAC+FW  F +P+L EAG++PIKGNG+D   +  V GM
Sbjct  130   LSFVGDFAEAT-GISLIYFRTVSACSFWACFCMPELIEAGDIPIKGNGMDLV-VKSVPGM  187

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             + +LR RDL  FCR  D+      +   E R + +A+  ILNTFEDLEGPILSQIR   P
Sbjct  188   DKYLRRRDLPGFCRVNDINEPKLQILKNETRQSTRAQAAILNTFEDLEGPILSQIRKHMP  247

Query  743   NVYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
              ++TIGP H+HL   L SK    S  S S  +ED +C+ WLDSQ P+SV+YVSFGSI+V+
Sbjct  248   RLFTIGPSHSHLTYRLESKNIQSSISSGSFWEEDRSCVDWLDSQPPRSVLYVSFGSITVV  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T  QL+EFW+GLVNSG++FLWVMR D + GKD + S IP+EL+EGTKA GY+VGWAPQE 
Sbjct  308   TSDQLLEFWHGLVNSGQRFLWVMRPDSIMGKDGK-SRIPAELEEGTKARGYMVGWAPQEE  366

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL+H A+GGFLTHSGWNSTLESI AGVPMICWP+FADQ  NSRFV E+WK+GLDMKD CD
Sbjct  367   VLNHPAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCD  426

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             R ++EK+++ELM  RK EFL+RA++M KLA+ A+ EGGSSY N D L+
Sbjct  427   RDTIEKIVKELMVVRKDEFLQRADHMAKLARGAVREGGSSYSNLDGLV  474



>ref|XP_002276617.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
 ref|XP_010658495.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=478

 Score =   487 bits (1253),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 249/469 (53%), Positives = 316/469 (67%), Gaps = 16/469 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFP P+Q H+NSMLKLA LL +   H+TF        RL   TD+ + RF+    FR
Sbjct  9     HVLIFPFPSQGHVNSMLKLAELLSVVGLHVTFLNSDYNQHRLFLHTDIQT-RFSRYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLLV  397
              Q+   G+      + E  ++L + L+   KP  ++ +    Q  D+  P +C I+D ++
Sbjct  68    FQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELMISRGQGSDTRPPVSCIIADGMM  127

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             S  +D++ E   +P+  FR +SAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  128   SFTIDIANEV-GIPIISFRTVSACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  578   DFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
              FLR RDL    R    D++  +L   E +   +A  LILNTFEDLEGPIL QIR   P 
Sbjct  186   GFLRKRDLPSLLRVSNLDDEGLLLVTKETQQTPRAHALILNTFEDLEGPILGQIRNHCPK  245

Query  746   VYTIGPLHAHLKATLASKST---HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
              YTIGPLHAHLK  LAS+ST    SNS  QED +C+AWLD Q  KSVIYVSFGS+ VI+R
Sbjct  246   TYTIGPLHAHLKTRLASESTTSQSSNSFRQEDRSCIAWLDHQPSKSVIYVSFGSMVVISR  305

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +QL+EF YGLVNS  +FLWV+R+D +A ++D E   P+EL EG K   YIV WAPQE VL
Sbjct  306   KQLIEFCYGLVNSSSRFLWVIRTDSLA-EEDGEHQTPAELMEGAKERSYIVEWAPQEEVL  364

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H AVGGFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV  VWK+G DMKD CDR 
Sbjct  365   AHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSDMKDTCDRL  424

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              VEK++R+LME+RK E LE A+ M   A++ +SEGGSSYCN   LI+++
Sbjct  425   IVEKMVRDLMEERKDELLETADMMATRARKCVSEGGSSYCNLSSLIEEI  473



>ref|XP_002276771.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=480

 Score =   485 bits (1249),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 248/469 (53%), Positives = 316/469 (67%), Gaps = 16/469 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFP P+Q H+NSMLKLA LL +   H+TF        RL   TD+ + RF+    FR
Sbjct  9     HVLIFPFPSQGHVNSMLKLAELLSVVGLHVTFLNSDYNQHRLFLHTDIQT-RFSRYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLLV  397
              Q+   G+      + E  ++L + L+   KP  ++ +    Q  D+  P +C I+D ++
Sbjct  68    FQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELMISRGQGSDTRPPVSCIIADGMM  127

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             S  +D++ E   +P+  FR +SAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  128   SFTIDIANEV-GIPIISFRTVSACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  578   DFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
              FLR RDL    R    D++  +L   E +   +A  LILNTFEDLEGPIL QIR   P 
Sbjct  186   GFLRKRDLPSLLRVSNLDDEGLLLLTKETQQTPRAHALILNTFEDLEGPILGQIRNHCPK  245

Query  746   VYTIGPLHAHLKATLASKST---HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
              YTIGPLHAHLK  LAS+ST    SNS  QED +C+AWLD Q  KSVIYVSFGS+ VI+R
Sbjct  246   TYTIGPLHAHLKTRLASESTTSQSSNSFRQEDRSCIAWLDHQPSKSVIYVSFGSMVVISR  305

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +QL+EF YGLVNS  +FLWV+R+D +A ++D E   P+EL EG K   YIV WAPQE VL
Sbjct  306   KQLIEFCYGLVNSSSRFLWVIRTDSLA-EEDGEHQTPAELMEGAKERSYIVEWAPQEEVL  364

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H AVGGFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV  VWK+G DMKD CDR 
Sbjct  365   AHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSDMKDTCDRL  424

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              VEK++R+LME+RK E L+ A+ M   A++ +SEGGSSYCN   LI+++
Sbjct  425   IVEKMVRDLMEERKDELLKTADMMATRARKCVSEGGSSYCNLSSLIEEI  473



>ref|XP_002280624.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=479

 Score =   484 bits (1246),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 247/470 (53%), Positives = 324/470 (69%), Gaps = 17/470 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFP P Q ++NSMLKLA LL LA+  +TF      H RLL+ +++ + RF+    FR
Sbjct  9     HVLIFPFPIQGNINSMLKLAELLCLADIQVTFLNCHYPHRRLLSYSNIQA-RFSRYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKP-FLKQYIAQNR---DSGLPFTCFISDLL  394
              ++   G+      + E F+++ D ++    P F++  I+  R   D+  P TC I+D L
Sbjct  68    FETISDGLPMEHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSASDTRSPLTCIIADGL  127

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A+DV+ E   LPV  FRPISAC+FW YFSLP L EAGE+P +G  +D   +  V GM
Sbjct  128   MSFAIDVANEV-GLPVIIFRPISACSFWAYFSLPQLIEAGEVPFRGGDMDRL-VASVPGM  185

Query  575   EDFLRVRDLSPFCRDEDLAVLYYTEA----RLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR R L    R  D+A           R A +A  L++NTF+DLEGP+LSQIR  YP
Sbjct  186   EGFLRRRHLPSSGRVNDVAYPGLQHLMKIFRQAQRAHSLVINTFDDLEGPVLSQIRDHYP  245

Query  743   NVYTIGPLHAHLKATLASK---STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
               Y IGPLHAHLK+ LAS+   S  SNS  +ED++C+ WLD Q PKSVIYVSFGS+++IT
Sbjct  246   RTYAIGPLHAHLKSKLASETSTSQSSNSFRKEDKSCIPWLDRQPPKSVIYVSFGSLAIIT  305

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             + +L EFW+GLVNSG +FLWV+R D + GKD EE   P+EL EGTK  GY+VGWAPQE V
Sbjct  306   KDELGEFWHGLVNSGNRFLWVIRPDALVGKD-EERQTPAELLEGTKDRGYVVGWAPQEEV  364

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGFLTH GWNSTLESI  G+PMICWP+FADQQ NSRFV  VWK+G+DMKD CDR
Sbjct  365   LKHPAVGGFLTHGGWNSTLESIVEGLPMICWPYFADQQINSRFVSHVWKLGMDMKDSCDR  424

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              +VEK++R+LM +++ EF++ A+ +  LAK+ + +GGSS CN + LI+D+
Sbjct  425   VTVEKMVRDLMVEKRDEFMKAADTLATLAKKCVGDGGSSSCNLNSLIEDI  474



>ref|XP_009597175.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=489

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 250/486 (51%), Positives = 325/486 (67%), Gaps = 27/486 (6%)
 Frame = +2

Query  44    FIGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTT  217
             F  H++IFP P Q H+N MLKLA LL L+  H+TF    +I  RL   TD+ S   RF  
Sbjct  6     FPPHVVIFPFPVQGHVNPMLKLAELLCLSGIHVTFINTLSIQNRLSRNTDIQSRFNRFPG  65

Query  218   RFRLQSFPPGIYDGA----LNSKEVFVELCDSLRRIGKPFLKQYI-AQNRDSGL------  364
              FR ++ P G+ +        + +V V + DSLR   KP LK+ I A    SG       
Sbjct  66    -FRFETIPDGLSNKVPQTYQETHKVMV-IFDSLRSTAKPILKEIILAAGCPSGSSEVTRQ  123

Query  365   -PFTCFISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGI  541
              P TC I+D ++S+AL+V+E+   +P+ YFR  SA +FW Y  LP L + GELP  GN +
Sbjct  124   GPVTCVIADGILSVALEVAEDV-GIPILYFRTASAASFWIYLCLPQLIQNGELPFPGNEL  182

Query  542   DSSPITKVKGMEDFLRVRDLSPFCRDEDLAV----LYYTEARLAVQARGLILNTFEDLEG  709
             D  PI  +KGME  LR RDL  FCR + + V    +  TE +  ++ +GLILNTFE++EG
Sbjct  183   DV-PIASIKGMESLLRRRDLPSFCRVDSVDVPILQMVLTETQKTLRTKGLILNTFEEVEG  241

Query  710   PILSQIRTKYPNVYTIGPLHAHLKATLAS----KSTHSNSLLQEDETCMAWLDSQEPKSV  877
             PIL QIR   P +Y+IGPLHAHLK  +AS    +S HSNS+ +ED++C+ WLD Q   SV
Sbjct  242   PILDQIRNHLPKLYSIGPLHAHLKNKIASESISQSIHSNSIWEEDKSCLKWLDDQPANSV  301

Query  878   IYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKAN  1057
             IYVSFGS+  +T+  L EFW+GLVNSG++FLWV+R D +   +D+E+ I  ELKEG   N
Sbjct  302   IYVSFGSLVTVTKNVLTEFWHGLVNSGQRFLWVIRHDSIT-DNDKEAQIEEELKEGVIEN  360

Query  1058  GYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVW  1237
             GYIV WAPQE VL H A+GGFLTHSGWNSTLESI  GVPMICWP  ADQQ NSR+V EVW
Sbjct  361   GYIVSWAPQEEVLAHTAIGGFLTHSGWNSTLESIIEGVPMICWPQLADQQINSRYVEEVW  420

Query  1238  KVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             K+GLDMKD CDR  +EK++R+LME R+ EFL+RA +M KLA+ +++E GSS  N   L+Q
Sbjct  421   KLGLDMKDTCDRVIIEKMVRDLMELRRSEFLQRANDMAKLARASVAEAGSSDSNLARLVQ  480

Query  1418  DMIKVN  1435
             D++ + 
Sbjct  481   DIVSMQ  486



>ref|XP_002276555.2| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=509

 Score =   482 bits (1240),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 247/470 (53%), Positives = 323/470 (69%), Gaps = 17/470 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LI P P Q ++NSMLKLA LL LA   +TF      H  LL+ ++V + RF+    FR
Sbjct  36    HVLILPSPLQGNVNSMLKLAELLCLAGIQVTFLNCHYPHHCLLSYSNVQA-RFSRYPGFR  94

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKP-FLKQYIAQNR---DSGLPFTCFISDLL  394
              ++   G+      + E F+++ D ++    P F++  I+  R   D+  P TC ++D L
Sbjct  95    FETISDGLPMEHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSTSDTRPPLTCIMADQL  154

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A DV+ E   LP+  F  ISAC+FW YFS P L EAGE+PI G+ +D   +  V GM
Sbjct  155   MSFATDVANE-VGLPIVIFCAISACSFWAYFSFPQLIEAGEVPITGDDMDRL-VVSVPGM  212

Query  575   EDFLRVRDLSPFCRDEDLAVLYYTEA----RLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL    R  D+A           R A +A  L++NTF+DLEGP+LSQIR  YP
Sbjct  213   EGFLRRRDLPSSGRVNDVAYPGLQHLMKIFRQAQRAHALVINTFDDLEGPVLSQIRDHYP  272

Query  743   NVYTIGPLHAHLKATLASK---STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
               Y +GPLHAHLK+ LAS+   S  SNS  +ED++C+ WLD Q PKSVIYVSFGS+++IT
Sbjct  273   RTYAVGPLHAHLKSKLASETSTSQSSNSFREEDKSCILWLDRQPPKSVIYVSFGSLAIIT  332

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             + +L EFW+GLVNSG +FLWV+R D + GKD EE   P+EL EGTK  GY+VGWAPQE V
Sbjct  333   KDELREFWHGLVNSGSRFLWVIRPDALVGKD-EERQTPAELLEGTKDRGYVVGWAPQEEV  391

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGFLTHSGWNSTLESI AG+PMICWP+FADQQ NSRFV  VWK+G+DMKD CDR
Sbjct  392   LQHPAVGGFLTHSGWNSTLESIIAGLPMICWPYFADQQINSRFVSHVWKLGMDMKDTCDR  451

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              +VEK++R+LME+++ EF++ A+ M   AK+++SEGGSSYCN   LI+++
Sbjct  452   VTVEKMVRDLMEEKRAEFMKAADTMATSAKKSVSEGGSSYCNLGSLIEEI  501



>ref|XP_006435572.1| hypothetical protein CICLE_v10031404mg [Citrus clementina]
 ref|XP_006486449.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
 gb|ESR48812.1| hypothetical protein CICLE_v10031404mg [Citrus clementina]
Length=476

 Score =   480 bits (1235),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 248/464 (53%), Positives = 314/464 (68%), Gaps = 12/464 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+ I PLPA  H+NSML LA LL  A   ITF    + + R++  +     R+     F+
Sbjct  8     HVAILPLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPGFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      + + F EL DSL     P LK+ ++   DS  P  C I+D  +S A
Sbjct  68    FKTLTDGLPRDHPRTPDKFPELVDSLNCATPPLLKEMVS---DSKSPVNCIITDGYMSRA  124

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +D + E   + + YFR ISACAFW++  +PD+ +AGELPIKG       IT V GME FL
Sbjct  125   IDAARE-VGVSIIYFRTISACAFWSFHCIPDIIDAGELPIKGTEDMDRLITTVPGMEGFL  183

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY-PNVY  751
             R RDL  FCR  D      +L+  E RL+  A GLILNTFEDLEGPILSQIR    PN+Y
Sbjct  184   RCRDLPSFCRVNDPMDPHLLLFARETRLSAHADGLILNTFEDLEGPILSQIRNHSCPNIY  243

Query  752   TIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLME  931
             +IGPL+AHLK  +  K+  S+SL + D +CMAWLD Q  +SVIYVSFGSI+V++R QL+E
Sbjct  244   SIGPLNAHLKVRIPEKTYSSSSLWKIDRSCMAWLDKQPKQSVIYVSFGSIAVMSRDQLIE  303

Query  932   FWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAV  1111
             F+YGLV+S K FLWV+R DL++GKD E   IP EL E TK  G I GW PQE VL H AV
Sbjct  304   FYYGLVHSKKNFLWVIRPDLISGKDGENQ-IPEELLEATKERGCIAGWVPQEEVLAHSAV  362

Query  1112  GGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKL  1291
             GGFLTH GWNSTLESI AG+PMICWP FADQQ NSRFVGEVWK+GLD+KD+CDR+ VEK 
Sbjct  363   GGFLTHCGWNSTLESIVAGMPMICWPSFADQQINSRFVGEVWKLGLDIKDLCDRNIVEKT  422

Query  1292  IRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             + +LM +RK EF+E A+ M  LAK+++++GGSSYCN D L+ D+
Sbjct  423   VNDLMVERKEEFMESADRMANLAKKSVNKGGSSYCNLDRLVNDI  466



>gb|KDO69253.1| hypothetical protein CISIN_1g011848mg [Citrus sinensis]
Length=476

 Score =   480 bits (1235),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 248/464 (53%), Positives = 314/464 (68%), Gaps = 12/464 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+ I PLPA  H+NSML LA LL  A   ITF    + + R++  +     R+     F+
Sbjct  8     HVAILPLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPGFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      + + F EL DSL     P LK+ ++   DS  P  C I+D  +S A
Sbjct  68    FKTLTDGLPRDHPRTPDKFPELVDSLNCATPPLLKEMVS---DSKSPVNCIITDGYMSRA  124

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +D + E   + + YFR ISACAFW++  +PD+ +AGELPIKG       IT V GME FL
Sbjct  125   IDAARE-VGVSIIYFRTISACAFWSFHCIPDIIDAGELPIKGTEDMDRLITTVPGMEGFL  183

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY-PNVY  751
             R RDL  FCR  D      +L+  E RL+  A GLILNTFEDLEGPILSQIR    PN+Y
Sbjct  184   RCRDLPSFCRVNDPMDPHLLLFARETRLSAHADGLILNTFEDLEGPILSQIRNHSCPNIY  243

Query  752   TIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLME  931
             +IGPL+AHLK  +  K+  S+SL + D +CMAWLD Q  +SVIYVSFGSI+V++R QL+E
Sbjct  244   SIGPLNAHLKVRIPEKTYSSSSLWKIDRSCMAWLDKQPKQSVIYVSFGSIAVMSRDQLIE  303

Query  932   FWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAV  1111
             F+YGLV+S K FLWV+R DL++GKD E   IP EL E TK  G I GW PQE VL H AV
Sbjct  304   FYYGLVHSKKSFLWVIRPDLISGKDGENQ-IPEELLEATKERGCIAGWVPQEEVLAHSAV  362

Query  1112  GGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKL  1291
             GGFLTH GWNSTLESI AG+PMICWP FADQQ NSRFVGEVWK+GLD+KD+CDR+ VEK 
Sbjct  363   GGFLTHCGWNSTLESIVAGMPMICWPSFADQQINSRFVGEVWKLGLDIKDLCDRNIVEKA  422

Query  1292  IRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             + +LM +RK EF+E A+ M  LAK+++++GGSSYCN D L+ D+
Sbjct  423   VNDLMVERKEEFMESADRMANLAKKSVNKGGSSYCNLDRLVNDI  466



>ref|XP_010650643.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=476

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 245/466 (53%), Positives = 315/466 (68%), Gaps = 13/466 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+N MLKLA LL LA   ITF      H RLL  T++   R+T    FR
Sbjct  9     HVLIFPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNI-LDRYTRYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+      +     ++ D ++   KP  ++ +     S  P TC I+D L+S A
Sbjct  68    FQTISDGLPLDRPWTGAGLRDMMDGIKATTKPLFREMVISWCQSSDPVTCIIADGLMSFA  127

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +DV+ E   +P+   R +S C F  YFS  +L EAGE+P K + +D   +T+V GME FL
Sbjct  128   IDVANEV-GVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRL-VTRVPGMEGFL  185

Query  587   RVRDLSPFCRDEDL----AVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR  D          TE +   +A  LILNTFEDL+GPILSQIR   P +YT
Sbjct  186   RRRDLPSFCRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIRNHCPKIYT  245

Query  755   IGPLHAHLKATLASKST---HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQL  925
             IGPLHAHLK+ LAS++T    SNS  +ED +C+AWLD Q  KS IYVSFGSI+VIT++Q+
Sbjct  246   IGPLHAHLKSRLASETTTSQFSNSFWEEDRSCLAWLDRQPSKSFIYVSFGSITVITKEQM  305

Query  926   MEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHL  1105
             MEFW+GLVNSG +FLWV+R D +  KD E   + ++L+E TK  G IV WAPQE VL H 
Sbjct  306   MEFWHGLVNSGSRFLWVIRPDSLTEKDGEFQ-LQAQLREVTKERGQIVDWAPQEEVLAHP  364

Query  1106  AVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVE  1285
             AVGGFLTH GWNSTLESI AGVPMICWP+F+DQQ NSRFV  VWK+G+DMKD CDR +VE
Sbjct  365   AVGGFLTHGGWNSTLESIFAGVPMICWPYFSDQQLNSRFVSHVWKIGMDMKDTCDRVTVE  424

Query  1286  KLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             K++R++ME+R+ EF +  + M KLA+ ++SEGG+SYCNF+ LI+D+
Sbjct  425   KMVRDVMEERRAEFTKSVDAMAKLARSSLSEGGTSYCNFNRLIEDI  470



>ref|XP_002280470.2| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetic acid glucosyltransferase-like 
[Vitis vinifera]
Length=479

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 249/471 (53%), Positives = 319/471 (68%), Gaps = 19/471 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFP P Q ++NSMLKLA LL LA   +TF      H RLL+ +++ + RF+    FR
Sbjct  9     HVLIFPFPIQGNVNSMLKLAELLCLAGIQVTFLNCHYPHRRLLSYSNIQA-RFSRYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKP-FLKQYIAQNR---DSGLPFTCFISDLL  394
              ++   G+      + E F+++ D ++   KP F+K  I+  R   D+  P TC I+D L
Sbjct  68    FETISDGLPMEHPRTAEQFLDIVDGVKTTTKPLFMKMMISWCRSASDTRSPLTCVIADGL  127

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A+DV+ E   LPV  FR ISAC+FW YFSLP L EAGE+P +G  +D   +  V GM
Sbjct  128   MSFAIDVANE-VGLPVIIFRAISACSFWAYFSLPQLIEAGEVPFRGGDMDRL-VASVPGM  185

Query  575   EDFLRVRDLSPFCR-----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             E FLR RDL   C      D DL  L     R   +A  L++NTF+DLEGPILSQIR   
Sbjct  186   EGFLRRRDLPSCCXLKDVDDPDLQNLM-KNTRQTHRAHALVINTFDDLEGPILSQIRNHC  244

Query  740   PNVYTIGPLHAHLKATLA---SKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             P  YTIGPLHA LK  LA   S S  SNS  +ED +C+ WLD Q  KSVIYVSFGS+++I
Sbjct  245   PRTYTIGPLHALLKTKLATETSTSQSSNSFWEEDRSCIPWLDRQPSKSVIYVSFGSLAII  304

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T+++L EFW+GLVNSG +FLWV+R D + GKD EE   P+EL EGTK  GY+VGWAPQE 
Sbjct  305   TKEELREFWHGLVNSGSRFLWVIRPDALVGKD-EERQTPAELLEGTKDRGYVVGWAPQEE  363

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTH GWNSTLESI  G+PMICWP+FADQQ NSRFV  VWK+G+DMKD CD
Sbjct  364   VLKHPAVGGFLTHGGWNSTLESIVEGLPMICWPYFADQQINSRFVSHVWKLGMDMKDSCD  423

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R +VEK++R+LM +++ EF+E A+ +  LAK+ + + GSS CN + LI+D+
Sbjct  424   RVTVEKMVRDLMVEKRDEFMEAADTLATLAKKCVGDSGSSSCNLNSLIEDI  474



>ref|XP_010262685.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262687.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262688.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262689.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   478 bits (1229),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 247/470 (53%), Positives = 321/470 (68%), Gaps = 15/470 (3%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TR  220
             + H+L+ P+P Q H+NSMLKL+ L+ LA FH+TF    +IH  LL  T+V S RF     
Sbjct  8     VPHVLVLPIPLQGHINSMLKLSELISLAGFHVTFLNTEHIHRLLLHFTNVTS-RFARWPG  66

Query  221   FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR---DSGLPFTCFISDL  391
             F   + P G+      S    VEL DSL+    P L++ +  NR   D   P TC I+D 
Sbjct  67    FHFATIPDGLPFDHPRSGPGLVELFDSLKITSIPLLREMLVSNRWGSDVRPPVTCIIADG  126

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
             ++S  +DV+ +  N+P  +FR +SAC+FW YF +P L EAGE+P +   +D  PIT V G
Sbjct  127   IMSFTIDVARD-LNIPTIFFRTVSACSFWAYFCVPKLIEAGEIPFRDADMDC-PITCVPG  184

Query  572   MEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             ME+FLR  DL   CR  +L         TE     +A  LILNTFEDLEGPIL QIR+  
Sbjct  185   MENFLRRADLPGSCRTNNLGDRTLQFLVTETINTTRASALILNTFEDLEGPILCQIRSHC  244

Query  740   PNVYTIGPLHAHLKATLASKSTHSNS--LLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
             P +YTIGPLHA LK  ++  S   +S  L +E+++C+ WLDS+  +SV+YVSFGS++ +T
Sbjct  245   PRLYTIGPLHALLKTQISDSSPSVSSNSLWEENKSCIRWLDSKPLRSVVYVSFGSLATMT  304

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             R +++EFW+GLVNSGK FLWV+R DL+A K+ E+  I +EL EGT+   YIV WAPQE V
Sbjct  305   RDEVLEFWHGLVNSGKPFLWVIRPDLLARKEGEDQ-ILTELVEGTRERAYIVEWAPQEEV  363

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV EVWK+GLDMKD CDR
Sbjct  364   LAHPAVGGFLTHSGWNSTLESIYAGVPMICWPYFADQQINSRFVSEVWKLGLDMKDTCDR  423

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
               VE +++E+ME+++ E ++ AENM KLA+ ++ EGGSS CN D LIQD+
Sbjct  424   LKVELMVKEVMERKRDEMIKSAENMAKLARMSVGEGGSSSCNLDKLIQDI  473



>ref|XP_010650608.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=487

 Score =   477 bits (1228),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 246/466 (53%), Positives = 312/466 (67%), Gaps = 13/466 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+N MLKLA LL LA   ITF      H RLL  T++   R+T    FR
Sbjct  9     HVLIFPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNI-LDRYTRYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+      +     ++ D ++   KP  ++ +     S  P TC I+D L+S A
Sbjct  68    FQTISDGLPLDRPRTGAGLRDMMDGIKATTKPLFREMVISWCRSSDPVTCIIADGLMSFA  127

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +DV+ E   +P+   R +S C F  YFS  +L EAGE+P K + +D   +T+V GME FL
Sbjct  128   IDVANEV-GVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRL-VTRVPGMEGFL  185

Query  587   RVRDLSPFCRDEDL----AVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR  D          TE +   +A  LILNTFEDL+GPILSQIR   P +YT
Sbjct  186   RRRDLPSFCRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIRNHCPKIYT  245

Query  755   IGPLHAHLKATLASKST---HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQL  925
             IGPLHAHLK+ LAS++T    SNS   ED +C+AWLD Q  KSVIYVSFGSI+VIT++Q+
Sbjct  246   IGPLHAHLKSRLASETTTSQFSNSFWVEDRSCLAWLDRQPSKSVIYVSFGSITVITKEQM  305

Query  926   MEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHL  1105
             MEFW+GLVNSG +FLWV+R D +  KD E   + ++L E TK  G IV WAPQE VL H 
Sbjct  306   MEFWHGLVNSGSRFLWVIRPDSLTEKDGEFQ-LQAQLWEVTKERGQIVDWAPQEEVLAHP  364

Query  1106  AVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVE  1285
             AVGGFLTH GWNSTLESI AGVPMICWP+F DQQ NSRFV  VWK+G+DMKD CDR ++E
Sbjct  365   AVGGFLTHGGWNSTLESIFAGVPMICWPYFTDQQLNSRFVSHVWKMGMDMKDTCDRVTIE  424

Query  1286  KLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             K++R++ME R+ EF +  + M KLA+ ++SEGG+SYCNFD LI+D+
Sbjct  425   KMVRDVMEGRRAEFTKSVDAMAKLARRSLSEGGTSYCNFDRLIEDI  470



>ref|XP_007009132.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17942.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=482

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 243/471 (52%), Positives = 313/471 (66%), Gaps = 15/471 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             HILIFPLP Q  +N+MLKLA L   A   +TF      H+RL+   ++ S RF     F 
Sbjct  12    HILIFPLPIQGPVNAMLKLAELCATAGLKVTFLNSEYNHSRLVRFANIPS-RFDKYPGFE  70

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      S   F+E+ +++    KP LK  + +      P  C I D ++   
Sbjct  71    FRTISDGLPGDHSRSGNRFMEIFEAMNIRTKPLLKDMLVEMIP---PVDCIIGDGILEFV  127

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             LDV+ E   +P+   R I AC  W+ +S+PD+ EAGELPIKG+     PIT V GME FL
Sbjct  128   LDVANE-LGIPIINCRTIGACFLWSNYSIPDMIEAGELPIKGSEDMDRPITAVPGMEKFL  186

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR  +++    + Y T  R +  A G+ILNTFE+LEGPILSQIR+K PNVYT
Sbjct  187   RCRDLPSFCRASNMSDSTLLRYGTVTRKSFTASGVILNTFEELEGPILSQIRSKCPNVYT  246

Query  755   IGPLHAHLKATLA----SKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             IGPL+ H K  ++      S  SN   + D +CM+WLD Q  +SV+YVSFGSI+V++ +Q
Sbjct  247   IGPLNEHFKTRMSLENGVSSQSSNYFWEVDRSCMSWLDRQPNQSVVYVSFGSIAVMSDEQ  306

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
             +MEFW+GLVNS ++FLWV+R D VAGK  +    P EL EGTK  GYIVGWA QE VL H
Sbjct  307   IMEFWHGLVNSKRRFLWVVRPDSVAGKGFQGEDTPKELVEGTKDRGYIVGWAAQEEVLSH  366

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              AVGGFLTHSGWNST+ESI AGVPM+CWP+FADQQ NSRFVGEVWK+G+DMKDVCDR  V
Sbjct  367   RAVGGFLTHSGWNSTMESIVAGVPMLCWPYFADQQLNSRFVGEVWKLGIDMKDVCDRKVV  426

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             EK++ +LM +RK EF++ A  M  LAK+ +S GG SYCNFD LI+D+  ++
Sbjct  427   EKMVNDLMVERKDEFVKSAAAMASLAKDCVSVGGPSYCNFDRLIEDIKTIS  477



>ref|XP_002280528.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=479

 Score =   473 bits (1217),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 243/470 (52%), Positives = 318/470 (68%), Gaps = 17/470 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFP P Q ++NSMLKL  LL LA   +TF      H RLL+ +++ + RF+    FR
Sbjct  9     HVLIFPFPIQGNVNSMLKLTELLCLAGIQVTFLNCHYPHRRLLSYSNIQA-RFSRYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKP-FLKQYIAQNR---DSGLPFTCFISDLL  394
              ++   G+      + E F+++ D ++    P F++  I+  R   D+  P TC I+D L
Sbjct  68    FETISDGLPMEHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSASDTRSPLTCIIADGL  127

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S ++DV+ E   LPV  FR ISAC+FW YFSLP L EAGE+P +G  +D   +  V GM
Sbjct  128   MSFSIDVANE-VGLPVIIFRAISACSFWAYFSLPQLIEAGEVPFRGGDMDRL-VASVPGM  185

Query  575   EDFLRVRDLSPFCRDEDLAVLYYTEA----RLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL   CR +D+            R    A   ++NTF+DLEGPILSQIR  +P
Sbjct  186   EGFLRRRDLPSCCRVKDVDNPDLQNPMKNIRKTHGAHAQVINTFDDLEGPILSQIRNHFP  245

Query  743   NVYTIGPLHAHLKATLA---SKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
               YTIGPLHA LK+ LA   S S  SNS  +ED +C+ WLD Q  KSVIYVSFGS+++IT
Sbjct  246   RTYTIGPLHALLKSKLATETSTSQSSNSFWEEDRSCIPWLDRQPSKSVIYVSFGSLAIIT  305

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             +++L EFW+GLVNSG +FLWV+R D + GKD EE   P+EL EGTK  GY+VGWAPQE V
Sbjct  306   KEELREFWHGLVNSGSRFLWVIRPDALVGKD-EERQTPAELLEGTKDRGYVVGWAPQEEV  364

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGFLTH GWNSTLESI  G+PMICWP+FADQQ NSRFV  VWK+G+DMKD CDR
Sbjct  365   LKHPAVGGFLTHGGWNSTLESIVEGLPMICWPYFADQQINSRFVSHVWKLGMDMKDSCDR  424

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              +VEK++R+LM +++ EF+E A+ +  LAK+ + +GGSS CN + LI+D+
Sbjct  425   VTVEKMVRDLMVEKRDEFMEAADTLATLAKKCVGDGGSSSCNLNSLIEDI  474



>ref|XP_009802463.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=480

 Score =   470 bits (1209),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 244/471 (52%), Positives = 304/471 (65%), Gaps = 17/471 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVD-SGRFTTRF  223
             + H+LIFP P Q H+N MLKLA LL     H+TF     IH RLL+ TD+  S +     
Sbjct  8     LSHVLIFPFPVQGHVNCMLKLAQLLCREGLHVTFLNSDFIHRRLLSYTDIHLSYKQYPNL  67

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL---PFTCFISDLL  394
               ++ P G+ D    + +  V+L +S+  I KP L + +   R S L   P TC I+D +
Sbjct  68    YFETIPDGLSDDHPRTGDRVVDLFNSIDTITKPLLMEMLIARRFSTLDRPPLTCIITDGI  127

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +   +D+  E  N+P   FR ISA  FW +F LP L E GELPI G     + +T V GM
Sbjct  128   MCFTIDIGRE-LNIPTILFRTISASCFWAFFCLPRLIEGGELPITGQSDMDTLLTNVAGM  186

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR+RDL  FCR  DL      L  +  +    A GLILNTFE+LEGP L+QI     
Sbjct  187   ESFLRLRDLPSFCRASDLTDRGLQLVISATQHTKSAHGLILNTFEELEGPALAQITKNIS  246

Query  743   NVYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
              +YTIGPLH  LKA +A+      T S+SL +ED +C+ WLD Q  KSVIYVSFGS++V+
Sbjct  247   KLYTIGPLHVQLKARVATNIGLTCTSSSSLWEEDRSCIDWLDQQPFKSVIYVSFGSMTVL  306

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR Q MEF +GLVNSGK FLWV+R   VA    E+  IP EL EGT+  GYIV WAPQE 
Sbjct  307   TRDQFMEFLHGLVNSGKPFLWVVRPKSVA----EDYQIPEELLEGTRQRGYIVEWAPQEE  362

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H A+GGFLTHSGWNSTLESI  GVPMICWPF+ADQQ NSR  GEVWK+GLDMKD CD
Sbjct  363   VLGHPAIGGFLTHSGWNSTLESIYEGVPMICWPFYADQQVNSRLAGEVWKIGLDMKDTCD  422

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R  +EK++++L+E RK EF +    M KLA+++ SE GSSYCN D LI+D+
Sbjct  423   RVIIEKMVKDLIETRKDEFAKSTRLMAKLARKSASENGSSYCNLDRLIKDI  473



>ref|XP_011100060.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=493

 Score =   467 bits (1201),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 244/481 (51%), Positives = 316/481 (66%), Gaps = 29/481 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSMLKLA L  L+N H+T  +    H RL    +++S RF+    FR
Sbjct  10    HVLIFPLPMQGHINSMLKLAELFCLSNLHVTMLLSEYTHGRLRRHANIES-RFSRYPGFR  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN---RDSGLP--FTCFISDL  391
             + + P G+ +      E  +E+  SL ++G    ++ +       D G     TC I D 
Sbjct  69    VATIPDGLPEDHPRVGERTMEIVMSLLKVGGAEFRKLMETTDALSDGGARRRVTCLIMDG  128

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP------  553
             ++S A+ V+EE   +P  YFR + AC+FW  F   D+ EAGE P+KG             
Sbjct  129   VLSFAVPVAEE-MGIPFIYFRTVGACSFWANFCFKDVIEAGEAPLKGKDEGKHEYWKKEE  187

Query  554   ----ITKVKGMEDFLRVRDLSPFCRDEDLAVLYYT----EARLAVQARGLILNTFEDLEG  709
                 +T V GME +LR RDL  FCR  D+    +     E R    +RGLILN+FEDLEG
Sbjct  188   LDLMVTSVPGMEGYLRRRDLPAFCRVNDVNDPGFQTIIRETRRTALSRGLILNSFEDLEG  247

Query  710   PILSQIRTKYPNVYTIGPLHAHLKATLASKSTHSNS-----LLQEDETCMAWLDSQEPKS  874
             PIL QIR   PN+Y+IGPLH HLKA L S+ +  +S       +ED + M+WLDSQ PKS
Sbjct  248   PILDQIRKPIPNLYSIGPLHTHLKARLESQKSEESSLPSSSFYEEDRSSMSWLDSQPPKS  307

Query  875   VIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKA  1054
             V+YVSFGS++++TR +L+EFWYGLVNSG KFLWVMR D + G D++++PIP+EL+E TK 
Sbjct  308   VLYVSFGSVTLLTRDELLEFWYGLVNSGHKFLWVMRPDSIVG-DNKDNPIPAELEEATKE  366

Query  1055  NGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEV  1234
              GY+VGW PQ  VL H +VG F THSGWNSTLE IAA +PMICWP+FADQ  NSRFV EV
Sbjct  367   RGYLVGWVPQNEVLAHPSVGAFFTHSGWNSTLEGIAAVMPMICWPYFADQTINSRFVSEV  426

Query  1235  WKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             WKVGLDMKD CDR  VEK +R++ME R+ EFLERA +M +LAK++ISEGG+SY N + LI
Sbjct  427   WKVGLDMKDSCDRVIVEKTVRDIMEVRRDEFLERALHMAELAKKSISEGGTSYTNLNRLI  486

Query  1415  Q  1417
             +
Sbjct  487   E  487



>ref|XP_009590620.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=524

 Score =   468 bits (1203),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 242/471 (51%), Positives = 311/471 (66%), Gaps = 18/471 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LIFPLP Q  +NS  KLA LL ++  HITF +  NIH RL++ T++ S RF     F+
Sbjct  54    HVLIFPLPLQGPVNSTFKLAELLCISGLHITFLLTENIHNRLVSHTNI-SSRFERFPGFQ  112

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSG----LPFTCFISDLL  394
             +++   G+          ++EL DSL+   KP  K  +     S      P +C I+D +
Sbjct  113   IKTISDGLPQDHPRKGSKYMELFDSLKCKTKPLFKDMLTSGWLSSDGKRRPVSCIIADGV  172

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +    DV+ E   +P++  R IS C  W +F LP L E+GE P KG+ +D  PI  V G 
Sbjct  173   LGFTCDVANE-IGIPIFSIRTISPCCLWIFFCLPQLIESGEYPFKGDDLDE-PIKSVPGA  230

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL  FCR  DL      LY TE +   +A GLILNTFE+L+G +LSQ+RT  P
Sbjct  231   ETFLRRRDLPDFCRTGDLTDSNVQLYKTEGQENSRAYGLILNTFEELDGHLLSQMRTVCP  290

Query  743   NVYTIGPLHAHLKATLASKSTH----SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             N+Y IGPLHAHLK  L+ ++      SNSL +ED++C+ WL++Q P SVIYVSFGSI+ +
Sbjct  291   NIYPIGPLHAHLKKKLSEENNSLPPSSNSLFEEDKSCINWLNNQLPNSVIYVSFGSIATM  350

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T++QLMEFWYGLVNS + FLWV+R D VAG DD ++ IP EL EGTK  GYIVGWAPQE 
Sbjct  351   TKEQLMEFWYGLVNSKQNFLWVIRLDSVAG-DDWKNKIPLELVEGTKERGYIVGWAPQEE  409

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H +VGGF TH GWNS LE++  G PMICWP+F DQQ NSRFV   WK+GLDMKD CD
Sbjct  410   VLAHPSVGGFWTHCGWNSILETVYEGKPMICWPYFMDQQVNSRFVEAAWKLGLDMKDTCD  469

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R  VEK++++LM  +K EFLERA  M   AK+ + EGGSSY NF+ L+ D+
Sbjct  470   RKIVEKMVKDLMVVKKEEFLERANQMSNFAKKCLKEGGSSYSNFERLVNDI  520



>ref|XP_009608691.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 242/471 (51%), Positives = 305/471 (65%), Gaps = 17/471 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVD-SGRFTTRF  223
             + H+LIFP P Q H+N MLKLA LL     H+TF     IH RLL+ T++  S +     
Sbjct  8     LSHVLIFPFPVQGHVNCMLKLAQLLCREGLHVTFLNSDFIHRRLLSYTNIHLSYKQYPNL  67

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL---PFTCFISDLL  394
               ++ P G+ D    + +  V+L +S+  + KP   + +   R S L   P TC I+D +
Sbjct  68    YFETIPDGLPDDHPRTGDRVVDLFNSIDTVTKPRFMEMLIARRFSILDRPPLTCIIADGI  127

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +   +D+  E  N+P   FR +SA  FW +F LP L EAGELPI G     + +T V GM
Sbjct  128   MCFTIDIGRE-LNIPTILFRTVSASCFWAFFCLPRLIEAGELPITGQSDMDTLLTNVVGM  186

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR+RDL  FCR  DL      L  +  +L   A GLILNTFE+LEGP L+QI     
Sbjct  187   ETFLRLRDLPSFCRASDLTDRGLQLVISATQLTKSAHGLILNTFEELEGPALAQITNNIS  246

Query  743   NVYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
              +YTIGPLH  LKA +A+      T S+SL +ED +C+ WLD Q  KSVIYVSFGS++V+
Sbjct  247   KLYTIGPLHVQLKARVATNIKLTCTSSSSLWEEDRSCIDWLDQQPFKSVIYVSFGSMTVL  306

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR Q MEF +G VNSGK FLWV+R   VA    E+  IP EL EGT+  GYIV WAPQE 
Sbjct  307   TRDQFMEFLHGFVNSGKPFLWVVRPKSVA----EDYQIPEELLEGTRQRGYIVEWAPQEE  362

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H A+GGFLTHSGWNSTLESI  GVPMICWPF+ADQQ NSR VGEVWK+GLDMKD CD
Sbjct  363   VLAHPAIGGFLTHSGWNSTLESIYEGVPMICWPFYADQQVNSRLVGEVWKIGLDMKDTCD  422

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R  +E ++++L+E RK EF + A  M KLA +++SE GSSYCN D LI+D+
Sbjct  423   RVIIENMVKDLIETRKDEFAKSARLMTKLAMKSVSENGSSYCNLDRLIKDI  473



>ref|XP_006435571.1| hypothetical protein CICLE_v10031408mg [Citrus clementina]
 gb|ESR48811.1| hypothetical protein CICLE_v10031408mg [Citrus clementina]
Length=476

 Score =   465 bits (1197),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 245/471 (52%), Positives = 310/471 (66%), Gaps = 24/471 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             HILIFPLP QSH+NSMLKLA +  LA   +TF    + H RL+  TD+   RF   + F+
Sbjct  9     HILIFPLPCQSHVNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDI-HDRFLQYSEFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      + +  +E+ DSL    +P LKQ +    D+  P +C I D  +   
Sbjct  68    FKTISDGLPADHPRAGDRLMEIFDSLSLNTRPLLKQMLI---DTSPPVSCIIGDACMEFV  124

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP-ITKVKGMEDF  583
             +DV+ E   +PV +FR ISAC+FW YFS+P++ +AGELP+K    D    ITKV GME F
Sbjct  125   VDVATE-LEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETF  183

Query  584   LRVRDLSPFCR-----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
             LR RDL  FCR     D DL VL     + + +   LILNTFEDLE PILS IRTK P V
Sbjct  184   LRFRDLPSFCRVSDVTDRDLQVLKNVTQQ-SPRTHALILNTFEDLEEPILSHIRTKCPKV  242

Query  749   YTIGPLHAHLKATLASK------STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             YTIGPLH  LK  LAS           NSL + D +C+ WL  Q  +SV+YVSFGSI+++
Sbjct  243   YTIGPLHLQLKTRLASNVISSSSQKSLNSLWEVDRSCIEWLGKQPVRSVLYVSFGSITLL  302

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
              R+QL+EFW+GLV+S ++FLWV+R D V G+ D     P+EL EGTK  G++V W PQE 
Sbjct  303   KREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDA----PAELVEGTKERGHLVSWVPQEE  358

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AV GFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV EVW +GLDMKDVCD
Sbjct  359   VLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCD  418

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R+ VEK++ +LM +RK EF+  A+ M  +A+   +EGG SYCN D LI D+
Sbjct  419   RNVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDI  469



>ref|XP_006486448.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Citrus sinensis]
Length=476

 Score =   465 bits (1196),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 245/471 (52%), Positives = 310/471 (66%), Gaps = 24/471 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             HILIFPLP QSH+NSMLKLA +  LA   +TF    + H RL+  TD+   RF   + F+
Sbjct  9     HILIFPLPCQSHVNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDI-HDRFLQYSEFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      + +  +E+ DSL    +P LKQ +    D+  P +C I D  +   
Sbjct  68    FKTISDGLPADHPRAGDRLMEIFDSLSLNTRPLLKQMLI---DTSPPVSCIIGDACMEFV  124

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP-ITKVKGMEDF  583
             +DV+ E   +PV +FR ISAC+FW YFS+P++ +AGELP+K    D    ITKV GME F
Sbjct  125   VDVATE-LEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETF  183

Query  584   LRVRDLSPFCR-----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
             LR RDL  FCR     D DL VL     + + +   LILNTFEDLE PILS IRTK P V
Sbjct  184   LRFRDLPSFCRVSDVTDRDLQVLKNVTQQ-SPRTHALILNTFEDLEEPILSHIRTKCPKV  242

Query  749   YTIGPLHAHLKATLASK------STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             YTIGPLH  LK  LAS           NSL + D +C+ WL  Q  +SV+YVSFGSI+++
Sbjct  243   YTIGPLHLQLKTRLASNVISSSSQKSLNSLWEVDRSCIEWLGKQPVRSVLYVSFGSITLL  302

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
              R+QL+EFW+GLV+S ++FLWV+R D V G+ D     P+EL EGTK  G++V W PQE 
Sbjct  303   KREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDA----PAELVEGTKERGHLVSWVPQEE  358

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AV GFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV EVW +GLDMKDVCD
Sbjct  359   VLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCD  418

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R+ VEK++ +LM +RK EF+  A+ M  +A+   +EGG SYCN D LI D+
Sbjct  419   RNVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDI  469



>gb|KDP44850.1| hypothetical protein JCGZ_01350 [Jatropha curcas]
Length=490

 Score =   465 bits (1196),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 243/472 (51%), Positives = 311/472 (66%), Gaps = 24/472 (5%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--F  223
              H+LIFP PAQ H+NSMLKLA LL L+   ITF    +    L   TD+ + RF     F
Sbjct  10    SHVLIFPFPAQGHVNSMLKLAELLSLSGLTITFLNTQHSQECLARFTDIKA-RFLKYPGF  68

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSI  403
             R  + P  +   + N  +V     D+L+   KP +++ + +   S     CFI D ++  
Sbjct  69    RFVTVPDSLPIDSGNVAKVL----DALKLESKPVIEKLLIE---SNPRINCFIVDGILGF  121

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
               D++ E   +P+ YFR ISACAFW+YF +PD+ EAGELPIKG       ITKV GME F
Sbjct  122   VTDLASE-LAIPIIYFRTISACAFWSYFCIPDMIEAGELPIKGEEEMDRLITKVPGMETF  180

Query  584   LRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVY  751
             LR RDL  FCR   +      +   E +   +A+ LI+NTFEDLE PILSQIR   P  Y
Sbjct  181   LRKRDLPSFCRANGMTEPTFYMIMNETQQTTRAQALIMNTFEDLESPILSQIRNHCPKTY  240

Query  752   TIGPLHAHLKATLASKSTH-------SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             TIGPLH  LK+ +  +ST+       SNSL + D TC+AWLD+Q  +SVIYVSFGS + +
Sbjct  241   TIGPLHELLKS-IKIRSTNKQELHQSSNSLWEVDRTCIAWLDNQPSQSVIYVSFGSFANL  299

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD-EESPIPSELKEGTKANGYIVGWAPQE  1087
             T  QL+EFW+GL+NS ++FLWV+R   V  K+       P EL+EG K NGYIV WAPQE
Sbjct  300   TLDQLIEFWHGLINSNRRFLWVIRPSSVTDKEGIVVEKFPEELQEGCKENGYIVKWAPQE  359

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H A+GGFLTHSGWNSTLESI AGVPMICWP+FADQQTNSRFV EVWK+GLDMKDVC
Sbjct  360   EVLAHKAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQQTNSRFVSEVWKLGLDMKDVC  419

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             +R  VEK++ +LM  ++ EF+  A  M +LA+++ISEGGSS+CN + LI+D+
Sbjct  420   NRKVVEKMVNDLMVNKREEFVRSAARMAELARKSISEGGSSFCNLNRLIEDI  471



>gb|KDO69252.1| hypothetical protein CISIN_1g011848mg [Citrus sinensis]
Length=460

 Score =   464 bits (1193),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 242/464 (52%), Positives = 308/464 (66%), Gaps = 28/464 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+ I PLPA  H+NSML LA LL  A   ITF    + + R++  +     R+     F+
Sbjct  8     HVAILPLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPGFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      + + F EL DSL     P LK+ ++   DS  P  C I+D  +S A
Sbjct  68    FKTLTDGLPRDHPRTPDKFPELVDSLNCATPPLLKEMVS---DSKSPVNCIITDGYMSRA  124

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +D + E   + + YFR ISACAFW++  +PD+ +AGELPIKG                FL
Sbjct  125   IDAARE-VGVSIIYFRTISACAFWSFHCIPDIIDAGELPIKG----------------FL  167

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY-PNVY  751
             R RDL  FCR  D      +L+  E RL+  A GLILNTFEDLEGPILSQIR    PN+Y
Sbjct  168   RCRDLPSFCRVNDPMDPHLLLFARETRLSAHADGLILNTFEDLEGPILSQIRNHSCPNIY  227

Query  752   TIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLME  931
             +IGPL+AHLK  +  K+  S+SL + D +CMAWLD Q  +SVIYVSFGSI+V++R QL+E
Sbjct  228   SIGPLNAHLKVRIPEKTYSSSSLWKIDRSCMAWLDKQPKQSVIYVSFGSIAVMSRDQLIE  287

Query  932   FWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAV  1111
             F+YGLV+S K FLWV+R DL++GKD E   IP EL E TK  G I GW PQE VL H AV
Sbjct  288   FYYGLVHSKKSFLWVIRPDLISGKDGENQ-IPEELLEATKERGCIAGWVPQEEVLAHSAV  346

Query  1112  GGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKL  1291
             GGFLTH GWNSTLESI AG+PMICWP FADQQ NSRFVGEVWK+GLD+KD+CDR+ VEK 
Sbjct  347   GGFLTHCGWNSTLESIVAGMPMICWPSFADQQINSRFVGEVWKLGLDIKDLCDRNIVEKA  406

Query  1292  IRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             + +LM +RK EF+E A+ M  LAK+++++GGSSYCN D L+ D+
Sbjct  407   VNDLMVERKEEFMESADRMANLAKKSVNKGGSSYCNLDRLVNDI  450



>gb|AIS39472.1| flavonoid UDP-glucosyltransferase 3 [Citrus x paradisi]
Length=476

 Score =   464 bits (1193),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 244/471 (52%), Positives = 309/471 (66%), Gaps = 24/471 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             HILIFPLP QSH+NSMLKLA +  LA   +TF    + H RL+  TD+   RF   + F+
Sbjct  9     HILIFPLPCQSHVNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDI-HDRFLQYSEFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      + +  +E+ DSL    +P LKQ +    D+  P +C I D  +   
Sbjct  68    FKTISDGLPADHPRAGDRLMEIFDSLSLNTRPLLKQMLI---DTSPPVSCIIGDACMEFV  124

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP-ITKVKGMEDF  583
             +DV+ E   +PV +FR ISAC+FW YFS+P++ +AGELP+K    D    ITKV GME F
Sbjct  125   VDVATE-LEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETF  183

Query  584   LRVRDLSPFCR-----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
             LR RDL  FCR     D DL VL     + + +   LILNTFEDLE PILS IRTK P V
Sbjct  184   LRFRDLPSFCRVSDVTDRDLQVLKNVTQQ-SPRTHALILNTFEDLEEPILSHIRTKCPKV  242

Query  749   YTIGPLHAHLKATLASK------STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             YTIGPLH  LK  LAS           NSL + D +C+ W   Q  +SV+YVSFGSI+++
Sbjct  243   YTIGPLHLQLKTRLASNVISSSSQKSLNSLWEVDRSCIEWFGKQPVRSVLYVSFGSITLL  302

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
              R+QL+EFW+GLV+S ++FLWV+R D V G+ D     P+EL EGTK  G++V W PQE 
Sbjct  303   KREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDA----PAELVEGTKERGHLVSWVPQEE  358

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AV GFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV EVW +GLDMKDVCD
Sbjct  359   VLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCD  418

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R+ VEK++ +LM +RK EF+  A+ M  +A+   +EGG SYCN D LI D+
Sbjct  419   RNVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDI  469



>ref|XP_009800319.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=479

 Score =   461 bits (1186),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 240/471 (51%), Positives = 309/471 (66%), Gaps = 18/471 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LIFPLP Q  +NS  KLA LL  +   ITF +  NIH RL++ T+++S RF     F+
Sbjct  9     HVLIFPLPLQGPVNSTFKLAELLCFSGLDITFLLTENIHNRLISHTNINS-RFERFPGFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSG----LPFTCFISDLL  394
             +++   G+          ++EL DSL+   KP  K  +     S        +C I+D +
Sbjct  68    IKTISDGLPQDHPRKGSKYMELFDSLKSKTKPLFKDMLTSGWLSSDGKRREVSCIIADGV  127

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +    DV+ E   +P++  R IS C  W +F LP L E+GE P K + +D  PI  V G 
Sbjct  128   LGFTCDVANE-IGIPIFSIRTISPCCLWIFFCLPQLIESGEYPFKDDDLDE-PIKSVPGA  185

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL  FCR  DL      LY TE +   +A GLILNTFE+L+G +LSQ+R   P
Sbjct  186   ETFLRRRDLPDFCRTGDLTDSNVQLYKTEGQENSRAYGLILNTFEELDGNLLSQMRNVCP  245

Query  743   NVYTIGPLHAHLKATLASKSTH----SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             N+Y IGPLHAHLK  L+ ++      SNSL +ED++C+ WL++Q P SVIYVSFGSI+ +
Sbjct  246   NIYPIGPLHAHLKNKLSEENNSMPPSSNSLFEEDKSCINWLNNQLPNSVIYVSFGSIATM  305

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T++QLMEFWYGLVNS ++FLWV+R D VAG DD ++ IP EL EGTK  GYIVGWAPQE 
Sbjct  306   TKEQLMEFWYGLVNSKQRFLWVIRLDSVAG-DDWKNKIPVELAEGTKERGYIVGWAPQEE  364

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H +VGGF TH GWNS LE++  G PMICWP+F DQQ NSRFV   WK+GLDMKD CD
Sbjct  365   VLAHPSVGGFWTHCGWNSILETVYEGKPMICWPYFMDQQVNSRFVEAAWKLGLDMKDTCD  424

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R  VEK++++LM  RK EFLERA  M K AK+ + EGGSSY NF+ L+ D+
Sbjct  425   REIVEKMVKDLMMVRKDEFLERANQMSKFAKKCLVEGGSSYSNFERLVNDI  475



>gb|KDO69251.1| hypothetical protein CISIN_1g011832mg [Citrus sinensis]
Length=476

 Score =   461 bits (1186),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 244/471 (52%), Positives = 308/471 (65%), Gaps = 24/471 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             HILIFPLP QSH+NSMLKLA +  LA   +TF    + H RL+  TD+   RF   + F+
Sbjct  9     HILIFPLPCQSHMNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHD-RFLQYSEFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      + +  +E+ DSL    +P LKQ +    D+  P +C I D  +   
Sbjct  68    FKTISDGLPADHPRAGDQLMEMFDSLSLNTRPLLKQMLI---DTSPPVSCIIGDACMEFV  124

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP-ITKVKGMEDF  583
             +DV+ E   +PV +FR ISAC+FW YFS+P++ +AGELP+K    D    ITKV GME F
Sbjct  125   VDVATE-LEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLITKVPGMETF  183

Query  584   LRVRDLSPFCR-----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
             LR RDL  FCR     D DL VL     + + +A  LILNTFEDLE PILS IRTK P V
Sbjct  184   LRFRDLPSFCRVSDVTDRDLQVLK-NATQQSPRAHALILNTFEDLEEPILSHIRTKCPKV  242

Query  749   YTIGPLHAHLKATLASK------STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             YTIGPLH  LK   AS           NSL + D +C+ WL  Q  +SV+YVSFGSI+++
Sbjct  243   YTIGPLHLQLKTRFASNMISSSSQKSLNSLWEVDRSCIEWLGKQPVRSVLYVSFGSITLL  302

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
              R+QL+EFW+GLV+S ++FLWV+R D V G+ D  +    EL EGTK  G +V W PQE 
Sbjct  303   KREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALA----ELVEGTKERGLLVSWVPQEE  358

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AV GFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV EVW +GLDMKDVCD
Sbjct  359   VLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCD  418

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R+ VEK++ +LM +RK EF+  A+ M  +A+   +EGG SYCN D LI D+
Sbjct  419   RNVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDI  469



>ref|XP_011084978.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=499

 Score =   461 bits (1185),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 242/482 (50%), Positives = 313/482 (65%), Gaps = 29/482 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             H+LIFP+P Q H+NSML LA LL L+  H+T  +    H RLL    + S RF+  + FR
Sbjct  13    HVLIFPVPLQGHVNSMLNLAELLCLSGLHVTILLSDYTHNRLLRHASLQS-RFSRHSGFR  71

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN---RDSGLP--FTCFISDL  391
             + +   G+        E  V++  SL+ +G    +  +       D G     +C I D 
Sbjct  72    VVTISDGLPADHPRVGERIVDIVLSLKEVGGQQFRHLMESTDGLSDGGARRRVSCLIVDG  131

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP------  553
             +   A+ V EE   +P  YFR ISAC+FW YF L ++ +AGE+P+KG   D         
Sbjct  132   VFRFAIPVVEE-MGIPYIYFRTISACSFWPYFCLQEIIDAGEVPLKGKNEDKLTYWKKKE  190

Query  554   ----ITKVKGMEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEG  709
                 +T V GME  LR RD+  FC+ ED+         TE R  + A GLILNTFEDLEG
Sbjct  191   MDLMVTSVPGMERVLRRRDIPRFCQVEDINHPGLQTMKTETRRTIDASGLILNTFEDLEG  250

Query  710   PILSQIRTKYPNVYTIGPLHAHLKATLASKS-----THSNSLLQEDETCMAWLDSQEPKS  874
             PIL +IR   PN+Y+IGPLHA LKA L S+        S+S  +ED+ C+AWLDSQ   S
Sbjct  251   PILDEIRKHIPNLYSIGPLHALLKAGLESEGMESSRNRSSSFWEEDQNCIAWLDSQPASS  310

Query  875   VIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEE-SPIPSELKEGTK  1051
             VIYVSFGS++++TR +L+EFWYGLVNSG +FLWV+R D + G D+   + IP EL+EGTK
Sbjct  311   VIYVSFGSVTILTRDELLEFWYGLVNSGHRFLWVIRPDSIIGNDNGNGNEIPVELEEGTK  370

Query  1052  ANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGE  1231
             + GY+VGW PQ+ VL H A+G F THSGWNSTLESI  G+PM+CW +FADQ TNSRFV E
Sbjct  371   SRGYMVGWVPQQQVLAHPAIGAFFTHSGWNSTLESITLGLPMLCWAYFADQITNSRFVSE  430

Query  1232  VWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCL  1411
             VWKVGLDMKD CDR  VEK+++E+ME R+ EFLERA++M  LA++AISEGGSSY N + L
Sbjct  431   VWKVGLDMKDTCDRIIVEKMVKEVMEVRREEFLERADSMATLARKAISEGGSSYLNLNGL  490

Query  1412  IQ  1417
             I+
Sbjct  491   IE  492



>ref|XP_008464643.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
 ref|XP_008464644.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
Length=509

 Score =   459 bits (1182),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 246/470 (52%), Positives = 312/470 (66%), Gaps = 23/470 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LIFP PAQ H+NSMLKLA LL L+   ITF     IH +L   T+  S RF+    F+
Sbjct  38    HVLIFPFPAQGHVNSMLKLAELLSLSGLRITFLNIHRIHHKLTLHTNFQS-RFSRFPNFQ  96

Query  227   LQSFPPGIYDGALNSKEV--FVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVS  400
              Q+   G+    L ++ +  F +L +SL+ I KP LKQ +        P TC I D L +
Sbjct  97    FQTITDGL---PLENRPIGNFSDLINSLKSITKPLLKQMLLSGELGPTP-TCIILDGLFN  152

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  580
                DV     N+PV+ FR ISAC+F  Y  +P L E G+LPI+G       I  V GME+
Sbjct  153   FIFDVDAHP-NIPVFSFRTISACSFSAYSFVPKLIEDGQLPIEGEEDMDRIINGVVGMEN  211

Query  581   FLRVRDLSPFCRDEDL--AVLYY--TEARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
              LR RDL  FCR ED     L Y  T+   + ++  LI NTFEDLEGPILS +R++  N+
Sbjct  212   VLRCRDLPSFCRLEDPFDPRLQYGVTQTIQSFKSHALIFNTFEDLEGPILSCLRSRCSNI  271

Query  749   YTIGPLHAHLKATLASK-----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
             Y IGPLHAHLK  L+S+     S  +N L + D +C+AWLD+Q PKSVIYVSFGS+ VI 
Sbjct  272   YAIGPLHAHLKTKLSSEISPTASESNNGLWEVDRSCLAWLDAQPPKSVIYVSFGSVVVID  331

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
               QL EFW+GLVNSGK+FLWV+R + VAGKD     +P+EL+E TK  GYIVGWAPQE V
Sbjct  332   DDQLREFWHGLVNSGKRFLWVLRPNSVAGKDG----VPAELEEETKERGYIVGWAPQEEV  387

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H A+G FLTHSGWNSTLESI AGVPMICWP FADQQTNSR+V E+WK+GLDMKDVC+R
Sbjct  388   LAHKAIGAFLTHSGWNSTLESIVAGVPMICWPQFADQQTNSRYVSEIWKIGLDMKDVCNR  447

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              +V K++ ++ME RK E +     + KLA  ++ EGGSSYC+ + +I+D+
Sbjct  448   ETVAKMVNDVMENRKNELMGSVIEIAKLAITSVEEGGSSYCDLERMIKDI  497



>ref|XP_007158356.1| hypothetical protein PHAVU_002G145900g [Phaseolus vulgaris]
 gb|ESW30350.1| hypothetical protein PHAVU_002G145900g [Phaseolus vulgaris]
Length=484

 Score =   458 bits (1179),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 233/467 (50%), Positives = 312/467 (67%), Gaps = 12/467 (3%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT-TRF  223
             + H+++ P P Q ++NSM+KLA LL L +FH+TF     IH RL    D+ +   T    
Sbjct  10    VNHVVLLPGPLQGNVNSMMKLAQLLALHHFHVTFLTTDFIHRRLHRFADIQALSQTYPNL  69

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISD-LLVS  400
              L++   G+ D    S     +L   L    KP ++  +     +    TC I D  L  
Sbjct  70    ELKTISDGLPDDHPRSDNALADLYSFLNSHAKPLIRDILVSQTAAKPKVTCLIGDGFLGG  129

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  580
             +  DV++E   +P+ +FR ISA  FW  F  P+LFE+ +LPI+G       IT + GME+
Sbjct  130   LTADVADEV-GIPLIHFRAISASCFWALFCAPNLFESNQLPIRGEEDMDRVITTLPGMEN  188

Query  581   FLRVRDLSPFCRDEDLAVLYYTEARL-----AVQARGLILNTFEDLEGPILSQIRTKYPN  745
              LR RDL  F R  +  ++   ++ +      ++ARG+ILNTFEDL+GP+LSQ+R K+P 
Sbjct  189   ILRCRDLPSFYRGTESNLVEPLKSTVFDCHQTLRARGVILNTFEDLDGPLLSQMRLKFPR  248

Query  746   VYTIGPLHAHLKA--TLASKSTHS-NSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             V+ +GPLHAHL +     +K T S +S  + D +C+ WLDSQ  KSV+YVSFGSI+ ITR
Sbjct  249   VFAVGPLHAHLNSERVFDAKPTPSMSSFWEVDRSCLTWLDSQPLKSVLYVSFGSITTITR  308

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             ++LMEFWYGLVNS K+FLWV+R D+VAG+D+ +  +P+EL+EGTK  G+IVGWAPQE VL
Sbjct  309   ERLMEFWYGLVNSKKRFLWVIRPDMVAGEDNNDR-VPAELEEGTKERGFIVGWAPQEEVL  367

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
             +H A+GGFLTHSGWNSTLES+ AGVPMICWP+FADQQ NSRFV EVWKVGLDMKDVCDR 
Sbjct  368   EHKAIGGFLTHSGWNSTLESVVAGVPMICWPYFADQQINSRFVSEVWKVGLDMKDVCDRD  427

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
              VEK++ +LM  R+ EFL  A+ M KLA +++S GGSSY +   LIQ
Sbjct  428   VVEKMVNDLMVHRREEFLNSAKAMAKLAHKSVSPGGSSYSSLLDLIQ  474



>gb|EYU19963.1| hypothetical protein MIMGU_mgv1a005336mg [Erythranthe guttata]
Length=488

 Score =   458 bits (1178),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 240/484 (50%), Positives = 311/484 (64%), Gaps = 24/484 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRF---  223
             H+LIFPLP Q  +N MLKLA L  L     TF    +IH RLL  TD  +  + TR+   
Sbjct  11    HVLIFPLPLQGPVNCMLKLAELFSLRRIRTTFLNTHHIHHRLLDCTD--NHTYFTRYPLL  68

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN----RDSGLPFTCFISDL  391
             R  + P G+ +G   + +    L +S+  +  P  +Q +        DS  P TC I+D 
Sbjct  69    RFDTVPDGLPEGNPRTGDQIPNLLNSMDAVAVPIFRQMVTSGGPYGPDSENPVTCIIADG  128

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
             + + A +++ E   +P+ YF  IS C  WTY  LP L EAGE+P K + +D   I    G
Sbjct  129   IFTFAAEIAAE-IGVPLLYFDTISPCGLWTYLCLPKLIEAGEVPFKDDNLDEI-IINAPG  186

Query  572   MEDFLRVRDLSPFCRDEDL----AVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             ME  +R RDL  FCR +DL      L   E +    A+GLI NTF++LE PILSQ+    
Sbjct  187   MEGIIRRRDLPSFCRTKDLNDRIIQLVLKEDKHIPLAQGLIFNTFQELESPILSQLLNIS  246

Query  740   PNVYTIGPLHAHLKATLAS-------KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGS  898
             PN+Y +GPLHAHLKA + S         T +NS+ +ED++C++WLD+Q  KSVI+VS GS
Sbjct  247   PNIYAVGPLHAHLKARVESLTGPEFRPETSTNSIWKEDKSCISWLDAQASKSVIFVSIGS  306

Query  899   ISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWA  1078
             ++V+T++QL E WYGLVNSG KFLWV R   V G D E   IP EL EGTK  G+IV WA
Sbjct  307   LAVMTKEQLFEIWYGLVNSGSKFLWVRRPGSVIGADAELE-IPLELSEGTKERGFIVKWA  365

Query  1079  PQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMK  1258
             PQE VL H A+GGFLTHSGWNSTLESI  G PMICWP+F DQQ NSR+VGEVWK+GLDMK
Sbjct  366   PQEEVLGHPAIGGFLTHSGWNSTLESIVEGKPMICWPYFVDQQVNSRYVGEVWKLGLDMK  425

Query  1259  DVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNE  1438
             D CDR+ VEK+IRE+M  +K EFLE A  M +LAK +++EGGSS+ +FD L++D +K  +
Sbjct  426   DTCDRAVVEKMIREVMVLKKDEFLETAAKMAELAKSSVAEGGSSFLDFDRLVED-VKTMK  484

Query  1439  ATRE  1450
              TR+
Sbjct  485   ITRK  488



>gb|EYU19961.1| hypothetical protein MIMGU_mgv1a005050mg [Erythranthe guttata]
Length=499

 Score =   458 bits (1179),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 241/484 (50%), Positives = 313/484 (65%), Gaps = 31/484 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+NSMLKLA LL L++ H++  +    H+RL     ++S RF+    FR
Sbjct  19    HVLIFPLPMQGHINSMLKLAELLCLSDIHVSMLISDYSHSRLRRHASIES-RFSRYPGFR  77

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN---RDSGLP--FTCFISDL  391
             + +   G+ D    + E  +++  SL R+G    ++ +       D G     +C I D 
Sbjct  78    VATMTDGLPDDHPRAGERSMDIVMSLVRVGGTEFRRVMETTDALSDGGARRRVSCLIMDG  137

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSS-------  550
             + S A+ V EE   +P  YFR ISACAFW  F   ++ EAGE+P+KG   D         
Sbjct  138   VFSFAVPVVEE-MGIPFLYFRTISACAFWANFCFKEVIEAGEIPLKGKDEDKYAYWKRED  196

Query  551   ---PITKVKGMEDFLRVRDLSPFCRDEDLAVLYY----TEARLAVQARGLILNTFEDLEG  709
                P+T V GME +LR RDL  FCR  D+    +    TE++   ++ GLILN+FEDLEG
Sbjct  197   FDLPVTSVPGMEGYLRRRDLPAFCRVNDVNNPVFQTIITESKRTARSNGLILNSFEDLEG  256

Query  710   PILSQIRTKYPNVYTIGPLHAHLKATLASKSTH----SNSLLQEDETCMAWLDSQEPKSV  877
             PIL QIR   PN+Y IGP+H HL+A L SK T     S+S  +ED + + WL++Q  KSV
Sbjct  257   PILDQIRNHIPNLYPIGPIHTHLQARLVSKKTELPLPSSSFWEEDRSSITWLNNQPTKSV  316

Query  878   IYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKAN  1057
             IYVSFGSI+++TR ++ EFWYGLVNSG +FLWVMR D + G   EE  +P EL  GTK  
Sbjct  317   IYVSFGSITLLTRSEVFEFWYGLVNSGHRFLWVMRPDSITG---EEYSVPEELDTGTKER  373

Query  1058  GYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVW  1237
             GY+VGW PQ  VL H +VG F THSGWNST+ES+AAGVPMICWP+FADQ  NSRFV +VW
Sbjct  374   GYLVGWVPQNEVLAHPSVGAFFTHSGWNSTMESVAAGVPMICWPYFADQTINSRFVSDVW  433

Query  1238  KVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             KVGLDMKD CDR  VEK++RE+ME ++ EF ER     +LAK+A+SEGGSSY + + LI 
Sbjct  434   KVGLDMKDSCDRVIVEKMVREVMEDKRDEFSERGVRFAELAKKAVSEGGSSYSSLNRLI-  492

Query  1418  DMIK  1429
             D IK
Sbjct  493   DFIK  496



>ref|XP_009795416.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=478

 Score =   456 bits (1173),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 237/473 (50%), Positives = 309/473 (65%), Gaps = 20/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLAN--FHITFFVPSNIHARLLALTDVDSGRFTT--R  220
             H+LIFPLP Q  +N MLKLA L  L +   H+TF    +I  RLL  TDV   RF     
Sbjct  5     HVLIFPLPIQGPVNCMLKLAELFCLHHQEIHVTFLNSEHIQQRLLNCTDVQI-RFKKYPN  63

Query  221   FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ---NRDSGLPFTCFISDL  391
             F+  + P G+ +    + +    L   +  +  P L++ +     + +S  P TC + D 
Sbjct  64    FKFMTIPDGLAEDNPRTGDQVRNLVKGVEDVSSPLLREMVTSGLLSPNSEKPVTCLLVDG  123

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
             +V+ A+D+++E   +P+ YF  IS CA WT   +P L EAGE+P KGN +D+  +  V G
Sbjct  124   IVTFAVDIAKE-VGIPLLYFDTISPCALWTCLCVPKLIEAGEIPFKGNDLDAL-VNNVPG  181

Query  572   MEDFLRVRDLSPFCRDEDL----AVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             ME  +R RDL  FCR  DL          E +  VQA+GLI NTFE LEGPIL Q RT  
Sbjct  182   MEGVIRRRDLPSFCRAPDLNNPTIQRIVKEGKHIVQAQGLIFNTFEGLEGPILPQFRTLC  241

Query  740   PNVYTIGPLHAHLKATLASK-----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
             PN+Y+IGPLH HLK +L+SK     ++ SNS+ +ED +CM WLD Q  KSV++VS GS++
Sbjct  242   PNIYSIGPLHIHLKKSLSSKCSVPKTSTSNSIWKEDMSCMDWLDEQPNKSVLFVSIGSVA  301

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
              +++ QL+E WYGLVNS  +FLWV R   V G + E + IP EL + TK  G IV WAPQ
Sbjct  302   TMSKAQLLEIWYGLVNSKTRFLWVQRPGSVIGLE-ENNDIPMELSKYTKERGCIVSWAPQ  360

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL H ++GGFLTH GWNSTLESI  GVPMICWP+F DQQ NSR+VGEVWK+GLDMKDV
Sbjct  361   EEVLAHPSIGGFLTHCGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKDV  420

Query  1265  CDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             CDR+ VEK++RE+ME RK EFLER   M KLA E+++EGGSSY + D L++D+
Sbjct  421   CDRAIVEKMVREIMEVRKIEFLERGREMRKLAIESVNEGGSSYKDLDSLVEDI  473



>ref|XP_006355679.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=482

 Score =   456 bits (1173),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 240/475 (51%), Positives = 306/475 (64%), Gaps = 17/475 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LIFPLP Q  +NSM KLA LL  +  HIT  +  NIH RL+  TD+ S RF     F+
Sbjct  10    HVLIFPLPLQGPVNSMFKLAELLCFSGLHITILLTENIHNRLVLHTDITS-RFDQCPGFQ  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN-------RDSGLPFTCFIS  385
             +++   G+ D        F+E+ +SLR   K   K  +  +              +C I+
Sbjct  69    IKTISDGLPDDHPRDGGKFMEVFESLRTKTKTLFKDMLTSDLLCFDLDGKERRRVSCIIA  128

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
             D ++    DV++E  ++P++  R IS C  W +F LP L E+GE P K + +D  P+  V
Sbjct  129   DGILGFTCDVADE-ISVPIFCVRTISPCCLWIFFCLPKLIESGEYPFKDDNLDE-PLKSV  186

Query  566   KGMEDFLRVRDLSPFCRDEDLAVLYY----TEARLAVQARGLILNTFEDLEGPILSQIRT  733
              G E FLR RDL  FCR  DL   Y     TE +   +A GLILNTFE+L+ PIL+Q+RT
Sbjct  187   PGTETFLRRRDLPSFCRSGDLTDSYIQLLKTEGQENSRAHGLILNTFEELDEPILNQLRT  246

Query  734   KYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
               PN+Y IGPLHAHLK    +    SNSL  ED TC+ WL+ Q P SVIYVSFGSI+ +T
Sbjct  247   ICPNLYPIGPLHAHLKKKQTTLQPSSNSLWAEDRTCIDWLNDQLPNSVIYVSFGSIATMT  306

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
               QL+EFWYGLVNSG+KFLWV+R D +AG ++  S IP +L  GTK  GYIV WAPQE V
Sbjct  307   NDQLIEFWYGLVNSGQKFLWVIRPDSIAG-EEWRSKIPVDLATGTKERGYIVEWAPQEEV  365

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGF TH GWNS LES+  G PMICWP+F DQQ NSRFV +VW +GLDMKD CDR
Sbjct  366   LAHPAVGGFWTHCGWNSILESVYEGKPMICWPYFYDQQVNSRFVEKVWGIGLDMKDTCDR  425

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNE  1438
               VEK++++LM  RK EFLERA +M KLAK  + EGGSSY NFD L++D+  +++
Sbjct  426   EIVEKMVKDLMVLRKEEFLERANHMSKLAKNCLMEGGSSYSNFDRLVKDIKSLSD  480



>ref|XP_004150246.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Cucumis sativus]
 gb|KGN50613.1| hypothetical protein Csa_5G196560 [Cucumis sativus]
Length=476

 Score =   455 bits (1170),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 236/464 (51%), Positives = 307/464 (66%), Gaps = 10/464 (2%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             H+LIFPLP Q H+NSMLKLA LL +A   +TF    +  ++L   +DV S   RF T FR
Sbjct  9     HVLIFPLPFQGHINSMLKLAELLSIAGITVTFLNTPHFQSQLTRHSDVLSRFSRFPT-FR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
               +   G+      + E F ++  SL  I KP  + ++      G   TC + D  +   
Sbjct  68    FHTIIDGLPPDHPRTIEFFAQIISSLDSITKPIFRNWLVSGH-FGSNLTCVVLDGFLKNF  126

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +D  E+    P++ FR +SAC+ WTY   P L E G+LPI+G       IT + GME+ L
Sbjct  127   IDGDEDEVKQPIFGFRTVSACSVWTYLCAPHLIEDGQLPIRGEEDMDRMITNLPGMENLL  186

Query  587   RVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKY-PNVY  751
             R RDL   CR  D + +VL YT  + + + Q   LILN+FEDLEGPILS+IRT   PN+Y
Sbjct  187   RCRDLPGLCRVTDTNDSVLQYTLKQTQGSYQFHALILNSFEDLEGPILSKIRTNLCPNLY  246

Query  752   TIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLME  931
             TIGPLH+ LK  L+ ++   N+L + D TC+AWLD+Q P SVIYVSFGSI+V+  + LME
Sbjct  247   TIGPLHSLLKTKLSHETESLNNLWEVDRTCLAWLDNQPPGSVIYVSFGSITVMGNEGLME  306

Query  932   FWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAV  1111
             FW+GLVNSG+ FLWV+R DLV+GK+ E   IP++L+EGTK  GY+VGWAPQE VL H AV
Sbjct  307   FWHGLVNSGRNFLWVIRPDLVSGKNGEIE-IPADLEEGTKQRGYVVGWAPQEKVLSHEAV  365

Query  1112  GGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKL  1291
             GGFLTHSGWNSTLESI AG  M+CWP+ ADQQ NSRFV  VWK+G+DMKD+CDR  V K+
Sbjct  366   GGFLTHSGWNSTLESIVAGKAMVCWPYTADQQVNSRFVSNVWKLGVDMKDMCDREIVAKM  425

Query  1292  IRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             + E+M  RK EF   A  M  LA+ ++S GGSSY +FD L+ ++
Sbjct  426   VNEVMVNRKEEFKRSAIEMANLARRSVSLGGSSYADFDRLVNEI  469



>ref|XP_004239922.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=487

 Score =   455 bits (1170),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 306/470 (65%), Gaps = 17/470 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LIFPLP Q  +NSM KLA LL  +  HIT  +  NIH RL+  TD+ S RF     F+
Sbjct  10    HVLIFPLPLQGPVNSMFKLAELLCFSGLHITILLTENIHNRLVLHTDI-SSRFDQCPGFQ  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR-----DSGLP--FTCFIS  385
             +++   G+ D        F+E+ DSLR   K   K  +  +      D  +    +C I+
Sbjct  69    IKTISDGLPDDHPRDGGKFLEVFDSLRTKTKTLFKDMLTSDSLCVDVDGKVRGRVSCIIA  128

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
             D ++    DV++E  N+P++  R IS+C  W +F LP+L E+GE P K + +D  PI  V
Sbjct  129   DGVLGFTCDVADE-VNVPIFCVRTISSCCLWIFFCLPELIESGEYPFKDDNLDE-PIKSV  186

Query  566   KGMEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRT  733
              G E FLR RDL  FCR  DL      L+ TE R   +A GLILNTFE+L+ PIL+Q+RT
Sbjct  187   PGTETFLRRRDLPEFCRSGDLTDPNIQLFKTEGRENSRAYGLILNTFEELDQPILNQMRT  246

Query  734   KYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
               PN+Y IGPLHAHLK    +  + SNSL  ED TC+ WLD Q P SVIYVSFGSI+ +T
Sbjct  247   ICPNLYPIGPLHAHLKKKQTTLRSSSNSLWAEDRTCIDWLDDQLPNSVIYVSFGSIATMT  306

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
               QL+EFWYGLVNS + FLWV+R + + G ++  S +P +L +GTK  GYIV WAPQE V
Sbjct  307   NDQLIEFWYGLVNSKQNFLWVIRPNSI-GDEEWRSKMPVDLVKGTKERGYIVEWAPQEEV  365

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGF TH GWNS LES+  G PMICWP+F DQQ NSRFV +VW +GLDMKD CDR
Sbjct  366   LAHPAVGGFWTHCGWNSILESVYEGKPMICWPYFFDQQVNSRFVEKVWGLGLDMKDTCDR  425

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
               VEK++++LM  RK EFL RA +M KLAK  + EGGSSY NFD L++D+
Sbjct  426   EIVEKMVKDLMVLRKQEFLGRANHMSKLAKNCLMEGGSSYSNFDRLVKDI  475



>ref|XP_009613526.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=498

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 233/474 (49%), Positives = 306/474 (65%), Gaps = 19/474 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTT--  217
             + H+LIFPLP Q  +N MLKLA L  L  + H+TF    +I  RLL  TDV   RF    
Sbjct  24    VPHVLIFPLPLQGPVNCMLKLAELFCLHQDIHVTFLNSEHIQQRLLNCTDVQI-RFKKYP  82

Query  218   RFRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR---DSGLPFTCFISD  388
              F++ + P G+ +    + +    L   +  +  P  ++ +       +S  P TC + D
Sbjct  83    NFKIMTIPDGLPEDNPRTGDQVRNLVKGVEDVSSPLFREMVTSGSLSPNSEKPVTCLLVD  142

Query  389   LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVK  568
              +   A+D++EE   +P+ YF  IS CA WTY  +P L EAGE+P KGN +D+  +  V 
Sbjct  143   GIFPFAVDIAEE-IGIPLLYFDTISPCALWTYLCIPKLIEAGEIPFKGNDLDAL-VNNVP  200

Query  569   GMEDFLRVRDLSPFCRDEDL----AVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTK  736
             GME  +R RDL  FCR  DL       +  E +   QA+GLI NTFE LEGPILSQ R  
Sbjct  201   GMEGVIRRRDLPSFCRVPDLDNPTLQFFIKEGKHIFQAQGLIFNTFEGLEGPILSQFRAV  260

Query  737   YPNVYTIGPLHAHLKATLASK-----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSI  901
              PN+Y++GPLH HLK +L+SK     ++ SNS+ +ED +CM WLD    KSV++VS GS+
Sbjct  261   CPNIYSVGPLHIHLKKSLSSKCSVPKTSLSNSIWKEDMSCMHWLDEHPKKSVLFVSIGSL  320

Query  902   SVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAP  1081
             + I++ Q +E WYGLVNS  +FLWV R   V G + E + +P EL + TK  G IV WAP
Sbjct  321   ATISKAQFLEIWYGLVNSKTRFLWVQRPGSVIGLE-ENNDVPVELSKSTKERGCIVSWAP  379

Query  1082  QEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKD  1261
             QE VL H +VGGFLTHSGWNSTLESI  GVPMICWP+F DQQ NSR+VGEVWK+GLDMKD
Sbjct  380   QEEVLAHPSVGGFLTHSGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKD  439

Query  1262  VCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             +CDR+ VEK++RE+ME RK EFLER   M  LA E+++EGGSSY + D L++D+
Sbjct  440   ICDRAIVEKMVREMMEVRKIEFLERVREMRNLAIESVNEGGSSYKDLDRLVEDI  493



>ref|XP_011076757.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=489

 Score =   452 bits (1164),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 241/480 (50%), Positives = 300/480 (63%), Gaps = 19/480 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALT--DVDSGRFTTRFR  226
             H+LIFPLP Q  +N MLKLA LL L    +TF    +I  RL   T  +V   R++  FR
Sbjct  10    HVLIFPLPLQGPVNCMLKLAELLCLGQIQVTFLNTLHIQERLRNCTGAEVYFKRYSN-FR  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN---RDSGLPFTCFISDLLV  397
               + P G+ +    + +    L  S+  +  P  +  +        S  P TC I+D + 
Sbjct  69    FDTVPDGLPEENPRTADEIWNLLQSIDAVAVPIFRCMVTSGVYGPGSENPVTCIIADGIF  128

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             + A  ++ E   +P+ YF  IS C  WTY  LP L EAGE P K + +D   I    GME
Sbjct  129   TFAAGIAGE-IGVPLLYFDTISPCGLWTYLCLPKLIEAGEFPFKDDNLDEI-IRNAPGME  186

Query  578   DFLRVRDLSPFCRDEDL----AVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
               +R RDL  F R  D+      L   E +    A+GLI NTFE+LE PILSQ+    PN
Sbjct  187   GIIRRRDLPSFYRTNDVNHVTIQLVLKEDKHIPLAQGLIFNTFEELEAPILSQMLNVCPN  246

Query  746   VYTIGPLHAHLKATLASKS-------THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
             +Y +GPLHAHLK  LA+++         SNS+ +ED +C++WLD+Q  KSVIYVS GS++
Sbjct  247   IYAVGPLHAHLKTRLAAETGPEAQPTITSNSIWREDSSCISWLDTQPSKSVIYVSIGSLA  306

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
             VIT+ QL E W+GLVNSG +FLWV R   V G D E   IPSEL  GTK  GYIV WAPQ
Sbjct  307   VITKDQLFEIWHGLVNSGSRFLWVRRPGSVTGLDSETEEIPSELSRGTKERGYIVTWAPQ  366

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             + VL H A+GGFLTHSGWNSTLESI  G PMICWP+F DQQ NSR+VGEVWK+GLDMKD 
Sbjct  367   DEVLGHPAIGGFLTHSGWNSTLESIVEGKPMICWPYFVDQQVNSRYVGEVWKLGLDMKDT  426

Query  1265  CDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEAT  1444
             CDR  VEK+IRELME RK EFLERA+ M KLAK ++SEGGSSY + D LI D+  +N  T
Sbjct  427   CDRVVVEKMIRELMESRKNEFLERADEMAKLAKASVSEGGSSYADLDRLIDDIKFMNIPT  486



>ref|XP_006355680.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=482

 Score =   452 bits (1163),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 239/475 (50%), Positives = 304/475 (64%), Gaps = 17/475 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LIFPLP Q  +NSM KLA LL  +  HIT  +  NIH RL+  TD+ S RF     F+
Sbjct  10    HVLIFPLPLQGPVNSMFKLAELLCFSGLHITILLTENIHNRLVLHTDITS-RFDQCPGFQ  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR-------DSGLPFTCFIS  385
             +++   G+ D        F+E+ DSLR   K   K  +  +              +C I+
Sbjct  69    IKTISDGLPDDHPRDGGKFIEVFDSLRTKTKTLFKDMLTSDMLCFDLDGKERRRVSCIIA  128

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
             D +     DV++E  ++P++  R IS C  W +F LP L E+GE P + + +D  P+  V
Sbjct  129   DGVWGFTCDVADE-ISVPIFCVRTISPCCLWIFFCLPKLIESGEYPFEDDNLDE-PLKSV  186

Query  566   KGMEDFLRVRDLSPFCRDEDLAVLYY----TEARLAVQARGLILNTFEDLEGPILSQIRT  733
              G E FLR RDL  FCR  DL   Y     TE +   +A GLILNTFE+L+ PIL+Q+RT
Sbjct  187   PGTETFLRRRDLPSFCRSGDLTDSYIQLLKTEGQENSRAHGLILNTFEELDEPILNQLRT  246

Query  734   KYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
               PN+Y IGPLHAHLK    +    SNSL  ED TC+ WL+ Q P SVIYVSFGSI+ +T
Sbjct  247   ICPNLYPIGPLHAHLKKKQTTLRPSSNSLWAEDRTCIDWLNDQLPNSVIYVSFGSIATMT  306

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
               QL+EFWYGLVNSG+KFLWV+R D +AG ++  S IP +L  GTK  GYIV WAPQE V
Sbjct  307   NDQLIEFWYGLVNSGQKFLWVIRPDSIAG-EEWRSKIPVDLATGTKERGYIVEWAPQEEV  365

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGF TH GWNS LES+  G PMICWP+F DQQ NSRFV +VW +GLDMKD CDR
Sbjct  366   LAHPAVGGFWTHCGWNSILESVYEGKPMICWPYFFDQQVNSRFVEKVWGIGLDMKDTCDR  425

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNE  1438
               VEK++++LM  RK EFL RA +M KLAK  + EGGSSY NFD L++D+  +++
Sbjct  426   EIVEKMVKDLMVLRKEEFLGRANHMSKLAKNCLMEGGSSYSNFDRLVKDIKSLSD  480



>ref|XP_004149949.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
 gb|KGN50608.1| hypothetical protein Csa_5G190520 [Cucumis sativus]
Length=478

 Score =   452 bits (1162),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 243/468 (52%), Positives = 305/468 (65%), Gaps = 21/468 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LIFP PAQ H+NSMLKLA LL L+   ITF     IH +L   TD+ S RF+    F+
Sbjct  9     HVLIFPFPAQGHVNSMLKLAELLTLSGLRITFLNILRIHQKLTLHTDIQS-RFSRFPNFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+ D  L  K  F +L DSL+ I  P LKQ +        P TC I D L +  
Sbjct  68    FQTITDGL-DNRLIDK--FSDLIDSLKSITMPLLKQMLLSGEFGPTP-TCIILDGLFNFI  123

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +DV     N+PV+ FR ISAC+F  Y  +P L E G+LPIKG       I+ + GME+ L
Sbjct  124   VDVDAHP-NIPVFSFRTISACSFSAYSFVPKLIEDGQLPIKGEEDMDRIISGMGGMENVL  182

Query  587   RVRDLSPFCRDEDL--AVLYY--TEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR ED     L +  T+   + ++R LI NTF DLEGPILS +R++  N+Y 
Sbjct  183   RCRDLPSFCRLEDPFDPGLQHGVTQTIQSFKSRALIFNTFNDLEGPILSSLRSRCSNIYA  242

Query  755   IGPLHAHLKATLA-----SKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             IGPLHAHLK  L+     + S  SN L + D +C+AWLD   PKSVIYVSFGS+ VI   
Sbjct  243   IGPLHAHLKTRLSGEISPASSVSSNGLWEVDRSCLAWLDDHPPKSVIYVSFGSVVVIGDD  302

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             Q  EFW+GLVNSGK+FLWVMR + +AGKD     +P++LKE T   GYIV WAPQE VL 
Sbjct  303   QFREFWHGLVNSGKRFLWVMRPNSLAGKDG----VPADLKEKTNERGYIVDWAPQEEVLA  358

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H A+G FLTHSGWNSTLESI AGVPMICWP FADQQTNSR+V +VWK+GLDMKDVC+R +
Sbjct  359   HKAIGAFLTHSGWNSTLESIVAGVPMICWPQFADQQTNSRYVSDVWKIGLDMKDVCNRET  418

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             V K++ ++ME RK E +     M + A  ++ EGGSSYC+ + +I D+
Sbjct  419   VTKMVNDVMENRKNELMGSVIEMAESAITSVEEGGSSYCDLERMINDI  466



>emb|CDP19643.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   451 bits (1160),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 231/457 (51%), Positives = 311/457 (68%), Gaps = 21/457 (5%)
 Frame = +2

Query  98    MLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFRLQSFPPGIYDGALNS  271
             ML+LA LL LA   +T+ V    H RLL  T+V S   R+   F  Q+   G+ D    +
Sbjct  1     MLRLAELLCLAGLDVTYIVSDFCHNRLLTHTNVSSHFARYPG-FSFQTISDGLPDDHPRA  59

Query  272   KEVFVELCDSLRRIGKPFLKQYIAQN---RDSGL--PFTCFISDLLVSIALDVSEECFNL  436
              E FV++  +++ +  P  K+ + +      SG   P TC I+D ++S A D +EE   +
Sbjct  60    GEGFVDIMPAIKMVTGPLFKRMMIEKGCFASSGTRSPVTCIIADGVLSFAGDFAEEN-GI  118

Query  437   PVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCR  616
              + YFR +SAC+FW  F +P + EAGE+P+KG+G++ + +  V GME+ LR RDL  F R
Sbjct  119   ALIYFRTVSACSFWACFCMPQVIEAGEIPLKGHGMELA-VKSVPGMENILRRRDLPGFYR  177

Query  617   DEDLAVLYY----TEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKA  784
              +DL    +    TE +   +A+ +ILNTFEDLEGPILS IR   P +YTIGP H HL A
Sbjct  178   VDDLDDTTFQIIKTETQQTPRAQAVILNTFEDLEGPILSHIRKHMPRLYTIGPNHFHLTA  237

Query  785   TLASKSTH------SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGL  946
              L +K+T       S SL +ED +C+ WLDSQ PKSVIYVSFGSI+++ R+QL+EFWYGL
Sbjct  238   RLGAKATETETLISSASLWEEDRSCLDWLDSQPPKSVIYVSFGSITIVRREQLLEFWYGL  297

Query  947   VNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLT  1126
             VNSG++FLWV+R D + G+      IP+EL+  TKA GY+VGWAPQ  VL+H +VGGFLT
Sbjct  298   VNSGQRFLWVVRPDSIMGEAGG-GKIPAELETATKARGYMVGWAPQLEVLNHPSVGGFLT  356

Query  1127  HSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELM  1306
             H GWNSTLES+AAGVPM+CWP+FADQ  NSRFV E+WK+GLDMKD CDR  ++K++ ELM
Sbjct  357   HGGWNSTLESMAAGVPMLCWPYFADQTINSRFVSEIWKIGLDMKDTCDRVIIQKMVAELM  416

Query  1307  EKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
               RK EFL RA+ M KLA++A+++GG+SY N D L++
Sbjct  417   HARKDEFLRRADAMAKLARKAVTQGGTSYNNLDSLVE  453



>ref|XP_006355163.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Solanum tuberosum]
Length=471

 Score =   447 bits (1151),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/467 (48%), Positives = 310/467 (66%), Gaps = 11/467 (2%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTT--  217
             + H+ IFPLP Q  +N MLKLA LL L    H+TF     IH RLL  TDV   RF    
Sbjct  3     VPHVFIFPLPLQGPVNCMLKLAELLCLHQEIHVTFINTEYIHQRLLNYTDV-LIRFAKYP  61

Query  218   RFRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLV  397
              F+  + P G+ +    + E   ++ + + ++  P  ++ +     +    TC I D + 
Sbjct  62    NFKFVTIPDGLPEDNPRNGEQVGKIIEGVEKVSSPLFREMVMMTTTNYCAPTCLIVDGIF  121

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             + A+D++++   +P+ YF  IS CA WTY ++P L E GE+P KGN +D+  +  V GME
Sbjct  122   TFAVDIAKDA-KIPLLYFDTISPCAIWTYLAVPKLIEDGEIPFKGNDLDAL-VNSVSGME  179

Query  578   DFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
               +R RDL  +CR  D D+ ++ +   + +  VQA+ LILNTFE LEGPILSQ R   PN
Sbjct  180   GVMRRRDLPSYCRATDLDIPIIQHIIKQGKHIVQAQALILNTFEALEGPILSQFRALCPN  239

Query  746   VYTIGPLHAHLKATLASKS-THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             +Y IGPLH  +KA LAS+S   SNSL +ED +C+ WL+ Q  KSV++VS GS++ +++ Q
Sbjct  240   IYAIGPLHTQMKAKLASQSLPTSNSLWKEDMSCIDWLNKQPNKSVLFVSIGSLATMSKAQ  299

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
              +EFWYGLVNS  +FLWV R   + G +D++  +P EL E TK  G IV WAPQE VL H
Sbjct  300   FLEFWYGLVNSKTRFLWVQRPGSIIGLEDDDINVPMELVESTKERGCIVSWAPQEEVLAH  359

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              ++GGFLTH GWNSTLESIA GVPMICWP+F DQQ NSR+VGEVWK+GLDMKDVCDR+++
Sbjct  360   PSIGGFLTHCGWNSTLESIAEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKDVCDRATI  419

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             E+++ E+M+ +K EFLERA+ M  LA  ++ EGG+SY + + LI+D+
Sbjct  420   ERMVIEVMDVKKIEFLERAKQMSNLAIASVGEGGASYQDLERLIEDI  466



>ref|XP_006367215.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=472

 Score =   447 bits (1150),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/470 (48%), Positives = 310/470 (66%), Gaps = 16/470 (3%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTT--  217
             + H+ IFPLP Q  +N MLKLA LL L    HITF     IH RL+  T+V   RF    
Sbjct  3     VPHVFIFPLPLQGPVNCMLKLAELLCLHQEIHITFINTEYIHQRLMNYTNV-LVRFEKYP  61

Query  218   RFRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLV  397
              F+  + P G+ +  L + E   ++ + + ++  P  ++ +  +       TC I D + 
Sbjct  62    NFKFVTVPDGLPEDNLRNGEQVEKIIEGVEKVSSPLFREMVMMSTTCAP--TCLIVDGIF  119

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             + A+D+++E   +P+ YF  IS C+ WTY ++P L E GE+P KGN +D   +  V GME
Sbjct  120   TFAVDIAKEA-KIPLLYFDTISPCSLWTYLAVPKLIEDGEIPFKGNDLDVL-VNGVAGME  177

Query  578   DFLRVRDLSPFCRDEDLAV----LYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
               +R RDL  FCR  D+ +    L   + +  VQA+GLI NTFEDLEGPILSQ R   PN
Sbjct  178   GVMRRRDLPSFCRTPDIDIPVIKLVIKQGKHIVQAQGLIFNTFEDLEGPILSQFRALCPN  237

Query  746   VYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
             +Y IGPLH  +KA L+S+    +  SNS+ +ED +C+ WLD Q  KSVI+VS GS++ ++
Sbjct  238   IYAIGPLHTQMKAKLSSQYLPNTPTSNSIWKEDMSCIDWLDKQPNKSVIFVSIGSLATMS  297

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             + Q +EFWYGLVNS  +FLWV R   + G +D+ + +P EL + TK  G I+ WAPQE V
Sbjct  298   KAQFLEFWYGLVNSKTRFLWVQRPGSIIGLEDDNNNVPMELVKSTKERGCIISWAPQEEV  357

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H ++GGFLTHSGWNSTLESI  GVPMIC P+F DQQ NSR+VGEVWK+GLDMKDVCDR
Sbjct  358   LAHPSIGGFLTHSGWNSTLESIVEGVPMICVPYFVDQQVNSRYVGEVWKLGLDMKDVCDR  417

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             +++E+++R++M+ +K EFLERA++M  LA  ++ EGGSSY + D LI+D+
Sbjct  418   ATIERMVRDVMDVKKIEFLERAKHMSDLAIASVGEGGSSYQDLDRLIEDI  467



>ref|XP_011084983.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=524

 Score =   449 bits (1154),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 240/484 (50%), Positives = 315/484 (65%), Gaps = 33/484 (7%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             HILIFP+P Q H+NSML LA LL L+  H+T  +    H RLL    + S RF+  + FR
Sbjct  38    HILIFPVPLQGHVNSMLNLAELLCLSGLHVTILLSDYTHNRLLRHATLRS-RFSRHSGFR  96

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLP-------FTCFIS  385
             + +   G+        E  V++  SL++IG    ++ +      GL         +C I 
Sbjct  97    VATISDGLPPDHPRVGERIVDMALSLKQIGGSQFRRLMEST--DGLSEGGAMRRVSCLIM  154

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP----  553
             D ++S A+ V EE   +P  YFR ISACAFW YF + ++ +AGE+P++G   D       
Sbjct  155   DGVLSFAISVVEE-MGIPYIYFRTISACAFWPYFCIQEIMDAGEVPLRGKNEDKLTYWKK  213

Query  554   ------ITKVKGMEDFLRVRDLSPF----CRDEDLAVLYYTEARLAVQARGLILNTFEDL  703
                   +T V GME FLR RD+  F      D+       T+ +  V+A GLILNTFEDL
Sbjct  214   KEMDMMVTSVPGMERFLRRRDIPRFFGVANADDPTFKTMKTDTKKTVEACGLILNTFEDL  273

Query  704   EGPILSQIRTKYPNVYTIGPLHAHLKATLASKS-----THSNSLLQEDETCMAWLDSQEP  868
             EGPIL +IR   PN+Y+IGPLHA LKA L SK       HS+S  +ED +C+AWLDSQ  
Sbjct  274   EGPILDEIRKHIPNLYSIGPLHALLKAQLESKGMESSHNHSSSFWEEDRSCIAWLDSQPT  333

Query  869   KSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEE-SPIPSELKEG  1045
              SVIYVSFGSI+++TR +L+EFWYGLVNSG +FLWV+R D + G + E  + IP EL+EG
Sbjct  334   CSVIYVSFGSITILTRDELLEFWYGLVNSGHRFLWVIRPDSIVGNNSENWNEIPVELEEG  393

Query  1046  TKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFV  1225
             TK+ G +VGW PQ+ VL H A+G F THSGWNSTLESIA G+PMICW +FADQ TNSRFV
Sbjct  394   TKSRGCMVGWVPQQEVLAHPAIGAFFTHSGWNSTLESIAIGLPMICWAYFADQTTNSRFV  453

Query  1226  GEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFD  1405
              +VWK+GLDMKD CDR  VEK+++++M+ R+ EFLERA +M  L+ +AISEGGSSY N +
Sbjct  454   SKVWKIGLDMKDTCDRIIVEKMVKDVMDVRRDEFLERAHSMAVLSGKAISEGGSSYLNLN  513

Query  1406  CLIQ  1417
              L++
Sbjct  514   RLVE  517



>ref|XP_004171873.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
Length=478

 Score =   447 bits (1149),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 243/477 (51%), Positives = 309/477 (65%), Gaps = 21/477 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LIFP PAQ H+NSMLKLA LL L+   ITF     IH +L   TD+ S RF+    F+
Sbjct  9     HVLIFPFPAQGHVNSMLKLAELLTLSGLRITFLNILRIHQKLTLHTDIQS-RFSRFPNFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+ D  L  K  F +L DSL+ I  P LKQ +        P TC I D L +  
Sbjct  68    FQTITDGL-DNRLIDK--FSDLIDSLKSITMPLLKQMLLSGEFGPTP-TCIILDGLFNFI  123

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +DV     N+PV+ FR ISAC+F  Y  +P L E G+LPIKG       I+ + GME+ L
Sbjct  124   VDVDAHP-NIPVFSFRTISACSFSAYSFVPKLIEDGQLPIKGEEDMDRIISGMGGMENVL  182

Query  587   RVRDLSPFCRDEDL--AVLYY--TEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR ED     L +  T+   + ++R LI NTF DLEGPILS +R++  N+Y 
Sbjct  183   RCRDLPSFCRLEDPFDPGLQHGVTQTIQSFKSRALIFNTFNDLEGPILSCLRSRCSNIYA  242

Query  755   IGPLHAHLKATLA-----SKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             IGPLHAHLK  L+     + S  SN L + + +C+AWLD   PKSVIYVSFGS+ VI   
Sbjct  243   IGPLHAHLKTRLSGEISPASSGSSNGLWEVNRSCLAWLDDHPPKSVIYVSFGSVVVIGDD  302

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             Q  EFW+GLVNSGK+FLWV+R + +AGKD     +P++LKE T   GYIV WAPQE VL 
Sbjct  303   QFREFWHGLVNSGKRFLWVVRPNSLAGKDG----VPADLKEKTNERGYIVDWAPQEEVLA  358

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H A+G FLTHSGWNSTLESI AGVPMICWP FADQQTNSR+V +VWK+GLDMKDVC+R +
Sbjct  359   HKAIGAFLTHSGWNSTLESIVAGVPMICWPQFADQQTNSRYVSDVWKIGLDMKDVCNRET  418

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATRE  1450
             V K++ ++ME RK E +     M + A  ++ EGGSSYC+ + +I D+  + +  RE
Sbjct  419   VTKMVNDVMENRKNELMGSVIEMAESAITSVEEGGSSYCDLERMINDIRLLCKRQRE  475



>ref|XP_006367216.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=474

 Score =   446 bits (1148),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 221/470 (47%), Positives = 309/470 (66%), Gaps = 14/470 (3%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTT--  217
             + H+ IFPLP Q  +N MLKLA LL L    HITF     IH RL+  TDV   RF    
Sbjct  3     VPHVFIFPLPLQGTVNCMLKLAELLCLHQEIHITFINTEYIHQRLMNYTDV-LVRFEKYP  61

Query  218   RFRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLV  397
              F+  + P G+ +    + +   ++ + + ++  P  ++ +     +    TC I D + 
Sbjct  62    NFKFVTVPDGLPEDNPRNGDQIGKIIEGVEKVSSPLFREMVMMTTTNYCTPTCLIVDGIF  121

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             S A+D+++E   +P+ YF  IS C+ WTY ++P L E GE+P KGN +D+  +  V GME
Sbjct  122   SFAVDIAKEA-KIPLLYFDTISPCSLWTYLAVPKLIEDGEIPFKGNDLDAL-VNGVAGME  179

Query  578   DFLRVRDLSPFCRDEDLAV----LYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
               +R RDL  FCR  DL +    L   + +  VQA+GLI NTFEDLEGPILSQ R   PN
Sbjct  180   GVMRRRDLPSFCRTPDLDIPIIKLVIKQGKHIVQAQGLIFNTFEDLEGPILSQFRALCPN  239

Query  746   VYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
             +Y IGPLH  +KA L+S+    +  SNS+ +ED +C+ WL+ Q  KSV++VS GS++ ++
Sbjct  240   IYAIGPLHTQMKANLSSQYLPNTPTSNSIWKEDMSCIDWLNKQPNKSVLFVSIGSLATMS  299

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             + Q +EFWYGLVNS  +FLWV R   + G +D+ + +P EL + TK  G I+ WAPQE V
Sbjct  300   KAQFLEFWYGLVNSKTRFLWVQRPGSIIGLEDDNNNVPMELVKSTKERGCIISWAPQEKV  359

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H ++GGFLTHSGWNSTLESI  GVPMICWP+F DQQ NSR+VGEVWK+G+DMKDVCDR
Sbjct  360   LAHPSIGGFLTHSGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGIDMKDVCDR  419

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             +++E+++ ++M+  K EFLE+A++M  LA  ++ EGGSSY + D LI+D+
Sbjct  420   ATIERMVIQVMDVEKIEFLEKAKHMSDLAIASVGEGGSSYQDLDRLIEDI  469



>emb|CBI31575.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   445 bits (1144),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 234/469 (50%), Positives = 302/469 (64%), Gaps = 36/469 (8%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFP PAQ H+NSMLKLA LL +A  H+TF        RLL  TD+ + RF+    FR
Sbjct  9     HVLIFPFPAQGHVNSMLKLAELLSVAGLHVTFLNSEYNQHRLLLHTDIQT-RFSGYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLLV  397
              Q+   G+      + E  ++L + L+   KP  ++ +    Q  D+  P  C I+D ++
Sbjct  68    FQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIM  127

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             S  +D++ E   +P+  FR ISAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  128   SFTIDIANEV-GIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  578   DFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
              FLR RDL    R    D++  +L   E +   +A  LILNTFEDLEGPIL QIR   P 
Sbjct  186   GFLRKRDLPSLIRVSNLDDEGLLLVMKETQQTPRAHALILNTFEDLEGPILGQIRNHCPK  245

Query  746   VYTIGPLHAHLKATLASKST---HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             +YTIGPLHAHLK  LAS+ST    SNS  QED +C+AWLD Q  KSVIYVSFGS++VI+R
Sbjct  246   IYTIGPLHAHLKTRLASESTTSQSSNSFRQEDRSCIAWLDHQPSKSVIYVSFGSLTVISR  305

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +QL+EF +GLVNSG +FLWV+R+D +A ++D E   P+EL EG K   YIV         
Sbjct  306   KQLIEFCHGLVNSGSRFLWVIRTDSLA-EEDGEHQTPAELMEGAKERSYIV---------  355

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
                         GWNSTLESI AGVPMICWP+FADQQ NSRFV  VWK+G DMKD CDR 
Sbjct  356   -----------DGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSDMKDTCDRL  404

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              VEK++R+LME+RK E L+ A+ M   A++ +SEGGSSYCN   L+ ++
Sbjct  405   IVEKMVRDLMEERKDELLKTADKMATRARKCVSEGGSSYCNLSSLVDEI  453



>ref|XP_011084985.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=495

 Score =   444 bits (1141),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 239/481 (50%), Positives = 313/481 (65%), Gaps = 31/481 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             HILIFPLP Q H+NSML LA LL L+  H+T  + +  H RLL    + S   R +  FR
Sbjct  13    HILIFPLPLQGHVNSMLNLAELLCLSGLHVTILLSNYAHNRLLRHASLRSLFSRHSG-FR  71

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN---RDSGL--PFTCFISDL  391
             + +F  G+      + E  ++L  SL+ +G    ++ +       D G     +C I D 
Sbjct  72    VATFSDGLPADHPRAGERLMDLAFSLKELGGSQFRRLMESTDGLSDGGARRGVSCLIIDG  131

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP------  553
             L+S  + V EE   +P  YFR I AC+FW +F + ++ +AGE+P+KG   D         
Sbjct  132   LLSFIISVVEE-MGIPYIYFRTIGACSFWPHFCIQEIIDAGEVPLKGKNEDKLTYWKKKE  190

Query  554   ----ITKVKGMEDFLRVRDL----SPFCRDEDLAVLYYTEARLAVQARGLILNTFEDLEG  709
                 +T V GME  LR RD+         D+       T+ +  V+A GLILNTFEDLE 
Sbjct  191   MDMMVTSVPGMEKVLRRRDIPRSFGVANGDDPTFKTMKTDTKRTVEACGLILNTFEDLEA  250

Query  710   PILSQIRTKYPNVYTIGPLHAHLKATLASK---STH--SNSLLQEDETCMAWLDSQEPKS  874
             PIL QIR   PN+Y+IGP+HA LK  L S+   S+H  S+SL +ED +C+AWLDSQ   S
Sbjct  251   PILDQIRKHIPNLYSIGPIHALLKDRLESEGMESSHNYSSSLWEEDRSCIAWLDSQPTCS  310

Query  875   VIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKA  1054
             VIYVSFGSI+ +TR +L+EFWYGLVNSG KFLWVMR D ++G  +E   IP EL+EGTK+
Sbjct  311   VIYVSFGSITTLTRDELLEFWYGLVNSGHKFLWVMRPDSISGNGNE---IPVELEEGTKS  367

Query  1055  NGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEV  1234
              G++VGW PQ+ VL H A+G F THSGWNST+ESIA G+PM+CWP+FADQ TNSRFV EV
Sbjct  368   RGWMVGWVPQQEVLAHPAIGAFFTHSGWNSTIESIAIGLPMLCWPYFADQMTNSRFVSEV  427

Query  1235  WKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             WKVGLDMKD CDR +VEK+++E M+ R+ EF +RA NM  LA++AISEGG+SY N + LI
Sbjct  428   WKVGLDMKDTCDRITVEKMVKEAMDVRRDEFSKRAHNMAMLARKAISEGGTSYLNLNRLI  487

Query  1415  Q  1417
             +
Sbjct  488   E  488



>ref|XP_007158359.1| hypothetical protein PHAVU_002G146200g [Phaseolus vulgaris]
 gb|ESW30353.1| hypothetical protein PHAVU_002G146200g [Phaseolus vulgaris]
Length=482

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 237/486 (49%), Positives = 307/486 (63%), Gaps = 28/486 (6%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVD--SGRFTT-R  220
              H+LIFPLP  +H+ SMLKLA LL L N HITF     IH RL    D+   S  + T  
Sbjct  4     AHVLIFPLPVSAHVASMLKLAELLTLENLHITFLTTDTIHGRLTRFGDIQVLSKSYPTLH  63

Query  221   FRL--QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISD-L  391
             F+    S+  G + G     +   +L  S     KPFL+  +  +       +C I D +
Sbjct  64    FKTLSDSYDEGDHPGF---GDRIWDLISSTTLHAKPFLRDILLSHTPQIPKLSCVIQDGI  120

Query  392   LVSIALDVSEECFN--LPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
               S++ DV+ E FN  +P+  FR +SAC FW Y S  +L  + ELPI+G+      I  +
Sbjct  121   FGSLSADVASE-FNVSIPIIQFRTVSACCFWAYISATNLLHSQELPIRGDEDMDRIIKDI  179

Query  566   KGMEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRT  733
              GME+ LR RDL  F R +         Y   +R ++ A  +I+N+FEDLEGP+LSQIR 
Sbjct  180   PGMENLLRCRDLPSFFRPDKKGNSTFESYVDRSRQSLAADAIIVNSFEDLEGPVLSQIRH  239

Query  734   KYPNVYTIGPLHAHLKATLASKST------HSNSLLQEDETCMAWLDSQEPKSVIYVSFG  895
              +P VYT+GPLH HL    A  +         N++ Q D TCM WLD+Q   SV+YVSFG
Sbjct  240   HFPKVYTVGPLHHHLNTRKAESNKGEDIPKFKNAIFQVDGTCMTWLDAQPEGSVMYVSFG  299

Query  896   SISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGW  1075
             S +++ R+ LME W+GLVNS K+FLWVMR D+VAGK D++  IP+E++EGTK  G+IV W
Sbjct  300   SSTIVKREDLMEIWHGLVNSKKRFLWVMRPDIVAGKQDDDR-IPAEVEEGTKERGFIVEW  358

Query  1076  APQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDM  1255
             APQE VL+H A+GGFLTHSGWNSTLES+ AGVPMICWP+FADQQ NSRFV EVWKVGLDM
Sbjct  359   APQEEVLEHKAIGGFLTHSGWNSTLESVVAGVPMICWPYFADQQINSRFVSEVWKVGLDM  418

Query  1256  KDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIK-V  1432
             KDVCDR  VEK++ +LM  R+ EFL  A+ M  LA +++S GGSSY +F    QD I  +
Sbjct  419   KDVCDRDVVEKMVNDLMVHRREEFLNSAKAMATLAHKSVSPGGSSYSSF----QDFIHYI  474

Query  1433  NEATRE  1450
                +RE
Sbjct  475   KSGSRE  480



>ref|XP_003517688.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Glycine max]
Length=481

 Score =   443 bits (1139),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 231/473 (49%), Positives = 301/473 (64%), Gaps = 22/473 (5%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS-GRFTTRFR  226
              H+LIFPLP   HL SMLKLA LL L N H+TF    NIH RL    D+           
Sbjct  4     AHVLIFPLPLPGHLGSMLKLAELLALDNIHVTFVDTENIHIRLTRFGDIQELSECYPTLH  63

Query  227   LQSFP-----PGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLP-FTCFISD  388
              ++ P      G + G  +    F+    S  +  KPFL+  +      G+P  +C I D
Sbjct  64    FKTIPDCYDEEGEHPGFGDRVGDFIT---STAQHAKPFLRDILVSQHSPGIPKVSCIIQD  120

Query  389   -LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
              +  +++ D + E   +P+ +FR +S+C FW YF +P L +  ELPIKG       I  +
Sbjct  121   GIFGALSSDFAAE-LRIPLIHFRTVSSCCFWAYFCVPKLLDCKELPIKGEEDMDRIIRNM  179

Query  566   KGMEDFLRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTK  736
              GME+ LR RDL  FCR   + +         R ++ A  L+LNTFEDLEG +LSQ+   
Sbjct  180   PGMENLLRCRDLPSFCRPNTEGNFLEWAVFRTRQSLAADALMLNTFEDLEGSVLSQMGQH  239

Query  737   YPNVYTIGPLHAHLKATLASKS------THSNSLLQEDETCMAWLDSQEPKSVIYVSFGS  898
             +P +YTIGP+H HLK   A  +      T  NSL Q D +CMAWL++Q   SVIYVSFGS
Sbjct  240   FPKLYTIGPIHHHLKIRKAESNKAKDIPTFKNSLFQVDRSCMAWLEAQPQGSVIYVSFGS  299

Query  899   ISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWA  1078
              +++ R+ LME W+GLVNS K+FLWVMR D+VA KD+++  IP+E++EGT+  G IVGWA
Sbjct  300   STIVKREDLMEIWHGLVNSKKRFLWVMRPDIVAAKDNDDR-IPAEVEEGTRERGLIVGWA  358

Query  1079  PQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMK  1258
             PQE VL H AVGGF TH+GWNSTL+S+ AGVPMICWP+FADQQ NSRFV EVWK+GLDMK
Sbjct  359   PQEDVLAHKAVGGFFTHNGWNSTLDSVVAGVPMICWPYFADQQINSRFVSEVWKLGLDMK  418

Query  1259  DVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             DVCDR  VEK++ +LM  RK EFL+ A+ M  LA ++++ GGSSY +FD LIQ
Sbjct  419   DVCDRHVVEKMVNDLMVHRKEEFLKSAQEMAMLAHKSVTPGGSSYSSFDDLIQ  471



>gb|KDO61155.1| hypothetical protein CISIN_1g037374mg [Citrus sinensis]
Length=463

 Score =   439 bits (1130),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 235/464 (51%), Positives = 301/464 (65%), Gaps = 23/464 (5%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RF  223
              H++IFPLP   H+NSMLKLA LL  A   ITF      + R++  +     R+      
Sbjct  7     AHVVIFPLPGVGHVNSMLKLAELLSHAGIKITFLNTEYYYDRVIRHSSDGFSRYMQIPGL  66

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSI  403
             +L++   G+      + + F EL DSL     P LK+ +    DS  P    I+D  +S 
Sbjct  67    QLKTVTDGLPKDHPRTPDKFTELIDSLNLAIPPLLKEMVT---DSNSPVNYIIADGYMSH  123

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
             A+DV+ E   + + YF  +SACAFW++  +P++  AGELPIKG       IT V GME F
Sbjct  124   AIDVAREV-GISIIYFCTVSACAFWSFHCIPNIIIAGELPIKGTEDMDRLITNVTGMEGF  182

Query  584   LRVRDLSPFCRDE---DLAVLYYT-EARLAVQARGLILNTFEDLEGPILSQIRTKYPNVY  751
             LR RDL  FCR     DL +L +  E RL+V+A GLILNTFEDLEGPI            
Sbjct  183   LRCRDLPSFCRVNNPMDLQLLLFARETRLSVRAGGLILNTFEDLEGPIF-----------  231

Query  752   TIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLME  931
              IGPL+AHLK  +  K+  S+ L + D +C+AWLD Q  +SVIYVSFGS++V++R QL+ 
Sbjct  232   -IGPLNAHLKVRIPEKTHSSSGLWKVDRSCIAWLDKQPKQSVIYVSFGSVAVMSRDQLIV  290

Query  932   FWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAV  1111
             F+YGLVNS   FLWV+R DL++GKD E S IP E+ E TK  GYI GW PQE VL H AV
Sbjct  291   FYYGLVNSKNGFLWVIRPDLISGKDGE-SQIPEEVVEATKERGYIAGWVPQEEVLAHKAV  349

Query  1112  GGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKL  1291
             GGFL H GWNSTLESI AG+PMICWP FADQQ NSRFV EVWK+GLD+KD+ DR+ VEK 
Sbjct  350   GGFLIHCGWNSTLESIMAGMPMICWPSFADQQINSRFVDEVWKLGLDIKDLFDRNIVEKA  409

Query  1292  IRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             + +LM KRK EF+E A+ M  LAK++++EGGS YCN D L++D+
Sbjct  410   VNDLMVKRKEEFMESADQMANLAKKSVNEGGSLYCNLDRLVKDI  453



>ref|XP_011085130.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=472

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 226/473 (48%), Positives = 302/473 (64%), Gaps = 22/473 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             H+L+FP P QSH+N ML LA +  ++ F ITF +P +I        D  S RF     F 
Sbjct  11    HVLVFPFPVQSHVNVMLNLAEIFSISGFQITFLIPDHIQTG--PRFDQISLRFARYPAFY  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLLV  397
              Q+   G+      + +   EL DS+    KP  +  +   A + +S  P TC I+D ++
Sbjct  69    FQAISDGLPLDHPRTGDRVKELFDSINVTTKPQFRNVLKSRALSSNSRAPLTCIIADGIM  128

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             S  +D+++  F +P   FRP SA  FWT F +P L +AGELP+K +      +  + GME
Sbjct  129   SFTIDIAQN-FGIPTVLFRPFSATCFWTLFCVPKLIQAGELPLKEDSDMDRLVENIPGME  187

Query  578   DFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
               LRVRDL  FCR ED A        +E   A  A  LILNT EDLE P L++IR  +P 
Sbjct  188   RVLRVRDLPSFCRVEDAADPQLQHVVSETHRATGAHSLILNTLEDLEEPALARIRANFPK  247

Query  746   VYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQL  925
             +Y IGPLH + +   +      NSL ++  +C+ WLD Q  KSV++VSFG+++V+  QQL
Sbjct  248   LYVIGPLHGYFRPLWSP-----NSLNEQHRSCIEWLDDQPLKSVVFVSFGNMTVLKSQQL  302

Query  926   MEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHL  1105
             +EFWYGLVNSGK FLWV+ ++L AG       IP+EL EG+  +G +V WAPQE VL H 
Sbjct  303   VEFWYGLVNSGKPFLWVVPANLTAG-----CRIPTELIEGSGKSGKVVDWAPQEEVLSHP  357

Query  1106  AVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVE  1285
             A GGFLTH GWNSTLESI  GVPMICWPF+ADQQ NSR V EVW+VG+DMKD+CDR +VE
Sbjct  358   ATGGFLTHGGWNSTLESIYEGVPMICWPFYADQQVNSRLVEEVWRVGVDMKDICDRKTVE  417

Query  1286  KLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEAT  1444
             K +RELME R+ EFL+ ++++ +LA+++ISEGGSSY N DCLI+D+  +N A 
Sbjct  418   KAVRELMEVRREEFLKSSKDIARLARKSISEGGSSYANLDCLIKDIKHMNYAN  470



>emb|CDP16024.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   439 bits (1128),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 223/469 (48%), Positives = 305/469 (65%), Gaps = 15/469 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             H+L+FPLP Q  +N ML LA L  L + H+TF    ++  RL + +DV+S RF     FR
Sbjct  11    HVLVFPLPLQGPVNCMLNLAELFCLGDLHVTFINTDHVQDRLRSCSDVES-RFERYPNFR  69

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN---RDSGLPFTCFISDLLV  397
               + P G+ + +  +    ++L  SL  + +P  +  +       +S  P TC I+D + 
Sbjct  70    FHTIPDGLPEDSPRTGGHILKLIQSLEVVSQPIFRAMVTSGSLGHNSEKPATCIIADGIF  129

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             S A+D+++E   +P+ YF  IS C  WTY  +P L EA E P KG+ +D+ P++ ++ ME
Sbjct  130   SFAVDIAKE-IGVPLIYFDTISPCGLWTYLCIPKLIEAQEFPFKGDDLDA-PLSSLQEME  187

Query  578   DFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
               +R RDL  FCR    D+ L  +   E R    A+ +I NTFE+L+   LS +RT  P 
Sbjct  188   CIMRRRDLPSFCRVREIDDPLIRIILEEDRQLPLAQAIIFNTFEELDRGTLSLMRTLGPT  247

Query  746   VYTIGPLHAHLKATLASKST---HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             VY IGPLH HLK+ LA+ ++    S+SL +ED++C+AWL+ Q  KSVIYVS GS++ +T+
Sbjct  248   VYAIGPLHTHLKSRLAATTSPPASSHSLWKEDKSCIAWLNDQPVKSVIYVSIGSLATMTK  307

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
              QLME WYGLVNSG +FLWV R   +AG   +   IP EL + T+  GYIV WAPQE VL
Sbjct  308   DQLMEIWYGLVNSGVRFLWVQRPGSIAGSAAKGDQIPEELAKATQERGYIVDWAPQEEVL  367

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H  +GGFLTHSGWNSTLESIA GVPMI WP+F DQQ NSR++ EVWK+GLDMKD CDR 
Sbjct  368   GHPGIGGFLTHSGWNSTLESIAEGVPMIGWPYFVDQQVNSRYLLEVWKLGLDMKDTCDRV  427

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              VEK+++++M+ R+ EFL RA  M KLA  ++SEGGSSY + D LI+D+
Sbjct  428   IVEKMVKDVMQLRRDEFLPRANEMAKLANSSVSEGGSSYNDLDNLIEDI  476



>dbj|BAK55741.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=493

 Score =   439 bits (1128),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 230/479 (48%), Positives = 307/479 (64%), Gaps = 29/479 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             H+L+FPLP Q  +N MLKLA LL   +  +TF    ++  RLL+ TDV S   R+   FR
Sbjct  12    HVLLFPLPLQGPVNCMLKLAELLCFNHLQVTFLNTDHVQRRLLSCTDVSSRFKRYAGHFR  71

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---------AQNRDSGLPFTCF  379
              ++ P G+  G   + E   EL DS+  +  P  ++ +         AQN     P TC 
Sbjct  72    FETVPDGLPAGKTMTGEQIGELLDSMEAVSLPLFREIVRSSVHVSDGAQN-----PLTCI  126

Query  380   ISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  559
             I+D     A+D++ E F + + YF  IS C  W+  S   L +AG+ P K + +D+ P+T
Sbjct  127   IADGAFGFAVDIAAE-FGVALMYFDTISPCGLWSILSANRLIQAGDFPFKDDDLDA-PVT  184

Query  560   KVKGMEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQI  727
              V GME FLR RDL  F R  D++  ++     E +   +  GLI N+FEDLEGPILSQ+
Sbjct  185   SVPGMEGFLRRRDLPSFFRIPDQNDPIIQRVLREEQQMKKCHGLIFNSFEDLEGPILSQL  244

Query  728   RTKYPNVYTIGPLHAHLKATLASKS------THSNSLLQEDETCMAWLDSQEPKSVIYVS  889
             +T  P VYTIGPLH H K  L S+         +NSL  E+++C++WLD+Q  KSVIYVS
Sbjct  245   KTLVPRVYTIGPLHTHKKNRLVSEKGSKNDRNSTNSLWTENKSCISWLDNQPAKSVIYVS  304

Query  890   FGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDE-ESPIPSELKEGTKANGYI  1066
              GS++++ ++QL+E W+GL NS  +FLWV R   + G D+E +  +P  L   T   G I
Sbjct  305   IGSLALMGKEQLLEIWHGLANSEVRFLWVQRPGSITGLDEENDGGVPLNLCRATIERGCI  364

Query  1067  VGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVG  1246
             V WAPQE VL H AVGGFLTHSGWNSTLESI  GVPMIC P+FADQQ NSR+VGEVWKVG
Sbjct  365   VSWAPQEEVLAHPAVGGFLTHSGWNSTLESIVEGVPMICLPYFADQQINSRYVGEVWKVG  424

Query  1247  LDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             LDMKD CDR  VE ++R+LMEKRK EFLE+A+++ KLAK ++S+GG+SY   +CLI+D+
Sbjct  425   LDMKDTCDRDIVEMMVRDLMEKRKDEFLEKADHVAKLAKASVSKGGASYNALNCLIEDI  483



>ref|XP_010032069.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51454.1| hypothetical protein EUGRSUZ_J00979 [Eucalyptus grandis]
Length=479

 Score =   437 bits (1125),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 234/471 (50%), Positives = 303/471 (64%), Gaps = 22/471 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H++IFPL AQ H+NSMLKLA LL L+   ITF    +IH RLL   D+   RF     F+
Sbjct  10    HVVIFPLAAQGHVNSMLKLAELLALSGLRITFINSEHIHHRLLQHADI-PARFAAYPDFQ  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI-AQNRDSGLPFTCFISDLLVSI  403
              +    G         + F+   D ++ I K   ++ + A +R    P TC I+D +++ 
Sbjct  69    FKIISDGFPIHHPRPSDHFLTTFDYVKSITKQLFEELVSAPDR----PVTCIIADGILTF  124

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
              +D + +   +PV  FR ISA  FWTYF +P + E+G+LPIKG+      +T V GMED 
Sbjct  125   TIDFAGD-LGVPVIAFRTISASCFWTYFCIPRMIESGDLPIKGDEDMDRDVTSVPGMEDI  183

Query  584   LRVRDLSPFCRDEDLA--VLYY--TEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVY  751
             LR RDL  FCR  DL+  +L Y  T+      AR LILN+F+ LEGP +SQIRT +PN+Y
Sbjct  184   LRCRDLPSFCRVADLSDWLLQYVTTQTLRTTGARALILNSFDHLEGPAISQIRTHFPNLY  243

Query  752   TIGPLHAHLKATLASKSTHSNS-------LLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             TIGPLH H K+ L+S S  S         L + D +C++WLD Q PKSVIYVSFGSI+ +
Sbjct  244   TIGPLHLHHKSRLSSSSPSSPPPSSASNSLWEVDRSCISWLDKQPPKSVIYVSFGSITTL  303

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR    EFWYGLVNSG++FLWV+R D +A  D     +P EL+E     G IVGWAPQE 
Sbjct  304   TRHDFTEFWYGLVNSGRRFLWVIRPDSLA--DGGNGAVPEELREAAAERGCIVGWAPQEE  361

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VLDH AV  FLTHSGWNSTLES+ AG PM+CWPF ADQQ NSR V  +WKVGLDMKDVCD
Sbjct  362   VLDHGAVAAFLTHSGWNSTLESVVAGKPMVCWPFSADQQLNSRLVSHLWKVGLDMKDVCD  421

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R  +E+++ E+M +RK EF   A ++ + A++A SEGGSS+ N D LI+D+
Sbjct  422   REVMERMVNEVMGERKEEFAAAAGDLARRARDAASEGGSSWDNLDRLIEDV  472



>ref|XP_010318076.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=471

 Score =   437 bits (1124),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 223/470 (47%), Positives = 304/470 (65%), Gaps = 17/470 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDS--GRFTT  217
             + H+LIFPLP Q  +N MLKLA LL L     ITF     IH RL+  TDV+   G++  
Sbjct  3     VPHVLIFPLPLQGPVNCMLKLAELLCLDKEIQITFINTEYIHQRLMNYTDVEVRFGKYPN  62

Query  218   RFRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLV  397
              F+  + P G+ +      +    + + +  +  P  K+ +     +    TC I D + 
Sbjct  63    -FKFVTVPDGLPEDNPRIGDQIRLIIEGVEEVSSPLFKEMVMTTNSAP---TCLIVDGIF  118

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             + AL +++E   +P+ YF  IS C+ WTY +LP L E GE+P KGN +D   +  + GME
Sbjct  119   TFALPIAKEA-KIPLLYFDTISPCSLWTYLALPKLIEDGEIPFKGNDLDVL-VNGMPGME  176

Query  578   DFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
               +R RDL  FCR  D D+ ++ +   E +  VQA+GLI NTFE LEGPILSQ R   PN
Sbjct  177   GVMRRRDLPSFCRTPDVDIPIIKHVIKEGKHIVQAQGLIFNTFEALEGPILSQFRALCPN  236

Query  746   VYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
             +Y IGPLH  +KA L+S+    +  SNS+ +ED +C+ WLD Q  KSV++VS GS++ ++
Sbjct  237   IYAIGPLHTQMKAKLSSQRLPNTPTSNSIWKEDVSCIDWLDKQPNKSVLFVSIGSLATMS  296

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             + Q  EFWYGLVNS  +FLWV R   + G +D+ + +P EL E TK  G I+ WAPQE V
Sbjct  297   KAQFFEFWYGLVNSDTRFLWVQRPGSIIGLEDDNNNVPMELVESTKERGCIISWAPQEEV  356

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L   ++G FLTHSGWNSTLESI  GVPMICWP+F DQQ NSR+VGEVWK+GLDMKDVCDR
Sbjct  357   LARPSIGAFLTHSGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKDVCDR  416

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              ++E+++RE+M+ +K EFLERA+ M  LA  ++ EGGSSY + D LI+D+
Sbjct  417   ITIERMVREVMDVKKIEFLERAKYMSDLAIASVGEGGSSYQDLDRLIEDI  466



>emb|CDP04614.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   436 bits (1120),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 228/481 (47%), Positives = 306/481 (64%), Gaps = 20/481 (4%)
 Frame = +2

Query  44    FIGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTT  217
              + H+LIFPLP QS +NSMLKLA LL LA   +TF    + H RLL  T++ S   ++  
Sbjct  7     LVPHVLIFPLPIQSPVNSMLKLAELLCLAGHRVTFLNTKHNHNRLLRCTNIQSRLDQYQG  66

Query  218   RFRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDS-----GLPFTCFI  382
             RF L+    G+ D    + E F E+ DSL+ + +PFL++ +   R S       P TC I
Sbjct  67    RFLLEKVDDGLPDEDPRTAEQFTEILDSLQSVAEPFLREVLCGERFSCNSSKRPPITCII  126

Query  383   SDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  562
             +D      LDV+EE   +P+ +F  IS C  W Y  +P L EAGELP KGN +D+  +  
Sbjct  127   ADGSYYYVLDVAEE-MGIPLIFFETISPCCLWVYMCVPKLIEAGELPFKGNDLDAE-VRS  184

Query  563   VKGMEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIR  730
             + GME  LR RDL  FCR +  A     L   E R   +A GLILNTFEDLEGP LS I 
Sbjct  185   IPGMEGLLRCRDLPDFCRRDCTADRNAQLVMAEIRNIPRAAGLILNTFEDLEGPFLSHIH  244

Query  731   TKYPNVYTIGPLHAHLKATLASKSTH-----SNSLLQEDETCMAWLDSQEPKSVIYVSFG  895
             ++  N+Y IGPL  HLK  LA++S       SNS   ED +C+ WLDSQ  KSVIY+SFG
Sbjct  245   SQARNLYAIGPLQLHLKTKLAAQSRELPTAVSNSFWVEDTSCLCWLDSQPLKSVIYISFG  304

Query  896   SISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAG-KDDEESPIPSELKEGTKANGYIVG  1072
             S+  IT+ + +EFW+G++NSG++FLWV+R   + G K ++      EL  GTK  G I+ 
Sbjct  305   SLKNITKDEFLEFWHGIMNSGQRFLWVIRPGSIKGQKLEQHDDFLKELNRGTKGKGLILS  364

Query  1073  WAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLD  1252
             W PQE V+ H A+GGFL+HSGWNSTLESI AGVPMICWP + DQQ  SRFV E W +GLD
Sbjct  365   WVPQEEVIGHSAIGGFLSHSGWNSTLESIIAGVPMICWPCYVDQQVTSRFVSETWTLGLD  424

Query  1253  MKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKV  1432
             MKD C RS +EK++R+++E R+ +F + A+   KLA+++++ GGSS+ + D LI D+ K+
Sbjct  425   MKDTCSRSIIEKMVRDIIE-RRCDFDQSADKFSKLARQSVAAGGSSHIDLDRLIGDIKKL  483

Query  1433  N  1435
             +
Sbjct  484   S  484



>ref|XP_007158358.1| hypothetical protein PHAVU_002G146100g [Phaseolus vulgaris]
 gb|ESW30352.1| hypothetical protein PHAVU_002G146100g [Phaseolus vulgaris]
Length=482

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 232/490 (47%), Positives = 304/490 (62%), Gaps = 36/490 (7%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              H+LIFPLP  +H+ SMLKLA LL L N H+TF     IH RL    D+       +F  
Sbjct  4     AHVLIFPLPLPAHVVSMLKLAELLVLENLHVTFLTTDTIHGRLTRFGDI-------QFLS  56

Query  230   QSFPP-------GIYDGALNSK--EVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFI  382
             +S+P          YD   +    +   +L  S     KPFL+  +  +       +C I
Sbjct  57    KSYPKLHFKTISDCYDEGDHPGFGDRLWDLISSTTLHAKPFLRDILLSHTPQIPKLSCVI  116

Query  383   SD-LLVSIALDVSEECFN--LPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP  553
              D +  S++ DV+ E FN  +P+  FR +SAC FW Y S  +L +  ELPI+G+      
Sbjct  117   QDGIFGSLSADVASE-FNVSIPIIQFRTVSACCFWAYMSATNLLQCQELPIRGDEDMDRI  175

Query  554   ITKVKGMEDFLRVRDLSPFCRDEDLAVLYY----TEARLAVQARGLILNTFEDLEGPILS  721
             I  + GME+ LR RDL  F R +      +      +R ++ A  +I+N+FEDLEGP+LS
Sbjct  176   IKDIPGMENLLRCRDLPSFFRPDKKGNSTFESHVDRSRQSLAADAIIVNSFEDLEGPVLS  235

Query  722   QIRTKYPNVYTIGPLHAHLKATLASKS------THSNSLLQEDETCMAWLDSQEPKSVIY  883
             QIR  +P VYT+GPLH HL    A  +         N++ Q D TCM WLD+Q   SV+Y
Sbjct  236   QIRHHFPKVYTVGPLHCHLNTRKAESNEGEDIPKFKNAIFQVDRTCMTWLDAQPEGSVMY  295

Query  884   VSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGY  1063
             VSFGS +++ R+ L E W+GLVNS  +FLWVMR D+VAGK D++  IP+E++EGTK  G+
Sbjct  296   VSFGSSTIVKREDLTEIWHGLVNSKNRFLWVMRPDIVAGKQDDDR-IPAEVEEGTKERGF  354

Query  1064  IVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKV  1243
             IV WAPQE VL+H A+GGFLTHSGWNSTLES+ AGVPMICWP+FADQQ NSRFV EVWKV
Sbjct  355   IVEWAPQEEVLEHKAIGGFLTHSGWNSTLESVVAGVPMICWPYFADQQINSRFVSEVWKV  414

Query  1244  GLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             GLDMKDVCDR  VEK++ +LM  R+ EFL  A+ M  LA +++S GGSSY +F    QD 
Sbjct  415   GLDMKDVCDRDVVEKMVNDLMVHRREEFLNSAKAMATLAHKSVSPGGSSYSSF----QDF  470

Query  1424  IK-VNEATRE  1450
             I  +   +RE
Sbjct  471   IHYIKSTSRE  480



>dbj|BAK55740.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=496

 Score =   434 bits (1116),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 230/481 (48%), Positives = 305/481 (63%), Gaps = 30/481 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             H+L+FPLP Q  +N MLKLA LL   +  +TF    ++  RLL+ TDV S   R+   FR
Sbjct  12    HVLLFPLPLQGPVNCMLKLAELLCFNHLQVTFLNTDHVQRRLLSCTDVSSRFKRYAGHFR  71

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---------AQNRDSGLPFTCF  379
              ++ P G+  G   + E   EL DS+  +  P  ++ +         AQN     P TC 
Sbjct  72    FETVPDGLPAGKTMTGEQIGELLDSMEAVSLPLFREIVRSSVHVSDGAQN-----PLTCI  126

Query  380   ISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDS--SP  553
             I+D     A+D++ E F + + YF  IS C  W+  S   L +AG+ P K    D   +P
Sbjct  127   IADGAFGFAVDIAAE-FGVALMYFDTISPCGLWSILSANRLIQAGDFPFKVYTDDDLDAP  185

Query  554   ITKVKGMEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILS  721
             +T V GME FLR RDL  F R  D++  ++     E +   +  GLI N+FEDLEGPILS
Sbjct  186   VTSVPGMEGFLRRRDLPSFFRIPDQNDPIIQRVLREEQQMKKCHGLIFNSFEDLEGPILS  245

Query  722   QIRTKYPNVYTIGPLHAHLKATLASKS------THSNSLLQEDETCMAWLDSQEPKSVIY  883
             Q++T  P VYTIGPLH H K  L S+         +NSL  E+++C++WLD+Q  KSVIY
Sbjct  246   QLKTLVPRVYTIGPLHTHKKNRLVSEKGSKNDRNSTNSLWTENKSCISWLDNQPAKSVIY  305

Query  884   VSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDE-ESPIPSELKEGTKANG  1060
             VS GS++++ ++QL+E W+GL NS  +FLWV R   + G D+E +  +P  L   T   G
Sbjct  306   VSIGSLALMGKEQLLEIWHGLANSEVRFLWVQRPGSITGLDEENDGGVPLNLCRATIERG  365

Query  1061  YIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWK  1240
              IV WAPQE VL H AVGGFLTHSGWNSTLESI  GVPMIC P+FADQQ NSR+VGEVWK
Sbjct  366   CIVSWAPQEEVLAHPAVGGFLTHSGWNSTLESIVEGVPMICLPYFADQQINSRYVGEVWK  425

Query  1241  VGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQD  1420
             VGLDMKD CDR  VE ++R+LMEKRK EFLE+A+++ KLAK ++S+GG+SY   +CLI+D
Sbjct  426   VGLDMKDTCDRDIVEMMVRDLMEKRKDEFLEKADHVAKLAKASVSKGGASYNALNCLIED  485

Query  1421  M  1423
             +
Sbjct  486   I  486



>ref|XP_008785471.1| PREDICTED: UDP-glycosyltransferase 85A4-like [Phoenix dactylifera]
Length=481

 Score =   433 bits (1113),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 233/474 (49%), Positives = 302/474 (64%), Gaps = 21/474 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+L+FP P Q  +N MLKLA LL  A   +TF    + H  L   +   + R   R  FR
Sbjct  10    HVLVFPFPGQGMVNCMLKLADLLSGAGLLVTFLNTHHNHRHLSRFSGAHT-RLAQRPKFR  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLR-RIGKPFLKQYIA-QNRDSG--LPFTCFISDLL  394
               S P G+ +    S   F +L +S+R R    F    IA +++DSG   P TC I+D L
Sbjct  69    FASIPDGLSEEETRSVFNFFDLEESMRTRAAASFRDLLIAYRDKDSGGWPPVTCVIADGL  128

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +  A+DVSEE   +P   FR ISAC  W +  +P L E GE+P         P+  V GM
Sbjct  129   MPFAVDVSEE-VGIPAIIFRTISACCVWAFLCVPKLLENGEIPFPEGADLDEPVRGVPGM  187

Query  575   EDFLRVRDLSPFCR------DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTK  736
             E FLR RDL  FCR      D +L V+    A  A +AR LILNTFE LEG  LS IR  
Sbjct  188   ESFLRRRDLPSFCRQARDHTDRELQVVSSVTAS-ANRARALILNTFESLEGSALSHIRNN  246

Query  737   YPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
              P  Y +GPL+A     LA  S+ S SL QED  CM WLDSQ  +SV+YVSFGS++V+TR
Sbjct  247   SPVTYAVGPLNA-----LARTSSDSGSLWQEDRDCMTWLDSQPDRSVVYVSFGSLAVVTR  301

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             ++ MEFW+GLV+SG++FLWV+RSDL+  +      +P+E++EGT+  G +VGWAPQE VL
Sbjct  302   EEFMEFWHGLVDSGQRFLWVVRSDLINRRGGGTEVLPAEVEEGTRERGCMVGWAPQEEVL  361

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H AVG FLTHSGWNSTLESIAAG PM+CWPFFADQQ NSRFV  VW +GLDMKD+C RS
Sbjct  362   SHPAVGCFLTHSGWNSTLESIAAGKPMLCWPFFADQQINSRFVSAVWGIGLDMKDLCGRS  421

Query  1277  SVEKLIRELMEKRKGEFLER-AENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
              VEK++RE+ME  + E L R A  M ++AK++++EGG+S+  F  LI+ ++ ++
Sbjct  422   IVEKMVREVMEGERSEELRRNAREMAEMAKKSVAEGGTSFNEFQSLIRLIMSLD  475



>emb|CDP19644.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   433 bits (1114),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 224/474 (47%), Positives = 309/474 (65%), Gaps = 19/474 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             H+L+FPLP Q  +N MLKLA L   ++  +TF    +I  RLL+ TDV S   R+   FR
Sbjct  12    HVLLFPLPLQGPVNCMLKLAELFCSSHLQVTFLNTDHIQRRLLSCTDVSSRFKRYAGHFR  71

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN----RDSGLPFTCFISDLL  394
              ++ P G+      + E   EL DS+  +  P  ++ +  +     D+  P TC I+D  
Sbjct  72    FETVPDGLPADKTLTGEQIGELLDSMEAVSLPLFREIVRSSVLLSDDAQNPLTCIIADGA  131

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
                A+DV+ E F + + YF  IS C  W+  S   L +AG+ P K + +D+ P+T + GM
Sbjct  132   FGFAVDVAAE-FGVALMYFDTISPCGLWSILSANRLIQAGDFPFKDDDLDA-PVTSIPGM  189

Query  575   EDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL  F R  D++  ++     E R   + +GLI N+FEDLEGPILSQ++T  P
Sbjct  190   EGFLRRRDLPSFFRIPDQNDPIIQRVLKEERQMKRCQGLIFNSFEDLEGPILSQLKTLVP  249

Query  743   NVYTIGPLHAHLKATLASKS------THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
             +VYTIGPLH H +  LAS+         +NSL +E+++C++WLD+Q  KSVIYVS GS++
Sbjct  250   SVYTIGPLHTHKETRLASERGSKNDRNSTNSLWKENKSCISWLDNQPAKSVIYVSIGSLA  309

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDE-ESPIPSELKEGTKANGYIVGWAP  1081
             ++ ++QL+E W+GL NSG +FLWV R   + G D+E ++ IP +L   T   G IV WAP
Sbjct  310   LMGKKQLLEIWHGLANSGVRFLWVQRPGSITGLDEENDAGIPLKLCRATTERGCIVSWAP  369

Query  1082  QEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKD  1261
             QE VL H A+GGFLTHSGWNSTLESI  GVPMIC P+FADQQ NSR+VGEVWK+GLDMKD
Sbjct  370   QEEVLAHPAIGGFLTHSGWNSTLESIVEGVPMICCPYFADQQINSRYVGEVWKLGLDMKD  429

Query  1262  VCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              CDR  VE ++R+LME+RK EF ++ ++M +LAK ++S GGSSY   + LI+D+
Sbjct  430   TCDRDIVEMMVRDLMEERKDEFSKKVDHMARLAKASVSNGGSSYNALNRLIEDI  483



>gb|KHG01935.1| UDP-glycosyltransferase 85A1 [Gossypium arboreum]
Length=948

 Score =   446 bits (1147),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 237/515 (46%), Positives = 329/515 (64%), Gaps = 19/515 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSG--RFTTRFR  226
             H+L+FP P Q H+NSM+KLA LL LA F +TF      H RL+   ++ +   R+   F 
Sbjct  13    HVLVFPFPLQGHINSMIKLAELLALAGFKLTFLNSHYNHERLVKFNNIAAHFERYQG-FE  71

Query  227   LQSFPPGIYDGALNSKEVFVELCD-SLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSI  403
              ++   G+      S   F+++ + +L    KP L++ +    +   P  C I+D  +  
Sbjct  72    FKTITDGLPLDHPRSGNWFLDMYEEALEMKMKPGLREML---ENISPPVDCIIADGFLGF  128

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
             A+DV++E   +P+ YFR  S C+FW Y+S+PD+ +AGELPIKG+      +T V GME +
Sbjct  129   AIDVAKE-LEIPIIYFRTSSPCSFWVYYSIPDIIQAGELPIKGSEDMDRLLTTVPGMETY  187

Query  584   LRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVY  751
              R RDL  FCR+ D+      LY  + + + QA  LILNT E+L+GPILSQIRTK P VY
Sbjct  188   FRCRDLPSFCRETDIEDSIIKLYVKQTQKSSQADALILNTAEELDGPILSQIRTKCPRVY  247

Query  752   TIGPLHAHLKATLASKSTHS-----NSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
              IGPLHA L   L +K   S     N+L + D++C+ WLD Q  +SVIYVSFGSI+  +R
Sbjct  248   AIGPLHAQLNTRLKAKHGESYDHFSNTLWEVDKSCIFWLDKQPNRSVIYVSFGSITSTSR  307

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +QL+E WYGL+NS  KFL V+R + V GKD E   +  EL E +K  GYIV WAPQEAVL
Sbjct  308   EQLVELWYGLLNSKTKFLLVVRPNSVIGKDGEGEDVVVELMEKSKDQGYIVNWAPQEAVL  367

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
             +H  VGGF TH+GWNSTLESI AGVPMICWP+FADQQ NSR V EVWK+GLDMKDVCD+ 
Sbjct  368   NHPTVGGFFTHNGWNSTLESIVAGVPMICWPYFADQQVNSRVVSEVWKIGLDMKDVCDKK  427

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM-IKVNEATREl  1453
              VEK+++++M  +K EF++ A    K+  ++++ GGSSY N D LI+D+ I   +  + +
Sbjct  428   IVEKMVKDVMVDQKEEFVQSAAETAKVTNQSVNVGGSSYSNLDHLIEDIRIMSLKTPKTM  487

Query  1454  l*nvlg*lvnFPLEFCSMHFQSHIYLLQWSTLGLY  1558
             +   L  L  F L F + H  +H  L++++++  Y
Sbjct  488   ILAELLALAGFKLTFLNSH-HNHERLIKFTSIVAY  521


 Score =   392 bits (1006),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 216/452 (48%), Positives = 280/452 (62%), Gaps = 20/452 (4%)
 Frame = +2

Query  107   LAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFRLQSFPPGIYDGALNSKEV  280
             LA LL LA F +TF    + H RL+  T + +   R+   F L++   G+      S   
Sbjct  489   LAELLALAGFKLTFLNSHHNHERLIKFTSIVAYFKRYPG-FELKTITDGLPLDHPRSGNW  547

Query  281   FVELCDS--LRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALDVSEECFNLPVYYFR  454
             F+E  +   L +I + F +  I  N     P  C I+D     A+DV+ E   +P+  FR
Sbjct  548   FLETYEEAILMKIKQSFREMMINSNP----PVDCVIADGFSGYAIDVANE-LGIPIIGFR  602

Query  455   PISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCRDEDL--  628
               S  +FW Y+S+ D+ +AGELPI+G+      IT V GME +LR RDL  FCR  D+  
Sbjct  603   TSSPRSFWVYYSITDIIKAGELPIRGSEDMDRLITTVPGMETYLRCRDLPSFCRKPDIED  662

Query  629   --AVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKATLASK-  799
                 L   + R + QA  LI NT ++L+ PILSQIRTK  N+Y IGPLHA L   L +K 
Sbjct  663   STVQLIVKQTRKSTQADALIFNTTDELDEPILSQIRTKCANIYPIGPLHAQLNTRLKAKH  722

Query  800   ----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNSGKKF  967
                    SN+L +ED++C+ WLD Q  +SVIYVSFGSI+  +R QL+E WYGL+NS  KF
Sbjct  723   GESFDQFSNTLREEDKSCIPWLDKQPNRSVIYVSFGSITSTSRDQLVELWYGLLNSKTKF  782

Query  968   LWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNST  1147
             L+V+R D V GKD E      EL E +K  GYIV WAPQE VL+H AVGGFLTHSGWNST
Sbjct  783   LFVVRPDSVIGKDGEGEDFVKELMEKSKDRGYIVDWAPQEVVLNHEAVGGFLTHSGWNST  842

Query  1148  LESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEF  1327
             LESI AGVPM+CWP+FADQQ  SR V  VWK+GLDMKDV DR  VEK++ ++M  +K EF
Sbjct  843   LESIVAGVPMVCWPYFADQQVTSRVVSTVWKIGLDMKDVSDRKIVEKMVNDVMVDQK-EF  901

Query  1328  LERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             +  A +M K+  + +S GGSS  N D LI+D+
Sbjct  902   VNSATDMAKVINQCVSIGGSSSNNLDRLIEDI  933



>dbj|BAP90373.1| UDP-glycose: glycosyltransferase UGT709H1 [Fagopyrum esculentum]
Length=482

 Score =   431 bits (1107),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 224/469 (48%), Positives = 296/469 (63%), Gaps = 16/469 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             H+LIFP+P   H+N MLKLA LL LA  ++TF   +  H RLL  TDV++   RF   FR
Sbjct  12    HVLIFPVPMLGHINPMLKLAQLLCLAKLNVTFLNTAYNHRRLLQYTDVEARLARFPG-FR  70

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDS-GLPFTCFISDLLVSI  403
              +  P G+ D    S E   E+  SL     P LK+ + + RD    P TCFI+D +   
Sbjct  71    FEIIPDGLPDDHPRSGERANEVYRSLELTATPILKEILIRLRDDLNSPVTCFIADGMFGY  130

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
             A DV EE   +PV  FR IS+C FW YF++P+L +A ++P + + +D   +  + GME F
Sbjct  131   AYDVGEEV-GIPVIAFRTISSCCFWIYFNMPNLIDAEQIPFQDDDLDEL-VNNIPGMEAF  188

Query  584   LRVRDLSPFCRDEDLAVLYY----TEARLAVQARGLILNTFEDLEGPILSQIRTK-YPNV  748
             LR RDL  FCR +D+   ++       R   +A  LILNTFE+LEGPI++ IR     N+
Sbjct  189   LRYRDLPSFCRVKDVNDSHFRRVTNATRRTQRANSLILNTFEELEGPIVNLIRAHCSSNI  248

Query  749   YTIGPLHAHLKATL----ASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             Y+IGPLH  L   L    + K T +NSL + D +C+ WLD +  KSV+YVSFGSI+ I++
Sbjct  249   YSIGPLHTQLNYRLGRTESDKITLNNSLWEVDRSCIKWLDDKPKKSVVYVSFGSITTISK  308

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +QLME W GLV S K FLWVMR + + G D+    +  E+ EGT+  GY+VGW PQE VL
Sbjct  309   EQLMEIWAGLVQSNKFFLWVMRPNSITG-DNPTQAVDPEILEGTEKRGYMVGWTPQEEVL  367

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H A+GGFLTHSGWNSTLESI AGVPM+CWP+FADQQ NSR+V  VWK+GLDMKD C R 
Sbjct  368   AHQAIGGFLTHSGWNSTLESIEAGVPMVCWPYFADQQVNSRYVSHVWKIGLDMKDKCHRD  427

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              VE ++ ++ME  K   L       +  K +++EGG+S CN D LI D+
Sbjct  428   IVENMVNDMMENMKDGLLSSVTEFSQAVKRSVAEGGTSSCNLDRLIDDI  476



>ref|XP_010674283.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   429 bits (1104),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 232/480 (48%), Positives = 310/480 (65%), Gaps = 33/480 (7%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+  ML LA LL LAN  +TF   +  H  L   T++++ RF     F 
Sbjct  9     HVLIFPLPIQGHITPMLNLAELLCLANLKVTFLNTTQNHKLLTRNTNIEA-RFARYPGFV  67

Query  227   LQSFPPGIYD-----GALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL-PFTCFISD  388
                 P G+ D     G    K+   EL + L   G+P L++ +  +  +G+   TC I D
Sbjct  68    FSIVPDGLADEHPRAGVSKFKDWSSELVEKLALSGEPLLREMLVGS--TGIDKVTCLIID  125

Query  389   LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGID----SSPI  556
               +S A +V+ E   +PV  FR  S C  WTYF +P L +AG++P K   +D    SSP 
Sbjct  126   GWISFANEVANE-VEVPVIAFRCSSPCYMWTYFCIPKLIQAGDIPFKDEAMDELVKSSP-  183

Query  557   TKVKGMEDFLRVRDLSPFCRDED------LAVLYYTEARLAVQARGLILNTFEDLEGPIL  718
                 GM+ FLR RDL  FCR++D      L  L+  E +   QA   ILNTFEDLE P L
Sbjct  184   ----GMDSFLRYRDLPSFCRNQDTSSCQDLLHLFNGEIQRNKQAHAFILNTFEDLEDPTL  239

Query  719   SQIRTKYPNVYTIGPLHAHLKATLASKST-----HSNSLLQEDETCMAWLDSQEPKSVIY  883
             S IR++   VY++GPLHAHLK  L+ K T      S++L + D++C++WLD +  KSV+Y
Sbjct  240   SLIRSECSKVYSLGPLHAHLKYKLSQKETTLCNNSSSNLWEVDQSCISWLDQKPNKSVVY  299

Query  884   VSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGY  1063
             VSFGS++++T+ QL EFW GLV+S K FLWV+R +L+ G +  ++P P +L EGTK  G 
Sbjct  300   VSFGSLTILTKDQLREFWAGLVHSKKYFLWVIRPNLIIGSE-LDNPTPDDLLEGTKKRGC  358

Query  1064  IVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKV  1243
             +V WAPQ+ VL H A+GGFLTHSGWNSTLESI AGVPM+CWP+FADQQ NSRFV EVW++
Sbjct  359   LVKWAPQQEVLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWPYFADQQVNSRFVSEVWRI  418

Query  1244  GLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             GLDMKDVCDR+ VEK+I +LM+ +K E     + + +LAK +ISEGGSSY NF+ LI+D+
Sbjct  419   GLDMKDVCDRTIVEKMINDLMDVKKDELQRSMDKISQLAKTSISEGGSSYSNFNQLIEDI  478



>ref|XP_008464907.1| PREDICTED: UDP-glycosyltransferase 85A3-like isoform X2 [Cucumis 
melo]
Length=483

 Score =   429 bits (1104),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 222/468 (47%), Positives = 302/468 (65%), Gaps = 17/468 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             H+L+FP PAQ H+N MLKLA LL L++  +TF    + + +L   +DV   RF+    F+
Sbjct  10    HVLLFPAPAQGHINVMLKLAELLSLSSVRVTFLTTEHSYRQLTLHSDV-LHRFSLFPSFQ  68

Query  227   LQSFPPGIYDGALNSKEVFV----ELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLL  394
              ++   G+    ++    F     E+  S   + KP  +  +  +  S    +C I D  
Sbjct  69    FRTISDGL---PVSHPRTFSCHLPEMLHSFVSVTKPLFRDMLVSHHFSS-DLSCLILDGF  124

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
              S  LD+ ++   +P++ FR   AC+ WT  S+P+L + G+LPIKG       +  V GM
Sbjct  125   FSYLLDIDDDFVKVPIFCFRTFGACSTWTILSIPNLIKQGQLPIKGEEDMDRILDNVPGM  184

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARL-AVQARGLILNTFEDLEGPILSQIRTKY  739
             E+ LR RDL  FCR    + D  + +   A + + +   LI+NTFEDLEGPILS IRT  
Sbjct  185   ENLLRCRDLPGFCRPTDPNNDPILQFIVSAFIRSTKFNALIMNTFEDLEGPILSNIRTLC  244

Query  740   PNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             PN+Y+IGPLHA LK  ++ ++   N+L + D +C+ WLD+Q   SVIYVSFGSI+V+  +
Sbjct  245   PNLYSIGPLHALLKTKVSHETESLNNLWEVDRSCLTWLDNQPAGSVIYVSFGSITVMGNR  304

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             +LMEFW+GLVNSG+ FLWV+R DLV GK+ E   IP+EL+EGTK  GY+VGW PQE VL 
Sbjct  305   ELMEFWHGLVNSGRNFLWVIRPDLVKGKNGEIE-IPAELEEGTKQRGYMVGWTPQEKVLC  363

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H AVGGFLTHSGWNSTLESI AG PMICWPF  DQQ NSRFV  +W +GLDMKD+CDR +
Sbjct  364   HEAVGGFLTHSGWNSTLESIVAGKPMICWPFGFDQQVNSRFVSNMWNLGLDMKDLCDRET  423

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             V K++ ++M  RK EF+  A  +  LA+ ++  GGSSY NFD LI+D+
Sbjct  424   VAKMVNDVMVNRKEEFVRSATEIANLARRSVKPGGSSYANFDRLIEDI  471



>ref|XP_007009137.1| UDP-glucosyltransferase family 1 protein, putative [Theobroma 
cacao]
 gb|EOY17947.1| UDP-glucosyltransferase family 1 protein, putative [Theobroma 
cacao]
Length=460

 Score =   428 bits (1100),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 230/475 (48%), Positives = 294/475 (62%), Gaps = 52/475 (11%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             H+LIFPLP Q H+NSM KLA LL L  F +TF    + H RL+  T++ +   R+   F 
Sbjct  12    HVLIFPLPLQGHVNSMFKLAELLALTGFKVTFLNSEHNHGRLVKHTNISAHFARYPG-FE  70

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++ P G+ D    S   F+E+  ++    K  L++ +    +   P  C I D  +   
Sbjct  71    FRTVPDGLPDDHPRSGNWFLEMYYAMETKAKLSLREMLL---NINPPVDCIIGDGFLGFV  127

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG------NGIDSSP--ITK  562
             LDV++E   +PV+Y R  SAC FW Y+S+PD+ +AGE+PIKG       GI+     IT 
Sbjct  128   LDVAKE-LGIPVFYCRTSSACCFWAYYSIPDIIQAGEIPIKGVFVKKLKGIEDMDRLITT  186

Query  563   VKGMEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIR  730
             V GME FLR RDL  FCR  D+A     L   + R + QA  LILNTFEDL+ PILS IR
Sbjct  187   VPGMETFLRCRDLPSFCRASDMANSTIQLVVKQTRKSPQAHALILNTFEDLDRPILSHIR  246

Query  731   TKYPNVYTIGPLHA----HLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGS  898
             TK P+VYTIGP+HA     LKA   + S  SNSL +ED  C++WLD Q  +SV+YV F  
Sbjct  247   TKCPHVYTIGPIHALLNTRLKAQCVASSQFSNSLWEEDRNCISWLDKQPKQSVVYVKF--  304

Query  899   ISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWA  1078
                                        R + V GKD +   +P EL EGT+  G IVGWA
Sbjct  305   ---------------------------RPNSVTGKDGQGEDVPVELLEGTQERGCIVGWA  337

Query  1079  PQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMK  1258
             PQE VL+H AVGGFLTHSGWNSTLES+ AGVPMICWP+FADQQ NSRFV EVWK+GLDMK
Sbjct  338   PQEEVLNHSAVGGFLTHSGWNSTLESVVAGVPMICWPYFADQQVNSRFVSEVWKLGLDMK  397

Query  1259  DVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             DVCDR +VEK++ +LM  ++ EF++ A  M KLAKE+++ GGSSYCN D LI+D+
Sbjct  398   DVCDRKAVEKMVNDLMMDKREEFVKSAAEMAKLAKESVNVGGSSYCNLDRLIEDI  452



>gb|KHN04919.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   429 bits (1102),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 242/477 (51%), Positives = 318/477 (67%), Gaps = 18/477 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT-TRFRL  229
             H+ IFP PAQ H+++MLKLA LL L  FHITF     IH RL    D+++   T    + 
Sbjct  10    HVAIFPCPAQGHVSTMLKLAQLLALHGFHITFLNTDFIHHRLHRFGDLEALLQTYPALQF  69

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLP-FTCFISD-LLVSI  403
             ++FP G+      S +  V+L  S+    KP ++ +I  ++D G P   CFI+D +  ++
Sbjct  70    KTFPDGLPHHHPRSGQSAVDLFQSINLHAKPHIR-HILLSQDPGKPKINCFIADGVFGAL  128

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
              +DV+ +   +P+ +FR ISA  FWTYF +P+LF++ +LPI G+      IT + GME+ 
Sbjct  129   TIDVAHQ-VGIPIIHFRTISASCFWTYFCVPNLFQSNQLPITGDEDMDRVITCIPGMENM  187

Query  584   LRVRDLSPFCRDEDLAVLYYT-----EARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
              R RDL  F R     ++Y       E R ++QAR LILNTFEDLEG +LSQ+R ++P V
Sbjct  188   FRCRDLPSFSRGTGSEIVYALNSLALETRESLQARALILNTFEDLEGSVLSQMRLQFPRV  247

Query  749   YTIGPLHAHLKATLAS--KSTHSNSLLQE-DETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             +TIGPLHAHL     S  ++T S S + E D+ CM WLDSQ  KSVIYVSFGSI+ +TR+
Sbjct  248   FTIGPLHAHLNTRKESNTETTPSTSCVGEVDQRCMTWLDSQPLKSVIYVSFGSIATMTRE  307

Query  920   QLMEFWYGLVNSGKK---FLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             +L+E WYGLVNS K+   FLWVMR DLV GK++ +  IP+EL+EGTK  G+IVGWAPQE 
Sbjct  308   KLIEIWYGLVNSKKRKNRFLWVMRPDLVVGKENGDW-IPAELEEGTKERGFIVGWAPQEE  366

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV-C  1267
             VL H A+GGFLTHSGWNSTLES+AAGVPMIC P F DQ  NSRFV EV KVGLDMKDV C
Sbjct  367   VLAHKAIGGFLTHSGWNSTLESLAAGVPMICCPSFGDQHVNSRFVSEVCKVGLDMKDVAC  426

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNE  1438
             DR+ VE ++ +LM+ R   FL  A  +  LA  ++S GGSSY N D LIQ +  +++
Sbjct  427   DRNLVENMVNDLMDHRNEVFLNSAREVALLANRSVSSGGSSYSNLDGLIQYIRSISQ  483



>ref|XP_004172562.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   428 bits (1100),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 228/471 (48%), Positives = 300/471 (64%), Gaps = 23/471 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP PAQ HLN MLKLA LL L++  +TF    + + +L   +DV       RF L 
Sbjct  10    HVLLFPAPAQGHLNVMLKLAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL-  63

Query  233   SFPP----GIYDG-ALNSKEVFV----ELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFIS  385
              FP      I DG  L+    F     E+  S   + KP  +  +     S    TC I 
Sbjct  64    -FPSFQFRTISDGLPLSHPRTFSHHLPEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLIL  121

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
             D   S  LD+ ++   +PV+ FR   AC+ WT  S+P+L +  +L IKG       +  V
Sbjct  122   DGFFSYLLDIDDDFVKVPVFCFRTFGACSTWTILSIPNLIKQEQLTIKGEEDMDRILDNV  181

Query  566   KGMEDFLRVRDLSPFCR----DEDLAVLYYTEARL-AVQARGLILNTFEDLEGPILSQIR  730
              GME+ LR RDL  FCR    + DL + +   A + + +   LI+NTFEDLEGPILS IR
Sbjct  182   PGMENLLRRRDLPGFCRATDPNNDLILQFIVSAFIRSTKFSALIMNTFEDLEGPILSNIR  241

Query  731   TKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             T  PN+Y+IGPLHA LK  L  ++   N+L + D +C+ WLD+Q   SVIYVSFGSI+V+
Sbjct  242   TLCPNLYSIGPLHALLKTKLNHETESLNNLWEVDRSCLTWLDNQAAGSVIYVSFGSITVM  301

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
               ++L+EFW+GLVNSG++FLWV+R DLV GK+ E   IP+EL+EGTK  GY+VGW PQE 
Sbjct  302   GNRELLEFWHGLVNSGRRFLWVIRPDLVKGKNGEIE-IPAELEEGTKQRGYMVGWTPQEK  360

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNSTLESI AG PMICWP+  DQQ NSRFV  VW +GLDMKD+CD
Sbjct  361   VLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQQVNSRFVSNVWNLGLDMKDLCD  420

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R +V K++ ++M  RK EF+  A  +  LA+ +++ GGSSY NFD L++D+
Sbjct  421   RETVAKMVNDVMVNRKEEFVRSATEIANLARRSVNPGGSSYANFDRLVEDI  471



>ref|XP_010923186.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   428 bits (1100),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 229/475 (48%), Positives = 298/475 (63%), Gaps = 24/475 (5%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--F  223
              H+L+FP P Q  +N MLKLA LL  A  H+TF    + H RL   +   S R   R  F
Sbjct  9     AHVLVFPFPGQGMVNCMLKLADLLSGAGLHVTFLNTHHNHRRLSQFSGALS-RLAQRPKF  67

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLR-RIGKPF---LKQYIAQNRDSGLPFTCFISDL  391
             R  S P G+ +    S   F +L +S+R R    F   L  Y  ++ D   P TC I+D 
Sbjct  68    RFASIPDGLSEEETRSVFNFFDLEESMRTRAATSFRDLLLAYRDKDTDGWPPVTCVIADG  127

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
             L+   +DVSEE   +P   FR ISAC  W Y  +P+L E+GE+P         P+  V G
Sbjct  128   LMPFTIDVSEE-VGIPAIMFRTISACCVWAYLCIPNLLESGEIPFPEGADLDEPVRGVAG  186

Query  572   MEDFLRVRDLSPFCR------DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRT  733
             ME FLR RDL  FCR      D +L V+    A    +AR LILNT E LEG  LS IR 
Sbjct  187   MESFLRRRDLPSFCRQARDQMDRELQVMSSVTASTN-RARALILNTLESLEGSALSHIRK  245

Query  734   KYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
               P  Y +GPL+A      A  S+ S SL QED  CM WL +Q  +SV+YVSFGS++V+T
Sbjct  246   HSPVTYAVGPLNAQ-----AGTSSDSGSLWQEDRDCMTWLHAQPDRSVVYVSFGSLTVVT  300

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLV---AGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
             R++ MEFW+GLV+SG++FLWV+RSDL+    G  +E+  +P+E++E T+  G IVGWAPQ
Sbjct  301   REEYMEFWHGLVDSGQRFLWVVRSDLINMRGGGTEEKPAVPAEVEEWTRDRGCIVGWAPQ  360

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL H +VG F+THSGWNSTLE IAAG PM+CWPFFADQQ NSRFV  VW++GLDMKD+
Sbjct  361   EEVLAHPSVGCFVTHSGWNSTLECIAAGKPMLCWPFFADQQINSRFVSAVWEIGLDMKDL  420

Query  1265  CDRSSVEKLIRELMEKRKGEFLER-AENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
             C RS VEK++RE+ME  + E L R A  M ++AK++++EGG+SY +   LIQ ++
Sbjct  421   CGRSIVEKMVREVMEGERSEELRRNAREMAEMAKKSVAEGGTSYNDLQRLIQHIM  475



>ref|XP_010674287.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=492

 Score =   427 bits (1099),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 226/475 (48%), Positives = 306/475 (64%), Gaps = 23/475 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             H+LIFPLPA  HL  ML+LA LL +ANF +TF   ++ H RL   TD+++ RF   + F 
Sbjct  14    HVLIFPLPALGHLTPMLQLAELLCIANFKVTFLNTTHNHQRLTQHTDIEA-RFEQYSGFE  72

Query  227   LQSFPPGIYD-----GALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDL  391
              ++ P G+ +     G  + K + +   +SL    +P L++ +  + ++    TC I D 
Sbjct  73    FKTMPDGLSEDNPRTGQGDVKGLMISAIESLSTSAEPLLREILLGSSETA-KITCLIVDG  131

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
              +S A DV+ E   +PV  FR  SA   W+Y+ +P L EAG+LPIK   +D   +    G
Sbjct  132   WMSFASDVANEA-EVPVIIFRCSSASCNWSYYCIPKLIEAGDLPIKDEKMDE-LVDNAPG  189

Query  572   MEDFLRVRDLSPFCRDE------DLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRT  733
             M  FLR RDL  FCR++      DL   +  E +   QA   ILNTFEDLEG  LS IR+
Sbjct  190   MSSFLRYRDLPTFCRNQNTSSCQDLQDWFNGEIQQNKQAHSFILNTFEDLEGHTLSLIRS  249

Query  734   KYPNVYTIGPLHAHLKATLASKSTH-----SNSLLQEDETCMAWLDSQEPKSVIYVSFGS  898
             +   VY+IGP+HAHLK  L  + T      S++L + D +C++WLD +  KSV+YVSFGS
Sbjct  250   QCSRVYSIGPIHAHLKYKLGQQKTTLSNNFSSNLWEVDRSCISWLDRKPNKSVVYVSFGS  309

Query  899   ISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWA  1078
             ++V+T+ QL EFW GLV S K FLWV+R +L+ G +  ++  P +L EGTK  G +V WA
Sbjct  310   LTVLTKDQLREFWAGLVQSNKYFLWVIRPNLIIGSE-LDNQTPDDLLEGTKKRGCLVKWA  368

Query  1079  PQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMK  1258
             PQ+ VL H A+GGFLTHSGWNSTLESI AGVPM+CWP+F+DQQ NSRFV EVW++GLDMK
Sbjct  369   PQKEVLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWPYFSDQQVNSRFVSEVWRIGLDMK  428

Query  1259  DVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             D CDR+ VEK+I +LM+  K E     + M  LAK++ISEGGSSY N + LI+D+
Sbjct  429   DTCDRTIVEKMINDLMDGNKDELQRSMDRMSYLAKKSISEGGSSYSNLNQLIEDI  483



>ref|XP_010032068.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51453.1| hypothetical protein EUGRSUZ_J00977 [Eucalyptus grandis]
Length=479

 Score =   427 bits (1097),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 238/478 (50%), Positives = 306/478 (64%), Gaps = 36/478 (8%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT----R  220
             H++IFPL AQ H+NSMLKLA LL L+   ITF    +IH RLL   D+ + RF      R
Sbjct  10    HVVIFPLAAQGHVNSMLKLAELLALSGLRITFINSEHIHHRLLQHADIQA-RFAAYPDFR  68

Query  221   FRLQS--FP---PGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI-AQNRDSGLPFTCFI  382
             F++ S  FP   P   D AL +        + ++ I K  L++ + A +R    P TC I
Sbjct  69    FKIISDGFPIDHPRAGDHALTT-------FNYVKSITKQLLEELVSAPDR----PVTCII  117

Query  383   SDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  562
             +D ++S  +D + +   +PV  FR ISA  FW YF +P + E+G+LPIKG+      +T 
Sbjct  118   ADGILSFTIDFAGD-LGVPVIAFRTISASCFWAYFCIPRMIESGDLPIKGDEDMDRDVTS  176

Query  563   VKGMEDFLRVRDLSPFCRDEDLA---VLYYTEARL-AVQARGLILNTFEDLEGPILSQIR  730
             V GMED LR RDL  FCR  DL+   + Y T   L    AR LILN+F+ LEGP LSQIR
Sbjct  177   VPGMEDILRCRDLPSFCRVADLSDWNLQYVTTQTLRTTGARALILNSFDQLEGPALSQIR  236

Query  731   TKYPNVYTIGPLHAHLKATLASKSTHSNSLL-------QEDETCMAWLDSQEPKSVIYVS  889
             T +PN+YTIGPLH+HLK+ L+S S  S           + D +C+AWLD Q PKSV+YVS
Sbjct  237   THFPNLYTIGPLHSHLKSRLSSSSPSSPPSSSASNSLWEVDRSCIAWLDKQPPKSVVYVS  296

Query  890   FGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIV  1069
             FGSI+ + R    EFWYGLVNSG++FLWV+RSD +   +     +P EL+E     G IV
Sbjct  297   FGSITTLNRHDFTEFWYGLVNSGRRFLWVLRSDSL--PEGSSGAVPEELREAAAERGCIV  354

Query  1070  GWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGL  1249
             GWAPQE VL H A+  FLTHSGWNSTLES+ AG PM+CWPFFADQQ NSR V   WK GL
Sbjct  355   GWAPQEEVLHHGAIAAFLTHSGWNSTLESVVAGKPMVCWPFFADQQLNSRLVSHAWKAGL  414

Query  1250  DMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             DMKDVCDR  VE+++ E+M +RK EF   A ++ + A++A SEGGSS+ N D LI+D+
Sbjct  415   DMKDVCDREVVERMVNEVMGERKEEFAAAAGDLARRARDAASEGGSSWDNLDRLIEDI  472



>ref|XP_003517692.2| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=505

 Score =   427 bits (1099),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 237/474 (50%), Positives = 315/474 (66%), Gaps = 15/474 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT-TRFRL  229
             H+ IFP PAQ H+++MLKLA LL L  FHITF     IH RL    D+++   T    + 
Sbjct  32    HVAIFPCPAQGHVSTMLKLAQLLALHGFHITFLNTDFIHHRLHRFGDLEALLQTYPSLQF  91

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLP-FTCFISD-LLVSI  403
             ++FP G+      S +  V+L   +    KP ++ +I  ++D G P   CFI+D +  ++
Sbjct  92    KTFPDGLPHHHPRSGQSAVDLFQYINLHAKPHIR-HILLSQDPGKPKINCFIADGVFGAL  150

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
              +DV+ +   +P+ +FR ISA  FWTYF +P+LF++ +LPI G+      IT + GME+ 
Sbjct  151   TIDVAHQV-GIPIIHFRTISASCFWTYFCVPNLFQSNQLPITGDEDMDRVITCIPGMENM  209

Query  584   LRVRDLSPFCRDEDLAVLYYT-----EARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
              R RDL  F R     ++Y       E R ++QAR LILNTFEDLEG +LSQ+R ++P V
Sbjct  210   FRCRDLPSFSRGTGSEIVYALNSLALETRESLQARALILNTFEDLEGSVLSQMRLQFPRV  269

Query  749   YTIGPLHAHLKATLAS--KSTHSNSLLQE-DETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             +TIGPLHAHL     S  ++T S S + E D  CM WLDSQ  KSVIYVSFGSI+ +TR+
Sbjct  270   FTIGPLHAHLNTRKESNTETTPSTSCVGEVDRRCMTWLDSQPLKSVIYVSFGSIATMTRE  329

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             +L+E WYGLVNS K+FLWV+R D+V  K++ +  +P+EL+EGTK  G+IVGWAPQE VL 
Sbjct  330   KLIEIWYGLVNSKKRFLWVVRPDMVGPKENGDR-VPAELEEGTKERGFIVGWAPQEEVLA  388

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV-CDRS  1276
             H A+GGFLTHSGWNSTLES+AAGVPMIC P F DQ  NSRFV EV KVGLDMKDV CDR+
Sbjct  389   HKAIGGFLTHSGWNSTLESLAAGVPMICCPSFGDQHVNSRFVSEVCKVGLDMKDVACDRN  448

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNE  1438
              VE ++ +LM+ R   FL  A  +  LA  ++S GGSSY N D LIQ +  +++
Sbjct  449   LVENMVNDLMDHRNEVFLNSAREVALLANRSVSSGGSSYSNLDGLIQYIRSISQ  502



>ref|XP_008464906.1| PREDICTED: UDP-glycosyltransferase 85A3-like isoform X1 [Cucumis 
melo]
Length=483

 Score =   426 bits (1096),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 227/471 (48%), Positives = 300/471 (64%), Gaps = 23/471 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L F  PAQ ++N MLKLA LL L++  +TF    + + +L   +DV       RF L 
Sbjct  10    HVLFFSAPAQGNINVMLKLAQLLSLSSVRVTFLTTEHSYRQLTLHSDV-----LRRFSL-  63

Query  233   SFPP----GIYDG-ALNSKEVFV----ELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFIS  385
              FP      I DG  L+    F     E+  S   + KP  +  +     S    +C I 
Sbjct  64    -FPSFQFRTISDGLPLSHPRTFSHHLPEMFHSFVSVTKPLFRDMLVSPHFSS-DLSCLIL  121

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
             D   S  LD+ ++   +P++ FR  SAC+ WT FS+P+L + G+LPIKG       +  V
Sbjct  122   DGFFSYLLDIDDDFVKVPIFCFRTFSACSTWTIFSIPNLIKQGQLPIKGEEDMDRILDNV  181

Query  566   KGMEDFLRVRDLSPFCR----DEDLAVLYYTEARL-AVQARGLILNTFEDLEGPILSQIR  730
              GME+ LR RDL  FCR    + D  + +   A + + +   LI+NTFEDLEGPILS IR
Sbjct  182   PGMENLLRCRDLPGFCRPTDPNNDPILQFIVSAFIRSTKFNALIMNTFEDLEGPILSNIR  241

Query  731   TKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             T  PN+Y+IGPLHA LK  ++ ++   N+L + D +C+ WLD+Q   SVIYVSFGSI+V+
Sbjct  242   TLCPNLYSIGPLHALLKTKVSHETESLNNLWEVDRSCLTWLDNQPAGSVIYVSFGSITVM  301

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
               ++LMEFW+GLVNSG+ FLWV+R DLV GK+ E   IP+EL+EGTK  GY+VGW PQE 
Sbjct  302   GNRELMEFWHGLVNSGRNFLWVIRPDLVKGKNGEIE-IPAELEEGTKQRGYMVGWTPQEK  360

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNSTLESI AG PMICWPF  DQQ NSRFV  +W +GLDMKD+CD
Sbjct  361   VLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPFGFDQQVNSRFVSNMWNLGLDMKDLCD  420

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R +V K++ ++M  RK EF+  A  +  LA+ ++  GGSSY NFD LI+D+
Sbjct  421   RETVAKMVNDVMVNRKEEFVRSATEIANLARRSVKPGGSSYANFDRLIEDI  471



>ref|XP_004162780.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   426 bits (1095),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 226/472 (48%), Positives = 299/472 (63%), Gaps = 25/472 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP+PAQ H+N MLK A LL L++  +TF    + + +L   +DV       RF L 
Sbjct  10    HVLLFPVPAQGHINVMLKFAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL-  63

Query  233   SFPP----GIYDG-ALNSKEVF----VELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFIS  385
              FP      I DG  L+   +F     E+  S   + KP  +  +     S    TC I 
Sbjct  64    -FPSFQFRTISDGLPLSHPRIFAHHLTEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLIL  121

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
             D   S  LD+ ++   +P + FR   AC+ WT  S+P+L + G+LPIKG       +  V
Sbjct  122   DGFFSYLLDIDDDFVKVPTFCFRTSGACSTWTILSIPNLIKQGQLPIKGEDDMDRILDNV  181

Query  566   KGMEDFLRVRDLSPFCRDED------LAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
              GME+ LR RDL  FCR  D      L  +  T  R + +   LI+NTFEDLEGPILS I
Sbjct  182   PGMENLLRCRDLPGFCRATDPNNDPILQFIMSTFIR-STKFSALIMNTFEDLEGPILSNI  240

Query  728   RTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             RT  PN+Y+IGPLHA LK  L  ++   N+L + D +C+ WLD+Q   SVIYVSFGSI+V
Sbjct  241   RTLCPNLYSIGPLHALLKTKLTHETESLNNLWEVDRSCLTWLDNQAAGSVIYVSFGSITV  300

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +  ++LMEFW+GLVNSG+ FLWV+R DL+ G++ E   IP+EL+EGTK  GY+VGW PQE
Sbjct  301   MGNRELMEFWHGLVNSGRSFLWVIRPDLLKGENGEIE-IPAELEEGTKQRGYMVGWTPQE  359

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H AVGGFLTHSGWNSTLES+ AG PMICWP+  DQ  NSRFV  VW +GLDMKD+C
Sbjct  360   KVLCHEAVGGFLTHSGWNSTLESMVAGKPMICWPYGFDQLVNSRFVSNVWNLGLDMKDLC  419

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             DR +V K++ ++M  RK EF+  A  +  LA+++++ GGSSY NFD LI+D+
Sbjct  420   DRETVAKMVNDVMVNRKEEFVRSATEIANLARQSVNPGGSSYANFDRLIEDI  471



>ref|XP_004235101.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   426 bits (1095),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 231/471 (49%), Positives = 302/471 (64%), Gaps = 24/471 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             H+LIFPLP QS +NS L+LA LL LA   ++F   ++   RL+A ++V+S RF   T F+
Sbjct  9     HVLIFPLPLQSTINSNLQLAELLCLAGLRVSFLNTNHNQQRLVANSNVES-RFKQYTGFQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL---PFTCFISDLLV  397
               +   G+ +    S E F ++  SL+ + +P+LKQ +     SGL   P TC I D L 
Sbjct  68    FLTISDGLPEDNPRSGEQFGDIISSLQTMAEPYLKQML-----SGLVKEPITCVILDGLF  122

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
                +D+  E   +PV  F  IS   FW Y SLP L EAG LP KGN ID+  +T V  ME
Sbjct  123   YYGVDIGNE-MGVPVVIFDTISPSCFWIYLSLPKLIEAGVLPFKGNDIDAL-VTHVPAME  180

Query  578   DFLRVRDLSPFCR-----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
              FLR RDL  FC      D++   ++    R+  +A GLILN+FE+L+GP L  IR+ +P
Sbjct  181   GFLRRRDLPHFCLLDYKIDQNSQAVFKEIERIP-KAHGLILNSFEELDGPFLYNIRSYFP  239

Query  743   NVYTIGPLHAHLKATLASKST----HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
               Y IGPL  +LK  LA+K+T     SNS+ +ED T + WLD+Q   SVIYVSFGS+ V+
Sbjct  240   KTYAIGPLPLNLKTRLAAKATPLLSSSNSMWEEDHTSIKWLDAQSKGSVIYVSFGSLVVV  299

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             +R ++MEFW+GL+NS  KFLWVMR +++ G D        EL EG K  GYIV WAPQE 
Sbjct  300   SRDEIMEFWHGLMNSKVKFLWVMRPNMLKG-DASHDQFMKELVEGCKGIGYIVSWAPQEM  358

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H +VGGFLTHSGWNSTLESI  G PMICWP + DQ+  SR V E WK+GLDMKD+CD
Sbjct  359   VLAHPSVGGFLTHSGWNSTLESIIEGKPMICWPQYVDQRVTSRLVNEFWKIGLDMKDICD  418

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             R  VEKL+++LME +K E+ +  E + +LAK ++ EGG SY N DCLI D+
Sbjct  419   RFVVEKLVKDLMETKKDEYTKSVEKLSELAKLSVEEGGLSYSNLDCLINDI  469



>gb|KGN50614.1| hypothetical protein Csa_5G196570 [Cucumis sativus]
Length=485

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 228/472 (48%), Positives = 298/472 (63%), Gaps = 25/472 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP PAQ HLN MLKLA LL L++  +TF    + + +L   +DV       RF L 
Sbjct  10    HVLLFPAPAQGHLNVMLKLAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL-  63

Query  233   SFPP----GIYDG-ALNSKEVFV----ELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFIS  385
              FP      I DG  L+    F     E+  S   + KP  +  +     S    TC I 
Sbjct  64    -FPSFQFRTISDGLPLSHPRTFSHHLPEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLIL  121

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
             D   S  LD+ ++   +PV+ FR   AC+ WT  S+P+L +  +L IKG       +  V
Sbjct  122   DGFFSYLLDIDDDFVKVPVFCFRTFGACSTWTILSIPNLIKQEQLTIKGEDDMDRILDNV  181

Query  566   KGMEDFLRVRDLSPFCRDED------LAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
              GME+ LR RDL  FCR  D      L  +  T  R + +   LI+NTFEDLEGPILS I
Sbjct  182   PGMENLLRRRDLPGFCRATDPNNDPILQFIMSTFIR-STKFSALIMNTFEDLEGPILSNI  240

Query  728   RTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             RT  PN+Y+IGPLHA LK  L  ++   N+L + D +C+ WLD+Q   SVIYVSFGSI+V
Sbjct  241   RTLCPNLYSIGPLHALLKTKLNHETESLNNLWEVDRSCLTWLDNQAAGSVIYVSFGSITV  300

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +  ++L+EFW+GL NSG++FLWV+R DLV GK+ E   IP+EL+EGTK  GY+VGW PQE
Sbjct  301   MGNRELLEFWHGLFNSGRRFLWVIRPDLVKGKNGEIE-IPAELEEGTKQRGYMVGWTPQE  359

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H AVGGFLTHSGWNSTLESI AG PMICWP+  DQQ NSRFV  VW +GLDMKD+C
Sbjct  360   KVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQQVNSRFVSNVWNLGLDMKDLC  419

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             DR +V K++ ++M  RK EF+  A  +  LA+++++ GGSSY NFD L++D+
Sbjct  420   DRETVAKMVNDVMVNRKEEFVRSATEIANLARQSVNPGGSSYANFDRLVEDI  471



>ref|XP_004150245.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 228/472 (48%), Positives = 297/472 (63%), Gaps = 25/472 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP PAQ HLN MLK A LL L++  +TF    + + +L   +DV       RF L 
Sbjct  10    HVLLFPAPAQGHLNVMLKFAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL-  63

Query  233   SFPP----GIYDG-ALNSKEVFV----ELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFIS  385
              FP      I DG  L+    F     E+  S   + KP  +  +     S    TC I 
Sbjct  64    -FPSFQFRTISDGLPLSHPRTFSHHLPEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLIL  121

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
             D   S  LD+ ++   +PV+ FR   AC+ WT  S+P+L + G+L IKG       +  V
Sbjct  122   DGFFSYLLDIDDDFVKVPVFCFRTFGACSTWTILSIPNLIKQGQLTIKGEEDMDRILDNV  181

Query  566   KGMEDFLRVRDLSPFCRDED------LAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
              GME+ LR RDL  FCR  D      L  +  T  R + +   LI+NTFEDLEGPILS I
Sbjct  182   PGMENLLRCRDLPGFCRATDPNNDPILQFIMSTFIR-STKFSALIMNTFEDLEGPILSNI  240

Query  728   RTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             RT  PN+Y+IGPLHA LK  L  ++   N+L + D +C+ WLD+Q   SVIYVSFGSI+V
Sbjct  241   RTLCPNLYSIGPLHALLKTKLNHETESLNNLWEVDRSCLTWLDNQAAGSVIYVSFGSITV  300

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +  ++L+EFW+GLVNSG++FLWV+R DLV GK+ E   IP+EL+EGTK  GY+VGW PQE
Sbjct  301   MGNRELLEFWHGLVNSGRRFLWVIRPDLVKGKNGEIE-IPAELEEGTKQRGYMVGWTPQE  359

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H AVGGFLTHSGWNSTLESI AG PMICWP+  DQ  NSRFV  VW +GLDMKD+C
Sbjct  360   KVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQLVNSRFVSNVWNLGLDMKDLC  419

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             DR +V K++ ++M  RK EF+  A  +  LA+ +++ GGSSY NFD L++D+
Sbjct  420   DRETVAKMVNDVMVNRKEEFVRSATEIANLARRSVNPGGSSYANFDRLVEDI  471



>gb|KGN50615.1| UDP-glucosyltransferase family 1 protein [Cucumis sativus]
Length=485

 Score =   424 bits (1091),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 226/472 (48%), Positives = 298/472 (63%), Gaps = 25/472 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP+PAQ H+N MLK A LL L++  +TF    + + +L   +DV       RF L 
Sbjct  10    HVLLFPVPAQGHINVMLKFAELLSLSSIRVTFLTTEHSYRQLTLHSDV-----LPRFSL-  63

Query  233   SFPP----GIYDG-ALNSKEVF----VELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFIS  385
              FP      I DG  L+   +F     E+  S   + KP  +  +     S    TC I 
Sbjct  64    -FPSFQFRTISDGLPLSHPRIFAHHLTEMLHSFVSVTKPLFRDMLLSPHFSS-DLTCLIL  121

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKV  565
             D   S  LD+ ++   +P + FR   AC+ WT  S+P+L + G+LPIKG       +  V
Sbjct  122   DGFFSYLLDIDDDFVKVPTFCFRTSGACSTWTILSIPNLIKQGQLPIKGEDDMDRILDNV  181

Query  566   KGMEDFLRVRDLSPFCRDED------LAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
              GME+ LR RDL  FCR  D      L  +  T  R + +   LI+NTFEDLEGPILS I
Sbjct  182   PGMENLLRCRDLPGFCRATDPNNDPILQFIMSTFIR-STKFSALIMNTFEDLEGPILSNI  240

Query  728   RTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             RT  PN+Y+IGPLHA LK  L  ++   N+L + D +C+ WL +Q   SVIYVSFGSI+V
Sbjct  241   RTLCPNLYSIGPLHALLKTKLTHETESLNNLWEVDRSCLTWLGNQAAGSVIYVSFGSITV  300

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +  ++LMEFW+GLVNSG+ FLWV+R DL+ G++ E   IP+EL+EGTK  GY+VGW PQE
Sbjct  301   MGNRELMEFWHGLVNSGRSFLWVIRPDLLKGENGEIE-IPAELEEGTKQRGYMVGWTPQE  359

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H AVGGFLTHSGWNSTLESI AG PMICWP+  DQ  NSRFV  VW +GLDMKD+C
Sbjct  360   KVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQLVNSRFVSNVWNLGLDMKDLC  419

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             DR +V K++ ++M  RK EF+  A  +  LA+++++ GGSSY NFD LI+D+
Sbjct  420   DRETVAKMVNDVMVNRKEEFVRSATEIANLARQSVNPGGSSYANFDRLIEDI  471



>ref|XP_008811497.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=499

 Score =   425 bits (1092),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 230/480 (48%), Positives = 298/480 (62%), Gaps = 27/480 (6%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRF-TTRFR  226
              H+LIFP PAQ H+N MLKL  LL     H+TF      H RL   +   +    + RFR
Sbjct  15    AHVLIFPFPAQGHVNCMLKLGELLTKTGLHVTFLNTDYNHHRLSRYSAAYALLAESPRFR  74

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN--RDSGL--PFTCFISDLL  394
              +S P G+ D    S    ++L +SLR       ++ + +   RD G   P TC I+D +
Sbjct  75    FESIPDGLADEDPRSVLHLMDLEESLRVRSAVLYRELLIKRGRRDDGKWPPVTCVIADGI  134

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             ++ A+D++EE   +P   FR +SAC+FW YF LP L ++GELP         P+  V GM
Sbjct  135   MTFAVDIAEE-LGIPAIAFRTVSACSFWAYFRLPQLLQSGELPFPDEADLDEPVRSVPGM  193

Query  575   EDFLRVRDLSPFCR------DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTK  736
             E FLR RDL  FCR      D     +    A    +AR LILNTFE LE   LS +R+ 
Sbjct  194   EAFLRRRDLPSFCRLAGDRTDRTFEFVTTVTANTN-RARALILNTFESLEATALSHVRSH  252

Query  737   YPNVYTIGPLHAHLK----------ATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYV  886
             +P  + +GPL A L+          A   + S  S +L +ED TCM WLDSQ  KSV+YV
Sbjct  253   FPVTFAVGPLPALLRSYRSRCPSDPAVPPASSMPSATLWEEDRTCMTWLDSQPHKSVVYV  312

Query  887   SFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVA--GKDDEES-PIPSELKEGTKAN  1057
             SFGS+++++++  +EFW GLVNSG++FLWV+R DLV   G+  EE  P+  E+K GTK  
Sbjct  313   SFGSLTLVSQEAFLEFWVGLVNSGQRFLWVVRPDLVGEEGRRWEEMLPVTEEVKVGTKER  372

Query  1058  GYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVW  1237
             G +V W PQE VL H AVG FLTHSGWNSTLESI AGVPM+CWPFFADQQ NSRFV EVW
Sbjct  373   GCLVKWVPQEEVLAHPAVGCFLTHSGWNSTLESIVAGVPMLCWPFFADQQINSRFVSEVW  432

Query  1238  KVGLDMKDVCDRSSVEKLIRELME-KRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             KVGLDMKD+C RS VEK++RE+ME  R  E+   A+ M K+A+E+++EGGSSY +F  LI
Sbjct  433   KVGLDMKDLCSRSIVEKMVREMMEGPRAEEWRRSAKEMAKMARESVAEGGSSYTDFRRLI  492



>ref|XP_010923185.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   423 bits (1088),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 227/475 (48%), Positives = 305/475 (64%), Gaps = 19/475 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLL--ALTDVDSGRFTTRFR  226
             H+LIFP PAQ H+ +MLKLA L  LA   ITF     IH RLL  + T     R   RFR
Sbjct  9     HVLIFPFPAQGHVPTMLKLAELFLLAGLRITFINTERIHRRLLLNSPTLPPLARLP-RFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLR-RIGKPFLKQYIAQNRDSG--LPFTCFISDLLV  397
              ++ P G+ +    +     EL +S+R R  +P+        RD       TC ++D  +
Sbjct  68    FRTIPDGLPEDDRRASVPLQELEESIRTRSREPYRDLLAPAGRDPDEWPSVTCVVADGSL  127

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
              ++ +V+EE   +PV +FR  SACAFW Y+ +PDL + GE+P          +  V GME
Sbjct  128   PLSWEVAEEV-GIPVIFFRTSSACAFWAYYRIPDLIKGGEIPFPEEADWDEKVRGVPGME  186

Query  578   DFLRVRDLSPFCRD----EDLAVLYYTEARLAVQ-ARGLILNTFEDLEGPILSQIRTKYP  742
              FLR RDL  FCR+     D  +     A  + + AR LILNTFE LEGP+LS IR+  P
Sbjct  187   SFLRRRDLPSFCRNAKTTSDRGLQSVDNATASTRRARALILNTFESLEGPVLSHIRSAIP  246

Query  743   NVYTIGPLHAHLKATLASKS---THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
               Y +GPLH  +K      S    +S  L QED +CM WLDSQ P+SV+YVSFGS++V++
Sbjct  247   ITYALGPLHLLVKTFENGGSFVTINSVRLSQEDRSCMTWLDSQPPRSVVYVSFGSVAVMS  306

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             R++LMEFW+GLV+SG++FLWV+RSDLV GK  E   +P+E  EGT+  G IVGWAPQE V
Sbjct  307   REELMEFWHGLVDSGERFLWVLRSDLVEGKTGEA--VPAE-AEGTRERGCIVGWAPQEEV  363

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVG FLTHSGWNSTLES++AGVPMICWP FADQQ NSRFV +VW++G DMKD C+R
Sbjct  364   LSHPAVGCFLTHSGWNSTLESVSAGVPMICWPCFADQQINSRFVSDVWRIGADMKDKCER  423

Query  1274  SSVEKLIRELMEKRKGEFLE-RAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             S VEK++R++M + + E L   A  M +LA+ ++++GGSSY ++  L++ +  ++
Sbjct  424   SIVEKMVRDVMVRERAERLRTSAMEMAELARRSVAKGGSSYRDYWSLVEHIRAIS  478



>ref|XP_009804549.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=487

 Score =   423 bits (1088),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 225/469 (48%), Positives = 298/469 (64%), Gaps = 16/469 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSG-RFTTRFRL  229
             H+L+FPLP QS +NSML+LA L  LA   +TF   ++    LL  T+V+S  R   RFR 
Sbjct  7     HVLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQKLLLQHTNVESRFRQYPRFRF  66

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRD--SGLPFTCFISDLLVSI  403
             ++   G+      S   F EL  SL+ + +PFL++ +  + D  +  P TC I D L   
Sbjct  67    RTISDGLPVENPRSSVQFGELISSLQAVAEPFLREILLSSSDGVTEPPVTCVIPDGLFYY  126

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
             A+DV  E   +PV  F  IS C  W Y  +P L +AGE+P KGN +D      V GM+  
Sbjct  127   AVDVGNE-IGVPVIPFDTISPCCLWVYLCIPKLIQAGEVPFKGNDLDVL-FENVAGMQGL  184

Query  584   LRVRDLSPFCRDEDLAVLYYTEARLA-----VQARGLILNTFEDLEGPILSQIRTKYPNV  748
             LR RD  PF R  D A   Y +  L       Q+ GLILNTFEDL+GP+LS IR+  P  
Sbjct  185   LRRRDF-PFYRLIDYATDPYCQIALKEVESIPQSNGLILNTFEDLDGPLLSLIRSHCPQT  243

Query  749   YTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             Y IGPLH HLK  LA K    S  SNSL +ED + + WLD+Q  +SVIYVSFGS++ +++
Sbjct  244   YAIGPLHLHLKTKLAEKRMPISASSNSLWEEDHSSIQWLDAQPIESVIYVSFGSMATLSK  303

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             ++++EFW+GLVNSG +FLWV+RS+L+ G++        EL EG K   YIV WAPQE VL
Sbjct  304   EEILEFWHGLVNSGIRFLWVIRSNLLRGEEWNHQ-FAKELAEGCKERAYIVSWAPQEEVL  362

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H A+GGFLTHSGWNST+ESI  G PMICW  + DQ+  SRFV EVWK+G+DMKD+CDR 
Sbjct  363   AHSAIGGFLTHSGWNSTMESIVQGKPMICWAVYVDQRVTSRFVSEVWKIGVDMKDICDRY  422

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              +EK++++LM   + EF + AE +  LAKE++ EGGSSY   +CL+ D+
Sbjct  423   IIEKMVKDLMVTNRDEFKKSAEKLSNLAKESVGEGGSSYNALECLVDDI  471



>ref|XP_009589440.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=488

 Score =   421 bits (1081),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 222/479 (46%), Positives = 301/479 (63%), Gaps = 17/479 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSG-RFTTRFRL  229
             H+L+FPLP QS +NSML LA L  LA   +TF   ++    LL  T+V+S  R   RFR 
Sbjct  7     HVLLFPLPIQSPINSMLHLAELFCLAGLQVTFLNTNHNQKLLLRHTNVESRFRQYPRFRF  66

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL---PFTCFISDLLVS  400
             ++   G+ +    S   F EL  SL+ + +PFL++ +  +   G+   P TC I D L  
Sbjct  67    RTISDGLPEENPRSSVQFGELISSLQAVAEPFLREILLSSSSDGVTEPPVTCVIPDGLFY  126

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  580
              A+D+  E   +PV  F  IS C  W Y  +P L +A E+P KGN +D+     V GM+ 
Sbjct  127   YAVDIGNE-IGVPVIPFDTISPCCLWVYLCIPKLIQAEEIPFKGNDLDAL-FENVAGMQG  184

Query  581   FLRVRDLSPFCRDEDLAVLYYTEARLA-----VQARGLILNTFEDLEGPILSQIRTKYPN  745
              LR RD  PF R  D A   Y +  L       ++ GLILNTFEDL+GP+LS IR+    
Sbjct  185   LLRRRDF-PFYRLIDYATDPYCQIALKEVESIPRSNGLILNTFEDLDGPLLSLIRSHCQQ  243

Query  746   VYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              Y IGPLH HLK  LA K    S  SNSL +ED + + WLD+Q  +SVIYVSFGS++ ++
Sbjct  244   TYAIGPLHLHLKTKLAEKRMPISASSNSLWEEDHSSIQWLDAQPIESVIYVSFGSMATLS  303

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             +++++EFW+GLVNSG +FLWVMRS+L+ G++     +  EL EG     YIV WAPQE V
Sbjct  304   KEEILEFWHGLVNSGIRFLWVMRSNLLRGEESNHQFV-KELAEGCIERAYIVSWAPQEKV  362

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H A+GGFLTHSGWNST+ESI  G PMICW  + DQ+  SRFVGEVWK+G+DMKD+CDR
Sbjct  363   LAHSAIGGFLTHSGWNSTMESIVQGKPMICWAVYVDQRVTSRFVGEVWKIGVDMKDICDR  422

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATRE  1450
               +EK++++LM   + EF + AE +  LAKE++ +GGSSY    CL+ D+ K+    ++
Sbjct  423   YIIEKMVKDLMVTNRDEFKKSAEKLSNLAKESVGDGGSSYNALQCLVDDVKKLGRKGKD  481



>ref|XP_010923184.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   421 bits (1081),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 225/480 (47%), Positives = 306/480 (64%), Gaps = 23/480 (5%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTD-VDSGRFTTRFR  226
              H+L+ P PAQ H+  MLK A LL  A   +TF    NIH R LA +  +       RFR
Sbjct  7     AHVLVSPFPAQGHVPPMLKFAELLAHAGLRVTFVNTDNIHRRFLASSPALQRLAGLPRFR  66

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ---NRDSGLPFTCFISDLLV  397
              ++ P G  +        F++L +SLR   +   ++ +     + D   P +C ++D ++
Sbjct  67    FRTIPDGFPEDHPRPFLEFLDLEESLRTRSREHYRELLVPTDPDPDGWPPVSCVVADGML  126

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG---NGIDSSPITKVK  568
              +A +V+ E   +P+ +FR   A A W Y  +PDL E G +P      +G+D + I  V 
Sbjct  127   RLASEVAAE-MEIPLIFFRTSGAGAVWAYLCVPDLIEGGVIPFPAEEEDGLDET-IRGVP  184

Query  569   GMEDFLRVRDLSPFCRD----EDLAVLYYTEARLAVQ-ARGLILNTFEDLEGPILSQIRT  733
             GME FLR RDL  FCR+     D  +L+ T A   V+  RGLILNTFE LEGP+LS IR+
Sbjct  185   GMEGFLRRRDLPSFCRNAKSTSDRPLLFVTNANANVRRGRGLILNTFESLEGPVLSHIRS  244

Query  734   KYPNVYTIGPLHAHLKA-----TLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGS  898
               PN+Y +GPLH   +A          S++S SL QED +C+ WLDSQ  +SV+Y+SFGS
Sbjct  245   AIPNIYALGPLHLLSRAFGDCGANVPFSSNSTSLWQEDRSCLKWLDSQPQRSVVYISFGS  304

Query  899   ISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWA  1078
             ++V++R +LMEFW+GLV+SGK+FLWV+R DLV GK +E      EL++ T+  G +VGWA
Sbjct  305   VTVMSRDELMEFWHGLVDSGKRFLWVVRPDLVEGKIEEAM---QELEKETRERGCVVGWA  361

Query  1079  PQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMK  1258
             PQE VL H AVG FLTHSGWNSTLES+AAGVPMICWPFFADQQ NSR VGEVW++GLDMK
Sbjct  362   PQEEVLAHPAVGCFLTHSGWNSTLESVAAGVPMICWPFFADQQVNSRLVGEVWRIGLDMK  421

Query  1259  DVCDRSSVEKLIRELMEKRKGEFLER-AENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             D  +RS VE+++RE+ME  + E L R A  M + A+ +I EGGSSY  F+ L++ +  ++
Sbjct  422   DKHERSVVERMVREVMEGDRAEELRRSAGEMAEHARRSIEEGGSSYRGFENLVEHIKAIS  481



>ref|XP_008359771.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
 ref|XP_008368325.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   420 bits (1079),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 221/475 (47%), Positives = 297/475 (63%), Gaps = 22/475 (5%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              H+L+ P PAQ H+  ML  A LL  A  H+TF    + H RLL      S RF T    
Sbjct  12    AHVLLLPFPAQGHITPMLSFAQLLCHAGIHVTFLSTEHNH-RLLTQRRALSARFPT-LHF  69

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI-----AQNRDSGL------PFTC  376
             +S P G+      +     ++  SLR + KP L+  +       N   G       P +C
Sbjct  70    ESIPDGLPPDHPRTIPPLDDIVSSLRSVTKPLLRDLLITLTKKDNESXGATTTPRPPLSC  129

Query  377   FISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPI  556
              I D ++  A+D++EE   +PV+  R +SAC+FW Y  +PDL + G+LP +   +D  PI
Sbjct  130   VIIDGIMCFAIDMAEEV-GIPVFALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMDH-PI  187

Query  557   TKVKGMEDFLRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
               + GME  LR+RDL  FCR   D      +  +     +   +ILNTF+DLE  ILSQI
Sbjct  188   RDIPGMEALLRLRDLPSFCRMPIDHPSFKFFMEQIEAITRVSAIILNTFDDLEPLILSQI  247

Query  728   RTKYPNVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
              T++P +YT+GP HA LK+ +    S+  +SL  ED  CMAWLDSQ+  SVI+VSFGS++
Sbjct  248   ATRFPKIYTLGPFHALLKSRVGDDLSSSVSSLRHEDRRCMAWLDSQQSGSVIFVSFGSLA  307

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
              ++R QL+EFW+GL+NSGK FLWV+RSD+++    EE   P EL++GTK  GYI  W PQ
Sbjct  308   KLSRVQLLEFWHGLINSGKPFLWVVRSDMLSSGQ-EERATPVELEDGTKERGYIAEWVPQ  366

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL H AVGGF THSGWNST+E I AGVPM+CWP  ADQQ NSR+VGE WK+GLDMKD 
Sbjct  367   EEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNSRWVGEGWKIGLDMKDT  426

Query  1265  CDRSSVEKLIRELMEK--RKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             CDRS+VEK++R LME+  ++ +  +  +N  KLA+ A+SE GSSY N + LI+D+
Sbjct  427   CDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSSYKNLEKLIEDL  481



>ref|XP_008388093.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   420 bits (1079),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 221/475 (47%), Positives = 297/475 (63%), Gaps = 22/475 (5%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              H+L+ P PAQ H+  ML  A LL  A  H+TF    + H RLL      S RF T    
Sbjct  12    AHVLLLPFPAQGHITPMLSFAQLLCHAGIHVTFLSTEHNH-RLLTQRRALSARFPT-LHF  69

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI-----AQNRDSGL------PFTC  376
             +S P G+      +     ++  SLR + KP L+  +       N   G       P +C
Sbjct  70    ESIPDGLPPDHPRTIPPLDDIVSSLRSVTKPLLRDLLITLTKKDNESCGATTTPRPPLSC  129

Query  377   FISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPI  556
              I D ++  A+D++EE   +PV+  R +SAC+FW Y  +PDL + G+LP +   +D  PI
Sbjct  130   VIIDGIMCFAIDMAEE-VGIPVFALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMDH-PI  187

Query  557   TKVKGMEDFLRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
               + GME  LR+RDL  FCR   D      +  +     +   +ILNTF+DLE  ILSQI
Sbjct  188   RDIPGMEALLRLRDLPSFCRMPIDHPSFKFFMEQIEAITRVSAIILNTFDDLEPLILSQI  247

Query  728   RTKYPNVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
              T++P +YT+GP HA LK+ +    S+  +SL  ED  CMAWLDSQ+  SVI+VSFGS++
Sbjct  248   ATRFPKIYTLGPFHALLKSRVGDDLSSSVSSLRHEDRRCMAWLDSQQSGSVIFVSFGSLA  307

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
              ++R QL+EFW+GL+NSGK FLWV+RSD+++    EE   P EL++GTK  GYI  W PQ
Sbjct  308   KLSRVQLLEFWHGLINSGKPFLWVVRSDMLSSGQ-EERATPVELEDGTKERGYIAEWVPQ  366

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL H AVGGF THSGWNST+E I AGVPM+CWP  ADQQ NSR+VGE WK+GLDMKD 
Sbjct  367   EEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNSRWVGEGWKIGLDMKDT  426

Query  1265  CDRSSVEKLIRELMEK--RKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             CDRS+VEK++R LME+  ++ +  +  +N  KLA+ A+SE GSSY N + LI+D+
Sbjct  427   CDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSSYKNLEKLIEDL  481



>ref|XP_006362115.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=489

 Score =   419 bits (1078),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 226/467 (48%), Positives = 298/467 (64%), Gaps = 18/467 (4%)
 Frame = +2

Query  56    ILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FRL  229
             +LIFPLP QS +NS L+LA LL LA   +TF   ++   RL+  ++V+S RF     FR 
Sbjct  11    VLIFPLPLQSTINSNLQLAELLCLAGLRVTFLNTNHNQQRLVGNSNVES-RFKQYPGFRF  69

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIAL  409
              +   G+ D    S E F ++  SL+ + +P LKQ ++       P TC I D L    +
Sbjct  70    LTLSDGLPDDHPRSVEQFGDILSSLQTMAEPLLKQMLSALVKE--PVTCVILDGLFYYGV  127

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  589
             D+  E   +PV  F  IS   FW Y SLP L EAG LP KGN +D+  +T +  ME  LR
Sbjct  128   DIGNE-MGVPVITFDTISPSCFWIYLSLPKLIEAGVLPFKGNDLDAL-VTHLPAMEGLLR  185

Query  590   VRDLSPFC-----RDEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
              RDL  FC      D++   ++    RL  +A GLILN+FEDL+GP LS +R+ +P  Y 
Sbjct  186   RRDLPHFCLLDYKTDQNSQAVFKEIERLP-KAHGLILNSFEDLDGPFLSSVRSYFPKTYA  244

Query  755   IGPLHAHLKATLASKST----HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             IGPL  +LK+ LA+K+T     SNSL +ED T + WL++Q   SVIYVSFGS+ V++R +
Sbjct  245   IGPLPLNLKSRLAAKATPLLSSSNSLWEEDHTSIKWLNAQSNGSVIYVSFGSLLVVSRDE  304

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
             +MEFW+GL+NS  KFLWVMR +++ G D        EL EG+K  GYIV WAPQ+ VL H
Sbjct  305   MMEFWHGLMNSKVKFLWVMRPNMLKG-DVSRDQFMKELVEGSKGIGYIVSWAPQKMVLAH  363

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              +VGGFLTHSGWNSTLESI  G PMICWP + DQ+  SR V E WK+GLDMKD+CDR  V
Sbjct  364   PSVGGFLTHSGWNSTLESIIEGKPMICWPQYVDQRVTSRLVNEFWKIGLDMKDICDRFVV  423

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             EK++++LME +K E+ +  E + KLAK ++ EGG SY N DCLI D+
Sbjct  424   EKMVKDLMETKKDEYKKSVEKLSKLAKLSVQEGGLSYSNLDCLINDI  470



>ref|XP_006361974.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=378

 Score =   415 bits (1067),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 213/392 (54%), Positives = 275/392 (70%), Gaps = 23/392 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++IFP PAQ H+NSMLKLA LL L+NF +TF V  + H R++   DV S RF + F LQ
Sbjct  6     HVIIFPFPAQGHVNSMLKLAQLLSLSNFDVTFLVTVDTHDRVVNHIDVLS-RFGSVFHLQ  64

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALD  412
             + P GI    +N+++    L  SL  I KPFL+++I  +       TC I D ++S+A D
Sbjct  65    ALPHGISMDGVNTRDGISMLYYSLNTIAKPFLREFIPNSS-----VTCLIVDGILSMAAD  119

Query  413   VSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRV  592
             V+EE  NLP+ YFR +SA +FW+YF +P+L +AGELP+K N  D + +TKVKGMEDFLR 
Sbjct  120   VAEE-INLPIIYFRTVSASSFWSYFCIPELIQAGELPLKENAKDLT-LTKVKGMEDFLRG  177

Query  593   RDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIG  760
             RDL  FC+  DL      +  TE R   +A+GLILNTFEDLE           P+ ++  
Sbjct  178   RDLPSFCQASDLTNPDFRIVMTETRQTPRAQGLILNTFEDLE----------RPHTFSNS  227

Query  761   PLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWY  940
              +HAHLKA LA+KST SN+L QEDE CM+WLD+Q PKS+IYVSFGS++ +T+++L+EFWY
Sbjct  228   NVHAHLKAKLATKSTSSNNLWQEDERCMSWLDTQPPKSMIYVSFGSVAGLTKEELLEFWY  287

Query  941   GLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGF  1120
             GLVNS +KFLWVMR DL+ G++ ++  I  EL++GTKA GY+  W PQE VL H  +GGF
Sbjct  288   GLVNSEQKFLWVMRPDLIIGQERKDE-ISVELEQGTKARGYMADWVPQEKVLAHREIGGF  346

Query  1121  LTHSGWNSTLESIAAGVPMICWPFFADQQTNS  1216
             LTHSGWNSTLESI  GV MICWP FADQQ NS
Sbjct  347   LTHSGWNSTLESIVEGVSMICWPRFADQQVNS  378



>ref|XP_002530397.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF31967.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=479

 Score =   418 bits (1075),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 230/468 (49%), Positives = 302/468 (65%), Gaps = 16/468 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFP P Q H+NSMLKLA LL LA   ITF     IH  L   +DV + RF     F+
Sbjct  12    HVLIFPAPGQGHVNSMLKLAELLALAGLKITFLNFEYIHENLFRCSDVQA-RFDKYPGFQ  70

Query  227   LQSFPPGIYDGAL--NSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVS  400
              ++ P    +G    N+ +   EL ++++   KP  K+ + +   +  P  C I D+L+ 
Sbjct  71    FKTIPNCWPEGRRIGNTSDTLRELLEAMKMQSKPIFKKILVECNITA-PINCIIGDMLMG  129

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  580
                DV+ E   +P   F  ISAC+  T+ S+PD+  A ELP+KG       ITKV GME+
Sbjct  130   FVYDVASEV-GIPAIQFHTISACSVLTFLSIPDVLAAQELPVKGKEDMDRLITKVPGMEN  188

Query  581   FLRVRDLSPFCRD-EDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTI  757
             FLR RDL  FC++  D ++L  T+     QA  LILNTFE+L+  IL+QIRT YP  YTI
Sbjct  189   FLRRRDLPDFCQEASDPSLLIITKEMRESQA--LILNTFEELDKEILAQIRTHYPKTYTI  246

Query  758   GPLHAHLKATLASKS-----THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             GPLH  LK+ L S       T SNS+++ D +C+ WLD Q  +SV++VSFGS +++TR Q
Sbjct  247   GPLHMLLKSRLTSIKKQELYTTSNSIVEVDRSCINWLDKQPKRSVLFVSFGSTTLMTRDQ  306

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKD-DEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             +MEFW+G+VNS  +FLWV+R   +  KD D+      E + G K +GYIV WAPQE VL 
Sbjct  307   MMEFWHGIVNSKIRFLWVLRPQSITAKDGDDLERFLDEFEVGPKESGYIVRWAPQEEVLG  366

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H A GGFLTHSGWNSTLESIAAGVPMICWP++ DQQ NSRFV  VWKVGLDMKDVCDR  
Sbjct  367   HKATGGFLTHSGWNSTLESIAAGVPMICWPYYGDQQVNSRFVSAVWKVGLDMKDVCDREI  426

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             VEK++ +LM  RK EF+  +  M + AK ++ +GGSS+CN + LI+D+
Sbjct  427   VEKMVIDLMVNRKEEFVGSSTRMAEAAKNSVKDGGSSFCNLESLIKDI  474



>gb|AGZ84549.1| glycosyltransferase KGT31 [Pueraria montana var. lobata]
Length=479

 Score =   418 bits (1075),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 222/473 (47%), Positives = 302/473 (64%), Gaps = 11/473 (2%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS-GRFTTRFR  226
              H+++FP P + ++NSMLKLA LL L +FH+TF    N H R      +++  +     +
Sbjct  4     AHVVLFPGPVKGNVNSMLKLAQLLALHDFHVTFLNTENNHHRFHRFGHIEALSQTYPTLQ  63

Query  227   LQSFPPGI-YDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSI  403
              ++ P G+ +    +     V+L  S+    KP L++ +          TC I D  ++ 
Sbjct  64    FKTIPDGLPHHHPRSGDHALVDLYASMNSHAKPLLREILLSQTPQKPRVTCLIGDGFLAA  123

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
                   +   +P+ +F  I   +FW  F  P+LF++ ELPI+G       IT + GME+ 
Sbjct  124   LAADVADEVGIPLIHFFAIGVSSFWALFCAPNLFQSNELPIRGEEDMDRIITTLPGMENL  183

Query  584   LRVRDLSPFCRDEDLAVL-----YYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
             LR RDL  F R  +  ++        E+   + ARGLILNTFED++GP+LSQIR K P V
Sbjct  184   LRCRDLPSFYRGAESHMVDPLKSKVFESHQTLGARGLILNTFEDIDGPVLSQIRLKIPQV  243

Query  749   YTIGPLHAHLKATLAS--KSTHSNSLLQE-DETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             + +GPLHAHL +   S  K+T S S   E D  C+ WLDSQ  KSVIYVSFGSI+ +TR+
Sbjct  244   FAVGPLHAHLNSRRVSDAKTTPSTSSFWEVDRGCLTWLDSQPLKSVIYVSFGSITTLTRE  303

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             +L+EFWYGLV+S K+FLWV+R D+VAGK+++   IP EL+EGTK  G +VGWAPQE  L 
Sbjct  304   RLLEFWYGLVDSKKRFLWVVRPDMVAGKEND-GRIPEELEEGTKERGLMVGWAPQEEALA  362

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H A+GGFLTHSGWNSTLES+ AGVPMICWP+FADQQ NSRFV EVWK+GLDMKDVCDR  
Sbjct  363   HKAIGGFLTHSGWNSTLESLVAGVPMICWPYFADQQVNSRFVNEVWKLGLDMKDVCDRHV  422

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNE  1438
             VE ++ +LM  R+ EFL  A+ M  LA +++S  GSSY + D LIQ +  +++
Sbjct  423   VENMVNDLMVHRRDEFLRSAQAMAMLAHKSVSPSGSSYSSLDQLIQYIKSISQ  475



>ref|XP_008785470.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=489

 Score =   418 bits (1074),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 225/481 (47%), Positives = 308/481 (64%), Gaps = 28/481 (6%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTD-VDSGRFTTRFR  226
              H+L+ P PAQ H+  MLKLA +L  A  H+TF    NIH R LA +  +       RFR
Sbjct  7     AHVLVSPFPAQGHVPPMLKLAEILSHAGLHVTFVNTDNIHRRFLASSPALQRLAGLPRFR  66

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLLV  397
              ++ P G+ +        F++L +SLR   +   ++ +    ++ D   P TC ++D ++
Sbjct  67    FRTIPDGLPEDHPRPFLQFLDLEESLRTRSREHYRELLVPTGKDPDGWPPVTCAVADGIL  126

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-------NGIDSSPI  556
              +A +V+ E   +PV + R   ACA W Y  +PDL + GE+P          +G+D + I
Sbjct  127   RLASEVAAE-MEIPVIFVRTSGACAVWAYLCIPDLIKGGEIPFPEEEEEKEEDGLDET-I  184

Query  557   TKVKGMEDFLRVRDLSPFCRD----EDLAVLYYTEARLAVQ-ARGLILNTFEDLEGPILS  721
               V GME FLR RDL  FCR+     D ++ + T A   V+  RGLILNTFE LEGP+LS
Sbjct  185   RGVPGMEGFLRRRDLPSFCRNAKSTSDRSLQFVTNANANVRRGRGLILNTFEALEGPVLS  244

Query  722   QIRTKYPNVYTIGPLHAHLKATL------ASKSTHSNSLLQEDETCMAWLDSQEPKSVIY  883
              IR+  P  Y +GPLH  L  T       A  S++S SL QED +C+ WLDSQ  +SV+Y
Sbjct  245   HIRSAIPISYALGPLHL-LSRTFDDCGADAPLSSNSASLWQEDRSCLKWLDSQPQRSVVY  303

Query  884   VSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGY  1063
             +SFGS+++++R +LMEFW+GLV+SGK+FLWV+R DL  GK +E   I  +L++ TK  G 
Sbjct  304   ISFGSVTMMSRDELMEFWHGLVDSGKRFLWVVRPDLAEGKIEEA--IQEDLEKETKERGC  361

Query  1064  IVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKV  1243
             +VGWAPQE VL H AV  FLTHSGWNSTLES+AAGVPMICWPFFADQ  NSRFVG+VW+ 
Sbjct  362   LVGWAPQEEVLAHPAVACFLTHSGWNSTLESVAAGVPMICWPFFADQPVNSRFVGDVWRF  421

Query  1244  GLDMKDVCDRSSVEKLIRELMEKRKGEFLER-AENMGKLAKEAISEGGSSYCNFDCLIQD  1420
             G+DMKD   RS VE+++RE+ME  + E L R A  M +LA+ ++ EGGSSY +F+ L++D
Sbjct  422   GVDMKDKRGRSVVERMVREVMEGERAEELRRSAGEMAELARRSVGEGGSSYRDFENLVKD  481

Query  1421  M  1423
             +
Sbjct  482   I  482



>ref|XP_010666054.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=495

 Score =   418 bits (1075),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 220/489 (45%), Positives = 303/489 (62%), Gaps = 29/489 (6%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLAN---FHITFFVPSNIHARLLALTDVDSGRFTT  217
             I HILIFPLP Q  +NSMLKLA L+ LA+    HITF     +H RL+   +  S RF +
Sbjct  7     IAHILIFPLPIQGPVNSMLKLAELILLASDAQIHITFLTTELVHRRLMLHANAAS-RFES  65

Query  218   R--FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSG---LPFTCFI  382
                F L++F  G+ +      + F E+ D++  + +P L++ +  +R +    +P TC I
Sbjct  66    YPGFSLRTFSDGLPEDHPRGSDKFGEMVDAVEAVSRPLLREMLVTDRANSPQEIPITCII  125

Query  383   SDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  562
              D   + ALDV +E   +PV YF  IS    W Y  LP L E GE+P + N  +   I  
Sbjct  126   PDGSYNFALDVGKEV-GIPVIYFDTISPSCLWVYLCLPKLIEDGEVPFQENW-EMEAIVG  183

Query  563   VKGMEDFLRVRDLSPFCRDEDLA--VLYYTEARLAVQAR---GLILNTFEDLEGPILSQI  727
             V G+   LR RD   FCR  + A  V+    ++ A Q R   G ILNTFEDLE P+LS +
Sbjct  184   VPGIGTLLRRRDFPDFCRANNPASDVMIQRISKQAKQFRKASGFILNTFEDLEAPLLSYM  243

Query  728   RTKYPNVYTIGPLHAHLKATLASKSTH---------SNSLLQEDETCMAWLDSQEPKSVI  880
             R+ +PN+Y +GPLH HLK  +  K T          SNSL  ED++C+ WLD+Q  +SVI
Sbjct  244   RSHFPNMYVVGPLHLHLKERILRKETTTSTTLLSYCSNSLWHEDKSCIEWLDAQPLRSVI  303

Query  881   YVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDE----ESPIPSELKEGT  1048
             + SFGS   +T++QLMEFW GLVNSG +FLW+ R   V G DD+    +  IPS L +G 
Sbjct  304   FCSFGSHVCLTKEQLMEFWQGLVNSGTRFLWIKRQRSVTGMDDDVHKWQEQIPSGLLKGM  363

Query  1049  KANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVG  1228
             K NGY+  WAPQE VL H ++GGFLTHSGWNSTLESI  G PM+CWP++ DQ   SR+V 
Sbjct  364   KENGYVTSWAPQEEVLSHPSIGGFLTHSGWNSTLESIVEGKPMLCWPYYVDQLIISRYVS  423

Query  1229  EVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDC  1408
              VWKVGLDMKD+CDR  +E ++R+LM++R+GE+ +    +  LA++++ E GSSYC+ + 
Sbjct  424   HVWKVGLDMKDICDRDIIENMVRDLMDRRRGEYSQNVNALAYLARQSVHEDGSSYCSLNK  483

Query  1409  LIQDMIKVN  1435
             L+ D++ + 
Sbjct  484   LVDDIMSLK  492



>ref|XP_010674284.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   416 bits (1070),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 226/476 (47%), Positives = 299/476 (63%), Gaps = 25/476 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+  ML LA LL LAN  +TF   +  H  L   T++++ RF     F 
Sbjct  9     HVLIFPLPIQGHITPMLNLAELLCLANLKVTFLNTTQNHKLLTRNTNIEA-RFARYPGFV  67

Query  227   LQSFPPGIYD-----GALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL-PFTCFISD  388
                 P G+ D     G    K+   EL + L   G+P L++ +  +  +G+   TC I D
Sbjct  68    FSIVPDGLADEHPRAGVSKFKDWSSELVEKLALSGEPLLREMLVGS--TGIDKVTCLIID  125

Query  389   LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVK  568
               +S A +V+ E   +PV  FR  S C  WTYF +P L +AG++P K + +D   +    
Sbjct  126   GWISFANEVANE-VEVPVIAFRCSSPCYMWTYFCIPKLIQAGDIPFKDDKMDEL-VENAP  183

Query  569   GMEDFLRVRDLSPFCRD------EDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIR  730
             GM  FLR R L  FCR+      +DL      E +   QA   ILNTFEDLEGP LS IR
Sbjct  184   GMSSFLRYRGLPTFCRNHDTSSCQDLKDWLIGEIQRNKQAHSFILNTFEDLEGPTLSLIR  243

Query  731   TKYPNVYTIGPLHAHLKATLASKSTH-----SNSLLQEDETCMAWLDSQEPKSVIYVSFG  895
             ++   VY+IGPLHAHLK  L  + T      S++L + D +C++WLD +  KSV+YVSFG
Sbjct  244   SQCSRVYSIGPLHAHLKYKLDQQKTTLSNNFSSNLWEVDRSCISWLDQKPNKSVVYVSFG  303

Query  896   SISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGW  1075
             S++V+T+ QL EFW GLV S K FLWV+R +L+ G + + S  P +L EGT+  G +V W
Sbjct  304   SLTVLTKDQLREFWAGLVQSNKYFLWVIRPNLIIGSELDNS-TPDDLLEGTEKRGCLVKW  362

Query  1076  APQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDM  1255
             APQ+ VL H A+GGFLTHSGWNSTLESI AGVPM+CWP+FADQQ NSRFV EVW++GLDM
Sbjct  363   APQKEVLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWPYFADQQVNSRFVSEVWRIGLDM  422

Query  1256  KDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             KD CDR+ VEK+I +LM+ +  E     + M  LAK++ISEGGSSY N + LI+D+
Sbjct  423   KDTCDRTIVEKMINDLMDGKNDELQRSMDRMSYLAKKSISEGGSSYSNLNQLIEDI  478



>ref|XP_004512576.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cicer arietinum]
Length=473

 Score =   414 bits (1065),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 230/464 (50%), Positives = 296/464 (64%), Gaps = 20/464 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LIFP PAQ H+NSMLKLA LL L N +ITF     IH RL+   D       T  +F+
Sbjct  12    HVLIFPCPAQGHVNSMLKLAELLALQNMNITFLNTEYIHNRLIRFNDSIQALSLTYPKFQ  71

Query  227   LQSFPPGIYDGALNSK--EVFVELCDSLRRIGKPFLKQYIAQNRDSGLP-FTCFISD-LL  394
              ++ P   +D   +    E   ++  SL   GKP+L+  I     S +P  +C I D + 
Sbjct  72    FKTIP-DFHDEEKHPGFGEKIGDVIMSLSLNGKPYLRDMIV----SEVPKISCIILDGVF  126

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
               +  D++ E F + + +FR ISAC FW Y  +P L E+ E+PI+G+      I    GM
Sbjct  127   GDLVTDLASE-FGIQLIHFRTISACCFWAYLCVPKLLESNEIPIRGDEDMDRIIRNAPGM  185

Query  575   EDFLRVRDLSPFCRD--EDLAV-LYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
             E+ LR RDL  F R+   +L++       + + +A  LILNTFEDLE PILSQIR  +P 
Sbjct  186   ENVLRCRDLPSFFRENKHNLSLDKLVVRTQQSFKANALILNTFEDLESPILSQIRLHFPK  245

Query  746   VYTIGPLHAHLKATLASKSTHSNS-LLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             +YTIGPLH HL  T  + +T  NS L Q D TCM WLDSQ  KSVIYVSFGS + +  ++
Sbjct  246   LYTIGPLHHHLNNTKKTTTTLINSNLFQVDRTCMTWLDSQPLKSVIYVSFGSTTPMKSEE  305

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
             ++E W+GL+NS K+FLWV+R ++V GK+     +  EL+E TK  G IVGW PQE VL H
Sbjct  306   VIEIWHGLMNSEKRFLWVIRPNMVQGKE----VLLKELEEKTKERGLIVGWVPQEEVLAH  361

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              A+G FLTHSGWNSTLES+  GVPMICWPFFADQQ NSRFV EVWK+GLDMKDVCDR  V
Sbjct  362   KAIGAFLTHSGWNSTLESVVCGVPMICWPFFADQQINSRFVSEVWKIGLDMKDVCDRKVV  421

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             E ++ +LM  RK EFL+ A  M KL+ +++S  GSSY NF  LI
Sbjct  422   ENMVNDLMVNRKEEFLKSAMEMSKLSCKSVSPSGSSYDNFQALI  465



>ref|XP_003613025.1| UDP-glucuronosyltransferase 1-1 [Medicago truncatula]
 gb|AES95983.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=475

 Score =   412 bits (1060),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 226/470 (48%), Positives = 289/470 (61%), Gaps = 28/470 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+LIFP PAQ H+NSMLKLA LL + N +ITF     IH RL+   D          +LQ
Sbjct  12    HVLIFPCPAQGHVNSMLKLAELLAIQNIYITFLNTKYIHNRLIQFNDDIQALLECYPKLQ  71

Query  233   SFPPGIYDGALNSK-----EVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISD-LL  394
                  I D     K     E   ++  SL   GKP LK  I   +      +C I D + 
Sbjct  72    F--KTISDFHSEEKHPGFGERIGDVITSLSLYGKPLLKDIIVSEK-----ISCIILDGIF  124

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
               +A D++ E F + + +FR IS+C FW YF +P L E  ELPI+G+      IT + GM
Sbjct  125   GDLATDLAAE-FGIQLIHFRTISSCCFWAYFCVPKLLECNELPIRGDEDMDRIITNIPGM  183

Query  575   EDFLRVRDLSPFCRDEDLAVLYYTEARL----AVQARGLILNTFEDLEGPILSQIRTKYP  742
             E+ LR RDL  FCR+     +   +  L    +++A   ILNTFEDLE  +LSQIR  +P
Sbjct  184   ENILRCRDLPSFCRENKKDHIRLDDVALRTKQSLKANAFILNTFEDLEASVLSQIRIHFP  243

Query  743   NVYTIGPLHAHLKATLASKSTHSNSLLQE----DETCMAWLDSQEPKSVIYVSFGSISVI  910
              +YTIGPLH  L  T  S    S          D TCMAWLDSQ  KSVIYVSFGS + +
Sbjct  244   KLYTIGPLHHLLNTTKKSSFPSSFFSKSNFFKVDRTCMAWLDSQPLKSVIYVSFGSTTPM  303

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGT-KANGYIVGWAPQE  1087
              R++++E W+GL+NS K+FLWV+R ++V     +E  + SEL+EGT K  G IVGW PQE
Sbjct  304   KREEIIEIWHGLLNSKKQFLWVIRPNMV-----QEKGLLSELEEGTRKEKGLIVGWVPQE  358

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H A+G FLTH+GWNSTLES+  GVPMICWP+FADQQ NSRFV +VWK+GLDMKDVC
Sbjct  359   EVLSHKAIGAFLTHNGWNSTLESVVCGVPMICWPYFADQQINSRFVSDVWKLGLDMKDVC  418

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             DR  VE ++ ++M  RK EF+  A ++ KLA +++S GGSSY NF  LIQ
Sbjct  419   DRKVVENMVNDVMVNRKEEFVRSAMDIAKLASKSVSPGGSSYNNFQDLIQ  468



>emb|CAN77812.1| hypothetical protein VITISV_010344 [Vitis vinifera]
Length=642

 Score =   416 bits (1069),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 221/451 (49%), Positives = 284/451 (63%), Gaps = 32/451 (7%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+N MLKLA LL LA   ITF      H RLL  T++   R+T    FR
Sbjct  9     HVLIFPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNI-LDRYTRYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+      +     ++ D ++   KP  ++ +     S  P TC I+D L+S A
Sbjct  68    FQTISNGLPLDRPWTGAGLRDMMDGIKATTKPLFREMVISWCQSSDPVTCIIADGLMSFA  127

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +DV+ E   +P+   R +S C F  YFS  +L EAGE+P K + +D   +T+V GME FL
Sbjct  128   IDVANEV-GVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRL-VTRVPGMEGFL  185

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  F R  D          TE +   +A  LILNTFEDL+GPILSQIR   P +YT
Sbjct  186   RRRDLPSFXRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIRNHCPKIYT  245

Query  755   IGPLHAHLKATLASKSTHS---NSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQL  925
             IGPLHAHLK+ LAS++T S   NS  +ED +C+AWLD Q  KS IYVSFGSI+VIT++Q+
Sbjct  246   IGPLHAHLKSRLASETTTSQFSNSFWEEDRSCLAWLDRQPSKSXIYVSFGSITVITKEQM  305

Query  926   MEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHL  1105
             MEFW+                    + D E  + ++L+E TK  G IV WAPQE VL H 
Sbjct  306   MEFWH--------------------EKDGEFQLQAQLREVTKERGQIVDWAPQEEVLAHP  345

Query  1106  AVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVE  1285
             AVGGFLTH GWNSTLESI AGVPMICWP+F+DQQ NSRFV  VWK G+DMKD CDR +VE
Sbjct  346   AVGGFLTHGGWNSTLESIVAGVPMICWPYFSDQQLNSRFVSHVWKXGMDMKDTCDRITVE  405

Query  1286  KLIRELMEKRKGEFLERAENMGKLAKEAISE  1378
             K++R++ME+R+ EF +  + M KLA+ ++SE
Sbjct  406   KMVRDVMEERRAEFTKSVDAMAKLARSSLSE  436



>ref|XP_009589441.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=477

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 218/479 (46%), Positives = 295/479 (62%), Gaps = 28/479 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSG-RFTTRFRL  229
             H+L+FPLP QS +NSML LA L  LA   +TF   ++    LL  T+V+S  R   RFR 
Sbjct  7     HVLLFPLPIQSPINSMLHLAELFCLAGLQVTFLNTNHNQKLLLRHTNVESRFRQYPRFRF  66

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL---PFTCFISDLLVS  400
             ++   G+ +    S   F EL  SL+ + +PFL++ +  +   G+   P TC I D L  
Sbjct  67    RTISDGLPEENPRSSVQFGELISSLQAVAEPFLREILLSSSSDGVTEPPVTCVIPDGLFY  126

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  580
              A+D+  E   +PV  F  IS C  W Y  +P L +A E+P K             GM+ 
Sbjct  127   YAVDIGNE-IGVPVIPFDTISPCCLWVYLCIPKLIQAEEIPFKA------------GMQG  173

Query  581   FLRVRDLSPFCRDEDLAVLYYTEARLA-----VQARGLILNTFEDLEGPILSQIRTKYPN  745
              LR RD  PF R  D A   Y +  L       ++ GLILNTFEDL+GP+LS IR+    
Sbjct  174   LLRRRDF-PFYRLIDYATDPYCQIALKEVESIPRSNGLILNTFEDLDGPLLSLIRSHCQQ  232

Query  746   VYTIGPLHAHLKATLASK----STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              Y IGPLH HLK  LA K    S  SNSL +ED + + WLD+Q  +SVIYVSFGS++ ++
Sbjct  233   TYAIGPLHLHLKTKLAEKRMPISASSNSLWEEDHSSIQWLDAQPIESVIYVSFGSMATLS  292

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             +++++EFW+GLVNSG +FLWVMRS+L+ G++     +  EL EG     YIV WAPQE V
Sbjct  293   KEEILEFWHGLVNSGIRFLWVMRSNLLRGEESNHQFV-KELAEGCIERAYIVSWAPQEKV  351

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H A+GGFLTHSGWNST+ESI  G PMICW  + DQ+  SRFVGEVWK+G+DMKD+CDR
Sbjct  352   LAHSAIGGFLTHSGWNSTMESIVQGKPMICWAVYVDQRVTSRFVGEVWKIGVDMKDICDR  411

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATRE  1450
               +EK++++LM   + EF + AE +  LAKE++ +GGSSY    CL+ D+ K+    ++
Sbjct  412   YIIEKMVKDLMVTNRDEFKKSAEKLSNLAKESVGDGGSSYNALQCLVDDVKKLGRKGKD  470



>ref|XP_008370121.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 214/480 (45%), Positives = 293/480 (61%), Gaps = 25/480 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+++ PLP+Q H   ML LA LL  A  H+TF +  + H+ L    D  S RF T    +
Sbjct  9     HVVLLPLPSQGHFTPMLSLAQLLCHAGIHVTFLITKHSHS-LFTQRDALSARFPT-LHFE  66

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI-------------AQNRDSGLPFT  373
             S P G+            E+  SLR   KPFL++ +                R    P  
Sbjct  67    SIPDGLPPDHGRKFSALHEVGASLRSTIKPFLRELLISLTKKDDETSNDGSTRRRLPPLR  126

Query  374   CFISD-LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSS  550
             C + D + +  A+DV+EE   +P++  R  SAC+FW Y  +PDL + G+LP +   +D  
Sbjct  127   CMVIDGIFMCFAIDVAEEV-GIPIFALRTTSACSFWCYTCIPDLIQQGQLPFQDEDMDQ-  184

Query  551   PITKVKGMEDFLRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILS  721
             PI  + GME  LR RDL  FC+   D      +  E     +   LILNTF+DLE PILS
Sbjct  185   PIRDIPGMESLLRRRDLPSFCKMPIDHPTFKFFVEEFEAITRVSALILNTFDDLESPILS  244

Query  722   QIRTKYPNVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGS  898
              I T++P +YT+GP HA LK+ + +  S+ ++SL  +D  CM WLDSQ+ +SVI+VSFGS
Sbjct  245   HIATRFPKIYTLGPFHALLKSRIGNDLSSSASSLRHQDRRCMTWLDSQQLRSVIFVSFGS  304

Query  899   ISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWA  1078
             +  +TR QL+EFW+GL++SGK FLWV+RSD++   + E      +L+ GTK  G+I  W 
Sbjct  305   LVKLTRVQLLEFWHGLIDSGKPFLWVIRSDML-WNEQEAHATSVKLEVGTKEKGFIAEWV  363

Query  1079  PQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMK  1258
             PQE VL H A+GGFLTHSGWNST+E I AGVPM+CWP  ADQ  NSR+VGE WK+GLDMK
Sbjct  364   PQEEVLAHKAIGGFLTHSGWNSTIEGIWAGVPMLCWPQIADQPVNSRWVGEGWKIGLDMK  423

Query  1259  DVCDRSSVEKLIRELMEK--RKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKV  1432
             D CDRS+VEK++R LME+  R  +  +  +   KLA+ A++E GSSY N + LI+D+ K+
Sbjct  424   DTCDRSTVEKMVRALMEEGDRSAQIFKSVDTFAKLARHAVNEDGSSYKNLEKLIEDVKKL  483



>ref|XP_009781211.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=352

 Score =   405 bits (1040),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 260/349 (74%), Gaps = 13/349 (4%)
 Frame = +2

Query  44    FIGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRF  223
             F+ H+ IFP PAQ H+NSMLKLA LL L+NFH++F V  + H RLL  TDV S RF + F
Sbjct  6     FVLHVAIFPFPAQGHVNSMLKLAQLLSLSNFHVSFLVTVDTHDRLLNHTDVLS-RFGSEF  64

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSI  403
              LQ+ P GI    +N+++   +L DSL  I KPFL++++A+      P TC I+D ++S+
Sbjct  65    HLQALPDGISLDEMNTRDGVGKLYDSLNTIAKPFLREFLAEP-----PVTCVIADGILSM  119

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
             A DV+EE  NLP+ YFR ISACAFW+YFS+P+L +A ELP+K NG+D + +TKVKGMEDF
Sbjct  120   AADVAEE-INLPIIYFRTISACAFWSYFSIPELLQASELPLKLNGMDIT-LTKVKGMEDF  177

Query  584   LRVRDLSPFCRDEDLAV----LYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVY  751
             LR RDL  FCR  DL      L  TE R   +ARGLILNTFEDLEGPIL+QIRT  PNVY
Sbjct  178   LRGRDLPSFCRVSDLTSADFRLLSTETRQTPRARGLILNTFEDLEGPILTQIRTVCPNVY  237

Query  752   TIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLME  931
             TIGP+HAHLKA LA+K T SNSL QEDE+C+ WLD+Q PKSV+YVSFGSI+ +TR++L+E
Sbjct  238   TIGPVHAHLKARLATKCTSSNSLWQEDESCINWLDTQPPKSVLYVSFGSIAGVTREELLE  297

Query  932   FWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWA  1078
             FWYGLVNS + FLWVMR+ L+ G++ +   IP EL++GTKA GY+  W 
Sbjct  298   FWYGLVNSDQNFLWVMRAGLIMGQEVKHE-IPVELEQGTKARGYMADWV  345



>emb|CDP14405.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   403 bits (1036),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 201/343 (59%), Positives = 247/343 (72%), Gaps = 22/343 (6%)
 Frame = +2

Query  428   FNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP----------ITKVKGME  577
               +P  YFR + AC+FW  F + D+ +AGE+P+KG   D             +T V GME
Sbjct  1     MGIPFIYFRTVGACSFWANFCIQDVIDAGEIPLKGKDEDKVSYRNKKEMDLMVTSVAGME  60

Query  578   DFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
              +LR RDL  F R  D+         +E R +V+AR L+LN+FEDLEGPIL QIR   P 
Sbjct  61    GYLRRRDLPAFFRVADVNNPGLQTIKSETRRSVKARALLLNSFEDLEGPILDQIRKHMPI  120

Query  746   VYTIGPLHAHLKATLA-SKST------HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
             +++IGPLHAHLK  +A SKST      HS S  +ED +C+ WL+SQ  KSVIYVSFGS++
Sbjct  121   LFSIGPLHAHLKVRIAASKSTTEKSMGHSGSFWEEDRSCIEWLNSQPDKSVIYVSFGSVT  180

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
             ++TR +L+EFWYGLVNSG+ FLWVMR D V GKD   S +P E++EGTKA GYIVGWAPQ
Sbjct  181   IMTRDELLEFWYGLVNSGQMFLWVMRPDSVIGKDGV-SHLPVEIEEGTKARGYIVGWAPQ  239

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL H A GGFLTH GWNSTLESI AG+PMICWP+FADQ  NSRFV EVWK+GLDMKD 
Sbjct  240   EEVLAHPATGGFLTHCGWNSTLESINAGIPMICWPYFADQTINSRFVDEVWKLGLDMKDT  299

Query  1265  CDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSY  1393
             CDR +VE ++R+LME RK EFL++AE+M  LAK+A+SEGGSSY
Sbjct  300   CDRVTVEIMVRDLMEVRKDEFLKKAEHMANLAKKAVSEGGSSY  342



>ref|XP_010688868.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=509

 Score =   409 bits (1050),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 222/483 (46%), Positives = 298/483 (62%), Gaps = 27/483 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHL---LDLANFHITFFVPSNIHARLLALTDVDSGRFTT--  217
             H++IFPLP Q  +N MLKLA L   L  A   +TF     IH+RLL L    + R +   
Sbjct  16    HVVIFPLPIQGPVNCMLKLADLILTLSHATISVTFLTTEFIHSRLL-LHSTAAARLSDTA  74

Query  218   -RFRLQSFPPGI-YDGALNSKEVFVELCDSLR---RIGKPFLKQYIAQNR---DSGLPFT  373
               FR ++ P G+  D          +L  +L    +     L++ +A      +S    T
Sbjct  75    PHFRFETVPDGLGLDENPRGSSQLADLTMTLEGQAQAKGSRLREVLAYGSVEPESKKVVT  134

Query  374   CFISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP  553
             C I+D      +DV++E   +P+ YF  IS C  WTY  +P++  A +LP +G     + 
Sbjct  135   CIIADGFFGCMVDVAKE-LKVPLVYFETISPCGLWTYLCVPNMIRACDLPFQGEEDLDAA  193

Query  554   ITKVKGMEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILS  721
             +T V GME +LR RDL  FCR    +  +  L   EA+   +A+G ILNTF+ LEG   +
Sbjct  194   VTSVPGMETYLRRRDLPSFCRAYNPNSPVIQLVLKEAQTFSRAQGHILNTFDKLEGEFFT  253

Query  722   QIRTKYPNVYTIGPLHAHLKATLASKS--THSNSLLQEDETCMAWLDSQEPKSVIYVSFG  895
              ++   PN+Y IGPLH +LK  +  +S  + SNSL QED +C+ WLD+Q  KSV++VS G
Sbjct  254   HMQALCPNLYNIGPLHLNLKCRIKQESAKSFSNSLWQEDRSCLGWLDAQPQKSVLFVSIG  313

Query  896   SISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEE------SPIPSELKEGTKAN  1057
             S++V+T+ QLME W GL+NS  +FLWV R+D +   ++EE      S +PSE+ EG K  
Sbjct  314   SLAVMTKDQLMEIWCGLINSKTRFLWVRRADSIIKSNNEEADQSQYSEVPSEVIEGIKDR  373

Query  1058  GYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVW  1237
             G IV WAPQE VL H A+GGFLTHSGWNSTLESI AGVPMICWPFF DQQ NSR V EVW
Sbjct  374   GCIVRWAPQEEVLAHKAIGGFLTHSGWNSTLESIVAGVPMICWPFFVDQQVNSRVVSEVW  433

Query  1238  KVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             K+GLDMKD C+R  +EK+I++LM  RK EFL RA+ MGKLA +A+ E GSSY + + LI 
Sbjct  434   KIGLDMKDNCNRVVIEKMIKDLMGTRKDEFLARADEMGKLAAQAVVEDGSSYNSLNRLID  493

Query  1418  DMI  1426
             D++
Sbjct  494   DIM  496



>ref|XP_010032067.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51452.1| hypothetical protein EUGRSUZ_J00976 [Eucalyptus grandis]
Length=513

 Score =   409 bits (1050),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 224/468 (48%), Positives = 297/468 (63%), Gaps = 19/468 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H++IFPL AQ H+NSMLKL  LL ++   ITF    +IH RLL    + +  F     FR
Sbjct  47    HVIIFPLAAQGHVNSMLKLTELLAISGLRITFINSEHIHHRLLRHAHIQA-HFAAFPDFR  105

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI-AQNRDSGLPFTCFISDLLVSI  403
              +    G         + F+   + ++ I K   ++ + A +R    P TC I+D +++ 
Sbjct  106   FKIISDGFPIDHPRPPDHFMTTFNYVKSITKQLFEELVSAPDR----PVTCIIADGILTF  161

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
              +D + +   +PV  FR ISA +FW  F +P + E+G+LP+KG+      +T V GMED 
Sbjct  162   TIDFAGD-LGVPVIAFRTISASSFWACFCIPRMIESGDLPLKGDEDMDRDVTSVPGMEDI  220

Query  584   LRVRDLSPFCRDEDLA--VLYYTEARLAVQA--RGLILNTFEDLEGPILSQIRTKYPNVY  751
             LR RDL  FCR  DL+   L Y   +       R LILNTF+ LEGP +SQIRT++PN+Y
Sbjct  221   LRCRDLPSFCRVADLSDQFLQYVTTQTLQTTAARALILNTFDQLEGPAISQIRTQFPNLY  280

Query  752   TIGPLHAHLKATLASKSTHSNSLL----QEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             TIGPLH+HL++ L+S S   +S      + D +C+AWLD Q PKSVIYVSFGSI+ + R 
Sbjct  281   TIGPLHSHLRSRLSSSSPSPSSASNSLWKVDRSCIAWLDKQPPKSVIYVSFGSIATLNRH  340

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
                EFWYGLVNSG++FLWV+R D +A  +     +P EL+E     G IVGWAPQE VL 
Sbjct  341   DFTEFWYGLVNSGRRFLWVVRPDSLA--EGSSGAVPEELREAAAERGCIVGWAPQEEVLH  398

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H AV  FLTHSGWNSTLES+ AG PM+CWPFFADQQ NSR V   WKVGLDMKDVCDR  
Sbjct  399   HGAVAAFLTHSGWNSTLESVVAGKPMVCWPFFADQQVNSRLVSHAWKVGLDMKDVCDREV  458

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             VE+++ E+M +R+ EF   A ++ + A+ A SEGGSS+ N D LI+D+
Sbjct  459   VERMVNEVMGERQEEFAAAAGDLARRARNAASEGGSSWDNLDRLIEDI  506



>dbj|BAB86920.1| glucosyltransferase-2 [Vigna angularis]
Length=485

 Score =   407 bits (1047),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 216/470 (46%), Positives = 299/470 (64%), Gaps = 22/470 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLD------LANFHITFFVPSNIHARLLALTDVDSGRFT  214
             H+L+ P P Q ++NSM+KLA          L++       P       L+ T++   R  
Sbjct  13    HVLLLPGPMQGNVNSMMKLAPSSSASLPHHLSHHRFHPPPPPPFRRHPLSFTNLPQPR--  70

Query  215   TRFRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISD-L  391
              +  L+  P    D   + +    +L  S+    KP ++  I     +    TC I D  
Sbjct  71    DQDHLRCLPD---DHPRSDRNALADLYSSMNSHAKPLIRDIILSQTAAKPKITCLIGDGF  127

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
                +  DV++E   +PV +FR ISA  FW  F  P+LFE+ ELPI+G       I  + G
Sbjct  128   FGGLTADVADEV-GIPVIHFRAISASCFWALFCAPNLFESNELPIRGEEDMDRIIATLPG  186

Query  572   MEDFLRVRDLSPFCRDEDLAVLYYTEARL-----AVQARGLILNTFEDLEGPILSQIRTK  736
             ME+ LR RDL  F R  +  ++   ++ +      ++ARG+ILNTFEDL+GP+L+Q+R K
Sbjct  187   MENILRCRDLPGFFRGTETNLVDPLKSTVFDCHQTLRARGVILNTFEDLDGPLLTQMRLK  246

Query  737   YPNVYTIGPLHAHL---KATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             +  V+ +G LHAHL   + + A  +  ++S  +ED +C+ WLDSQ  KSV+YVSFGSI+ 
Sbjct  247   FLRVFAVGSLHAHLNYRRVSDAKTTPSTSSFWEEDRSCLTWLDSQPLKSVLYVSFGSITT  306

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +TR++LMEFWYGLVNS K+FLWV+R D+VAG D++E  + +EL+EGTK  G+IVGWAPQE
Sbjct  307   VTRERLMEFWYGLVNSKKRFLWVIRPDMVAGADNDER-VAAELEEGTKERGFIVGWAPQE  365

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H A+GGFLTHSGWNSTLES+ AGVPMICWP FADQQ NSRFV EVWK+GLDMKD+C
Sbjct  366   EVLAHKAIGGFLTHSGWNSTLESLVAGVPMICWPCFADQQINSRFVSEVWKLGLDMKDLC  425

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             DR  VEK++ +LM  R+ EFL+ A+ M  LA +++S GGSSY +   L++
Sbjct  426   DRDVVEKMVNDLMVHRREEFLKSAQAMATLADKSVSPGGSSYSSLHDLVE  475



>ref|XP_006481394.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Citrus sinensis]
Length=469

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 210/470 (45%), Positives = 288/470 (61%), Gaps = 20/470 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTR  220
             + H+++FP PA  H+  ML LA L   A F +TF      H RLL   DV     RF   
Sbjct  6     VPHVVLFPYPAYGHIKPMLTLAELFSHAGFRVTFVNTEQYHDRLLGNNDVTGFYKRFPN-  64

Query  221   FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVS  400
             FR  S P G+            +   S + + K    Q +      GL  TC ISD ++S
Sbjct  65    FRFTSIPDGLPPDNPRFGIYIKDWFCSDKPVSKLAFLQLLMS---PGLLPTCIISDSIMS  121

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  580
               +DV+EE  N+P+  FRP SA   W+ F    L E GELP+     D  P+  + G+E+
Sbjct  122   FTIDVAEE-LNIPIITFRPYSAHCSWSDFHFSKLAEEGELPVTNENFDK-PVKCIPGLEN  179

Query  581   FLRVRDLSPFCRD----EDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
             F R RDL   CRD    + +   +  +     +   L++NTF ++EGPI+S++ ++   +
Sbjct  180   FFRNRDLPSICRDGGPDDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKLGSRLTKI  239

Query  749   YTIGPLHAHLKATLASKSTHSNS-------LLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             YT+GPLHA LK+ +   S  S+        L +ED +CM WLDSQ  +SV+YVSFGS   
Sbjct  240   YTVGPLHALLKSRIQEDSAESSPPESNNCVLSKEDRSCMTWLDSQPSRSVLYVSFGSFIK  299

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             + R+Q++EFW+G+VNSGK+FLWV+RSDL+ G+     P+P EL++GTK  G IV WAPQE
Sbjct  300   LGREQILEFWHGMVNSGKRFLWVIRSDLIDGEPGV-GPVPVELEQGTKERGCIVSWAPQE  358

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H A+GGFLTHSGWNSTLES+ AGVPMICWP   DQQ NSR V E+WK+GLDMKD C
Sbjct  359   EVLAHQAIGGFLTHSGWNSTLESLVAGVPMICWPQIGDQQVNSRCVSEIWKIGLDMKDTC  418

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             DRS++E L+R+LM+ ++ + +E    + K+A++A+ EGGSSY N D LI+
Sbjct  419   DRSTIENLVRDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLDKLIK  468



>ref|XP_008353149.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 217/475 (46%), Positives = 290/475 (61%), Gaps = 22/475 (5%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              H+L+ P PAQ H+  ML LA LL  A  H+TF    + H RLL      S RF T    
Sbjct  12    AHVLLLPFPAQGHITPMLSLAQLLCHAGIHVTFLSTEHNH-RLLTQRRALSARFPT-LHF  69

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGL--------PFTC  376
             +S P  +      +     ++  SLR + KP L+  +   A+  D           P +C
Sbjct  70    ESIPDALPPDQPPAIHSLHDISSSLRSVTKPLLRDLLITLAKKDDESYRSTTIRCPPLSC  129

Query  377   FISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPI  556
              I D ++  A+D +EE   +PV   R +SAC+FW Y  +PDL + G+LP +   +D  PI
Sbjct  130   VIIDGIMCFAIDXAEE-VGIPVXALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMDH-PI  187

Query  557   TKVKGMEDFLRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
               + GME  LR RDL  FCR   D      +  +     +   +I NTF+DL   IL QI
Sbjct  188   RDIPGMEALLRXRDLPSFCRMPIDHPSFKFFMEQIEAITRVSAIIXNTFDDLXPXILXQI  247

Query  728   RTKYPNVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
              T++  +YT+GP HA LK+ +    S+  +SL  ED  CMAWLDSQ+  SVI+VSFGS++
Sbjct  248   ATRFXKIYTLGPXHALLKSRVGDDLSSSVSSLRHEDRRCMAWLDSQQSGSVIFVSFGSLA  307

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
              ++R QL+EFW+GL+NSGK FLWV+RSD++     EE   P EL++GTK  GYI  W PQ
Sbjct  308   KLSRVQLLEFWHGLINSGKPFLWVVRSDMLXSGQ-EEXATPVELEDGTKERGYIAEWVPQ  366

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL H AVGGF THSGWNST+E I AGVPM+CWP  ADQQ NSR+VGE WK+GLDMKD 
Sbjct  367   EEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNSRWVGEGWKIGLDMKDT  426

Query  1265  CDRSSVEKLIRELMEK--RKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             CDRS+VEK++R LME+  ++ +  +  +N  KLA+ A+SE GSSY N + LI+D+
Sbjct  427   CDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSSYKNLEKLIEDL  481



>ref|XP_008388092.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 217/475 (46%), Positives = 289/475 (61%), Gaps = 22/475 (5%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              H+L+ P PAQ H+  ML LA LL  A  H+TF      H R L      S RF T    
Sbjct  12    AHVLLLPFPAQGHITPMLSLAQLLCHAGIHVTFLSTEXNH-RXLTQRRALSARFPT-LHF  69

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGL--------PFTC  376
             +S P  +      +     ++  SLR + KP L+  +   A+  D           P +C
Sbjct  70    ESIPDALPPDQPPAIHSLHDISSSLRSVTKPLLRDLLITLAKKDDESYRSTTIRCPPLSC  129

Query  377   FISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPI  556
              I D ++  A+DV+EE   +PV   R +SAC+FW Y  +PDL + G+LP +   +D  PI
Sbjct  130   VIIDGIMCFAIDVAEE-VGIPVLALRTVSACSFWCYSCIPDLIQQGQLPFQDQDMDH-PI  187

Query  557   TKVKGMEDFLRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
               + GME  LR RDL  FCR   D      +  +     +   +I NTF+DL   IL QI
Sbjct  188   RDIPGMEALLRXRDLPSFCRMPIDHPSFKFFMEQIEAITRVSAIIXNTFDDLXPXILXQI  247

Query  728   RTKYPNVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
              T++  +YT+GP HA LK+ +    S+  +SL  ED  CMAWLDSQ+  SVI+VSFGS++
Sbjct  248   ATRFXKIYTLGPXHALLKSRVGDDLSSSVSSLRHEDRRCMAWLDSQQSGSVIFVSFGSLA  307

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
              ++R QL+EFW+GL+NSGK FLWV+RSD++     EE   P EL++GTK  GYI  W PQ
Sbjct  308   KLSRVQLLEFWHGLINSGKPFLWVVRSDMLXSGQ-EEXATPVELEDGTKERGYIAEWVPQ  366

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL H AVGGF THSGWNST+E I AGVPM+CWP  ADQQ NSR+VGE WK+GLDMKD 
Sbjct  367   EEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNSRWVGEGWKIGLDMKDT  426

Query  1265  CDRSSVEKLIRELMEK--RKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             CDRS+VEK++R LME+  ++ +  +  +N  KLA+ A+SE GSSY N + LI+D+
Sbjct  427   CDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSSYKNLEKLIEDL  481



>gb|KHG01936.1| UDP-glycosyltransferase 85A1 [Gossypium arboreum]
Length=913

 Score =   419 bits (1077),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 216/441 (49%), Positives = 289/441 (66%), Gaps = 17/441 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSG--RFTTRFR  226
             H+L+FP P Q H+NSM+KLA LL LA F +TF      H RL+   ++ +   R+   F 
Sbjct  13    HVLVFPFPLQGHINSMIKLAELLALAGFKLTFLNSHYNHERLVKFNNIAAHFERYQG-FE  71

Query  227   LQSFPPGIYDGALNSKEVFVELCD-SLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSI  403
              ++   G+      S   F+++ + +L    KP L++ +    +   P  C I+D  +  
Sbjct  72    FKTITDGLPLDHPRSGNWFLDMYEEALEMKMKPGLREML---ENISPPVDCIIADGFLGF  128

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
             A+DV++E   +P+ YFR  S C+FW Y+S+PD+ +AGELPIKG+      +T V GME +
Sbjct  129   AIDVAKE-LEIPIIYFRTSSPCSFWVYYSIPDIIQAGELPIKGSEDMDRLLTTVPGMETY  187

Query  584   LRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVY  751
              R RDL  FCR+ D+      LY  + + + QA  LILNT E+L+GPILSQIRTK P VY
Sbjct  188   FRCRDLPSFCRETDIEDSIIKLYVKQTQKSSQADALILNTAEELDGPILSQIRTKCPRVY  247

Query  752   TIGPLHAHLKATLASKSTHS-----NSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
              IGPLHA L   L +K   S     N+L + D++C+ WLD Q  +SVIYVSFGSI+  +R
Sbjct  248   AIGPLHAQLNTRLKAKHGESYDHFSNTLWEVDKSCIFWLDKQPNRSVIYVSFGSITSTSR  307

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +QL+E WYGL+NS  KFL V+R + V GKD E   +  EL E +K  GYIV WAPQEAVL
Sbjct  308   EQLVELWYGLLNSKTKFLLVVRPNSVIGKDGEGEDVVVELMEKSKDQGYIVNWAPQEAVL  367

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
             +H  VGGF TH+GWNSTLESI AGVPMICWP+FADQQ NSR V EVWK+GLDMKDVCD+ 
Sbjct  368   NHPTVGGFFTHNGWNSTLESIVAGVPMICWPYFADQQVNSRVVSEVWKIGLDMKDVCDKK  427

Query  1277  SVEKLIRELMEKRKGEFLERA  1339
              VEK+++++M  +K EF++ A
Sbjct  428   IVEKMVKDVMVDQKEEFVQSA  448


 Score =   382 bits (981),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 274/443 (62%), Gaps = 20/443 (5%)
 Frame = +2

Query  134   FHITFFVPSNIHARLLALTDVDS--GRFTTRFRLQSFPPGIYDGALNSKEVFVELCDS--  301
             F +TF    + H RL+  T + +   R+   F L++   G+      S   F+E  +   
Sbjct  463   FKLTFLNSHHNHERLIKFTSIVAYFKRYPG-FELKTITDGLPLDHPRSGNWFLETYEEAI  521

Query  302   LRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALDVSEECFNLPVYYFRPISACAFWT  481
             L +I + F +  I  N     P  C I+D     A+DV+ E   +P+  FR  S  +FW 
Sbjct  522   LMKIKQSFREMMINSNP----PVDCVIADGFSGYAIDVANE-LGIPIIGFRTSSPRSFWV  576

Query  482   YFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCRDEDL----AVLYYTE  649
             Y+S+ D+ +AGELPI+G+      IT V GME +LR RDL  FCR  D+      L   +
Sbjct  577   YYSITDIIKAGELPIRGSEDMDRLITTVPGMETYLRCRDLPSFCRKPDIEDSTVQLIVKQ  636

Query  650   ARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKATLASK-----STHSN  814
              R + QA  LI NT ++L+ PILSQIRTK  N+Y IGPLHA L   L +K        SN
Sbjct  637   TRKSTQADALIFNTTDELDEPILSQIRTKCANIYPIGPLHAQLNTRLKAKHGESFDQFSN  696

Query  815   SLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLV  994
             +L +ED++C+ WLD Q  +SVIYVSFGSI+  +R QL+E WYGL+NS  KFL+V+R D V
Sbjct  697   TLREEDKSCIPWLDKQPNRSVIYVSFGSITSTSRDQLVELWYGLLNSKTKFLFVVRPDSV  756

Query  995   AGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVP  1174
              GKD E      EL E +K  GYIV WAPQE VL+H AVGGFLTHSGWNSTLESI AGVP
Sbjct  757   IGKDGEGEDFVKELMEKSKDRGYIVDWAPQEVVLNHEAVGGFLTHSGWNSTLESIVAGVP  816

Query  1175  MICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGK  1354
             M+CWP+FADQQ  SR V  VWK+GLDMKDV DR  VEK++ ++M  +K EF+  A +M K
Sbjct  817   MVCWPYFADQQVTSRVVSTVWKIGLDMKDVSDRKIVEKMVNDVMVDQK-EFVNSATDMAK  875

Query  1355  LAKEAISEGGSSYCNFDCLIQDM  1423
             +  + +S GGSS  N D LI+D+
Sbjct  876   VINQCVSIGGSSSNNLDRLIEDI  898



>ref|XP_006429244.1| hypothetical protein CICLE_v10013877mg [Citrus clementina]
 gb|ESR42484.1| hypothetical protein CICLE_v10013877mg [Citrus clementina]
Length=477

 Score =   405 bits (1042),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 210/472 (44%), Positives = 288/472 (61%), Gaps = 20/472 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTR  220
             + H+++ P PA  H+  ML LA L   A F +TF      H RLL   DV     RF   
Sbjct  6     VPHVVLLPYPAYGHIKPMLTLAELFSHAGFRVTFVNTEQYHDRLLGNNDVTGFYKRFPN-  64

Query  221   FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVS  400
             FR  S P G+            +   S + + K    Q +      GL  TC ISD ++S
Sbjct  65    FRFTSIPDGLPPDNPRFGIYIKDWFCSDKPVSKLAFLQLLMS---PGLLPTCIISDSIMS  121

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  580
               +DV+EE  N+P+  FRP SA   W+ F    L E GELP+     D  P+  + G+E+
Sbjct  122   FTIDVAEE-LNIPIITFRPYSAHCSWSDFHFSKLAEEGELPVTNENFDK-PVKCIPGLEN  179

Query  581   FLRVRDLSPFCRD----EDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
             F R RDL   CRD    + +   +  +     +A  L++NTF ++EGPI+S++ ++   +
Sbjct  180   FFRNRDLPSICRDGGPDDPILQTFIRDTSATTRASALVINTFNEIEGPIISKLGSRLTKI  239

Query  749   YTIGPLHAHLKATLASKSTHSNS-------LLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             YT+GPLHA LK+ +   S  S+        L +ED +CM WLDSQ  +SV+YVSFGS   
Sbjct  240   YTVGPLHALLKSRIQEDSAESSPPESNNCVLSKEDRSCMTWLDSQPSRSVLYVSFGSFIK  299

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             + R+Q++EFW+G+VNSGK+FLWV+RSDL+ G+     P+P EL +GTK  G IV WAPQE
Sbjct  300   LGREQILEFWHGMVNSGKRFLWVIRSDLIDGEPGV-GPVPVELDQGTKERGCIVSWAPQE  358

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H A+GGFLTHSGWNSTLES+ AGVPMICWP   DQQ NSR V E+WK+GLDMKD C
Sbjct  359   EVLAHQAIGGFLTHSGWNSTLESLVAGVPMICWPQIGDQQVNSRCVSEIWKIGLDMKDTC  418

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             DRS++E L R+LM+ ++ + +E    + K+A++A+ EGGSSY N + LI+D+
Sbjct  419   DRSTIENLARDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLEKLIEDI  470



>ref|XP_004231996.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Solanum lycopersicum]
Length=477

 Score =   405 bits (1040),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 217/473 (46%), Positives = 298/473 (63%), Gaps = 16/473 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSG-RFTTRFRL  229
             H+L+FPLP QS +NSML+LA L  LA   +TF   ++    L   TDV+S  R   +F+ 
Sbjct  4     HVLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTDVESRFRQYPKFQF  63

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIAL  409
             ++   G+ D    S  +F +L  SL+ + +PFL++ + +   SG+  TC I D L   A+
Sbjct  64    RTISDGLPDDHPRSSLLFGDLITSLQAVAEPFLREIVTE---SGV--TCVIPDGLFYYAV  118

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  589
             D+  E   + V  F  IS C  W Y   P L ++G++P KGN +D   I  V GMED LR
Sbjct  119   DICNE-LGVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKGNDLDVL-IENVPGMEDLLR  176

Query  590   VRDLSPFCRDEDLAVLYYTEARLA-----VQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
              RD  PF R  + A   Y +  L       ++ GLILNTFEDL+GP+LS IRT  P  Y 
Sbjct  177   RRDF-PFYRLTNCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLSNIRTHCPQTYA  235

Query  755   IGPLHAHLKATLASKS-THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLME  931
             +GPL   LK  LA KS + SNSL +ED + + WLD+Q  +SVIYVSFGS++ +T+++++E
Sbjct  236   VGPLQLQLKTRLADKSMSSSNSLREEDGSSIQWLDAQPVESVIYVSFGSLATLTKEEMLE  295

Query  932   FWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAV  1111
             FW+GLVNSG +FLWVMRSDL+  ++     +  EL +G K   YIV WAPQE VL H A+
Sbjct  296   FWHGLVNSGIRFLWVMRSDLLREEEFSHQFV-KELADGCKERAYIVSWAPQEKVLSHPAI  354

Query  1112  GGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKL  1291
             GGFLTHSGWNST+ESI    PMICW  + DQ+  SRFVGEVWK+GLDMKD+CDR  +EK 
Sbjct  355   GGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDRYIIEKA  414

Query  1292  IRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATRE  1450
             +++LM   K +  +  + +  LAK ++ EGGSSY  F+ L+ D+ K+    ++
Sbjct  415   VKDLMVTNKDKLKKSVDKLSMLAKISVGEGGSSYNAFESLVIDIKKLGRRDKD  467



>ref|XP_010316061.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   404 bits (1038),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 214/473 (45%), Positives = 300/473 (63%), Gaps = 16/473 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSG-RFTTRFRL  229
             H+L+FPLP QS +NSML+LA L  LA   +TF   ++    L   T+V+S  R   +FR 
Sbjct  12    HVLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTNVESRFRQYPKFRF  71

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIAL  409
             ++   G+ D    S  +F +L +SL+ + +P L++ + +   SG+  TC I D L   A+
Sbjct  72    RTISDGLPDDHPRSFPMFEDLINSLQAVAEPSLREIVTE---SGV--TCVIPDGLFYYAV  126

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  589
             D+  E   + V  F  IS C  W Y   P L + G++P KGN +D   I  V GMED LR
Sbjct  127   DICNE-VGVSVISFDTISPCCLWVYLCFPKLIQTGDIPFKGNDLDML-IENVPGMEDLLR  184

Query  590   VRDLSPFCRDEDLAVLYYTEARLA-----VQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
              RD  PF R  D A   Y +  L       ++ GLILNTFEDL+GP+LS IR+  P  Y 
Sbjct  185   RRDF-PFYRLTDCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLSNIRSHCPQTYA  243

Query  755   IGPLHAHLKATLASKS-THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLME  931
             +GPLH  LK  LA K+ + SNSL +ED + + WLD+Q  +SVIYVSFGS++ +T+++++E
Sbjct  244   VGPLHLQLKTRLADKTMSSSNSLWEEDHSSIQWLDAQPIESVIYVSFGSLATLTKEEMLE  303

Query  932   FWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAV  1111
             FW+GLVNSG +FLWVMRSDL+  +++    +  EL +G K   YIV WAPQE VL H A+
Sbjct  304   FWHGLVNSGIRFLWVMRSDLLR-EEEFSHQLVKELADGCKERAYIVSWAPQEKVLSHPAI  362

Query  1112  GGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKL  1291
             GGFLTHSGWNST+ESI    PMICW  + DQ+  SRFV EVWK+GLDMKD+CDR ++EK+
Sbjct  363   GGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVSEVWKIGLDMKDICDRDNIEKV  422

Query  1292  IRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATRE  1450
             +++LM   K +  +  + +  LA+ ++ EGGSSY  F+ L+ D+ K+    ++
Sbjct  423   VKDLMVTNKEKLKKSVDKLSMLAEISVGEGGSSYNAFEYLVDDIKKLGRRDKD  475



>ref|XP_006357782.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=484

 Score =   404 bits (1038),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 215/474 (45%), Positives = 301/474 (64%), Gaps = 18/474 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+L+FPLP QS +NSML+LA L  LA+  +TF   ++    L   T+V+S RF    +F+
Sbjct  14    HVLLFPLPIQSPINSMLQLAELFCLADLQVTFLNTNHNQQLLYRHTNVES-RFKQYPKFQ  72

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+ D    S  +F +L +SL+ + +PFL++ + +   SG+  TC I D L   A
Sbjct  73    FRTISDGLPDDHPRSFPMFEDLINSLQAVAEPFLRKILTE---SGV--TCVIPDGLFYYA  127

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +D+  E   + V  F  IS C  W Y   P L + G++P KGN +D   I  V GMED L
Sbjct  128   VDICNE-VGVSVISFDTISPCCLWVYLCFPKLIQTGDIPFKGNDLDML-IENVPGMEDLL  185

Query  587   RVRDLSPFCRDEDLAVLYYTEARLA-----VQARGLILNTFEDLEGPILSQIRTKYPNVY  751
             R RD  PF R  + A   Y +  L       ++ GLILNTFEDL+GP+LS IR+  P  Y
Sbjct  186   RRRDF-PFYRLTNCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLSHIRSHCPQTY  244

Query  752   TIGPLHAHLKATLASKS-THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLM  928
              +GPLH  LK  LA K  + SNSL +ED + + WLD+Q  +SVIYVSFGS++ +T+++++
Sbjct  245   AVGPLHLQLKTRLADKRMSSSNSLWEEDHSSIQWLDAQPIESVIYVSFGSLATLTKEEML  304

Query  929   EFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLA  1108
             EFW+GLVNSG +FLWVMRSDL+  ++     +  EL  G K   YIV WAPQE VL H A
Sbjct  305   EFWHGLVNSGIRFLWVMRSDLLREEEFSHQFV-KELAAGCKERAYIVSWAPQEKVLSHPA  363

Query  1109  VGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEK  1288
             +GGFLTHSGWNST+ESI    PMICW  + DQ+  SRFVGEVWK+GLDMKD+CDR ++EK
Sbjct  364   IGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDRDNIEK  423

Query  1289  LIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATRE  1450
             ++++LM   K +  +  + +  LA+ ++ EGGSSY  F+ L+ D+ K+    ++
Sbjct  424   VVKDLMVTNKDKLKKSVDKLSMLAEISVGEGGSSYNAFEYLVDDIKKLGRRDKD  477



>ref|XP_010905381.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=491

 Score =   404 bits (1037),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 225/484 (46%), Positives = 291/484 (60%), Gaps = 27/484 (6%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT-RFR  226
              H+L+FP P Q  +N MLKLA LL     H+TF      H RL   +   +    + RFR
Sbjct  9     AHVLVFPFPGQGMVNCMLKLAELLSKTGLHVTFLNSDYNHDRLSRSSSAYALLAQSPRFR  68

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSG-----LPFTCFISDL  391
               S   G+ D    S    +EL +SLR       ++ +  NR  G      P TC I+D 
Sbjct  69    FDSISDGLADENPRSAFRLMELEESLRTRSAVQYRELLT-NRGRGDDGKWPPVTCVIADG  127

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
              ++ A+D++EE   +P   FR ISAC+FW YF +P L + GELP         P+  V G
Sbjct  128   AMTFAVDIAEE-LGIPAIAFRTISACSFWAYFCIPRLLQNGELPFPDEADLDEPVRSVPG  186

Query  572   MEDFLRVRDLSPFCR---DEDLAVLYYTEARLAV--QARGLILNTFEDLEGPILSQIRTK  736
             ME FLR RDL  FCR   DE      +     A   +AR LILNTFE LE   LS +R+ 
Sbjct  187   MEAFLRRRDLPSFCRQAGDEADQTFEFVTTVTANTNRARALILNTFESLEATALSHVRSH  246

Query  737   YPNVYTIGPLHAHLK----------ATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYV  886
             +P  Y +GPL A L+          A   + S  S SL +ED TCM WLDSQ  KSV+YV
Sbjct  247   FPVTYAVGPLPALLRSYGSHCPSNPAVSPTSSMPSASLWEEDRTCMTWLDSQPHKSVVYV  306

Query  887   SFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYI  1066
             SFGS++V++++  +EFW GLVNSG++FLWV+R DLV  +         E+K GTK  G +
Sbjct  307   SFGSLTVVSQEAFLEFWIGLVNSGQRFLWVVRPDLVEEEMLPLP---EEVKVGTKERGCL  363

Query  1067  VGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVG  1246
             V W PQE VL H AVG FLTHSGWNSTLES+ AGVPM+CWPFFADQQ NSRFV EVWKVG
Sbjct  364   VDWVPQEQVLAHPAVGCFLTHSGWNSTLESLVAGVPMLCWPFFADQQINSRFVSEVWKVG  423

Query  1247  LDMKDVCDRSSVEKLIRELMEKRKGEFLER-AENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             LDMKD+C RS VE ++RE+ME ++ +   R A  M K+A E+++EGGSS+ +F  LIQ +
Sbjct  424   LDMKDLCSRSIVEMMVREVMEGQRTDGWRRSAREMAKMAWESVAEGGSSHADFRRLIQRI  483

Query  1424  IKVN  1435
             + ++
Sbjct  484   MSLS  487



>gb|KHN04913.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=457

 Score =   402 bits (1032),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 220/470 (47%), Positives = 286/470 (61%), Gaps = 40/470 (9%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              H+LIFPLP   HL SMLKLA LL L N H+TF            + ++     T  F+ 
Sbjct  4     AHVLIFPLPLPGHLGSMLKLAELLALDNIHVTF------------VDELSECYPTLHFKT  51

Query  230   QSFPPGIYDGALNSKEVFVELCD---SLRRIGKPFLKQYIAQNRDSGLP-FTCFISD-LL  394
                 P  YD           + D   S  +  KPFL+  +      G+P  +C I D + 
Sbjct  52    I---PDCYDEEGEHPGFGDRVGDFITSTAQHAKPFLRDILLSQHSPGIPKVSCIIQDGIF  108

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
              +++ D + E   +P+ +FR +S+C FW YF +P L +  ELPIKG       I  + GM
Sbjct  109   GALSSDFAAE-LRIPLIHFRTVSSCCFWAYFCVPKLLDCKELPIKGEEDMDRIIRNMPGM  167

Query  575   EDFLRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
             E+ LR RDL  FCR   + +         R ++ A  L+LNTFEDLEG +LSQ+   +P 
Sbjct  168   ENLLRCRDLPSFCRPNTEGNFLEWAVFRTRQSLAADALMLNTFEDLEGSVLSQMGQHFPK  227

Query  746   VYTIGPLHAHLKATLASKS------THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             +YTIGP+H HLK   A  +      T  NSL Q D +CMAWL++Q   SVIYVSFGS ++
Sbjct  228   LYTIGPIHHHLKIRKAESNKAKDIPTFKNSLFQVDRSCMAWLEAQPQGSVIYVSFGSSTI  287

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             + R+ LME W+GLVNS K+FLWVMR D+VA        IP+E++EGT+  G IVGWAPQE
Sbjct  288   VKREDLMEIWHGLVNSKKRFLWVMRPDIVAADR-----IPAEVEEGTRERGLIVGWAPQE  342

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H A+GGFLT      TL+S+ AGVPMICWP+FADQQ NSRFV EVWK+GLDMKDVC
Sbjct  343   DVLAHKAIGGFLT-----PTLDSVVAGVPMICWPYFADQQINSRFVSEVWKLGLDMKDVC  397

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             DR  VEK++ +LM  RK EFL+ A+ M  LA ++++ GGSSY +FD LIQ
Sbjct  398   DRHVVEKMVNDLMVHRKEEFLKSAQEMAMLAHKSVTPGGSSYSSFDDLIQ  447



>gb|AFJ53009.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=485

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 219/475 (46%), Positives = 295/475 (62%), Gaps = 23/475 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             H+LIFP P Q H+ SML LA LL L+N  +TFF   +I  RLL  T V S   ++   F 
Sbjct  10    HVLIFPYPLQGHVTSMLNLAELLCLSNIRVTFFNSDHIQRRLLQFTSVQSRFAKYPYLFH  69

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+      S +  ++L  S+  I +P  K+ +  N+    P  C ISD  +   
Sbjct  70    FQTISDGLPPDHSRSGKDVLDLFLSMSSITRPLFKELLISNQP---PIDCVISDGGLEFT  126

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP--ITKVKGMED  580
             ++V++E   +P+ YFR I A  FW YF +PD+ EAGELPI+    +     ITKV G E 
Sbjct  127   VEVADE-VGIPLVYFRTIGASCFWVYFCIPDIIEAGELPIRVEEEEDMERVITKVPGAEG  185

Query  581   FLRVRDLSPFCRDEDLAVLY----YTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
             FLR RDL   CR  DL+  +     +  R + +A  LILNTFEDLEGPIL +IRT+ P  
Sbjct  186   FLRCRDLPSLCRVGDLSDPFLQAIVSTTRKSPKAYALILNTFEDLEGPILGRIRTRCPKT  245

Query  749   YTIGPLHAHLKATLASKSTHSNS-------LLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             Y IGP+H  L+  L +  T   S       L +ED +CM WLD Q PKSV+YV+FGSI+V
Sbjct  246   YPIGPIHEQLRLKLVNLKTPQESSSSSSSSLWEEDRSCMKWLDLQPPKSVLYVNFGSITV  305

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSEL-KEGTKANGYIV--GWA  1078
             +  ++L+E W+GL+NS +KFLWV+R   +   ++  S  P EL K G+K + ++V  GW 
Sbjct  306   MKPEELVEIWHGLINSKQKFLWVIRQGTITSIENT-SEFPEELVKGGSKGDEFMVLSGWV  364

Query  1079  PQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMK  1258
              Q+ VLDH ++GGFLTHSGWNSTLE+I AGVPMIC P+FADQQ NSRF  EVWK+GLDMK
Sbjct  365   AQKEVLDHESIGGFLTHSGWNSTLETIVAGVPMICLPYFADQQVNSRFTSEVWKLGLDMK  424

Query  1259  DVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             D C+R  VE+++ ELM +RK EF   A  M +LA  ++S  G S  N + LI+++
Sbjct  425   DSCERGVVERMVNELMVERKEEFGRCAAKMAELAGMSVSSDGCSSRNLEDLIEEI  479



>ref|XP_003613028.1| Cis-zeatin O-glucosyltransferase [Medicago truncatula]
 gb|AES95986.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=474

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 288/469 (61%), Gaps = 27/469 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+LIFP PAQ H+N MLKLA LL + N +ITF     IH RL+   D          +LQ
Sbjct  12    HVLIFPCPAQGHVNPMLKLAELLAIQNIYITFLNTKYIHNRLIQFNDDIQALLECYPKLQ  71

Query  233   SFPPGIYDGALNSK-----EVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISD-LL  394
                  I D     K     E   ++  SL   GKP LK  I   +      +C I D + 
Sbjct  72    F--KTISDFHSEEKHPGFGEKVGDVILSLSLYGKPLLKDIIVSEK-----ISCIILDGIF  124

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
               +A D++ E F + + +FR ISAC FW Y S+P L E  ELPIKG+      I  V GM
Sbjct  125   GDLATDLAAE-FGIQLIHFRTISACCFWAYLSVPKLLECNELPIKGDEDMDRIIRNVPGM  183

Query  575   EDFLRVRDLSPFCRDEDLAVLYYTEARLAVQA---RGLILNTFEDLEGPILSQIRTKYPN  745
             E+ LR RDL  F + +D   +    A L  Q+     LILNTFE+LE P LSQIR   P 
Sbjct  184   ENLLRCRDLPSFRKMDDSDTILDKAALLTQQSLKGNALILNTFENLESPALSQIRLHAPK  243

Query  746   VYTIGPLHAHLKATLASKSTHSN----SLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
             +YTIGPLH HL  T  + S+ S+    +  + D TCM WL+SQ  KSV+YVSFGSI+ + 
Sbjct  244   LYTIGPLHHHLNTTKKTSSSSSSSSKSNFFEVDRTCMTWLESQPLKSVVYVSFGSITPMK  303

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGT-KANGYIVGWAPQEA  1090
              ++++E W+GL+NS K FLWV+R ++V     +E  +  EL+EGT K  G IVGW PQE 
Sbjct  304   GEEIIEIWHGLLNSKKPFLWVIRPNMV-----QEKGLLKELEEGTTKEKGMIVGWVPQEE  358

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H A+G FLTHSGWNSTLES+  GVPMICWP+FADQQ NSRFV +VWK+GLDMKDVCD
Sbjct  359   VLSHKAIGAFLTHSGWNSTLESVVCGVPMICWPYFADQQINSRFVSDVWKLGLDMKDVCD  418

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             R  VE ++ ++M  RK EF+  A ++ KLA +++S GGSSY NF  LIQ
Sbjct  419   RKVVENMVNDVMVNRKEEFVRSAMDIAKLASKSVSPGGSSYNNFQDLIQ  467



>dbj|BAB86929.1| glucosyltransferase-11 [Vigna angularis]
Length=462

 Score =   400 bits (1029),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 216/465 (46%), Positives = 291/465 (63%), Gaps = 20/465 (4%)
 Frame = +2

Query  101   LKLAHLLDLANFHITFFVPSNIHARLLALTDVD--SGRFTTRFRLQSFPPGIYDGALNS-  271
             LKLA LL L N  +TF   + IH+RL    ++   S  + T    ++F     +G     
Sbjct  1     LKLAELLVLQNLRVTFLTTNTIHSRLARFGEIQVLSESYPT-LHFKTFSDCYDEGNHPGF  59

Query  272   KEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISD-LLVSIALDVSEEC-FNLPVY  445
              +   +L  S+    KPFL+  +  +       +C I D +  S++  V+ E   ++P+ 
Sbjct  60    GDRIWDLISSVTLHAKPFLRDILLSHTPQIPKLSCVIQDGIFGSLSSGVASELNISIPII  119

Query  446   YFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCR--D  619
             +FR +S+C FW Y S   L +  ELPI+G+      I  + GME+ LR RDL  F R   
Sbjct  120   HFRTVSSCCFWAYMSATKLLQCQELPIRGDDDMDRIIKNLPGMENLLRCRDLPSFFRPNQ  179

Query  620   EDLAVL--YYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKATLA  793
             E  +    Y   +R ++ A  +ILN+FEDLEGP+LSQIR  +  VYT+GPLH HL    A
Sbjct  180   EGNSTFESYADRSRQSLAADAVILNSFEDLEGPVLSQIRHNFSKVYTVGPLHHHLNMRKA  239

Query  794   SKST------HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNS  955
               +         NS+ Q D +CM WLD+Q   SV+YVSFGS +++ ++ LME W+GLVNS
Sbjct  240   ESNKGKEIPRFKNSIFQVDRSCMTWLDAQPDGSVMYVSFGSSTIMNKEDLMEIWHGLVNS  299

Query  956   GKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSG  1135
              K+FLWV   D+VAGK +EE  +P+E+KEGTK  G+IV WAPQE VL H A+GGFLTHSG
Sbjct  300   KKRFLWVKLPDIVAGKHNEEH-VPTEVKEGTKERGFIVEWAPQEEVLTHKAIGGFLTHSG  358

Query  1136  WNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKR  1315
             WNSTLES+ AGVPMICWP+FADQQ NSRFV EVWKVGLDMKDVCDR  VEK++ ++M  R
Sbjct  359   WNSTLESLVAGVPMICWPYFADQQINSRFVSEVWKVGLDMKDVCDRDVVEKMVNDVMVHR  418

Query  1316  KGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATRE  1450
             + EFL+ A+ M  LA +++S GGSSY +   LI+ +I    A+RE
Sbjct  419   REEFLKSAQTMAMLAHQSVSPGGSSYTSLHDLIEYIIS---ASRE  460



>ref|XP_003613026.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES95984.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   400 bits (1027),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 217/468 (46%), Positives = 286/468 (61%), Gaps = 26/468 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+LIFP PAQ H+N+MLKLA LL + N HITF     IH RL++L   D    +  +   
Sbjct  5     HVLIFPCPAQGHVNTMLKLAELLLIQNLHITFLNTEYIHNRLISLNIDDVKSISQCYPKL  64

Query  233   SFPPGIYDGALNSK-----EVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLV  397
              F   I D     K     E  V++  S+   GKP L+  I   + S +       DL  
Sbjct  65    QFK-TISDFQNKEKHPGFGENIVDVISSINMYGKPSLRDIIVSEKISCIILDGGFGDL--  121

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
               A D++ E F + + +FR ++A   W YF +P L +  E+PI+G+      I  V GME
Sbjct  122   --ATDLAAE-FGIQLIHFRTVAASTVWIYFCMPKLLDCNEIPIRGDEDMDRIIRNVPGME  178

Query  578   DFLRVRDLSPFCRDEDL------AVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             + +R RDL  F     +       VL  T+A L  +   +ILNTFEDLE PILSQIR  +
Sbjct  179   NIIRCRDLPRFGTSNKMDHIILDKVLQLTQASL--KGNAVILNTFEDLESPILSQIRLHF  236

Query  740   PNVYTIGPLHAHLKATLASKSTHSNS-LLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             P +YTIGPLH HL     + S+  NS   + D TCM WL+SQ  KSV+YVSFGS + +TR
Sbjct  237   PKLYTIGPLHHHLNTMKKTTSSSFNSNFFKVDRTCMTWLESQPLKSVVYVSFGSTTTMTR  296

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGT-KANGYIVGWAPQEAV  1093
             ++++EFW+GL+NS K FLWV+R ++V     +E  +  EL+EGT K  G IV WAPQE V
Sbjct  297   EEILEFWHGLLNSKKAFLWVIRPNMV-----QEKRLIKELEEGTSKEKGLIVEWAPQEEV  351

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H A+G FLTHSGWNSTLES+  GVPMICWP+F+DQ  NSRFV EVWK+GLDMKDVCDR
Sbjct  352   LSHKAIGAFLTHSGWNSTLESVVCGVPMICWPYFSDQPLNSRFVSEVWKLGLDMKDVCDR  411

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             + VE ++ ++M  +K EF + A  M  LA ++++  GSSY N   LIQ
Sbjct  412   NVVENMVNDIMVNKKEEFSKSATKMADLASKSVNPDGSSYNNLQDLIQ  459



>ref|XP_009346996.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=485

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 213/478 (45%), Positives = 283/478 (59%), Gaps = 25/478 (5%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              H+L+ P PAQ H+  ML  A LL  A  H+TF    + H RLL      S RF T    
Sbjct  10    AHVLLLPFPAQGHITPMLSFAQLLGHAGIHVTFLNTEHNH-RLLTQRHALSARFPT-LHF  67

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI-----------AQNRDSGLPFTC  376
             +S P G+      S    +++  SL+ + KP L+  +                   P +C
Sbjct  68    ESLPDGLPPDCPRSIPHIIDMVSSLKSVTKPLLRDLLITLTKKDEESYGSTSTRRPPLSC  127

Query  377   FISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPI  556
              I D ++  A+DV+E+   +P      IS C +W+Y  +P+L + G +P     +D    
Sbjct  128   VIMDEIMCFAIDVAEK-VGVPAMAITVISGCGYWSYSCIPNLIQQGHVPFTDEDMDKQS-  185

Query  557   TKVKGMEDFLRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
             + + GME  LR RDL  FCR   D  +  ++  E   A +A  LI+NTF+ LE  ILS I
Sbjct  186   SDIPGMEGLLRRRDLPGFCRFSIDHPVTKIFM-EVIKATRASALIINTFDGLEASILSHI  244

Query  728   RTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
              T +P VY IGP+HA +K+ +    + S SL QED  CMAWLDS+   SVIYVSFGS+  
Sbjct  245   ATLFPQVYAIGPVHALVKSRVGDGLSSSASLRQEDRRCMAWLDSKPVGSVIYVSFGSLVE  304

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEE----SPIPSELKEGTKANGYIVGW  1075
             +T  QL EFW+GLV+ GK+FLWV+RSD+++G+  E       IP+ELK GTK  G IV W
Sbjct  305   LTHDQLFEFWHGLVSCGKQFLWVVRSDMISGEQGEHVIPTELIPTELKMGTKERGLIVEW  364

Query  1076  APQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDM  1255
             APQE VL H AVGGFLT  GWNS LE I AGVPM+CWP  A+Q   SR++GEVW++G+DM
Sbjct  365   APQEEVLAHKAVGGFLTQCGWNSILEGIWAGVPMLCWPRLAEQLVTSRWIGEVWRIGIDM  424

Query  1256  KDVCDRSSVEKLIRELMEK--RKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             KD C+RS VEK+IR LME+   + + L   E   KLA+ A++EGGSSY N D LIQD+
Sbjct  425   KDTCERSMVEKMIRRLMEEGDEREQILRSVERFSKLARGAVTEGGSSYNNLDKLIQDL  482



>ref|XP_006357780.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=489

 Score =   397 bits (1021),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 212/474 (45%), Positives = 296/474 (62%), Gaps = 15/474 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+L+FPLP QS +NSML+LA L  LA   +TF   ++    L   T+V+S RF    +F+
Sbjct  16    HVLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTNVES-RFKQYPKFQ  74

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              ++   G+      S  +F +L  SL+ + +PFL++ +    +   P TC I D L   A
Sbjct  75    FRTISDGLPKDHPRSSLLFGDLITSLQAVAEPFLREILLGVTEP--PVTCVIPDGLFYYA  132

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +D+  E   + V  F  IS C  W Y   P L ++G++P KGN +D   I  V GMED L
Sbjct  133   VDICNE-VGVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKGNDLDVL-IENVPGMEDLL  190

Query  587   RVRDLSPFCRDEDLAVLYYTEARLA-----VQARGLILNTFEDLEGPILSQIRTKYPNVY  751
             R RD  PF R  + A   Y +  L       ++ GLILNTFEDL+GP+LS IR+  P  Y
Sbjct  191   RRRDF-PFYRLTNCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLSLIRSHCPQTY  249

Query  752   TIGPLHAHLKATLASKS-THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLM  928
              +GPLH  LK  LA K+ + SNSL +ED + + WLD+   +SVIYVSFGS++ +T+++++
Sbjct  250   AVGPLHLQLKTRLADKTMSSSNSLWEEDHSSIQWLDAHPTESVIYVSFGSLATLTKKEIL  309

Query  929   EFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLA  1108
             EFW+GLVNSG +FLWVMRSDL+  ++     +  EL +G +   YIV WAPQE VL H A
Sbjct  310   EFWHGLVNSGIRFLWVMRSDLLREEEFSHQFV-KELTDGCEERAYIVSWAPQEKVLSHPA  368

Query  1109  VGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEK  1288
             +GGFLTHSGWNST+ESI    PMICW  + DQ+  SRFVGEVWK+GLDMKD+CDR  +EK
Sbjct  369   IGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDRYIIEK  428

Query  1289  LIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATRE  1450
              ++ELM   K +  +  + +  LA+ ++ EGGSSY  F+ L+ D+ K+    ++
Sbjct  429   AVKELMVTNKDKLKKSVDKLSMLAEISVGEGGSSYNAFEYLVNDIKKLGRRNKD  482



>ref|XP_010316060.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Solanum lycopersicum]
Length=469

 Score =   396 bits (1018),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 214/473 (45%), Positives = 294/473 (62%), Gaps = 24/473 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSG-RFTTRFRL  229
             H+L+FPLP QS +NSML+LA L  LA   +TF   ++    L   TDV+S  R   +F+ 
Sbjct  4     HVLLFPLPIQSPINSMLQLAELFCLAGLQVTFLNTNHNQQLLYRHTDVESRFRQYPKFQF  63

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIAL  409
             ++   G+ D    S  +F +L  SL+ + +PFL++ + +   SG+  TC I D L   A+
Sbjct  64    RTISDGLPDDHPRSSLLFGDLITSLQAVAEPFLREIVTE---SGV--TCVIPDGLFYYAV  118

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLR  589
             D+  E   + V  F  IS C  W Y   P L ++G++P K N         V GMED LR
Sbjct  119   DICNE-LGVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKEN---------VPGMEDLLR  168

Query  590   VRDLSPFCRDEDLAVLYYTEARLA-----VQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
              RD  PF R  + A   Y +  L       ++ GLILNTFEDL+GP+LS IRT  P  Y 
Sbjct  169   RRDF-PFYRLTNCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLSNIRTHCPQTYA  227

Query  755   IGPLHAHLKATLASKS-THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLME  931
             +GPL   LK  LA KS + SNSL +ED + + WLD+Q  +SVIYVSFGS++ +T+++++E
Sbjct  228   VGPLQLQLKTRLADKSMSSSNSLREEDGSSIQWLDAQPVESVIYVSFGSLATLTKEEMLE  287

Query  932   FWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAV  1111
             FW+GLVNSG +FLWVMRSDL+  +++       EL +G K   YIV WAPQE VL H A+
Sbjct  288   FWHGLVNSGIRFLWVMRSDLLR-EEEFSHQFVKELADGCKERAYIVSWAPQEKVLSHPAI  346

Query  1112  GGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKL  1291
             GGFLTHSGWNST+ESI    PMICW  + DQ+  SRFVGEVWK+GLDMKD+CDR  +EK 
Sbjct  347   GGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDRYIIEKA  406

Query  1292  IRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATRE  1450
             +++LM   K +  +  + +  LAK ++ EGGSSY  F+ L+ D+ K+    ++
Sbjct  407   VKDLMVTNKDKLKKSVDKLSMLAKISVGEGGSSYNAFESLVIDIKKLGRRDKD  459



>gb|KDO43669.1| hypothetical protein CISIN_1g011792mg [Citrus sinensis]
Length=477

 Score =   395 bits (1015),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 206/475 (43%), Positives = 289/475 (61%), Gaps = 26/475 (5%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS-GRFTTRF  223
             + H+++ P PA  H+  ML LA L   A F ITF      H RL   TDV +  +    F
Sbjct  6     VPHVVLLPFPAYGHIKPMLSLAKLFSHAGFRITFVNTDQYHDRLFGNTDVTAFYKHFPNF  65

Query  224   RLQSFPPGIYDG----ALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDL  391
                S P G+        + +K+ F     S + + K   +Q +      G   TC ISD 
Sbjct  66    LCTSIPDGLPPDNPRFGIYTKDWFC----SNKPVSKLAFRQLLMT---PGRLPTCIISDS  118

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
             ++S A+DV+EE  N+P+  FRP SA   W+ F    L E GELP+     D  P+T +  
Sbjct  119   IMSFAIDVAEE-LNIPIITFRPYSAYCSWSDFHFSKLAEEGELPVTDENFDK-PVTCIPE  176

Query  572   MEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             +E+  R RDL   CR    D+ +   +  +     +   L++NTF ++EGPI+S++ ++ 
Sbjct  177   LENIFRNRDLPSICRHGGPDDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKLGSRL  236

Query  740   PNVYTIGPLHAHLKATLASKSTHSNSL-------LQEDETCMAWLDSQEPKSVIYVSFGS  898
               +YT+GPLHA LK+ +   S  S+ L        +ED +CM WL SQ  +SV+YVSFGS
Sbjct  237   TKIYTVGPLHALLKSRIQEDSVESSPLESNNCVLSKEDRSCMTWLGSQPSRSVLYVSFGS  296

Query  899   ISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWA  1078
                ++  Q++EFW+G+VNSGK FLWV+RSDL+ G+     P+P+EL +GTK  G IV WA
Sbjct  297   FIKLSGDQILEFWHGIVNSGKGFLWVIRSDLIDGESGV-GPVPAELDQGTKERGCIVSWA  355

Query  1079  PQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMK  1258
             PQE VL H A+GGFLTHSGWNSTLES+ AGVPMICWP   DQQ NSR V E+WK+G DMK
Sbjct  356   PQEEVLAHQAIGGFLTHSGWNSTLESMVAGVPMICWPQVGDQQVNSRCVSEIWKIGFDMK  415

Query  1259  DVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             D CDRS++EKL+R+LM+ ++ + +E    + K+A++A+ EGGSSY N + LI+D+
Sbjct  416   DTCDRSTIEKLVRDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLEKLIEDI  470



>ref|XP_006423294.1| hypothetical protein CICLE_v10030404mg [Citrus clementina]
 ref|XP_006469143.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Citrus sinensis]
 gb|ESR36534.1| hypothetical protein CICLE_v10030404mg [Citrus clementina]
Length=477

 Score =   394 bits (1012),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 206/471 (44%), Positives = 286/471 (61%), Gaps = 18/471 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS-GRFTTRF  223
             + H+++ P PA  H+  ML LA L   A F ITF      H RL   TDV +  +    F
Sbjct  6     VPHVVLLPFPAYGHIKPMLSLAKLFSHAGFRITFVNTEQYHDRLFGNTDVTAFYKHFPNF  65

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSI  403
                S P G+            +   S + + K   +Q +       LP TC ISD ++S 
Sbjct  66    LCTSIPDGLPPDNPRFGIYIKDWFCSNKPVSKLAFRQLLMT--PGRLP-TCIISDSIMSF  122

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
             A+DV+EE  N+P+  FRP SA   W+ F    L E GELP+     D S +T +  +E+ 
Sbjct  123   AIDVAEE-LNIPIITFRPYSAYCSWSDFHFSKLAEEGELPVTDENFDKS-VTCIPELENI  180

Query  584   LRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVY  751
              R RDL   CR    D+ +   +  +     +   L++NTF ++EGPI+S++ ++   +Y
Sbjct  181   FRNRDLPSICRHGGPDDPILQTFIRDTSATTRTSALVINTFNEIEGPIMSKLGSRLTKIY  240

Query  752   TIGPLHAHLKATLASKSTHSNSL-------LQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             TIGPLHA LK+ +   S  S+ L        +ED +CM WL SQ  +SV+YVSFGS   +
Sbjct  241   TIGPLHALLKSRIQEDSVESSPLESNNCVLSKEDRSCMTWLGSQPSRSVLYVSFGSFIKL  300

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             +  Q++EFW+G+VNSGK FLWV+RSDL+ G+     P+P+EL +GTK  G IV WAPQE 
Sbjct  301   SGDQILEFWHGIVNSGKGFLWVIRSDLIDGESGV-GPVPAELDQGTKERGCIVSWAPQEE  359

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H A+GGFLTHSGWNSTLES+ AGVPMICWP   DQQ NSR V E+WK+G DMKD CD
Sbjct  360   VLAHQAIGGFLTHSGWNSTLESMVAGVPMICWPQVGDQQVNSRCVSEIWKIGFDMKDTCD  419

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             RS++EKL+R+LM+ ++ + +E    + K+A++A+ EGGSSY N + LI+D+
Sbjct  420   RSTIEKLVRDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLEKLIEDI  470



>ref|XP_007026848.1| UDP-glucosyl transferase 85A3, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY07350.1| UDP-glucosyl transferase 85A3, putative isoform 2, partial [Theobroma 
cacao]
Length=478

 Score =   394 bits (1012),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 215/475 (45%), Positives = 295/475 (62%), Gaps = 21/475 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS-GRFTTRF  223
             + H+++ P P+  H+  +L LA LL  A+F +TF  P  IH RLL   D+ +  R    F
Sbjct  8     VPHVVLLPFPSLGHIKPLLSLAELLSHASFQVTFLNPQQIHDRLLLSMDMPAFHRRHPEF  67

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIG---KPFLKQY-IAQNRDSGL--PFTCFIS  385
                S P  +   +   +     L D++  +G   KP L +  I+ NR+ G   P TC I+
Sbjct  68    EFLSMPDPVRRSSDRPRPGLFSLHDNILSLGSVIKPALGELLISFNRERGRRQPATCIIA  127

Query  386   D-LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  562
             D LL S  +DV+E+ F +P +  R  SAC  W YF+ P L E G++P +   +D   +T 
Sbjct  128   DGLLSSPVIDVAEQ-FEIPFFALRTSSACCIWAYFNPPKLVEEGDVPFQDEDMDKL-VTC  185

Query  563   VKGMEDFLRVRDLSPFCRDE---DLAVLYYTEARLAV--QARGLILNTFEDLEGPILSQI  727
             + G+E+ +R RDL    R E   D A+ Y+   +  V  +A GLILNTF++LE P+++++
Sbjct  186   IPGLENVVRRRDLPGIFRIERANDPALEYFINDQTLVLPRASGLILNTFDELEAPVIAKL  245

Query  728   RTKYPNVYTIGPLHA----HLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFG  895
              + +  VYT+GPLH+     +K  L S ++  N L +ED +CM WLDSQ  KSVI+VSFG
Sbjct  246   GSHFTKVYTVGPLHSLSTVRMK-DLISVASGENILWKEDTSCMTWLDSQLSKSVIFVSFG  304

Query  896   SISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGW  1075
             S+   TR Q+ E W+GLVN GK FLW +R D + G+D   S I  +LK+ T   G +V W
Sbjct  305   SVISFTRDQMFELWHGLVNCGKPFLWAIRQDSIIGEDGP-SLILGKLKDMTGDKGLLVSW  363

Query  1076  APQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDM  1255
             APQE VL H A+GGF THSGWNSTLESI AGVPMICWP   DQQ NSRFV +VWK+G DM
Sbjct  364   APQELVLTHPAIGGFFTHSGWNSTLESIFAGVPMICWPAIGDQQMNSRFVSDVWKIGFDM  423

Query  1256  KDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQD  1420
             KD CDRS +EK++R+LME ++ E ++    + KLA EA+ EGGSS+CN D LI D
Sbjct  424   KDSCDRSLIEKMVRDLMEDKREEIMKSVNEIKKLAHEAVKEGGSSFCNLDKLIDD  478



>emb|CAN68538.1| hypothetical protein VITISV_039646 [Vitis vinifera]
Length=450

 Score =   392 bits (1006),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 220/469 (47%), Positives = 287/469 (61%), Gaps = 46/469 (10%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RFR  226
             H+LIFP PAQ H+NSMLKLA LL +A  H+TF        RLL  TD+ + RF+    FR
Sbjct  9     HVLIFPFPAQGHVNSMLKLAELLSVAGLHVTFLNSEYNQHRLLLHTDIQT-RFSXYPGFR  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLLV  397
              Q+   G+      + E  ++L + L+   KP  ++ +    Q  D+  P  C I+D ++
Sbjct  68    FQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGIM  127

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             S  +D++ E   +P+  FR ISAC+FW YFS   L E+GELP+KGN +D   +T + GME
Sbjct  128   SFTIDIANEV-GIPIISFRTISACSFWAYFSALKLIESGELPLKGNDMDQL-VTSIPGME  185

Query  578   DFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
              FLR RDL    R    D++  +L   E +   +A  LILNTFEDLEGPIL QIR   P 
Sbjct  186   GFLRKRDLPSLIRVSNLDDEXLLLVTKETQQTPRAHALILNTFEDLEGPILGQIRNHCPK  245

Query  746   VYTIGPLHAHLKATLASKST---HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
              YTIGPLHAHL+  LAS+ST    SNSL QED +C+AWL+ Q  KSVIYVSFGS++VITR
Sbjct  246   TYTIGPLHAHLETRLASESTTSQSSNSLRQEDRSCIAWLNRQPSKSVIYVSFGSVTVITR  305

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +QL+EF YGL NSG +FLWV+R+D +A ++D E   P+EL EG K   YI G        
Sbjct  306   KQLIEFCYGLENSGSRFLWVIRTDSLA-EEDGERQTPAELLEGAKERSYIRG--------  356

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
                 VG   T  G      S A G          +QQ NSRFV  VWK+G DMKD CDR 
Sbjct  357   ----VGS--TRRG------SSAPG----------NQQINSRFVSHVWKLGSDMKDTCDRL  394

Query  1277  SVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              VEK++R+LME+RK E L+ A+ M   A++ +SEGGSS CN   LI+++
Sbjct  395   IVEKMVRDLMEERKDELLKTADKMATRARKCVSEGGSSXCNLSSLIEEI  443



>gb|AFJ53008.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=487

 Score =   393 bits (1009),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 230/481 (48%), Positives = 296/481 (62%), Gaps = 36/481 (7%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLA---NFHITFFVPSNIHARLLALTDVDSGRFTTR-  220
             H+LIFP P Q H+NSMLKLA LL LA      ITF      H RLL  +D +S RF+   
Sbjct  11    HVLIFPFPVQGHVNSMLKLAELLSLAAGGGIRITFLNSDCTHNRLLQFSDAES-RFSVYP  69

Query  221   -FRLQSFPPG-IYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLL  394
              F+ ++     I    L   +  ++L  ++    KP  +  +++      P TC I D L
Sbjct  70    GFQFKTIDDHRIPMEKLTKGDKVLDLVGAMESEMKPDFRDMLSRMDP---PVTCVIGDGL  126

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +    +VS E   +PV  FR IS C FW  + LPDL EAGELPI+        I+KV GM
Sbjct  127   LGFIREVSME-LGIPVIRFRTISPCCFWVNYCLPDLIEAGELPIQDM---DRKISKVPGM  182

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E FLR RDL   CR    D+   V+     R +     LILNTFEDL+  +LSQIR  +P
Sbjct  183   ESFLRSRDLPGMCRVSGLDDPTLVMLINATRESPPLSPLILNTFEDLDSSVLSQIRRHFP  242

Query  743   NVYTIGPLHAHLKATLAS-----------KSTHSNSLLQEDETCMAWLDSQEPKSVIYVS  889
               Y IGPLH HL++ L +           +S+ SNSL +E+ +C+ WLD Q   SV+YV+
Sbjct  243   QTYAIGPLHQHLESRLRTMSFGSQNNINTQSSSSNSLWKEEASCLKWLDQQPEGSVLYVN  302

Query  890   FGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSEL---KEGTKANG  1060
             FGSI+V+T  +++EFW GL +S  +FLWVMR  L+  K+ E+  IP E+   KEG     
Sbjct  303   FGSITVMTADRIVEFWEGLSSSKHRFLWVMRPGLIPDKELEK--IPQEILNQKEGFYK--  358

Query  1061  YIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWK  1240
              +VGWAPQE VL+H AVGGFLTHSGWNSTLES+AAGVPMICWPFFADQ  NSR V EV+ 
Sbjct  359   VVVGWAPQEEVLNHAAVGGFLTHSGWNSTLESVAAGVPMICWPFFADQLVNSRVVSEVYN  418

Query  1241  VGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQD  1420
             +GLDMKDVCDR  VE+++ +LM++RK EF   A  M  LAK ++SEGGSS  N + LIQD
Sbjct  419   LGLDMKDVCDRKVVERMVNDLMDERKDEFQSLAAKMAALAKGSVSEGGSSCRNLEVLIQD  478

Query  1421  M  1423
             +
Sbjct  479   I  479



>gb|EPS60746.1| hypothetical protein M569_14056, partial [Genlisea aurea]
Length=455

 Score =   391 bits (1005),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 222/454 (49%), Positives = 293/454 (65%), Gaps = 28/454 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             H+L+FPLP Q H+NSMLKL+ LL LA  H+T  +     +RL   +DV+S RF+  + FR
Sbjct  4     HVLVFPLPLQGHVNSMLKLSELLCLAGIHVTLLLSKFSSSRLRRHSDVES-RFSRYSGFR  62

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN---RDSGLP--FTCFISDL  391
             +  F  G+ +      E  ++L  S+ R+G+  L++ +       D G     + F+ D 
Sbjct  63    IAVFDDGLPEDNPRVGESTIDLLSSILRVGETELRKVLEATDSLSDGGARRRVSFFVIDG  122

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG----------NGI  541
             ++S A+ V+EE   +PV YFR ISAC+FW YF   +L  AGELP++G          N  
Sbjct  123   VLSFAMPVAEE-LGIPVVYFRTISACSFWCYFCSSELIAAGELPLRGEDEGKYEYWRNPN  181

Query  542   DSSPITKVKGMEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEG  709
                P+T + GME  LR RDL  F R    ++ +  +   E R    + GLILNTFEDLEG
Sbjct  182   LDLPVTSIPGMEAILRRRDLPSFLRVTDPNDSVLQIMAAETRKTALSAGLILNTFEDLEG  241

Query  710   PILSQIRTKYPNVYTIGPLHAHLKATLASKSTHSNS--LLQEDETCMAWLDSQEPKSVIY  883
             PI+ +IR + PNV++IGPLH HLK+ L  +S+   S   L+ED T + WL+SQ PKSVIY
Sbjct  242   PIMDEIRKRIPNVFSIGPLHTHLKSHLDPQSSSLASSSFLREDRTSIDWLNSQPPKSVIY  301

Query  884   VSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEE--SPIPSELKEGTKAN  1057
             VSFGS++ +T ++ +EFWYGLVNSG  FLWVMR D +AG D+    + IP EL+EGTK  
Sbjct  302   VSFGSLTQLTEEEHLEFWYGLVNSGHMFLWVMRPDSIAGSDNRHRNAAIPKELEEGTKQR  361

Query  1058  GYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVW  1237
             GY+V W PQ  VL H +VG F TH GWNSTLESI AGVPMICWP+FADQQTNSRFV   W
Sbjct  362   GYLVEWVPQMEVLAHPSVGAFFTHGGWNSTLESICAGVPMICWPYFADQQTNSRFVSHEW  421

Query  1238  KVGLDMKDVCDRSSVEKLIRELM-EKRKGEFLER  1336
             KVG DMKD CDR  VE+++RE+M ++R+ E  ER
Sbjct  422   KVGFDMKDSCDRVVVEEMVREVMGDRRRDELSER  455



>ref|XP_009759439.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=483

 Score =   391 bits (1005),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 219/480 (46%), Positives = 298/480 (62%), Gaps = 20/480 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--  220
             I H+LIFPLP Q  +N  L+LA L  L+   +TF    +   RLL  T+V S RF     
Sbjct  10    IPHVLIFPLPIQGPINCKLQLAELFCLSGLKVTFLNTIHNQERLLRHTNVQS-RFEKYPG  68

Query  221   FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVS  400
             FR  + P G+ D    S E F ++  S++ + +PFL++ +       +  TC + D L  
Sbjct  69    FRFLTIPDGLPDEHPRSFEQFGDIISSVQTVAEPFLREMLRSGAKELV--TCVVPDALSY  126

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMED  580
                D+  E   +PV  F  +S    W Y  LP L E+GELP K N +D+S +T +  +E 
Sbjct  127   YVADIGNE-MGVPVIPFDTLSPSCVWVYMCLPKLIESGELPFKDNDLDAS-VTHIPALEG  184

Query  581   FLRVRDLSPFC-----RDEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
              LR RDL PFC      D D         R+  Q+ GLILNTFEDL+ P LS I +  P 
Sbjct  185   LLRRRDLPPFCLMDYKTDPDFLAALKQVERIP-QSHGLILNTFEDLDRPFLSCIHSYSPK  243

Query  746   VYTIGPLHAHLKATLASKST-HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
              Y IGPLH HLKA L+SK+   SNSL +ED + + WLD+Q   SV+YVSFGS+ V+++++
Sbjct  244   TYAIGPLHLHLKAKLSSKNAPSSNSLWEEDHSSIKWLDAQPMGSVLYVSFGSVVVVSKEE  303

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
             ++EF +GL+NS  KFLWVMR +++ G + +   +  EL EG K NGYIV WAPQ+ VL H
Sbjct  304   ILEFQHGLLNSKVKFLWVMRPNILKGGESDVQFM-KELAEGCKGNGYIVSWAPQKMVLAH  362

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              A+ GFLTHSGWNSTLES++ G PMICWP + DQ+ NSR V E+W++GLDMK +CDRS++
Sbjct  363   PAIAGFLTHSGWNSTLESVSEGKPMICWPHYVDQRVNSRLVNELWQIGLDMKGICDRSTI  422

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM-----IKVNEATR  1447
             E++I++LME ++ E  +  E + KLAK ++ EGGSSY N DCLI D+      K NE  R
Sbjct  423   ERMIKDLMEIKRDELKKSIEELSKLAKLSVEEGGSSYNNLDCLIDDIKELARTKENENIR  482



>ref|XP_006379614.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
 gb|ERP57411.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
Length=365

 Score =   387 bits (994),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 229/306 (75%), Gaps = 8/306 (3%)
 Frame = +2

Query  530   GNGIDSSPITKVKGMEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFE  697
             GN      ITKV GME FLR RDL  FCR  D+     +L   E R + +A+ LILNTFE
Sbjct  50    GNEDMDRLITKVPGMETFLRCRDLPSFCRVSDMTHPNLLLVMNETRQSPRAKALILNTFE  109

Query  698   DLEGPILSQIRTKYPNVYTIGPLHAHLKATLASKSTHS----NSLLQEDETCMAWLDSQE  865
             DLEGP++SQIRT  P +Y+IGPLH HL+A L++K+  S    NSL + D +CM WLD+Q 
Sbjct  110   DLEGPLMSQIRTHCPEIYSIGPLHEHLQAKLSAKNEKSCQSSNSLREIDRSCMTWLDNQP  169

Query  866   PKSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEG  1045
              KSV+YVSFGS +V+TR QL+EFWYGLV+S K+FLWV+R D +A KD E   IP E++EG
Sbjct  170   EKSVLYVSFGSFTVMTRHQLLEFWYGLVSSKKRFLWVIRPDSIATKDGEFEKIPVEVEEG  229

Query  1046  TKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFV  1225
             TK  G+I GW PQE VL H A+ GFLTHSGWNSTLESI AGVPMICWP+FADQQ NSRFV
Sbjct  230   TKERGFIAGWVPQEEVLAHKAIAGFLTHSGWNSTLESIVAGVPMICWPYFADQQVNSRFV  289

Query  1226  GEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFD  1405
             GEVWK+GLDMKD CDR  VEK++ +LM +R+ EF+  A  M +L+++++ EGGSSYCN +
Sbjct  290   GEVWKLGLDMKDQCDREIVEKMVNDLMVERREEFVRSATRMAELSRKSVREGGSSYCNLN  349

Query  1406  CLIQDM  1423
              LI+D+
Sbjct  350   RLIEDI  355



>ref|XP_007026847.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07349.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
Length=496

 Score =   391 bits (1005),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 215/477 (45%), Positives = 295/477 (62%), Gaps = 21/477 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS-GRFTTRF  223
             + H+++ P P+  H+  +L LA LL  A+F +TF  P  IH RLL   D+ +  R    F
Sbjct  8     VPHVVLLPFPSLGHIKPLLSLAELLSHASFQVTFLNPQQIHDRLLLSMDMPAFHRRHPEF  67

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIG---KPFLKQY-IAQNRDSGL--PFTCFIS  385
                S P  +   +   +     L D++  +G   KP L +  I+ NR+ G   P TC I+
Sbjct  68    EFLSMPDPVRRSSDRPRPGLFSLHDNILSLGSVIKPALGELLISFNRERGRRQPATCIIA  127

Query  386   D-LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP-IT  559
             D LL S  +DV+E+ F +P +  R  SAC  W YF+ P L E G++P +    D    +T
Sbjct  128   DGLLSSPVIDVAEQ-FEIPFFALRTSSACCIWAYFNPPKLVEEGDVPFQVADEDMDKLVT  186

Query  560   KVKGMEDFLRVRDLSPFCRDE---DLAVLYYTEARLAV--QARGLILNTFEDLEGPILSQ  724
              + G+E+ +R RDL    R E   D A+ Y+   +  V  +A GLILNTF++LE P++++
Sbjct  187   CIPGLENVVRRRDLPGIFRIERANDPALEYFINDQTLVLPRASGLILNTFDELEAPVIAK  246

Query  725   IRTKYPNVYTIGPLHA----HLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSF  892
             + + +  VYT+GPLH+     +K  L S ++  N L +ED +CM WLDSQ  KSVI+VSF
Sbjct  247   LGSHFTKVYTVGPLHSLSTVRMK-DLISVASGENILWKEDTSCMTWLDSQLSKSVIFVSF  305

Query  893   GSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVG  1072
             GS+   TR Q+ E W+GLVN GK FLW +R D + G+D   S I  +LK+ T   G +V 
Sbjct  306   GSVISFTRDQMFELWHGLVNCGKPFLWAIRQDSIIGEDGP-SLILGKLKDMTGDKGLLVS  364

Query  1073  WAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLD  1252
             WAPQE VL H A+GGF THSGWNSTLESI AGVPMICWP   DQQ NSRFV +VWK+G D
Sbjct  365   WAPQELVLTHPAIGGFFTHSGWNSTLESIFAGVPMICWPAIGDQQMNSRFVSDVWKIGFD  424

Query  1253  MKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             MKD CDRS +EK++R+LME ++ E ++    + KLA EA+ EGGSS+CN D LI D+
Sbjct  425   MKDSCDRSLIEKMVRDLMEDKREEIMKSVNEIKKLAHEAVKEGGSSFCNLDKLIDDI  481



>gb|KDO58004.1| hypothetical protein CISIN_1g037999mg [Citrus sinensis]
Length=447

 Score =   389 bits (999),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 204/453 (45%), Positives = 277/453 (61%), Gaps = 20/453 (4%)
 Frame = +2

Query  98    MLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFRLQSFPPGIYDGALNS  271
             ML LA L   A F +TF      H RLL   DV     RF   FR  S P G+       
Sbjct  1     MLTLAELFSHAGFRVTFVNTEQYHDRLLGNNDVTGFYKRFPN-FRFTSIPDGLPPDNPRF  59

Query  272   KEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALDVSEECFNLPVYYF  451
                  +   S + + K    Q +      GL  TC ISD ++S  +DV+EE  N+P+  F
Sbjct  60    GIYIKDWFCSDKPVSKLAFLQLLMS---PGLLPTCIISDSIMSFTIDVAEE-LNIPIITF  115

Query  452   RPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCRD----  619
             RP SA   W+ F    L E GELP+     D  P+  + G+E+F R RDL   CRD    
Sbjct  116   RPYSAHCSWSDFHFSKLAEEGELPVTNENFDK-PVKCIPGLENFFRNRDLPSICRDGGPD  174

Query  620   EDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKATLASK  799
             + +   +  +     +   L++NTF ++EGPI+S++ ++   +YT+GPLHA LK+ +   
Sbjct  175   DPILQTFIRDTSATTRTSALVINTFNEIEGPIISKLGSRLTKIYTVGPLHALLKSRIQED  234

Query  800   STHSNS-------LLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNSG  958
             S  S+        L +ED +CM WLDSQ  +SV+YVSFGS   + R+Q++EFW+G+VNSG
Sbjct  235   SAESSPPESNNCVLSKEDRSCMTWLDSQPSRSVLYVSFGSFIKLGREQILEFWHGMVNSG  294

Query  959   KKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGW  1138
             K+FLWV+RSDL+ G+     P+P EL++GTK  G IV WAPQE VL H A+GGFLTHSGW
Sbjct  295   KRFLWVIRSDLIDGEPGV-GPVPVELEQGTKERGCIVSWAPQEEVLAHQAIGGFLTHSGW  353

Query  1139  NSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRK  1318
             NSTLES+ AGVPMICWP   DQQ NSR V E+WK+GLDMKD CDRS++E L+R+LM+ ++
Sbjct  354   NSTLESLVAGVPMICWPQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTIENLVRDLMDNKR  413

Query  1319  GEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
              + +E    + K+A++A+ EGGSSY N D LI+
Sbjct  414   DKIMESTVQIAKMARDAVKEGGSSYRNLDKLIK  446



>gb|KDO38335.1| hypothetical protein CISIN_1g044936mg [Citrus sinensis]
Length=455

 Score =   389 bits (999),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 206/456 (45%), Positives = 280/456 (61%), Gaps = 22/456 (5%)
 Frame = +2

Query  98    MLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFRLQSFPPGIYDGALNS  271
             ML LA L   A F +TF      H RLL  TDV     RF   FR  S P G+       
Sbjct  1     MLTLAELFSHAGFRVTFVNTEQYHDRLLGNTDVTGFYKRFPN-FRFTSIPDGLPPDNPRF  59

Query  272   KEVFVELCDSLRRIGK-PFLKQYIAQNRDSGLPFTCFISDLLVSIALDVSEECFNLPVYY  448
                  +   S + + K  F +  +   R   LP TC ISD ++S  +DV+EE  N+P+  
Sbjct  60    GIYIKDWFCSDKPVSKLAFRRLLMTPGR---LP-TCIISDSIMSFTIDVAEE-LNIPIIT  114

Query  449   FRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCRD---  619
             FRP SA   W+ F    L E GELP+     D  P+T + G+E+  R RDL   CRD   
Sbjct  115   FRPYSAHCSWSDFHFSKLAEEGELPVTNEDFDK-PVTCIPGLENIFRNRDLPSICRDGGP  173

Query  620   -EDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKATLAS  796
              + +   +  +     +   L++NTF ++EGPI+S++ ++   +YT+GPLHA LK+ +  
Sbjct  174   DDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKLGSRLTKIYTVGPLHALLKSRIQE  233

Query  797   KSTHSNS-------LLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNS  955
              S  S+        L +ED +CM WLDSQ   +V+YVSFGS   + R+Q++EFW+G+VNS
Sbjct  234   DSAESSPPESNNCVLSKEDRSCMTWLDSQPSGTVLYVSFGSFIKLGREQILEFWHGMVNS  293

Query  956   GKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSG  1135
             GK+FLWV+RSDL+ G+     P+P EL +GTK  G IV WAPQE VL H A+GGFLTHSG
Sbjct  294   GKRFLWVIRSDLIDGEPGV-GPVPVELDQGTKERGCIVSWAPQEEVLAHQAIGGFLTHSG  352

Query  1136  WNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKR  1315
             WNSTLES+ AGVPMICWP   DQQ NSR V E+WK+GLDMKD CDRS++E L+R+LM+ +
Sbjct  353   WNSTLESMVAGVPMICWPQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTIENLVRDLMDNK  412

Query  1316  KGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             + E +E    + K+A++A+ EGGSSY N + LI+D+
Sbjct  413   RDEIMESTVKIAKMARDAVKEGGSSYRNLEKLIEDI  448



>emb|CDO99846.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   387 bits (994),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 212/471 (45%), Positives = 276/471 (59%), Gaps = 61/471 (13%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+LIFP P Q H+N MLKLA LL     H+TF    +IH RLL  TD+        +   
Sbjct  6     HVLIFPFPVQGHINCMLKLAELLCCRGLHVTFLNSHHIHERLLCCTDI-------HYHFS  58

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALD  412
              +P      + + + +   L     R G   L      + +     TC I+D ++S  +D
Sbjct  59    QYP------SFHFETISDGLPADHPRTGDHILTGLQFHSPNGRPALTCIIADGIMSFTVD  112

Query  413   VSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRV  592
             V++E  ++P   FR +SA  FW +  +P L EAGELP  G       ++ V G+E F R+
Sbjct  113   VAKE-LHIPTILFRTVSASCFWAFLCVPKLLEAGELPFNGENDMDKLLSSVPGLERF-RM  170

Query  593   RDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIG  760
             RDL  FCR  +LA     +  +E    ++A GL+LNTFEDLE   LS IRT  P +YT+G
Sbjct  171   RDLPSFCRTSNLADPGFQVVISETLQNLKADGLLLNTFEDLEESALSHIRTHIPKLYTVG  230

Query  761   PLHAHLKATLAS----KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLM  928
             PLHAHLKA  AS    +   S+SL +ED +CMAWLD +   SVIYVSFGS++V+TR QL 
Sbjct  231   PLHAHLKAREASSPALQQPSSSSLWKEDRSCMAWLDRKPRNSVIYVSFGSMTVLTRNQLF  290

Query  929   EFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLA  1108
             EFW+GLVNSGK FLW                                       VL H A
Sbjct  291   EFWHGLVNSGKPFLW--------------------------------------EVLAHPA  312

Query  1109  VGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEK  1288
             VGGFLTHSGWNSTLESI  GVPMICWPF+ADQQ NSR VGEVWKVGLDMKD C+R++VEK
Sbjct  313   VGGFLTHSGWNSTLESIYEGVPMICWPFYADQQVNSRLVGEVWKVGLDMKDTCERATVEK  372

Query  1289  LIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEA  1441
             +I++LM+ ++ EF+  A+   KLA+ ++ + GSS+CN D LI D+  +N A
Sbjct  373   MIKDLMDVKRDEFMLCAKEKAKLARRSVEQAGSSHCNLDRLIDDINMMNRA  423



>gb|KHG08953.1| hypothetical protein F383_15475 [Gossypium arboreum]
Length=484

 Score =   389 bits (999),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 217/470 (46%), Positives = 289/470 (61%), Gaps = 12/470 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS-GRFTTRFRL  229
             H+LI P+PAQ HL  MLKLA LL  A+F ITF      H   L+  D+ +  R   +F+ 
Sbjct  10    HVLILPIPAQGHLRPMLKLAELLSNASFQITFLNTEYFHHTFLSSIDIHAFSRRFPKFQF  69

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRD-SGLPFTCFISDLLVSIA  406
              + P G+   +    +       SL    KP + + +   R  SG P TC I+D ++S A
Sbjct  70    VTIPDGLPPDSPRPGKGIAHYLISLTDAAKPAVVEVLVSLRSKSGRPPTCIIADGIMSSA  129

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
                + E F +PV  FR  SAC  WTYF+L +L E GELP+    +D   +T + G+E+ L
Sbjct  130   AVAAGEEFGIPVLAFRTYSACCTWTYFNLSNLVEGGELPLPDKDMDKL-VTCIPGLENVL  188

Query  587   RVRDLSPFCR-----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVY  751
             R RDL  FCR     D  L   +  +A    +A  LILNTFE LE P +S++ + +  +Y
Sbjct  189   RHRDLPSFCRLEKADDHLLYDFFIAQASAMRRASALILNTFEQLETPFISKLASIFSKIY  248

Query  752   TIGPLH--AHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQL  925
             TIGPLH  +++    A  ST S    QE++ C+ WLDS   KSV++VSFGS+   T  Q+
Sbjct  249   TIGPLHCLSNVDDPTALASTKS-IFWQEEKGCLTWLDSHPSKSVVFVSFGSVVTFTLDQM  307

Query  926   MEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHL  1105
             +EFW+GLVNSGK FLWV+RS+ + G+DD    I  +LK+ TK  G IV WAPQE VL H 
Sbjct  308   LEFWHGLVNSGKPFLWVIRSNAIIGEDDPRK-ILEDLKDNTKGKGSIVSWAPQEEVLAHP  366

Query  1106  AVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVE  1285
             AVG FLTHSGWNSTLESI AGVPMICWP F DQ  NSR V  VW+VG DMKD C RS +E
Sbjct  367   AVGAFLTHSGWNSTLESIYAGVPMICWPLFVDQYVNSRCVSYVWRVGFDMKDSCHRSIIE  426

Query  1286  KLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             K++R+++E +  E ++  E + K A+E++ E G SYCN D +IQD++ VN
Sbjct  427   KMVRDVIEMKNEEIMKSMEEISKQAQESVKESGPSYCNLDKMIQDIMSVN  476



>dbj|BAB86930.1| glucosyltransferase-12 [Vigna angularis]
Length=463

 Score =   387 bits (995),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 215/464 (46%), Positives = 298/464 (64%), Gaps = 21/464 (5%)
 Frame = +2

Query  98    MLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS---GRFTTRFRL--QSFPPGIYDGA  262
             MLKLA LL L + H+TF    +IH RL    D+ S      T  F      +  G + G+
Sbjct  1     MLKLAELLALHHLHVTFINTHSIHNRLTRYGDIQSLSASYPTLHFNTIADCYSHGNHTGS  60

Query  263   LNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISD-LLVSIALDVSEEC-FNL  436
              ++    + L  +L    KP L+  +          TC I D +L S++ D++ E    +
Sbjct  61    GDTSGDII-LSTALH--AKPLLRNILLAQSPEIPKVTCIIQDGILGSLSNDLASELGIRI  117

Query  437   PVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCR  616
              + +FR  S C FW YF LP+LF+  ELPI+G+      IT + GME+ LR RDL  FCR
Sbjct  118   TIIHFRTSSPCCFWPYFWLPNLFKTNELPIRGDEDMDRIITNMPGMENLLRCRDLPSFCR  177

Query  617   ---DEDLAVLYYT-EARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKA  784
                  ++++ + + + + ++ A  LILNTFE+L+  +LSQIR  +P VYT+GPLH HL  
Sbjct  178   PGAKGNMSIDWVSFQTQQSLAADALILNTFEELDRLVLSQIRLHFPKVYTLGPLHHHLNV  237

Query  785   TLASKS------THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGL  946
               A  +      +  +S  + D +CMAWLD+Q   SV+YVSFG+ +++TR++LMEFW+GL
Sbjct  238   RKAETNGANDAPSFRSSFFEVDRSCMAWLDAQAQGSVLYVSFGTSTIVTREELMEFWHGL  297

Query  947   VNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLT  1126
             V+S K+FLWVMR DLV G+++++  IP E++EGTK  G +V WAPQE VL H A+GGFLT
Sbjct  298   VDSKKRFLWVMRPDLVVGRENDDR-IPEEVEEGTKERGLMVEWAPQEEVLAHKAIGGFLT  356

Query  1127  HSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELM  1306
             HSGWNSTLES+ AGVPMICWP+FADQQ NSRFV EVWKVGLDMKDVCDR  VEK++ +LM
Sbjct  357   HSGWNSTLESLVAGVPMICWPYFADQQVNSRFVSEVWKVGLDMKDVCDRDVVEKMVNDLM  416

Query  1307  EKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNE  1438
               R+ EFL+ A+ M  LA +++S GGSS+ +   LI  +  V++
Sbjct  417   VHRRDEFLKSAQAMAMLAHQSVSPGGSSHSSMQDLIHYIKSVSK  460



>ref|XP_011000049.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Populus 
euphratica]
Length=486

 Score =   387 bits (993),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 213/479 (44%), Positives = 288/479 (60%), Gaps = 17/479 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTR  220
             + H++  P PAQ H+  ML LA LL  A F  TF   ++I  RL   T++ +  GRF  +
Sbjct  6     VPHVVFLPFPAQGHVKPMLMLAELLSQAGFEATFINSNHIQDRLEHSTNIATMYGRFP-K  64

Query  221   FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDL  391
             F+ +S P G+      S     +L  S R   +   +  +    Q      P TC I+D 
Sbjct  65    FQFRSIPDGLPSDHPRSGSSISQLLISNRDETRTEFRNLLVNLGQKNGRWEPPTCIIADG  124

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
             ++S A+D++EE   +PV  FR  SAC  WTYF L  L E GE P +G+      IT + G
Sbjct  125   IMSFAIDIAEE-LTIPVITFRTFSACCTWTYFHLTKLIEEGEFPFQGDVDMDKTITCIPG  183

Query  572   MEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             +E  LR RDL   CR    ++ L   +  E     +A GLILNTF+ LE  ++S++ + +
Sbjct  184   LEGTLRCRDLPGICRLKEANDPLLQFFIKETAAMPRASGLILNTFDGLEASMVSKLGSFF  243

Query  740   PNVYTIGPLHAHLKATLASKSTHS--NSLL-QEDETCMAWLDSQEPKSVIYVSFGSISVI  910
               +YT+GPL         S S  +  N LL +ED  C+ WLDS   +SVIYVSFGS+  +
Sbjct  244   SKIYTLGPLQGLFDTFAKSPSARTSFNGLLWKEDRGCITWLDSHPSRSVIYVSFGSLVGL  303

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
              R QL+EFW+GLVNSGK FLWV+RSD + G+D   S +P ELK  T+  G IV WAPQE 
Sbjct  304   FRDQLLEFWHGLVNSGKPFLWVLRSDSIIGEDGV-SEVPLELKAATEERGCIVDWAPQEE  362

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H A+GGFLTHSGWNSTLESI AGVPMICWP  ADQQ NSR V E+WK G DMKD C+
Sbjct  363   VLAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMLADQQVNSRCVSELWKTGFDMKDKCE  422

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATR  1447
             R+ +EKL+R+LME    E ++  + +  +A++++ EGGSSY N   LI+D+  ++ A +
Sbjct  423   RAVIEKLVRDLME--SDEIVKATDEIAGMARDSVKEGGSSYSNLQKLIEDIKSMSLAGK  479



>gb|AIE12478.1| UGT5 [Panax ginseng]
Length=477

 Score =   386 bits (992),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 204/474 (43%), Positives = 283/474 (60%), Gaps = 17/474 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR---F  223
             H+L+ P PA  H+  ML L  LL  A   +T       H  +L    +D   F +R   F
Sbjct  8     HVLMLPFPAVGHIKPMLMLGKLLCQAGLSVTLLNTDQNHNNIL--NPIDQSSFYSRYPGF  65

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI-AQNRDSGLP--FTCFISDLL  394
             + +S   G+    L +  V  EL   +        K+Y+  +  + G P   TC I+D +
Sbjct  66    QFKSLAVGLPPEHLRTGPVVAELLYWITSACSTKFKEYLMVEENEKGQPEPVTCIIADGI  125

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S  +D++EE F++PV  FR  ++ + W YF L  L + GE+P++ +      IT + G+
Sbjct  126   MSFTIDIAEE-FHIPVITFRTYNSTSTWVYFHLHQLLQNGEIPVQRDEDMDQQITSIPGL  184

Query  575   EDFLRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
             E  LR RDL PFC+    + L   Y  +     +A  LILNTFE+LEGPI+S + + +P 
Sbjct  185   ETILRRRDLPPFCKLDSTDHLLQFYMGQTSKMKRASALILNTFEELEGPIVSHLHSIFPT  244

Query  746   VYTIGPLH----AHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
             VYTIGPLH    +H+        +   S+  +D TC+ WLDSQ  KSV+YVSFGS+ V+T
Sbjct  245   VYTIGPLHGLLQSHINHNAPPSDSSETSVRPQDRTCIRWLDSQPSKSVVYVSFGSVVVLT  304

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             + QL+EFW+GLVNSG  FLWV+R  LV  +++  +  PSEL   T   G IVGW PQE V
Sbjct  305   QDQLLEFWHGLVNSGSPFLWVIRPGLVLAENNV-AETPSELTIATNERGCIVGWGPQEEV  363

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGFL+HSGWNSTLESI AG+PMICWP  ADQ  NSR VGE+W+ GLDMKD CDR
Sbjct  364   LAHRAVGGFLSHSGWNSTLESIWAGMPMICWPQIADQWINSRCVGEMWRTGLDMKDTCDR  423

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             S+VEK++R LME +  E  +       +A+ ++++GGSSY +   LI+D+  + 
Sbjct  424   STVEKMVRGLMEDKNEEIRKSTAIYSSMARNSVAKGGSSYHSMSKLIEDIKSIQ  477



>emb|CDP05613.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   383 bits (984),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 211/413 (51%), Positives = 272/413 (66%), Gaps = 33/413 (8%)
 Frame = +2

Query  284   VELCDSLRRIGKPFLKQYIAQNRDSGL-----PFTCFISDLLVSIALDVSEECFNLPVYY  448
             ++L  SL+ + KPFLK++++++   G      PFT  I+D ++S+ALDV+EE   LPV Y
Sbjct  1     MDLHTSLQSVMKPFLKEFLSKDPVGGSGKNRPPFTSIIADGILSVALDVAEE-IGLPVIY  59

Query  449   FRPISACAFWTYFSLPDLFEAGELPI-------KGNGIDSSPITKVKGMEDFLRVRDLSP  607
             FR  SA  FW YF  P L EAGE P        + N +D  PI  VKGME  LR RDL+ 
Sbjct  60    FRTTSAGFFWPYFCTPLLTEAGEFPFSFTILYSERNDMDL-PIAHVKGMEGVLRHRDLTS  118

Query  608   FCRDEDLAV----LYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAH  775
             F R  DL      L   E     +A+GLILNTFEDLE PILS +R + PN+YTIGPL+AH
Sbjct  119   FYRANDLNSPRFKLLLNENLQTPRAKGLILNTFEDLERPILSHVRIQCPNLYTIGPLYAH  178

Query  776   LKA----TLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYG  943
             LK      L  +      L +ED +C+ WLD+Q PKSV+YVSFGSI++ITR++L+EFW+G
Sbjct  179   LKTRLQLQLVLERGRGFDLCEEDTSCIKWLDNQPPKSVLYVSFGSITIITREKLLEFWHG  238

Query  944   LVNSGKKFLWVMRSDLVA---GKDDEESPIPSE------LKEGTKANGYIVGW--APQEA  1090
             +VNS  +FLWV+RSD +    G D  E+    +      +   +   GY VG+  APQE 
Sbjct  239   IVNSRVRFLWVIRSDSIRVRLGDDGLETDKQYKYLGKKLINNYSSDRGYRVGYFLAPQEE  298

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL   A+  FLTHSGWNSTLES+  G PMICWP+F DQ  NSRFVGE+WK+GLD+KD CD
Sbjct  299   VLARPAIDRFLTHSGWNSTLESMVEGKPMICWPYFGDQHPNSRFVGELWKLGLDIKDTCD  358

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIK  1429
             R  VEK+I+ LM +RK EFL+RA  M KLA+++I EGGSS+CNF  LI D++K
Sbjct  359   RKIVEKMIKGLMVERKDEFLQRANEMAKLARKSIEEGGSSFCNFLRLIDDIVK  411



>ref|XP_004302685.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Fragaria vesca 
subsp. vesca]
Length=465

 Score =   385 bits (988),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 222/471 (47%), Positives = 288/471 (61%), Gaps = 38/471 (8%)
 Frame = +2

Query  98    MLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT-RFRLQSFPPGIYDGALNS-  271
             ML LA LL  A  H+TF    + H R L   +  S RF T RFR       I+DG  +  
Sbjct  1     MLTLAQLLCHAGIHVTFVNTEHNH-RHLTQRESLSARFPTLRFR------SIFDGLPSDH  53

Query  272   ----KEVFVELCDSLRRIGKPFLKQYIAQ-----NRDSGL-------PFTCFISDLLVSI  403
                    F+++  SLR    P L Q +       N D G        P +C I+D L+  
Sbjct  54    PRSISPYFLDIVTSLRSTTAPLLHQLLVSLASKTNDDIGAAAGDQLPPLSCVITDGLMCF  113

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
             A+D +EE   LPV   R  SAC+ W Y  LP L E  ELP     +D + ++ V G E  
Sbjct  114   AIDAAEE-VGLPVIAVRTSSACSVWCYLCLPKLIEEAELPFGDEDMDKT-VSGVPGKECL  171

Query  584   LRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             LR RDL   CR   D  +   +  E     +A GLILNTFEDLE  +LS I +K+  +Y 
Sbjct  172   LRRRDLLSICRMPVDHPVFKFFMEEHIAITRASGLILNTFEDLESSVLSHIASKFSKIYP  231

Query  755   IGPLHAHLKATL------ASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             IGPLHA LK+ +      +S +  + SL +ED +CM WLDSQ P SVI+VS+GS+  +TR
Sbjct  232   IGPLHALLKSRVDDHDLSSSSTAMAASLHREDRSCMTWLDSQRPGSVIFVSYGSLVKLTR  291

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPI-PSELKEGTKANGYIVGWAPQEAV  1093
              QL+EFW+GLVNSG  FLWVMRSD+++ + +    + P+EL+ GTK  G+IV WAPQE V
Sbjct  292   VQLLEFWHGLVNSGSHFLWVMRSDVLSDEGEHMRHVTPTELEMGTKERGFIVDWAPQEEV  351

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGFLTHSGWNSTLE+I AGVPM+CWP  ADQQ NSR+VGEVWK+G+DMKD+CDR
Sbjct  352   LAHDAVGGFLTHSGWNSTLEAIWAGVPMLCWPQVADQQVNSRWVGEVWKIGIDMKDMCDR  411

Query  1274  SSVEKLIRELMEKRKGEFLERA-ENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             ++VEK+I+ LM   + E   R+ +   KLA+ ++SE GSSY N + LIQD+
Sbjct  412   TTVEKMIKALMGGEEREVFTRSVDRFSKLARASVSESGSSYHNLEKLIQDL  462



>ref|XP_011014019.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Populus euphratica]
Length=496

 Score =   385 bits (989),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 210/478 (44%), Positives = 288/478 (60%), Gaps = 15/478 (3%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSG-RFTTRF  223
             + H++  P PAQ H+  ML LA LL  A F  TF   ++I  RL    ++ +  R   +F
Sbjct  16    VPHVVFLPFPAQGHVKPMLMLAELLSQAGFEATFINSNHIQHRLEHSINIATMYRRFPKF  75

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLL  394
             + +S   G+      S    V+L  S R   +   +  +    Q      P TC I+D +
Sbjct  76    QFRSVTDGLPSDHPRSSSSIVQLLISARDETRTEFRNLLVNLGQKNGRWEPPTCIIADGI  135

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S A+D++EE   +PV  FR  SAC  WTYF L  L E GE+P +G+      IT + G+
Sbjct  136   MSFAIDIAEE-LTIPVITFRTFSACCTWTYFHLTKLIEQGEVPFQGDVDMDKTITCIPGL  194

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E  LR RDL   CR    ++ L   +  E     +A G+ILNTF+ LE  ++S++ + + 
Sbjct  195   EGTLRCRDLPGICRLKEANDPLLQFFIKETAAMPRAYGVILNTFDGLEASMVSKLGSFFS  254

Query  743   NVYTIGPLHAHLK--ATLASKSTHSNSLL-QEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              +YT+GPL       A   S  T  N LL +ED  C++WLD    +SVIYVSFGS+  + 
Sbjct  255   KIYTLGPLQGLFDTFAKSPSARTSFNGLLWKEDRGCISWLDFHPSRSVIYVSFGSLVCLV  314

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             R QL+EFW+GLVNSGK FLWV+RSD + G+D   S +P ELK  T+  G IV WAPQE V
Sbjct  315   RDQLLEFWHGLVNSGKPFLWVLRSDSILGEDGV-SEVPLELKAATEERGCIVDWAPQEEV  373

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H A+GGFLTHSGWNSTLESI AGVPMICWP FADQQ NSR V E+WK+G DMKD C+R
Sbjct  374   LAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMFADQQVNSRCVSELWKIGFDMKDKCER  433

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATR  1447
             + +EKL+R+LME    E ++  +   ++A++++ EGGSSY N   LI+D+  ++ A +
Sbjct  434   AVIEKLVRDLME--SDEIVKSTDEFARMARDSVKEGGSSYSNLQKLIEDIKSISLAGK  489



>ref|XP_006373896.1| hypothetical protein POPTR_0016s10010g [Populus trichocarpa]
 gb|ERP51693.1| hypothetical protein POPTR_0016s10010g [Populus trichocarpa]
Length=486

 Score =   384 bits (987),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 212/479 (44%), Positives = 289/479 (60%), Gaps = 17/479 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTR  220
             + H++  P PAQ H+  ML LA LL  A F  TF   ++I  RL   TD+ +   RF  +
Sbjct  6     VPHVVFLPFPAQGHVKPMLMLAELLSHAGFEATFINSNHIQHRLEHSTDIATMYCRFP-K  64

Query  221   FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDL  391
             F+ +S P G+      S     +L  + R   +   +  +    Q      P TC I+D 
Sbjct  65    FQFRSIPDGLPSDHPRSGSSISQLLIASRDETRTEFRNLLVNLGQKNGRWEPPTCIIADG  124

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
             ++S A+D++EE   +PV  FR  SAC  WTYF L  L E GE+P +G+      IT + G
Sbjct  125   IMSFAIDIAEE-LTIPVITFRTFSACCTWTYFHLTKLIEEGEVPFQGDVDMDKTITCIPG  183

Query  572   MEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             +E  LR RDL   CR    ++ L   +  E     +A GLILNTF+ LE  ++S++ + +
Sbjct  184   LEGTLRYRDLPSICRRKEANDPLFQFFIKETAAMPRASGLILNTFDRLEASMVSKLGSFF  243

Query  740   PNVYTIGPLHAHLK--ATLASKSTHSNSLL-QEDETCMAWLDSQEPKSVIYVSFGSISVI  910
               +YT+GPL       A   S  T SN LL +ED  CM WLDS   +SVIYVSFGS+  +
Sbjct  244   SKIYTLGPLQGLFDTFAESPSARTSSNGLLWKEDRGCMTWLDSHPSRSVIYVSFGSLVGL  303

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
              R QL+EFW+GLVNSGK FLWV+RSD +  ++D  S +P +LK  T+  G IV WAPQE 
Sbjct  304   FRDQLLEFWHGLVNSGKPFLWVIRSDSIM-EEDGVSEVPLQLKAATEERGCIVDWAPQEE  362

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H A+GGFLTHSGWNSTLESI AGVPMICWP  ADQQ NSR V E+WK+G DMKD C+
Sbjct  363   VLAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMIADQQVNSRCVSELWKIGFDMKDKCE  422

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATR  1447
             R+ +EKL+R+LME    E ++  +    +A++++ EGGSSY N   L++D+  ++ A +
Sbjct  423   RAVIEKLVRDLME--SDEIVKSTDEFAGMARDSVKEGGSSYSNLQKLVEDIKSMSLAGK  479



>gb|AFK79038.1| glycosyltransferase UGT6 [Bupleurum chinense]
Length=489

 Score =   384 bits (985),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 215/474 (45%), Positives = 300/474 (63%), Gaps = 20/474 (4%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RF  223
              H+LIFPLP Q  +N MLKLA LL L N H+TF   ++I   L+  T V+S RFT    F
Sbjct  11    AHVLIFPLPLQGPVNCMLKLAELLALNNLHVTFLNTTHIQNSLIKHTHVES-RFTKYPDF  69

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTC---FISDLL  394
             R ++ P G+ +    + + F+++   + ++ KP  ++ ++  + S          I+D  
Sbjct  70    RFETIPDGLSEDHPRTGDKFLDITHGIEKVMKPLFREMLSSGKLSSKSSKPVSLVIADGF  129

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
              +  + +++E   +P+ YF  IS CA WT+FSLP L + GE+P      D   +T + G 
Sbjct  130   YNFGVGIAKEA-GIPLVYFDTISPCAVWTFFSLPTLIKLGEVPFTEEDYDKK-VTCIPGT  187

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E +LR RDL  F R  DL+     L   E     +++G+ILNT E ++G I+SQ+ T   
Sbjct  188   EKYLRPRDLPSFFRTSDLSDPIVHLILQEIEAIPKSQGIILNTSEHIDGQIISQLSTYCS  247

Query  743   NVYTIGPLHAHLKATLASK------STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
             NVYTIGPLHA  K+ + SK      +  SNSL +ED +CM WLD+Q  KSVIYVS GS++
Sbjct  248   NVYTIGPLHALHKSIMLSKDKASPQANSSNSLWEEDNSCMTWLDAQPRKSVIYVSIGSLA  307

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
             V++  QLME  +G+VNSGK+FLWV R   ++GKD E+  I +EL + T   G IV W  Q
Sbjct  308   VMSIAQLMELRHGIVNSGKRFLWVQRPGSLSGKD-EDYAISTELSDATTERGCIVSWVFQ  366

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL H A+G FLTHSGWNSTLE I  GVPM+CWP+F DQQ NSRFV EVW VG+D+KD 
Sbjct  367   EEVLAHPAIGLFLTHSGWNSTLEGIIEGVPMLCWPYFVDQQVNSRFVQEVWSVGIDIKDK  426

Query  1265  CDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAI-SEGGSSYCNFDCLIQDM  1423
             CDR ++EK +RE+ME+RK EF + A  M KLA++++  +GGSS+ NF+ L+ D+
Sbjct  427   CDRVTIEKAVREIMEERKDEFEKSASMMAKLARQSVCDQGGSSHHNFNRLVNDI  480



>ref|XP_011014018.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Populus euphratica]
Length=498

 Score =   384 bits (986),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 211/480 (44%), Positives = 290/480 (60%), Gaps = 17/480 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSG-RFTTRF  223
             + H++  P PAQ H+  ML LA LL  A F  TF   ++I  RL    ++ +  R   +F
Sbjct  16    VPHVVFLPFPAQGHVKPMLMLAELLSQAGFEATFINSNHIQHRLEHSINIATMYRRFPKF  75

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLL  394
             + +S   G+      S    V+L  S R   +   +  +    Q      P TC I+D +
Sbjct  76    QFRSVTDGLPSDHPRSSSSIVQLLISARDETRTEFRNLLVNLGQKNGRWEPPTCIIADGI  135

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNG-ID-SSPITKVK  568
             +S A+D++EE   +PV  FR  SAC  WTYF L  L E GE+P +G G +D    IT + 
Sbjct  136   MSFAIDIAEE-LTIPVITFRTFSACCTWTYFHLTKLIEQGEVPFQGPGDVDMDKTITCIP  194

Query  569   GMEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTK  736
             G+E  LR RDL   CR    ++ L   +  E     +A G+ILNTF+ LE  ++S++ + 
Sbjct  195   GLEGTLRCRDLPGICRLKEANDPLLQFFIKETAAMPRAYGVILNTFDGLEASMVSKLGSF  254

Query  737   YPNVYTIGPLHAHLKATLASKSTHS--NSLL-QEDETCMAWLDSQEPKSVIYVSFGSISV  907
             +  +YT+GPL         S S  +  N LL +ED  C++WLD    +SVIYVSFGS+  
Sbjct  255   FSKIYTLGPLQGLFDTFAKSPSARTSFNGLLWKEDRGCISWLDFHPSRSVIYVSFGSLVC  314

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             + R QL+EFW+GLVNSGK FLWV+RSD + G+D   S +P ELK  T+  G IV WAPQE
Sbjct  315   LVRDQLLEFWHGLVNSGKPFLWVLRSDSILGEDGV-SEVPLELKAATEERGCIVDWAPQE  373

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H A+GGFLTHSGWNSTLESI AGVPMICWP FADQQ NSR V E+WK+G DMKD C
Sbjct  374   EVLAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMFADQQVNSRCVSELWKIGFDMKDKC  433

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATR  1447
             +R+ +EKL+R+LME    E ++  +   ++A++++ EGGSSY N   LI+D+  ++ A +
Sbjct  434   ERAVIEKLVRDLME--SDEIVKSTDEFARMARDSVKEGGSSYSNLQKLIEDIKSISLAGK  491



>gb|KDO38337.1| hypothetical protein CISIN_1g011531mg [Citrus sinensis]
Length=483

 Score =   380 bits (977),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 210/474 (44%), Positives = 294/474 (62%), Gaps = 23/474 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             H+++ P P Q H+  M+ LA LL  ANF +TF    + H  LL  TD+ S   RF   F+
Sbjct  9     HVVLLPYPLQGHIKPMMSLAELLGSANFQVTFVNTDHNHDLLLRNTDITSFCNRFPN-FQ  67

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSG---LPFTCFISD-LL  394
              +S P G+    + S     ++ D+++ + KP  +  +   R+        TC I+D +L
Sbjct  68    FRSIPSGLPANVIRSGLTAKDVFDAMKAVSKPAFRDLLISLREETEQRQSPTCVIADGIL  127

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
               + LDVSEE   +P+   R  +A   W YF LP L E G +P     ++  P+  + G 
Sbjct  128   CFLTLDVSEE-LQIPLLALRTHNASYSWIYFLLPKLVEDGHIPFPDENMEK-PVAGIPGF  185

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARLAV-QARGLILNTFEDLEGPILSQIRTKY  739
             E+FLR RDL   CR    D+D  + ++     A+ +A  LILNTFE +E P++S + + +
Sbjct  186   ENFLRNRDLPGTCRVKTSDDDYLLQFFIGETFAMTRASALILNTFE-IEAPVVSLLGSHF  244

Query  740   PNVYTIGPLHAHLKATLA---SKSTHSNSLLQ-EDETCMAWLDSQEPKSVIYVSFGSISV  907
               +YTIGPLH   K+ +    S S  S+ +LQ ED +CM WL+SQ PKSV+YVSFGS+  
Sbjct  245   TKIYTIGPLHELRKSRMKDINSPSVSSSGILQTEDTSCMTWLNSQPPKSVLYVSFGSLVG  304

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDE-ESPIPSELKEGTKA-NGYIVGWAP  1081
             +TR+Q+ E W+GLVN G++FL V+R DL+ G+    E+P+     EGT+  N +IV WAP
Sbjct  305   LTREQMSELWHGLVNRGQRFLLVVRPDLILGEPGAAETPLAQ--NEGTEERNRFIVSWAP  362

Query  1082  QEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKD  1261
             QE VL H AVGGFLTH GWNSTLE IAAGVPMICWP F+DQ  NSR V EVWK+G DMKD
Sbjct  363   QEEVLAHPAVGGFLTHGGWNSTLEGIAAGVPMICWPQFSDQLVNSRCVSEVWKIGFDMKD  422

Query  1262  VCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              CD S +EKL+R+LME ++ E +   + +  +A++A++EGGSSY N D LI+D+
Sbjct  423   TCDGSIIEKLVRDLMENKREEIMGSTDRVATMARDAVNEGGSSYRNLDGLIEDI  476



>ref|XP_006429243.1| hypothetical protein CICLE_v10011602mg [Citrus clementina]
 gb|ESR42483.1| hypothetical protein CICLE_v10011602mg [Citrus clementina]
Length=486

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 206/472 (44%), Positives = 291/472 (62%), Gaps = 19/472 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             H+++ P P Q H+  M+ LA LL  ANF +TF   ++ H  LL  TD+ S   RF   F+
Sbjct  12    HVVLLPYPLQGHIKPMMSLAELLGSANFQVTFVNTNHNHDLLLRNTDITSFCNRFPN-FQ  70

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISD-LL  394
              +S P G+    + S     ++ D+++ + KP  +  +    +  +     TC I+D +L
Sbjct  71    FRSIPSGLPANVIRSGLTAKDVFDAMKAMSKPAFRDLLISLGEETEQRQRPTCVIADGIL  130

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
               + LDVSEE   +P+   R  +A   W YF LP L E G +P     +D  P+  + G 
Sbjct  131   CFLTLDVSEE-LQIPLLALRTHNASYSWIYFHLPKLIEDGHIPFLDENMDK-PVAGIPGF  188

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARLAV-QARGLILNTFEDLEGPILSQIRTKY  739
             E+FLR RDL   CR    D+D  + ++     A+ +A  LILNTFE +E P++S + + +
Sbjct  189   ENFLRNRDLPGTCRVKTSDDDYLLQFFIGETFAMTRASALILNTFE-IEAPVVSLLGSHF  247

Query  740   PNVYTIGPLHAHLKATLA---SKSTHSNSLLQ-EDETCMAWLDSQEPKSVIYVSFGSISV  907
               +YTIGPLH   K+ +    S S  S+ +LQ ED +CM WL+SQ PKSV+YVSFGS+  
Sbjct  248   TKIYTIGPLHKLRKSRMKDINSPSVSSSGILQKEDTSCMTWLNSQPPKSVLYVSFGSLVG  307

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +TR+Q+ E W+GLVNSG++FL V+R DL+ G+    +   ++ K   + N +IV WAPQE
Sbjct  308   LTREQMSELWHGLVNSGQRFLLVVRPDLILGEPGAGATPLAQNKGTEERNRFIVSWAPQE  367

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H AVGGFLTH GWNSTLE I AGVPMICWP F+DQ  NSR V EVWK+G DMKD C
Sbjct  368   EVLAHPAVGGFLTHGGWNSTLEGIVAGVPMICWPQFSDQFVNSRCVSEVWKIGFDMKDTC  427

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             D S +EKL+R+LME ++ E +   + +  +A +A++EGGSSY N D LI+D+
Sbjct  428   DGSIIEKLVRDLMENKREEIMGSTDRVATMAHDAVNEGGSSYRNLDGLIEDI  479



>ref|XP_007026849.1| UDP-glucosyl transferase 85A3, putative [Theobroma cacao]
 gb|EOY07351.1| UDP-glucosyl transferase 85A3, putative [Theobroma cacao]
Length=468

 Score =   377 bits (969),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 208/467 (45%), Positives = 289/467 (62%), Gaps = 15/467 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+ P PAQ H+  ML LA LL  A   +TF    + H RL  L D+ S RF T    +
Sbjct  5     HVLVLPFPAQGHIKPMLCLAELLCQAGLRVTFLNTHHSHRRLNNLQDL-STRFPT-LHFE  62

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN--RDSGLPFTCFISDLLVSIA  406
             S   G+ +    +   F+ L  S++ + KP L+  +     +    P +C I+D ++S A
Sbjct  63    SVSDGLPEDHPRNLVHFMHLVHSIKNVTKPLLRDLLTSLSLKTDIPPVSCIIADGILSFA  122

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +DV+EE   + V  FR IS+C  W+Y  +P L + GEL    + +    ++ V  M+  L
Sbjct  123   IDVAEE-LQIKVIIFRTISSCCLWSYLCVPKLIQQGELQFSDSDMGQK-VSSVPEMKGSL  180

Query  587   RVRDLSPFC----RDEDLAVLYY-TEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVY  751
             R+ D  P+     + ED    ++ +E +   +A  +I NTF+ LE P+LSQ+    P VY
Sbjct  181   RLHD-RPYSFGLKQLEDPNFQFFVSETQAMTRASAVIFNTFDSLEAPVLSQMIPLLPKVY  239

Query  752   TIGPLHAHLKATLASKSTHSN---SLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             TIGPLHA  KA L   S HS+   +L + D  C+ WLDSQ  +SV+YVSFGS  V+T ++
Sbjct  240   TIGPLHALRKARLGDLSQHSSFNGNLREADHNCITWLDSQPLRSVVYVSFGSHVVLTSEE  299

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
             L+EFW+GLVNSGK+FLWV+R D++AG+ D    I  E   GTK  G +V WAPQE VL H
Sbjct  300   LLEFWHGLVNSGKRFLWVLRPDIIAGEKDHNQIIAREPDLGTKEKGLLVDWAPQEEVLAH  359

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              +VGGFLTH GWNSTLES+ AGVPM+CWP   DQ  NS  V EVWK+GLD+KD+CDRS+V
Sbjct  360   PSVGGFLTHCGWNSTLESMVAGVPMLCWPKLPDQLVNSSCVSEVWKIGLDLKDMCDRSTV  419

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             EK++R LME R+ E +   + + KLA+E++S GGSS  N + LIQ++
Sbjct  420   EKMVRALMEDRREEVMRSVDGISKLARESVSHGGSSSSNLEMLIQEL  466



>dbj|BAM63146.1| uncharacterized glucosyltransferase 2 [Ipomoea nil]
Length=464

 Score =   377 bits (967),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 209/464 (45%), Positives = 283/464 (61%), Gaps = 19/464 (4%)
 Frame = +2

Query  98    MLKLAHLLDLANFHITFFVPSNIHARLL---ALTDVDS--GRFTTRFRLQSFPPGIYDGA  262
             MLKLA LL LA  H+TF    + H RLL   A  DV+S   R+   FR +    G  +  
Sbjct  1     MLKLAELLCLAGVHVTFLNTKHNHQRLLRSAANGDVESRFDRYPGSFRFEVISDGFPEDH  60

Query  263   LNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALDVSEECFNLPV  442
               S E F+++ +SL+ + +P L++ + +  +SG   TC + + + S   ++ +E   +PV
Sbjct  61    PRSVEDFLDVVNSLQTVAEPHLREVLLRPPESGRKVTCAVVEAVFSYVFEIGKE-VGVPV  119

Query  443   YYFRPISACAFWTYFSLPDLFEAGELP-IKGNGID-SSPITKVKGMEDFLRVRDLSPFCR  616
             + F  IS C    Y  +P LF+ G+LP IK  G D  + +  V GME  L+VRDL  FCR
Sbjct  120   FAFETISPCCLGVYLCIPKLFQDGKLPLIKDLGEDLETVVDVVAGMEGVLKVRDLPEFCR  179

Query  617   DEDLAV-----LYYTEAR-LAVQARGLILNTFEDLEGPILSQIRTKYP-NVYTIGPLHAH  775
              E         L   E   L+  A GLILN+FE+LEGPIL  IRT +P N Y IGP+  H
Sbjct  180   TEGPRAEKSRKLAMAEIHSLSKLAHGLILNSFEELEGPILPHIRTHFPGNTYMIGPVQQH  239

Query  776   LKATLA----SKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYG  943
             LK  LA    ++S  SNS  +ED TC+ WLD Q  +SVIYVSFGS++ +T  QLME W+G
Sbjct  240   LKTRLAEREITQSPSSNSFWREDNTCIQWLDEQPDESVIYVSFGSLNTLTMAQLMEVWHG  299

Query  944   LVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFL  1123
             LV S  +FLWV+R D+V      +  + +EL++G   NG IV WAPQE VL H A+GGF 
Sbjct  300   LVASAVRFLWVLRPDIVKDNLSSDQNLVTELRKGCSENGQIVSWAPQEEVLAHRAIGGFW  359

Query  1124  THSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIREL  1303
             THSGWNSTLESI AG PMIC     DQ    R V EVWK+G+DM+D CDR S+EK+++E+
Sbjct  360   THSGWNSTLESIIAGKPMICSAQIVDQLITRRVVSEVWKIGVDMEDKCDRLSIEKMVKEV  419

Query  1304  MEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             M  R  E  + A+   KLA+E+++ GGSSY N D LI ++ +++
Sbjct  420   MGSRGQELKKSAQKFSKLARESVNNGGSSYTNLDHLINEIRRLS  463



>ref|XP_010674285.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=536

 Score =   379 bits (972),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 197/404 (49%), Positives = 262/404 (65%), Gaps = 20/404 (5%)
 Frame = +2

Query  263   LNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALDVSEECFNLPV  442
             +N K+    L ++L    +P L++ +   RD     TCFI D  +  A +++ E   +PV
Sbjct  138   INPKDALEALHEALAPSAEPLLRELLFGTRDK---ITCFIIDGWLRFAYEIANEA-EVPV  193

Query  443   YYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCRDE  622
               FR  SAC  W YF +P + EAGE+P K N      +  V GM+ FLR RDL  FCR +
Sbjct  194   IAFRCPSACCIWAYFCIPQIIEAGEVPFKDNEEMDQLVKNVAGMDSFLRCRDLPSFCRGQ  253

Query  623   DLAVL------YYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKA  784
             D++        +  E +    A   ILNTFEDLEGPILSQIR++   VY+IGPLHAHLK 
Sbjct  254   DMSSCCELQEYFAGEIQRTKHAHSFILNTFEDLEGPILSQIRSQCSTVYSIGPLHAHLKY  313

Query  785   TLASKST-----HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLV  949
              L    T      S+SL + D++C++WLD +  KSVIY+S GS + +T+ QL E W G+V
Sbjct  314   RLGKGETPLSNNSSSSLWEVDKSCISWLDQKPDKSVIYISLGSTTTLTKNQLTELWTGVV  373

Query  950   NSGKKFLWVMRSDLV--AGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFL  1123
              S + FLWV+R +++   G D   SPIP++L EGT   G IV WAPQ+ VL H A+GGFL
Sbjct  374   QSKRYFLWVVRPNVIIEGGLD---SPIPNDLLEGTDKRGCIVKWAPQDEVLTHRAIGGFL  430

Query  1124  THSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIREL  1303
             THSGWNSTLESI AGVPM+CWP FADQQ NSRF  EVW++GLDMKD CDR+ VEK+I +L
Sbjct  431   THSGWNSTLESIVAGVPMLCWPHFADQQLNSRFASEVWRIGLDMKDTCDRTIVEKMINDL  490

Query  1304  MEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             M+ +K E    A+ + + AK++ISEGGSSY N + LI+D+I ++
Sbjct  491   MDGKKDELQRSAKRVSQEAKKSISEGGSSYSNLNRLIEDIIAMS  534



>emb|CAN67315.1| hypothetical protein VITISV_036458 [Vitis vinifera]
Length=479

 Score =   375 bits (963),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 194/373 (52%), Positives = 246/373 (66%), Gaps = 28/373 (8%)
 Frame = +2

Query  284   VELCDSLRRIGKPFLKQYI---AQNRDSGLPFTCFISDLLVSIALDVSEECFNLPVYYFR  454
             ++L + L+   KP  ++ +    Q  D+  P  C I+D ++S  +D++ E   +P+  FR
Sbjct  79    MDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGMMSFTIDIANEV-GIPIISFR  137

Query  455   PISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCR----DE  622
              ISAC+FW YFS   L E+GEL +KGN +D   +T + GME FLR RDL    R    D+
Sbjct  138   TISACSFWAYFSALKLIESGELXLKGNDMDQL-VTSIPGMEGFLRKRDLPSLIRVSNLDB  196

Query  623   DLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKATLASKS  802
             +  +L   E +   +A  LILNTFEDLEGPIL QIR   P  YTIGPLHAHL   LAS+S
Sbjct  197   EXLLLVXKETQQTPRAHALILNTFEDLEGPILGQIRNHCPKTYTIGPLHAHLXTRLASES  256

Query  803   THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMR  982
             T+ +                  KSVIYVSFGS++VITR+QL+EF YGLVNSG +FLWV+R
Sbjct  257   TNPS------------------KSVIYVSFGSLTVITRKQLIEFCYGLVNSGXRFLWVIR  298

Query  983   SDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIA  1162
             +D +A ++D E   P+EL EG K   YIV WAPQE VL H AVGGFLTHSGWNSTLESI 
Sbjct  299   TDSLA-EEDGERQTPAELLEGAKERSYIVEWAPQEEVLAHPAVGGFLTHSGWNSTLESIC  357

Query  1163  AGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAE  1342
             AGVPMICWP+FADQQ NSRF   VWK+G DMKD CDR  VEK++R+LME R+ E L+ A+
Sbjct  358   AGVPMICWPYFADQQINSRFASHVWKLGSDMKDTCDRLIVEKMVRDLMEXRRDELLKTAD  417

Query  1343  NMGKLAKEAISEG  1381
              M   A++ +  G
Sbjct  418   MMATRARKCLDRG  430



>ref|XP_010674282.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   374 bits (959),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 196/403 (49%), Positives = 261/403 (65%), Gaps = 20/403 (5%)
 Frame = +2

Query  266   NSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALDVSEECFNLPVY  445
             N K+    L ++L    +P L++ +   RD     TCFI D  +  A +++ E   +PV 
Sbjct  132   NLKDALEALHEALAPSAEPLLRELLFGTRDK---ITCFIIDGWLRFAYEIASEA-EVPVI  187

Query  446   YFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCRDED  625
              FR  SAC  W YF +P + EAGE+P K N      +  V GM+ FLR RDL  FCR++D
Sbjct  188   AFRCPSACCIWAYFCIPHIIEAGEVPFKDNEEMDQLVKNVPGMDSFLRCRDLPSFCREQD  247

Query  626   LAVL------YYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKAT  787
             ++        +  E +    A   ILNTFEDLEGPILSQIR++   VY+IGPLHAHLK  
Sbjct  248   MSSCCELQEYFVGEIQRTKYAHSFILNTFEDLEGPILSQIRSQCSTVYSIGPLHAHLKYR  307

Query  788   LASKST-----HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVN  952
             L    T      S+SL + D++C++WLD +  KSVIYVS GS + +T+ QL E W GLV 
Sbjct  308   LGKGETPLSNNSSSSLWEVDKSCISWLDQKPDKSVIYVSLGSTTTLTKDQLTELWTGLVQ  367

Query  953   SGKKFLWVMRSDLV--AGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLT  1126
             S + FLWV+  +++   G D   SP P++L EGT+  G IV W+PQ+ VL H A+GGFLT
Sbjct  368   SKRYFLWVVSPNVIIEGGLD---SPTPNDLLEGTEKRGCIVKWSPQDEVLTHRAIGGFLT  424

Query  1127  HSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELM  1306
             HSGWNSTLESI AGVPM+CWP FADQQ NSRF  EVW++GLDMKD CDR+ VEK+I +LM
Sbjct  425   HSGWNSTLESIVAGVPMLCWPHFADQQLNSRFASEVWRIGLDMKDTCDRTIVEKMINDLM  484

Query  1307  EKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             + +K E    A+ + + AK++ISEGGSSY N + LI+D+I ++
Sbjct  485   DGKKDELQRSAKRVSQEAKKSISEGGSSYSNLNRLIEDIIAMS  527


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 36/66 (55%), Gaps = 3/66 (5%)
 Frame = +2

Query  50   GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTT--RF  223
             HILIFPLP Q H+  ML LA L  LAN  +TF   +  H  L   TD+ + RF     F
Sbjct  9    SHILIFPLPLQGHITPMLHLAELFCLANLKVTFLNTNKNHKLLTQHTDIQA-RFARYPSF  67

Query  224  RLQSFP  241
            R ++ P
Sbjct  68   RFETIP  73



>gb|KDO69249.1| hypothetical protein CISIN_1g0487532mg, partial [Citrus sinensis]
Length=286

 Score =   364 bits (935),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 174/283 (61%), Positives = 214/283 (76%), Gaps = 5/283 (2%)
 Frame = +2

Query  554   ITKVKGMEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILS  721
             I  V GME FLR RDL  FCR ED       L  +E R +V+A GL+LNTFEDLEGP++S
Sbjct  5     IKHVPGMEKFLRCRDLPSFCRAEDPMDMNLQLVVSETRSSVRADGLVLNTFEDLEGPVVS  64

Query  722   QIRTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSI  901
             QIR  +P +YTIGPL+AHLKA +   +  SNSL + D +C+AWLD+Q  KSVI+VSFGS+
Sbjct  65    QIRAHFPKIYTIGPLNAHLKARIPENTHSSNSLWEVDRSCIAWLDNQPSKSVIFVSFGSV  124

Query  902   SVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAP  1081
             +V+ R QL+EFWYGLVNS K+FLWV+R DL++GKD E   IP EL + TK  GYI GW P
Sbjct  125   AVMQRDQLIEFWYGLVNSHKRFLWVIRPDLISGKDGENQ-IPEELDKATKERGYIAGWVP  183

Query  1082  QEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKD  1261
             QE VL H AVGGFLTH GWNSTLESI A +PMICWP FADQQ NSRFV EVWK+GLDMKD
Sbjct  184   QEEVLGHKAVGGFLTHCGWNSTLESIVARMPMICWPSFADQQINSRFVDEVWKLGLDMKD  243

Query  1262  VCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSS  1390
             +CDR  VEK++ EL+ +R+  F++ A+ M  LA ++++EGGSS
Sbjct  244   LCDRKIVEKMVNELLVERRAAFMKSADRMANLAIKSVNEGGSS  286



>ref|XP_010666049.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=516

 Score =   369 bits (948),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 207/497 (42%), Positives = 289/497 (58%), Gaps = 42/497 (8%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLA--NFHITFFVPSNIHARLLALTDVDSGRF--TTR  220
             HILIFPLP Q  +NSMLKLA LL L+  N H TF     ++ +L+        RF    R
Sbjct  15    HILIFPLPMQGPVNSMLKLAELLILSADNIHATFLTTDVVYHQLIVSARAKE-RFDRNPR  73

Query  221   FRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIA------------QNRDSGL  364
             F  ++F  G+ +      + F+E+ D+++ +  P +++ ++            Q  +  L
Sbjct  74    FSFRTFSDGLPNDHPRGGDKFLEMLDAVKAVSHPIVREIVSSGDTHTSSSETNQTLEVVL  133

Query  365   P--FTCFISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNG  538
                 TC +SD L + ALDV  E   +PV+YF  +S    W Y  LP L EAGE+P   N 
Sbjct  134   SPLVTCIVSDGLYNFALDVGNE-VGIPVFYFETMSPSCLWVYLCLPKLVEAGEVPFTENS  192

Query  539   IDSSPITKVKGMEDFLRVRDLSPFCR-----DEDLAVLYYTEARLAVQARGLILNTFEDL  703
                + +  V GM+ +LR RDL  FCR     D+ +      + +   +A+G+ILNTFEDL
Sbjct  193   DLDALLVNVPGMDGYLRRRDLPDFCRARDATDDIMLQRVLGQVQQMQRAQGIILNTFEDL  252

Query  704   EGPILSQIRTKYP-NVYTIGPLHAHLKATLASK----------STHSNSLLQEDETCMAW  850
             +  +LS +R+     +YTIGPLH+ LK  L +           S HSNSL QED  CMAW
Sbjct  253   DSHLLSYMRSHCSIPIYTIGPLHSSLKERLQANALSSNQPFVYSDHSNSLWQEDRNCMAW  312

Query  851   LDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD------E  1012
             LD Q  +SVI+ SFGS  VIT++QL EF +GLV+S   FLW+ R   V G ++      +
Sbjct  313   LDKQPLRSVIFCSFGSQVVITKEQLTEFLHGLVDSKTLFLWMNRPGSVIGLEENYEMLEK  372

Query  1013  ESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPF  1192
             +  +  +L +G K NG IV W PQ  VL H A+GGFLTH GWNS +ES+ AGVPM+CWP 
Sbjct  373   QVLMHGDLLKGIKKNGCIVSWVPQVEVLSHPAIGGFLTHGGWNSVIESVVAGVPMVCWPH  432

Query  1193  FADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAI  1372
             + DQ  NSR   EVWK+G+D+KD C+R+ VEK++R++M  R+ E LE A  M  LA  ++
Sbjct  433   YVDQLVNSRLATEVWKLGVDIKDSCNRAIVEKVVRDIMCLRRDELLENATKMANLASTSV  492

Query  1373  SEGGSSYCNFDCLIQDM  1423
              +GG+SY +   LI+DM
Sbjct  493   QKGGTSYESMKNLIKDM  509



>ref|XP_008467017.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
Length=304

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 221/294 (75%), Gaps = 5/294 (2%)
 Frame = +2

Query  554   ITKVKGMEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILS  721
             IT + GME+ LR RDL  FCR  D + +VL +   + + + Q   LILN+FEDLE PILS
Sbjct  5     ITNLPGMENLLRCRDLPGFCRVTDTNDSVLQFNIKQTQRSNQFHALILNSFEDLEEPILS  64

Query  722   QIRTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSI  901
             +IRT +PN+Y IGPLH+ L+  L+ ++   N+L + D TC+AWLD+Q P SVIYVSFGSI
Sbjct  65    KIRTLWPNLYAIGPLHSLLRTKLSRETEALNNLWEVDRTCLAWLDNQPPGSVIYVSFGSI  124

Query  902   SVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAP  1081
             +V+  + LMEFW+GLVNSG+ FLWV+R DLV+GK+ E   IP+EL+EGTK  GY+VGWAP
Sbjct  125   TVMGNEGLMEFWHGLVNSGRNFLWVIRPDLVSGKNGE-IEIPAELEEGTKQRGYVVGWAP  183

Query  1082  QEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKD  1261
             QE VL H AVGGFLTHSGWNSTLESI AG PM+CWP+ ADQQ NSRFV  VWK+G+DMKD
Sbjct  184   QEKVLSHEAVGGFLTHSGWNSTLESIVAGKPMVCWPYTADQQVNSRFVSNVWKLGVDMKD  243

Query  1262  VCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             +CDR  V K++ E+M  RK EF+  A  M  LA+ ++S GGSSY +FD L+ ++
Sbjct  244   LCDRDIVAKMVNEIMVNRKEEFMRTASEMANLARRSVSPGGSSYADFDRLVNEI  297



>emb|CBI36709.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   365 bits (938),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 205/466 (44%), Positives = 268/466 (58%), Gaps = 70/466 (15%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FR  226
             H+LIFPLP Q H+N MLKLA LL LA   ITF      H RLL  T++   R+T    FR
Sbjct  31    HVLIFPLPVQGHVNPMLKLAELLSLAGLRITFLNSDYNHHRLLRYTNI-LDRYTRYPGFR  89

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+      +     ++ D ++   KP  ++ +     S  P TC I+D L+S A
Sbjct  90    FQTISDGLPLDRPRTGAGLRDMMDGIKATTKPLFREMVISWCRSSDPVTCIIADGLMSFA  149

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +DV+ E   +P+   R +S C F  YFS  +L EAGE+P K + +D   +T+V GME FL
Sbjct  150   IDVANE-VGVPIISCRTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRL-VTRVPGMEGFL  207

Query  587   RVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYT  754
             R RDL  FCR  D          TE +   +A  LILNTFEDL+GPILSQIR   P +YT
Sbjct  208   RRRDLPSFCRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIRNHCPKIYT  267

Query  755   IGPLHAHLKATLASKSTHS---NSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQL  925
             IGPLHAHLK+ LAS++T S   NS   ED +C+AWLD Q  KSVIYVSFGSI+VIT++Q+
Sbjct  268   IGPLHAHLKSRLASETTTSQFSNSFWVEDRSCLAWLDRQPSKSVIYVSFGSITVITKEQM  327

Query  926   MEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHL  1105
             MEFW+GLVNSG +FLWV+R D +  KD +             A G   GW P        
Sbjct  328   MEFWHGLVNSGSRFLWVIRPDSLTEKDGD-------------APG--CGWVP--------  364

Query  1106  AVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVE  1285
                                                NSRFV  VWK+G+DMKD CDR ++E
Sbjct  365   -----------------------------------NSRFVSHVWKMGMDMKDTCDRVTIE  389

Query  1286  KLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             K++R++ME R+ EF +  + M KLA+ ++SEGG+SYCNFD LI+D+
Sbjct  390   KMVRDVMEGRRAEFTKSVDAMAKLARRSLSEGGTSYCNFDRLIEDI  435



>gb|AFJ53007.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=480

 Score =   365 bits (937),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 275/472 (58%), Gaps = 23/472 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLD-LANFHITFFVPSNIHA---RLLALTDVDSGRFTTR  220
             H++  P PAQ H+  M  LA LL  +A F IT     + HA   R L     D G     
Sbjct  13    HVVFLPFPAQGHIKPMFTLAKLLSHVAKFRITLVNTHHNHALLQRSLDTAAADFGDSFPD  72

Query  221   FRLQSFPPGI--YDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLL  394
             F   S P  +   DG  N   +  +L  ++R     F +  +    D     TC I D +
Sbjct  73    FHFASLPDVVAHQDGQSNLANI-AQLLPAIRNSKPDFHRLML----DLPSAATCIIVDGV  127

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +S  ++V+EE   +P   FR  SA   W YF+L  L E G +PI GN      IT + G+
Sbjct  128   MSYGIEVAEE-IGIPAITFRTFSAVGLWVYFNLDKLTEDGSIPIPGNADMDELITSIPGL  186

Query  575   EDFLRVRDLSPFCR---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIR-TKYP  742
             E  LR+RDL   CR      +   +  E +   +A GLILNTF++LEG I+S++  T +P
Sbjct  187   EGVLRLRDLPSMCRPGPSSQVLKFFIDETKSMKRASGLILNTFDELEGSIISKLSSTIFP  246

Query  743   NVYTIGPLHAHLKATLASKSTHSNS-LLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
               Y +GPLH  L   +  K  HS+  L +ED+ CM WL+S   KSV+YVSFGS+   T  
Sbjct  247   KTYPVGPLHGLLNNVV--KEHHSDGGLWREDKGCMTWLESHPSKSVVYVSFGSLVAFTEA  304

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDD--EESPIPSELKEGTKANGYIVGWAPQEAV  1093
             Q MEFW+GLVN+GK FLWV+R D V+G+D   +   I S LKE       +V WAPQ  V
Sbjct  305   QFMEFWHGLVNTGKPFLWVIRPDSVSGEDGSIQSGRIISGLKEAHGNKCCVVDWAPQLEV  364

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGFLTHSGWNSTLE+I  GVPMICWP F+DQQ NSR V ++W VGLDMKD CDR
Sbjct  365   LAHEAVGGFLTHSGWNSTLEAILEGVPMICWPRFSDQQVNSRAVSDIWNVGLDMKDTCDR  424

Query  1274  SSVEKLIRELMEK--RKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              +VEK++RELM+   ++ E ++    + +LA+++I EGGSSYCN + LI D+
Sbjct  425   WTVEKMVRELMDDSCKRDEIVKSTAEIARLARDSIKEGGSSYCNLEKLIADV  476



>ref|XP_007026845.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07347.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
Length=488

 Score =   364 bits (935),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 207/486 (43%), Positives = 297/486 (61%), Gaps = 27/486 (6%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFR  226
             + H++  P+P   H+  MLKLA LL   +F +TF     IH RLL+ TD+   R+   F+
Sbjct  8     VPHVVFLPIPGLGHIKPMLKLAELLSRPSFQVTFINTQRIHDRLLS-TDL-LARYP-EFQ  64

Query  227   LQSFPPGI-----YDGALNSKEVFVELCDSLRRIGKPFLKQ-YIAQNRDSGL--PFTCFI  382
               + P  +       G ++  +  +     +    KP L+Q +I+  +  G   P TC I
Sbjct  65    FLTIPDVVPRDRPRSGTMSPGDFLLAAGPVI----KPALRQLFISLCKKKGRWQPATCII  120

Query  383   SD-LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  559
              D +L S  +DV+EE F +PV+ FR  SAC  WTYF +  L E G++P+  +     P+T
Sbjct  121   EDGILSSSVIDVAEE-FQVPVFAFRTSSACCIWTYFHVRKLVEEGDVPVVQDKDMDKPVT  179

Query  560   KVKGMEDFLRVRDLSPFCRDE---DLAVLYYTEARLAVQARG--LILNTFEDLEGPILSQ  724
              + G+E+ +R RDL    R E   D  + ++   +  V  R   +I+NTF+ LE  ++S+
Sbjct  180   CIPGLENVVRRRDLPGIFRIERADDPGLEFFINDQTLVMPRAFAIIINTFDGLEATMISK  239

Query  725   IRTKYPNVYTIGPLH--AHLKATLASKSTHSNSLL-QEDETCMAWLDSQEPKSVIYVSFG  895
             + + +  +YT+GPLH  ++ +A   + S  SNS+L +ED  CM WLDSQ  +SV++VSFG
Sbjct  240   LASVFTKMYTVGPLHGLSNARAKEETTSASSNSILWKEDRGCMFWLDSQPSRSVVFVSFG  299

Query  896   SISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKAN-GYIVG  1072
             S   +TR +++EF +GLVNSG  FLWV+R D + G+ D  S I  ELK   + N G +V 
Sbjct  300   SFVGLTRDKMLEFGHGLVNSGYPFLWVIRPDSITGEVDP-SLILGELKAMIEDNKGLMVS  358

Query  1073  WAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLD  1252
             WAPQE VL H A+G FLTHSGWNSTLES+ AGVPMICWP   DQQ NSRFV +VWK+GLD
Sbjct  359   WAPQEEVLAHPAIGVFLTHSGWNSTLESVYAGVPMICWPAIGDQQINSRFVSDVWKIGLD  418

Query  1253  MKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKV  1432
             MKD CDRS++EK++R LME ++ E ++    + KLA E I EGGSS+ N + LI D+  +
Sbjct  419   MKDTCDRSTIEKMVRSLMEDKREEIMKSVNEIKKLAHETIKEGGSSFSNLEKLIDDIWSM  478

Query  1433  NEATRE  1450
             +   R+
Sbjct  479   SHFARK  484



>ref|XP_004173134.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 85A1-like, 
partial [Cucumis sativus]
Length=308

 Score =   355 bits (912),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/295 (59%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = +2

Query  554   ITKVKGMEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILS  721
             IT + GME+ LR RDL   CR  D + +VL YT  + + + Q   LILN+FEDLEGPILS
Sbjct  8     ITNLPGMENLLRCRDLPGLCRVTDTNDSVLQYTLKQTQGSYQFHALILNSFEDLEGPILS  67

Query  722   QIRTKY-PNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGS  898
             +IRT   PN+YTIGPLH+ LK  L+ ++   N+L + D TC+AWLD+Q P SVIYVSFGS
Sbjct  68    KIRTNLCPNLYTIGPLHSLLKTKLSHETESLNNLWEVDRTCLAWLDNQPPGSVIYVSFGS  127

Query  899   ISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWA  1078
             I+V+  + LMEFW+GLVNSG+ FLWV+R DLV+GK+ E   IP++L+EGTK  GY+VGWA
Sbjct  128   ITVMGNEGLMEFWHGLVNSGRNFLWVIRPDLVSGKNGE-IEIPADLEEGTKQRGYVVGWA  186

Query  1079  PQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMK  1258
             PQE VL H AVGGFLTHSGWNSTLESI AG  M+CWP+ ADQQ NSRFV  VWK+G+DMK
Sbjct  187   PQEKVLSHEAVGGFLTHSGWNSTLESIVAGKAMVCWPYTADQQVNSRFVSNVWKLGVDMK  246

Query  1259  DVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             D+CDR  V K++ E+M  RK EF   A  M  LA+ ++S GGSSY +FD L+ ++
Sbjct  247   DMCDREIVAKMVNEVMVNRKEEFKRSAIEMANLARRSVSLGGSSYADFDRLVNEI  301



>ref|XP_010044032.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW86038.1| hypothetical protein EUGRSUZ_B02744 [Eucalyptus grandis]
Length=473

 Score =   361 bits (926),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 204/473 (43%), Positives = 288/473 (61%), Gaps = 16/473 (3%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+ P PAQ H+  ML LA LL  A   +TF    + H R+L          ++  RL+
Sbjct  8     HVLVLPFPAQGHIKPMLCLAKLLAAAGLRVTFLNTHHNHRRILPRGPSSP--PSSLLRLE  65

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALD  412
             S   G+ D    S E   EL  S++   K  L++++  ++ +  P TC I+D ++SI +D
Sbjct  66    SISDGLPDDHPRSLERIEELLLSIKTAMKAALREFLV-SKSAEPPVTCVIADGIMSIGID  124

Query  413   VSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRV  592
             V+EE  ++P   FR  SAC  WTYF +P     G+LP   + +D      + G E  LR 
Sbjct  125   VAEE-LSVPAISFRTFSACCLWTYFCIPTFIHEGKLPFPDDDLDKE-FHGLLGAEGLLRR  182

Query  593   RDLSPFCRDE---DLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGP  763
             RDL   CR     +L   +  E     +A  LILNTF+ LE P+LS + T + ++YTIGP
Sbjct  183   RDLPSICRSAIAINLYRYFMDETIAMTRACALILNTFDALEAPMLSHLATIFTDIYTIGP  242

Query  764   LHA-----HLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLM  928
             LHA     H+    + +S    SL  ED +CM WL+SQ  +SV+YVSFGS+  IT  QLM
Sbjct  243   LHALAVKSHV-GHFSGRSESVGSLQMEDRSCMVWLNSQASRSVVYVSFGSLVKITVDQLM  301

Query  929   EFWYGLVNSGKKFLWVMRSDLVAGKDDEES-PIPSELKEGTKANGYIVGWAPQEAVLDHL  1105
             EFW+GLVN G+ FLWV+R D + G+++E++  + SELK  ++    +V WAPQE VL H 
Sbjct  302   EFWHGLVNCGRPFLWVLREDAILGENEEKARSLLSELKVVSERR-RVVDWAPQEEVLAHA  360

Query  1106  AVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVE  1285
             AVGGFLTHSGWNSTLE I AG+PMICWP  ADQQ NSR+V EVWK+GLDMKD CDRS+VE
Sbjct  361   AVGGFLTHSGWNSTLEGIVAGIPMICWPRIADQQINSRWVSEVWKIGLDMKDTCDRSTVE  420

Query  1286  KLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEAT  1444
              ++R LM+ +K E ++    +  L+ +++   GSS  N + L++++ K+ + +
Sbjct  421   TMVRLLMDDKKEEIMKSMARISALSSDSVGPEGSSSKNLERLVKNIRKICQTS  473



>ref|XP_007026850.1| UDP-glucosyl transferase 85A4-like protein isoform 1 [Theobroma 
cacao]
 gb|EOY07352.1| UDP-glucosyl transferase 85A4-like protein isoform 1 [Theobroma 
cacao]
Length=490

 Score =   360 bits (923),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 200/480 (42%), Positives = 288/480 (60%), Gaps = 24/480 (5%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT-TRF  223
             + H++ FP PA  H+  M +LA LL  ANF +TF      H  LL  +D+ + R     F
Sbjct  8     VPHVVFFPFPAHGHIKPMFRLAELLSHANFQVTFLNTQRNHDLLLLSSDIPAFRSRYPNF  67

Query  224   RLQSFP---PGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISD--  388
             +L S+P   P   D    S++ FV+L  S +   KP L + + + +    P TC I+D  
Sbjct  68    QLLSYPDKVPLGLDPHRRSEQGFVDLLLSTKAAAKPALSELL-EKKTGRRPPTCIIADWA  126

Query  389   LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVK  568
             ++ S A+DV++E  N+PV+ F+   A   W  F L  L E GE+P++G      P+T + 
Sbjct  127   IMCSSAMDVAKEFGNIPVFAFQTACAHYMWMDFHLLKLIEEGEVPLRGYKDMDKPVTSIS  186

Query  569   GMEDFLRVRDLSPFCRDE-------DLAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
             G+   +R RDLS F R +       +++  Y + A    QA G+I NTF+ LE P++S++
Sbjct  187   GLGMSVRRRDLSGFARFDTVCKQVIEISTNYGSSA--VSQAYGVIHNTFDKLEAPVISKL  244

Query  728   RTKYP-NVYTIGPLHAHLKATLASKSTHSNSL----LQEDETCMAWLDSQEPKSVIYVSF  892
              +  P  +YTIGPLH  L       S   +S+     +ED  C+ WLDSQ   SVI+VSF
Sbjct  245   SSFLPFKIYTIGPLHCLLNNYCIKDSNPLHSINVTICKEDTNCITWLDSQPSGSVIFVSF  304

Query  893   GSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESP---IPSELKEGTKANGY  1063
             GS+  ++R Q++E   GL+NS + FLWV+  + + G+ +++S    I  EL+  +K  G 
Sbjct  305   GSLVSLSRSQILEIGQGLLNSCRPFLWVILPNPIVGQQEDDSTPGQILMELENMSKEKGL  364

Query  1064  IVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKV  1243
             IV WAPQE VL H A+GGFLTHSGWNST+ESI A VPMICWP  ADQ  NSR V E+W++
Sbjct  365   IVSWAPQEKVLAHPAIGGFLTHSGWNSTMESIYARVPMICWPTEADQLVNSRCVSELWRI  424

Query  1244  GLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             G DMKD CDRS+VEKL+ +LME ++ E ++  + + + A+E++ EGGSSYCN   LI D+
Sbjct  425   GFDMKDTCDRSTVEKLVNDLMEDKRDEIMKSMDKITRQAEESVQEGGSSYCNLQRLITDI  484



>ref|XP_007026851.1| UDP-Glycosyltransferase superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY07353.1| UDP-Glycosyltransferase superfamily protein isoform 2 [Theobroma 
cacao]
Length=489

 Score =   359 bits (921),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 201/480 (42%), Positives = 290/480 (60%), Gaps = 25/480 (5%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT-TRF  223
             + H++ FP PA  H+  M +LA LL  ANF +TF      H  LL  +D+ + R     F
Sbjct  8     VPHVVFFPFPAHGHIKPMFRLAELLSHANFQVTFLNTQRNHDLLLLSSDIPAFRSRYPNF  67

Query  224   RLQSFP---PGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISD--  388
             +L S+P   P   D    S++ FV+L  S +   KP L + + + +    P TC I+D  
Sbjct  68    QLLSYPDKVPLGLDPHRRSEQGFVDLLLSTKAAAKPALSELL-EKKTGRRPPTCIIADWA  126

Query  389   LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVK  568
             ++ S A+DV++E  N+PV+ F+   A   W  F L  L E GE+P++   +D  P+T + 
Sbjct  127   IMCSSAMDVAKEFGNIPVFAFQTACAHYMWMDFHLLKLIEEGEVPLRDKDMDK-PVTSIS  185

Query  569   GMEDFLRVRDLSPFCRDE-------DLAVLYYTEARLAVQARGLILNTFEDLEGPILSQI  727
             G+   +R RDLS F R +       +++  Y + A    QA G+I NTF+ LE P++S++
Sbjct  186   GLGMSVRRRDLSGFARFDTVCKQVIEISTNYGSSA--VSQAYGVIHNTFDKLEAPVISKL  243

Query  728   RTKYP-NVYTIGPLHAHLKATLASKSTHSNSL----LQEDETCMAWLDSQEPKSVIYVSF  892
              +  P  +YTIGPLH  L       S   +S+     +ED  C+ WLDSQ   SVI+VSF
Sbjct  244   SSFLPFKIYTIGPLHCLLNNYCIKDSNPLHSINVTICKEDTNCITWLDSQPSGSVIFVSF  303

Query  893   GSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGK-DDEESP--IPSELKEGTKANGY  1063
             GS+  ++R Q++E   GL+NS + FLWV+  + + G+ +D+ +P  I  EL+  +K  G 
Sbjct  304   GSLVSLSRSQILEIGQGLLNSCRPFLWVILPNPIVGQQEDDSTPGQILMELENMSKEKGL  363

Query  1064  IVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKV  1243
             IV WAPQE VL H A+GGFLTHSGWNST+ESI A VPMICWP  ADQ  NSR V E+W++
Sbjct  364   IVSWAPQEKVLAHPAIGGFLTHSGWNSTMESIYARVPMICWPTEADQLVNSRCVSELWRI  423

Query  1244  GLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             G DMKD CDRS+VEKL+ +LME ++ E ++  + + + A+E++ EGGSSYCN   LI D+
Sbjct  424   GFDMKDTCDRSTVEKLVNDLMEDKRDEIMKSMDKITRQAEESVQEGGSSYCNLQRLITDI  483



>gb|AFJ53010.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=459

 Score =   357 bits (915),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 204/472 (43%), Positives = 278/472 (59%), Gaps = 43/472 (9%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDS--GRFTTRFR  226
             H+LIFP P Q H+ SML LA LL L+N  +TFF   +I  RLL  T V S   ++   F 
Sbjct  10    HVLIFPYPLQGHVTSMLNLAELLCLSNIRVTFFNSDHIQRRLLQFTSVQSRFAKYPYLFH  69

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIA  406
              Q+   G+      S +  ++L  S+  I +P  K+ +  N+    P  C ISD  +   
Sbjct  70    FQTISDGLPSDHSRSGKDVLDLFLSMSTITRPLFKELLLSNQP---PIDCVISDGGLEFT  126

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSS---PITKVKGME  577
             ++V++E   +P+ YFR I A  FW YF +PD+ EAGELPI+    +      ITKV G E
Sbjct  127   VEVADEV-GIPLVYFRTIGASCFWIYFCIPDMIEAGELPIRVEVEEEDMERVITKVPGAE  185

Query  578   DFLRVRDLSPFCRDEDL------AVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
               LR RDL   CR  DL      A++  T  R + +   LILNTFEDLE           
Sbjct  186   GVLRCRDLPSLCRVGDLSDPFLQAIVLTT--RKSPKVYALILNTFEDLE-----------  232

Query  740   PNVYTIGPLHAHLKATLASKSTHSNSLL-QEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
                         +KA     S+    ++ +ED +CM WLD Q PKSV+Y +FGSI+V+  
Sbjct  233   ----------VEIKAFQPQNSSRIIIVVREEDRSCMKWLDLQPPKSVLYANFGSITVMKP  282

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSEL-KEGTKANGYIV--GWAPQE  1087
             ++L+E W+GL+NS +KFLWV+R   +   ++  S  P EL K G+K + ++V  GW  Q+
Sbjct  283   EELVEIWHGLINSKQKFLWVIRQGTITSIENT-SEFPEELVKGGSKGDEFMVLSGWVAQK  341

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VLDH ++GGFLTHSGWNSTLE+I AGVPMIC P+FADQQ NSRF  EVWK+GLDMKD C
Sbjct  342   EVLDHGSIGGFLTHSGWNSTLETIVAGVPMICLPYFADQQVNSRFTSEVWKLGLDMKDSC  401

Query  1268  DRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              R  VE+++ ELM +RK EF   A  M +LA+ ++S GG S  N + LI+++
Sbjct  402   KRGVVERMVNELMVERKEEFGRCAAKMAELARMSVSTGGCSSRNLEDLIEEI  453



>gb|EPS61663.1| hypothetical protein M569_13131, partial [Genlisea aurea]
Length=464

 Score =   355 bits (912),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 205/453 (45%), Positives = 279/453 (62%), Gaps = 30/453 (7%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFT--TRFR  226
             H+LIFPLP Q  +N+MLKL+ LL LA  H+TF + +  +A L   +D++S RF+  + FR
Sbjct  17    HVLIFPLPLQGPVNAMLKLSELLCLAGIHVTFLLSNFSYALLRRHSDIES-RFSRYSGFR  75

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQN---RDSGLP--FTCFISDL  391
             +     G+ +         ++L  S+ R+G+  L++ +      RD       +  I D 
Sbjct  76    IAGIDDGLPEDRPRVGVGSIDLLSSILRVGETELRKVLEATDSLRDGSARRRVSFIIIDG  135

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG----------NGI  541
             +++  L V+EE   +PV +FR ISAC+FW  F   ++  AGELP++G          N  
Sbjct  136   ILNFVLPVAEE-LGIPVVHFRTISACSFWASFCSKEVIAAGELPLRGEEEGKYEYWRNPN  194

Query  542   DSSPITKVKGMEDFLRVRDLSPFCR-----DEDLAVLYYTEARLAVQARGLILNTFEDLE  706
                P+T + GME  LR RDL  F R     D +L +L  T+ R A  + GLILNTFEDLE
Sbjct  195   LDLPVTSIPGMEAILRRRDLPSFFRVTDPNDSELQMLA-TDTRKAALSAGLILNTFEDLE  253

Query  707   GPILSQIRTKYPNVYTIGPLHAHLKATLASKSTHSNS---LLQEDETCMAWLDSQEPKSV  877
             GPI+ +IR + PNVY+IGPLH HLK+ L  +S+   S    L+ED T + WL+SQ PKSV
Sbjct  254   GPIIDEIRKRIPNVYSIGPLHTHLKSHLDPRSSSVASSSSFLREDRTSIDWLNSQPPKSV  313

Query  878   IYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKAN  1057
             IYVSFGS++ +T ++ +EF  GLVNSG +FLWV+R D +AG D  +  IP EL++GT+  
Sbjct  314   IYVSFGSLTQLTEEEHLEFLNGLVNSGHRFLWVVRPDSIAGSD--KVAIPEELEQGTRER  371

Query  1058  GYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVW  1237
             GY+V WAPQ  VL H +VG F TH GWNSTLESI AGVPMICWP+F DQ TNSRFV   W
Sbjct  372   GYVVEWAPQMEVLAHPSVGAFFTHGGWNSTLESICAGVPMICWPYFIDQPTNSRFVSHEW  431

Query  1238  KVGLDMKDVCDRSSVEKLIRELMEKRKGEFLER  1336
             KVGLD+         E +   + ++R+ E  ER
Sbjct  432   KVGLDVNSCDRVVVEEMVREVMEDRRRDELSER  464



>ref|XP_009594030.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=380

 Score =   352 bits (904),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/363 (50%), Positives = 237/363 (65%), Gaps = 15/363 (4%)
 Frame = +2

Query  365   PFTCFISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGID  544
             P TC I D L    +D+  E   +PV  F  IS    W Y  L  L E+GELP K N +D
Sbjct  9     PVTCVIPDALSYYVVDIGNE-MGVPVIPFDTISPSCVWVYLCLSKLIESGELPFKDNDLD  67

Query  545   SSPITKVKGMEDFLRVRDLSPFC-----RDEDLAVLYYTEARLAVQARGLILNTFEDLEG  709
             +S +T +  ME  LR RDL  FC      D +         R+  Q+ GLILNTFEDL+ 
Sbjct  68    AS-VTHIPAMEGLLRRRDLPHFCLMDYKTDPNFLAALKQIERIP-QSHGLILNTFEDLDR  125

Query  710   PILSQIRTKYPNVYTIGPLHAHLKATLASKST----HSNSLLQEDETCMAWLDSQEPKSV  877
               LS IR+  P  Y IGP+H HLKA LASK+T     SNSL +ED + + WLD+Q   SV
Sbjct  126   SFLSCIRSYSPKTYAIGPVHLHLKAKLASKNTPSLPFSNSLWEEDHSSIKWLDAQPMGSV  185

Query  878   IYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLV-AGKDDEESPIPSELKEGTKA  1054
             IYVSFGS  V+++++++EF +GL+NS  KFLWVMR +++  GK D +     EL EG K 
Sbjct  186   IYVSFGSAVVLSKKEILEFRHGLLNSKVKFLWVMRPNILKGGKSDVQ--FMKELAEGCKG  243

Query  1055  NGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEV  1234
             NGY+V WAPQ+ VL H ++ GFLTHSGWNSTLES+  G PMICWP + DQ+  SR V E+
Sbjct  244   NGYVVSWAPQKMVLAHPSISGFLTHSGWNSTLESVIEGKPMICWPQYVDQRVTSRLVNEL  303

Query  1235  WKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             W++GLDMKD+CDRS++E+ I++LME ++ EF +  E + KLAK +I EGGSSY N DCLI
Sbjct  304   WQIGLDMKDMCDRSTIERTIKDLMETKRDEFKKSIEELSKLAKLSIGEGGSSYNNLDCLI  363

Query  1415  QDM  1423
              D+
Sbjct  364   HDI  366



>ref|XP_004305167.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   355 bits (910),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 202/467 (43%), Positives = 278/467 (60%), Gaps = 17/467 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++IFP P Q H+  +L LA LL  A  H+TF    + H RL  L  + S RF T    +
Sbjct  7     HVVIFPFPLQGHIKPLLCLAELLCHAGLHVTFVNTRHNHNRLANLPAL-SARFPT-LNFE  64

Query  233   SFPPGI---YDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSI  403
             S   G+   +   L S E+ + L  S++   K  L+  +  N  +    TC I+D LV+ 
Sbjct  65    SISDGLPLEHPRTLGS-ELLIALKTSIKPHFKELLQSPLKANGVALPAPTCIITDGLVTF  123

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
             A DV+EE   LP++ +        WT   LP+L E G+LP   + ++   IT V GME  
Sbjct  124   AFDVAEE-LGLPIFSYNVPCTRYMWTCLCLPNLIEQGQLPFPDDDMNVE-ITGVPGMEGL  181

Query  584   LRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKYPNVY  751
             LR  DL  FCR    +   L +   E +   +A  LIL+T  +L+ P LS +   +P +Y
Sbjct  182   LRRVDLPGFCRVKQSNHPGLQFAIHETQTQKRASTLILDTIYELDAPCLSHMANMFPKIY  241

Query  752   TIGPLHAHLKATLA--SKSTHSNS-LLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
             T+GPLH+ L + +   S+S  S+  L + D  CM WLDSQ  KSV+YVSFG++  +T  Q
Sbjct  242   TLGPLHSLLHSQIGDVSRSLASHGGLWKGDPNCMTWLDSQPTKSVLYVSFGTLVTLTGTQ  301

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDH  1102
             ++EFWYGL+NSG  FLWV+RSD+ +G   +  PIP EL+ GTK  GYIV W  QE VL H
Sbjct  302   IIEFWYGLINSGHPFLWVIRSDITSGLGGD--PIPMELEIGTKERGYIVNWVSQEEVLAH  359

Query  1103  LAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSV  1282
              +VGGFLTHSGWNSTLESI AG+PMICWP   D    SR V E WK+GL +K+ CDR  +
Sbjct  360   KSVGGFLTHSGWNSTLESIVAGIPMICWPNLGDHYIISRTVSEKWKIGLQLKENCDRKEI  419

Query  1283  EKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             E +IR LME ++GE     + + K+A++++ +GGSS  N + LIQD+
Sbjct  420   ETMIRMLMEFKRGEIQSSMDVISKVARDSVVKGGSSNHNLEMLIQDI  466



>ref|XP_010676681.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=503

 Score =   355 bits (911),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 211/463 (46%), Positives = 277/463 (60%), Gaps = 26/463 (6%)
 Frame = +2

Query  80    QSHLNSMLKLAHLLDLANFH--ITFFVPSNIHARLLALTDVDSGRFTTRFRLQSFPPGIY  253
             Q  +N  LKLAHLL L++ H  ITF     +H RLL L      RF    +   F  GI 
Sbjct  40    QGPINCFLKLAHLLSLSSDHLNITFLNAEFVHQRLLDL----PSRFP-HVKFLKFSDGIS  94

Query  254   DGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALDVSEECFN  433
                  +   F  +   L    +  + + + +  +S  P TC ISD + +   + + E   
Sbjct  95    GDEPRTPAKFPAMVGFL----QAEISRRLPEFMESPAPATCLISDGVFTSVGERANE-LG  149

Query  434   LPVYYFRPISACAFW-TYFSLPDLFEAGELPIKGNGID-SSPITKVKGMEDF-LRVRDLS  604
             +PV YF  +S C  W + F +P L + GELP K  G+D   P++ + G  D  LR  DL 
Sbjct  150   IPVVYFSTLSPCCVWASCFLVPKLVDYGELPFK-KGMDLDEPVSDIPGAADTSLRWCDLP  208

Query  605   PFCRDEDLAVLYY----TEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHA  772
               CR  D+   Y      E R    A+G ILNTF+DLE P+LS++R   PN+YTIGP+H 
Sbjct  209   GICRTHDMTDPYVQLVLKEFRELPNAQGHILNTFDDLEEPLLSELRLLCPNLYTIGPIHL  268

Query  773   HLKATLASKSTH---SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYG  943
             H +     +S     SNSL QED +C+AWLD+Q   SVIYVSFGS+  +T  QL EFWYG
Sbjct  269   HSRTRQQLESEQRITSNSLWQEDRSCIAWLDAQPSGSVIYVSFGSVVPLTMDQLTEFWYG  328

Query  944   LVNSGKKFLWVMRSDLVAGKDDEES---PIPSELKEGTKANGYIVGWAPQEAVLDHLAVG  1114
             LVNSG +FLWV RS +V   ++ E     +P+E+ EGT+  G+IV WAPQE VL H AVG
Sbjct  329   LVNSGTRFLWVRRSGMVVEMEESEEISLQVPTEILEGTRNRGFIVKWAPQEEVLAHRAVG  388

Query  1115  GFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLI  1294
             GFLTHSGWNSTLESI  G+PM+CWP   DQ   SRFVG+VWK+G+DMKD+CDR  +E ++
Sbjct  389   GFLTHSGWNSTLESIVEGLPMLCWPNGIDQLVISRFVGDVWKIGIDMKDICDRGVIEHMV  448

Query  1295  RELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              +LM+ RK EF  RA  + KLA EA+ EGGSS+     LI+D+
Sbjct  449   IDLMKGRKDEFSRRANRLSKLAGEAVREGGSSWRALHRLIEDI  491



>ref|XP_008346926.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Malus domestica]
Length=476

 Score =   346 bits (888),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 190/471 (40%), Positives = 285/471 (61%), Gaps = 22/471 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++IFPLP Q H+  +L LA LL  + FH+TF V ++ + +    ++  S  F T    +
Sbjct  6     HVVIFPLPLQGHIKPLLCLAELLCHSGFHVTF-VNTHQNYKRFGNSEAISTHFPT-LHFE  63

Query  233   SFPPGI---YDGALNSKEVFVELCDSLRRIGKPFLKQYI--AQNRDSGL-----PFTCFI  382
             S   G+   +  A++S  + +EL  S++   +  LK  I  A ++D  +     P TC I
Sbjct  64    SISDGLPEEHPRAISST-LLIELKSSIKPPFRELLKTIILRADDKDHVIGCWVPPLTCII  122

Query  383   SDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  562
             +D  ++ A D+++E   +P+           WT  S+P L E G++P K + ++   I  
Sbjct  123   TDGTLAGAFDIAQE-LGIPIIAHNVPYPGYLWTVLSIPKLVEQGQIPFKDDDMNVE-IMG  180

Query  563   VKGMEDFLRVRDLSPFCR--DEDLAVLYY--TEARLAVQARGLILNTFEDLEGPILSQIR  730
             V GME +LR RDL  FC+    D   L Y   E +   +A  LIL++  +L+ PILS + 
Sbjct  181   VPGMEGYLRRRDLPGFCKVKQADHPALQYISNEYKTLKRASALILDSVYELDAPILSHMA  240

Query  731   TKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
               +P +YT+GP+HA L + +   S   NS  +  + CM WLD+   +SVIYVSFGS+  +
Sbjct  241   QVFPKIYTLGPIHALLNSQVGDISRELNSHTKTAQKCMTWLDNHPSRSVIYVSFGSLVKL  300

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T +Q++EFWYGLV SG+ F+WV+RSD+ + +D +   +P+EL+ GTK  G+IV WAPQE 
Sbjct  301   THEQVIEFWYGLVKSGQPFIWVIRSDITSRQDLD---VPAELETGTKERGFIVEWAPQEE  357

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H+AVGGFLTHSGWNSTLE I AGVPMIC+P   D    SR V   WK+GL + + CD
Sbjct  358   VLAHIAVGGFLTHSGWNSTLEGIVAGVPMICFPILGDHMIVSRTVCLKWKIGLPLSENCD  417

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             RS +E +I++LM  +K    +  ++  KLA++++ +GGSS+CN + LIQ +
Sbjct  418   RSEIETVIKDLMGYKKEGIQKSMDSTSKLARDSVKKGGSSHCNLELLIQQI  468



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   346 bits (887),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 197/472 (42%), Positives = 282/472 (60%), Gaps = 21/472 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    FHITF        RLL      S    + FR +
Sbjct  11    HAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNSEYNQKRLLKSRGSSSLHALSSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ-NRDSGLPFTCFISDLLVSIAL  409
             + P G+ D  +++ +    LC+S RR   P  ++ +A+ N   G P +C +SD +++  L
Sbjct  71    TIPDGLPDSDVDATQDIPSLCESTRRTCLPHFRKLLAKLNNSDGPPVSCIVSDGVMTFTL  130

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSS-----PITKVKGM  574
             D ++E   LP   F   SAC F  Y     LF  G  P+K + + +S      I  + G+
Sbjct  131   DAAQE-LGLPEVLFWTTSACGFMCYLQYEQLFRKGITPLKDSSLVTSGYLETTIDWIPGI  189

Query  575   EDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E  +R++D+  F R  D D  +L +   E + A +A  +ILNTF+ LE  +L    +  P
Sbjct  190   EK-IRLKDIPSFIRTTDSDDIMLDFVQWECKRARRASAIILNTFDTLEHDVLKAFSSILP  248

Query  743   NVYTIGPLHAHLKA--TLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
              VY+IGPL+  +K     A  +  SN L +E+  CM WL+++EP SV+YV+FGSI+V+T 
Sbjct  249   PVYSIGPLNLLVKNVDNKALNAIESN-LWKEESECMEWLNTKEPNSVVYVNFGSITVMTS  307

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +QL+EF +GL NS K FLWV+R DLVAG   E + +P E  + TK  G +  W  QE VL
Sbjct  308   EQLVEFAWGLGNSNKSFLWVIRPDLVAG---ENAILPPEFVKQTKNRGLLSSWCSQEQVL  364

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
             +H A+GGFLTHSGWNSTLES+ AGVPMICWPFFA+QQTN RF  + W +G++++DV  R 
Sbjct  365   NHPAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGMEIEDV-KRD  423

Query  1277  SVEKLIRELMEKRKGEFL-ERAENMGKLAKEAISEG-GSSYCNFDCLIQDMI  1426
              +E L++ELM+  KG+ + E+A    KLAK A S   G+S+ N D ++ +++
Sbjct  424   KIESLVKELMDGEKGKQMKEKALQWKKLAKTAASGPYGTSFLNLDNMVHEVL  475



>ref|XP_007141191.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
 gb|ESW13185.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
Length=491

 Score =   345 bits (886),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 197/478 (41%), Positives = 280/478 (59%), Gaps = 20/478 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P P Q H+N MLKLA LL    FHITF      H RLL     DS +  + FR +
Sbjct  20    HAVCIPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLLKSRGPDSLKGLSSFRFE  79

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLP-FTCFISDLLVSIAL  409
             + P G+ + A+++ +    LCDS RR   P L   + +   S +P  TC ++D ++S  L
Sbjct  80    TIPDGLPEPAVDATQDIPSLCDSTRRTCLPHLNNLLTKINSSDVPPVTCLVADGVMSFTL  139

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGM  574
             D +EE   +P+  F   SAC F  Y  L  L + G +P+K      NG   + I  + G+
Sbjct  140   DAAEE-LGVPLALFWTPSACGFMCYVQLEQLIQKGLIPLKDSSSVTNGYLETKIDSIPGI  198

Query  575   EDFLRVRDLSPFCRDED----LAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             ++ +R+RD   F R  D    +      E   A +A  +ILNTF+ +E  +L  + +  P
Sbjct  199   KE-IRLRDFPSFVRTTDSDDFMIEFLQWECGRAREASAIILNTFDAMEHDVLEALSSILP  257

Query  743   NVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
              VY+IGPL+  +K       +   ++L +E+  C+ WLD++EP SVIYV+FGSI+V+T +
Sbjct  258   PVYSIGPLNLLVKDIDDEDLNVIRSNLWKEEFECVEWLDTKEPNSVIYVNFGSITVMTSE  317

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             QL EF +GL NS K FLWV+R D+V G   E   +P E  E TK  G++  W PQE VL 
Sbjct  318   QLNEFAWGLANSNKSFLWVIRPDVVGG---ENVVLPPEFVEQTKDRGFLSSWCPQEQVLA  374

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H A+GGFLTHSGWNSTLES+  GVPMICWPFFA+QQTN RF  + W +GL+++DV  R  
Sbjct  375   HPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCKEWGIGLEIEDV-KRDK  433

Query  1280  VEKLIRELMEKRKG-EFLERAENMGKLAKEAI-SEGGSSYCNFDCLIQDMIKVNEATR  1447
             +E+L+RELM+  KG E  E+A     LA  A     GSS+ N + +I++++ V E+ +
Sbjct  434   IERLVRELMDGEKGKEMKEKAIQWKDLAVSATYGPHGSSFLNLENMIREVL-VGESVK  490



>ref|XP_007207791.1| hypothetical protein PRUPE_ppa025605mg [Prunus persica]
 gb|EMJ08990.1| hypothetical protein PRUPE_ppa025605mg [Prunus persica]
Length=483

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 201/469 (43%), Positives = 279/469 (59%), Gaps = 26/469 (6%)
 Frame = +2

Query  56    ILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQS  235
             ++IFP P Q H+  +L LA LL  A FH+TF    + H RL A  +  S  F T    +S
Sbjct  8     VVIFPFPLQGHIKPLLCLAELLCHAGFHVTFVNTHHNHKRL-ANPEALSTHFPT-LHFES  65

Query  236   FPPGIYDG---ALNSKEVFVELCDSLRRIGKPFLK--QYIAQNRDS-GLPFTCFISDLLV  397
                G+ D    ALN  E+ + L  S+R   +  L+     A++ D+   P  C I+D LV
Sbjct  66    ISDGLPDDHPRALNG-ELLIALKTSIRPHFRELLETISIKAESNDAPAPPLNCIITDGLV  124

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGME  577
             + A D++EE   +PV  +    A   WT   LPDL E G+LP   + + S  IT V GM+
Sbjct  125   TFAFDLAEE-LEIPVLSYNVPCARYLWTCLCLPDLIEQGQLPFPDDDM-SVEITGVSGMD  182

Query  578   DFLRVRDLSPFCRDEDLA------VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
               L  +DL  FCR +          + +T+A+   +A  LIL+T  +L+   LS +   +
Sbjct  183   GPLHRQDLPSFCRVKQANHPALQFAINWTQAQR--RASALILDTVYELDASCLSHMALMF  240

Query  740   PNVYTIGPLHAHLKATLA--SKSTHSNS-LLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             P +YT+GPLHA L A +   SKS  S+  L + D  CM WLDSQ  +SVIYVSFG++  +
Sbjct  241   PKIYTLGPLHALLNAQIGNVSKSLASHGGLWKSDPNCMTWLDSQPSRSVIYVSFGTLVNL  300

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             TR Q++EFWYGLVNSG  F+WV+RSD++ G       IP+EL+ GTK  GYIV W  QE 
Sbjct  301   TRAQMIEFWYGLVNSGHPFMWVIRSDIIYGAHQ----IPAELEIGTKERGYIVDWVSQEE  356

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNSTLESI AG+PMICWP   D    SR V + WK+GL + ++CD
Sbjct  357   VLAHKAVGGFLTHSGWNSTLESIVAGLPMICWPNLGDHYIISRTVSQKWKIGLQLNEICD  416

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             R ++E +I+ LM  ++ E     + + KLA++++ +GGSS+ N + LI+
Sbjct  417   RCNIETMIQTLMGPKREEIQSSIDTISKLARDSVVKGGSSHNNLEQLIE  465



>ref|XP_007207618.1| hypothetical protein PRUPE_ppa019804mg [Prunus persica]
 gb|EMJ08817.1| hypothetical protein PRUPE_ppa019804mg [Prunus persica]
Length=474

 Score =   343 bits (880),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 197/468 (42%), Positives = 273/468 (58%), Gaps = 22/468 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++IFP P Q H+  +L LA LL  A  H+T+    + H RL A     S  F T    +
Sbjct  7     HVVIFPFPLQGHMKPLLCLAELLCHAGLHVTYVNTHHNHQRL-ANRQALSIHFPT-LHFE  64

Query  233   SFPPGIYDG---ALNSKEVFVELCDSLRRIGKPFLK--QYIAQNRDSGLPF-TCFISDLL  394
             S   G+ +     LNS ++ + L  S+R   +  LK   + A++ D+ +P  +C ++D L
Sbjct  65    SISDGLPEDDPRTLNS-QLLIALKTSIRPHFRELLKTISFKAESNDALVPPPSCIMTDGL  123

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             V+ A DV EE   LP+  F        WT   LP L E G+LP + + ++   IT V GM
Sbjct  124   VTFAFDVGEE-LGLPILSFNVPCPRYLWTCLCLPKLIENGQLPFQDDDMNVE-ITGVPGM  181

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E  L  +DL  FCR    D         E +   +A  LIL+T  +L+ P +S +   +P
Sbjct  182   EGLLHRQDLPGFCRVKQADHPSLQFAINETQTLKRASALILDTVYELDAPCISHMALMFP  241

Query  743   NVYTIGPLHAHLKATLASKS---THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              +YT+GPLHA L + +   S       SL + D  CM WLDSQ  KSVIYVSFG++  +T
Sbjct  242   KIYTLGPLHALLNSQIGDMSRGLASHGSLWKSDLNCMTWLDSQPSKSVIYVSFGTLVHLT  301

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             R Q++EFWYGLVNSG  FLWVMRSD+ +G    +  IP+EL+ GTK  G IV W  QE V
Sbjct  302   RAQVIEFWYGLVNSGHPFLWVMRSDITSG----DHQIPAELENGTKERGCIVDWVSQEEV  357

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H +VGGFLTHSGWNSTLESI AG+PMICWP   D    SR V   WK+GL + + CDR
Sbjct  358   LAHKSVGGFLTHSGWNSTLESIVAGLPMICWPKLGDHYIISRTVCRQWKIGLQLNENCDR  417

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             S++E +++ LM  ++ E     + + KLA+++++EGGSS+ N + LI+
Sbjct  418   SNIESMVQTLMGSKREEIQSSMDAISKLARDSVAEGGSSHNNLEQLIE  465



>ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=485

 Score =   343 bits (881),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 196/471 (42%), Positives = 274/471 (58%), Gaps = 19/471 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    FHITF      H RLL     DS    + FR +
Sbjct  12    HAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFRFE  71

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ-NRDSGLPFTCFISDLLVSIAL  409
             + P G+ +  L++ +    LC++ RR   P  K  + + N     P +C +SD ++S  L
Sbjct  72    TIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLTKINNSDAPPVSCIVSDGVMSFTL  131

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGM  574
             D +EE   LP   F   SAC F  Y     L E G  P+K      NG   + I  + G+
Sbjct  132   DAAEE-LGLPEVLFWTTSACGFMCYVQYEQLIEKGLTPLKDSSYITNGYLETTIDWIPGI  190

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             ++ +R++DL  F R    DE +      E     +A  +ILNTF+ LE  +L    +  P
Sbjct  191   KE-IRLKDLPSFIRTTNPDEFMLDFIQWECGRTRRASAIILNTFDALEHDVLEAFSSILP  249

Query  743   NVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
              VY+IGPL+  +K       +   ++L +E+  C+ WLD++EP SV+YV+FGSI+V+T +
Sbjct  250   PVYSIGPLNLLVKHVDDKDLNAIGSNLWKEESECVEWLDTKEPNSVVYVNFGSIAVMTSE  309

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             QL+EF +GL NS K FLWV+R DLVAG   E + +PSE  + T+  G +  W  QE VL 
Sbjct  310   QLIEFAWGLANSNKTFLWVIRPDLVAG---ENALLPSEFVKQTEKRGLLSSWCSQEQVLT  366

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H A+GGFLTHSGWNSTLES+  GVPMICWPFFA+QQTN  F  + W +GL+++DV +R  
Sbjct  367   HPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEIEDV-ERDK  425

Query  1280  VEKLIRELMEKRKG-EFLERAENMGKLAKE-AISEGGSSYCNFDCLIQDMI  1426
             +E L+RELM+  KG E  E+A    +LAK  A    GSS+ N D +++D++
Sbjct  426   IESLVRELMDGEKGKEMKEKALQWKELAKSAAFGPVGSSFANLDNMVRDVL  476



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score =   342 bits (878),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 196/474 (41%), Positives = 276/474 (58%), Gaps = 22/474 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
             H++  P PAQ H+N MLKLA LL     FH+TF      H RLL     DS      FR 
Sbjct  12    HVVCIPYPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKSRGPDSLNGLPSFRF  71

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL---PFTCFISDLLVS  400
             ++ P G+ +  ++  +    LC S R+   P  K+ +++  D      P TC +SD  +S
Sbjct  72    ETIPDGLPETDVDVTQDIPSLCISTRKTCLPHFKKLLSKLNDVSSDVPPVTCIVSDGCMS  131

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKV  565
               LD + E  N+P   F   SAC F  Y    +L E G +P+K      NG   + I  +
Sbjct  132   FTLDAAIE-LNIPEVLFWTTSACGFMGYVQYRELIEKGIIPLKDSSDITNGYLETTIEWL  190

Query  566   KGMEDFLRVRDLSPFCRDED----LAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRT  733
              GM++ +R++DL  F R  D    +      E + A++A  +ILNTF+ LE  +L    +
Sbjct  191   PGMKN-IRLKDLPSFLRTTDPNDKMLDFLTGECQRALKASAIILNTFDALEHDVLEAFSS  249

Query  734   KYPNVYTIGPLHAHLK-ATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
               P VY+IGPLH  +K  T  + ++  ++L +ED  C+ WLD++EP SV+YV+FGSI+V+
Sbjct  250   ILPPVYSIGPLHLLIKDVTDKNLNSLGSNLWKEDSECLKWLDTKEPNSVVYVNFGSIAVM  309

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T +Q++EF +GL NS K FLWV+R DLVAGK    + +P E    T   G +  W PQE 
Sbjct  310   TSEQMVEFAWGLANSNKTFLWVIRPDLVAGK---HAVLPEEFVAATNDRGRLSSWTPQED  366

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H A+GGFLTHSGWNSTLESI  GVPMICWPFFA+QQTN R+  E W +GL+++D   
Sbjct  367   VLTHPAIGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRYCCEEWGIGLEIEDA-K  425

Query  1271  RSSVEKLIRELMEKRKGEFL-ERAENMGKLAKE-AISEGGSSYCNFDCLIQDMI  1426
             R  VE L+RELM+  KG+ + E A    KLA + A+   GSS+ N + + + ++
Sbjct  426   RDRVESLVRELMDGEKGKLMKENALKWKKLAHDSAVGPKGSSFVNLENMFRGVL  479



>emb|CBI36705.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   339 bits (869),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 194/451 (43%), Positives = 257/451 (57%), Gaps = 70/451 (16%)
 Frame = +2

Query  98    MLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTR--FRLQSFPPGIYDGALNS  271
             MLKLA LL LA   ITF      H RLL  T++   R+T    FR Q+   G+      +
Sbjct  1     MLKLAELLSLAGLRITFLNSDYNHHRLLRYTNI-LDRYTRYPGFRFQTISDGLPLDRPWT  59

Query  272   KEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALDVSEECFNLPVYYF  451
                  ++ D ++   KP  ++ +     S  P TC I+D L+S A+DV+ E   +P+   
Sbjct  60    GAGLRDMMDGIKATTKPLFREMVISWCQSSDPVTCIIADGLMSFAIDVANE-VGVPIISC  118

Query  452   RPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCRDEDLA  631
             R +S C F  YFS  +L EAGE+P K + +D   +T+V GME FLR RDL  FCR  D  
Sbjct  119   RTVSPCCFLAYFSFAELIEAGEVPFKDDDMDRL-VTRVPGMEGFLRRRDLPSFCRTRDAN  177

Query  632   ----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKATLASK  799
                     TE +   +A  LILNTFEDL+GPILSQIR   P +YTIGPLHAHLK+ LAS+
Sbjct  178   DRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIRNHCPKIYTIGPLHAHLKSRLASE  237

Query  800   ST---HSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFL  970
             +T    SNS  +ED +C+AWLD Q  KS IYVSFGSI+VIT++Q+MEFW+GLVNSG +FL
Sbjct  238   TTTSQFSNSFWEEDRSCLAWLDRQPSKSFIYVSFGSITVITKEQMMEFWHGLVNSGSRFL  297

Query  971   WVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTL  1150
             WV+R D +  KD +             A G   GW P                       
Sbjct  298   WVIRPDSLTEKDGD-------------APG--CGWVP-----------------------  319

Query  1151  ESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFL  1330
                                 NSRFV  VWK+G+DMKD CDR +VEK++R++ME+R+ EF 
Sbjct  320   --------------------NSRFVSHVWKIGMDMKDTCDRVTVEKMVRDVMEERRAEFT  359

Query  1331  ERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             +  + M KLA+ ++SEGG+SYCNF+ LI+D+
Sbjct  360   KSVDAMAKLARSSLSEGGTSYCNFNRLIEDI  390



>ref|XP_007207170.1| hypothetical protein PRUPE_ppa022102mg [Prunus persica]
 gb|EMJ08369.1| hypothetical protein PRUPE_ppa022102mg [Prunus persica]
Length=474

 Score =   342 bits (876),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 196/468 (42%), Positives = 272/468 (58%), Gaps = 22/468 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++IFP P Q H+  +L LA LL  A  H+T+    + H RL A     S  F T    +
Sbjct  7     HVVIFPFPLQGHMKPLLCLAELLCHAGLHVTYVNTHHNHQRL-ANRQALSTHFPT-LHFE  64

Query  233   SFPPGIYDG---ALNSKEVFVELCDSLRRIGKPFLK--QYIAQNRDSGLPF-TCFISDLL  394
             S   G+ +     LNS ++ + L  S+R   +  LK     A++ D+ +P  +C ++D L
Sbjct  65    SISDGLPEDDPRTLNS-QLLIALKTSIRPHFRELLKTISLKAESNDALVPPPSCIMTDGL  123

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             V+ A DV+EE   LP+  F        WT   LP L E G+LP + + ++   IT V GM
Sbjct  124   VTFAFDVAEE-LGLPILSFNVPCPRYLWTCLCLPKLIENGQLPFQDDDMNVE-ITGVPGM  181

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E  L  +DL  FCR    D         E +   +A  LIL+T  +L+ P +S +   +P
Sbjct  182   EGLLHRQDLPGFCRVKQADHPSLQFAINETQTLKRASALILDTVYELDTPCISHMALMFP  241

Query  743   NVYTIGPLHAHLKATLASKS---THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              +YT+GPLHA L + +   S       SL + D  CM WLDSQ  KSVIYVSFG++  +T
Sbjct  242   KIYTLGPLHALLNSQIGDMSRGLASHGSLWKSDLNCMTWLDSQPSKSVIYVSFGTLVHLT  301

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             R Q++EFWYGL+NSG  FLWVMRSD+ +G    +  IP EL+ GTK  G IV W  QE V
Sbjct  302   RAQVIEFWYGLINSGHPFLWVMRSDITSG----DHQIPPELENGTKERGCIVDWVSQEEV  357

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H +VGGFLTHSGWNSTLESI AG+PMICWP   D    SR V   WK+GL + + CDR
Sbjct  358   LAHKSVGGFLTHSGWNSTLESIVAGLPMICWPNLGDHYIISRTVCRQWKIGLQLNENCDR  417

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             S++E +++ LM  ++ E     + + KLA+++++EGGSS+ N + LI+
Sbjct  418   SNIESMVQTLMGSKREEIQSSMDAISKLARDSVAEGGSSHNNLEQLIE  465



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   343 bits (880),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 194/478 (41%), Positives = 276/478 (58%), Gaps = 19/478 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLK+A LL    FHITF      H RLL     ++      FR +
Sbjct  11    HAVCLPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLKSRGPNALDGVPDFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLP-FTCFISDLLVSIAL  409
             + P G+    +++ +    LCDS  +      +Q +A+   SG+P  TC +SD ++S  L
Sbjct  71    TIPDGLPPPDIDATQDIPALCDSTSKNCLAPFRQLLAKLNSSGVPPVTCIVSDGVMSFTL  130

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGM  574
               +EE   +P   F   SAC F  Y   P L E G  P+K      NG   + I  + GM
Sbjct  131   KAAEE-LGIPEVLFWTTSACGFLGYMHYPRLIERGFTPLKDETYLTNGYLDTVIDWIPGM  189

Query  575   EDFLRVRDLSPFCRDED----LAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             ++ +R+RDL  F R  D    +      E+  A +A  +I+NTF++ E  ++  + +  P
Sbjct  190   KN-IRIRDLPSFVRTTDRNDIMLNFLAVESERAAKASAVIVNTFDEFEHDVVKALSSMLP  248

Query  743   NVYTIGPLHAHLKATLAS--KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
              +YTIGPL   L     +  +S  SN L +E+  C+ WL+S+EPKSV+YV+FGSI+V+T 
Sbjct  249   RIYTIGPLQLLLNQIPQTPLESIGSN-LWKEEPECLQWLNSKEPKSVVYVNFGSITVMTA  307

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             QQL+EF +GL NS   FLW++R DLV G   + S +P E  E T+  G +  W PQE VL
Sbjct  308   QQLVEFAWGLANSKHTFLWIIRPDLVRG---DSSILPPEFLEETEERGLMASWCPQEQVL  364

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
             +H A+ GFLTHSGWNST+ESI  GVPMI WPFFA+QQTN RF    W VG+++ +   R 
Sbjct  365   NHPAIAGFLTHSGWNSTVESIGYGVPMISWPFFAEQQTNCRFACTEWGVGMEIDNNVKRE  424

Query  1277  SVEKLIRELMEKRKGEFLE-RAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVNEATR  1447
              VE+L+RELME  KG+ +  +A    K A++A S  GSS+ N + LI+D++  ++  R
Sbjct  425   EVERLVRELMEGEKGKGMRNKAMEWKKKAEQAASPNGSSFLNLEKLIKDVLLKHQTVR  482



>dbj|BAJ98857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score =   341 bits (874),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 193/468 (41%), Positives = 255/468 (54%), Gaps = 28/468 (6%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARL-LALTDVDSGRFTTRFR  226
              H+L+FP P Q H+NSML  A  L  A  H+TF     +H    L          T R R
Sbjct  4     AHVLVFPWPLQGHINSMLHFAAGLLDAGLHVTF-----VHTEHNLRRAQRAEAAATPRLR  58

Query  227   LQSFPPGIYDGALNSKEVFVELCDSLRRIG----KPFLKQYIAQNRDSGLP-FTCFISDL  391
               S P G+      S     +L  SL   G    +  L   ++     G P  +C ++D 
Sbjct  59    FVSLPDGLSVDHPRSVGDLKDLAKSLMTTGPAAYRALLASALSPAAIGGFPALSCVVADG  118

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKG  571
             L+  A+DV+EE   +P   FR  SAC+F  Y S+P L E GE+PI        P+  V G
Sbjct  119   LLPFAIDVAEE-LGVPALAFRTSSACSFLAYLSVPKLVELGEVPIPVGADLDGPVCSVPG  177

Query  572   MEDFLRVRDLSPFCRD-------EDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIR  730
             MEDFLR RDL   CR        + L  L  +    +  AR LI NT   LE   L+ I 
Sbjct  178   MEDFLRRRDLPSSCRRRPETQDVDPLLQLLVSYTAHSCNARALIFNTAASLERSALAHIA  237

Query  731   TKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
                 +V+ IGPLHA     +++    + SL +ED+ CMAWLD Q  +SV+YVS GS++VI
Sbjct  238   PHMRDVFAIGPLHA-----ISAAPAPATSLWREDDGCMAWLDGQADRSVVYVSLGSLAVI  292

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             + +Q  EF  GLVNSG  FLWV+R D++     + + +   +    K    +VGWAPQ  
Sbjct  293   SLEQFTEFLSGLVNSGYTFLWVLRPDMIGAS--QSAVLQEAVGAAGKGKARVVGWAPQRD  350

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVG FLTH+GWNSTLE IA GVP++CWPFF DQQ NSRFVG VW  GLDMKDVCD
Sbjct  351   VLRHRAVGCFLTHAGWNSTLEGIAEGVPLVCWPFFLDQQINSRFVGAVWGAGLDMKDVCD  410

Query  1271  RSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             R+ VE ++R+ ME    +    A+ + +  +  ++EGGSS   F  L+
Sbjct  411   RAVVEGMVRQAMESE--QLRMSAQTLSQEVRRDVAEGGSSATEFQRLL  456



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   341 bits (875),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 194/473 (41%), Positives = 267/473 (56%), Gaps = 21/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    FHITF      H RLL     +S      FR +
Sbjct  11    HAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSG--LPFTCFISDLLVSIA  406
             + P G+     N+ +    LCDS R+ G P+ +  +++   S    P +C +SD  +   
Sbjct  71    TIPDGLPPTDANATQDIPSLCDSTRKRGLPYFRDLLSKLNSSPDCPPVSCVVSDGAMGFT  130

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  571
             LD ++E   LP   F   SAC F  Y     L E G  P+K      NG   + I  + G
Sbjct  131   LDAAQE-LGLPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTNGYLETEIDWIPG  189

Query  572   MEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             M   +R++D+  F R  D D  +L +   E     +A  +I NTF D E  +L+ + T  
Sbjct  190   MRG-IRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVIFNTFHDFEHEVLNALSTLL  248

Query  740   PNVYTIGPLHAHLKATLAS---KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             P +Y+IGPLH  +    A    K   SN L  E+  C+ WLDS+EP SV+YV+FGSI+V+
Sbjct  249   PPIYSIGPLHLQINQIPADSELKEIRSN-LWTEEPECLEWLDSKEPNSVVYVNFGSITVM  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T +QL+EF +GL NS + F WV+R DLV G   + + +P E  E TK    +  W PQE 
Sbjct  308   TAEQLIEFAWGLANSNQTFFWVIRPDLVGG---DSAVVPPEFVEETKERSLLANWCPQEQ  364

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNST+ES+ AGVPMICWPFFA+QQTN R+  + W +G++++    
Sbjct  365   VLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWAIGMEIESDVK  424

Query  1271  RSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
             R+ VE L+R+LME  +G E  ++A    KLA EAIS  GSS+   D ++  ++
Sbjct  425   RNYVEGLVRKLMEGDEGKEMRKKALEWKKLATEAISPNGSSFVGLDKMVNQVL  477



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   340 bits (873),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 195/473 (41%), Positives = 269/473 (57%), Gaps = 21/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    FHITF      H RLL     +S      FR +
Sbjct  11    HAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ-NRDSGLP-FTCFISDLLVSIA  406
             + P G+     N+ +    LC+S R+   P+ +  +++ N  +G P  +C +SD ++S  
Sbjct  71    TIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSSTGCPPVSCIVSDGVMSFT  130

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  571
             LD + E   +P   F   SAC F  Y     L E G  P+K      NG   + I  + G
Sbjct  131   LDAAHE-LGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDANYLTNGYLETQIDWIPG  189

Query  572   MEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             M   +R++D+  F R  D D  +L +   E     +A  ++LNTF DLE   L  + T  
Sbjct  190   MRG-IRLKDIPSFIRTTDPDDLMLDFLVHETERTRKASAVVLNTFHDLEHEALDALSTLL  248

Query  740   PNVYTIGPLHAHLKATLAS---KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             P +Y+IGPLH  +    A    K   SN L  E+  C+ WLDS+EP SV+YV+FGSI+V+
Sbjct  249   PPIYSIGPLHLQINQIPADSELKEIRSN-LWTEEPECLEWLDSKEPNSVVYVNFGSITVM  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T +QL+EF +GL NS + F WV+R DLV G   + + +P E  E TK    +  W PQE 
Sbjct  308   TAEQLIEFAWGLANSNQTFFWVIRPDLVGG---DSAVVPPEFVEETKERSLLAHWCPQEQ  364

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNST+ES+ AGVPMICWPFFA+QQTN R+  + W +G+++K    
Sbjct  365   VLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVK  424

Query  1271  RSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
             R+ VE L+R+LME  +G +  ++A    KLAKEA S  GSS+   D +I  ++
Sbjct  425   RNYVEGLVRKLMEGEEGKDMRKKALEWKKLAKEATSPNGSSFVPLDKMINQVL  477



>ref|XP_007206751.1| hypothetical protein PRUPE_ppa025141mg [Prunus persica]
 gb|EMJ07950.1| hypothetical protein PRUPE_ppa025141mg [Prunus persica]
Length=482

 Score =   339 bits (869),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 194/468 (41%), Positives = 272/468 (58%), Gaps = 22/468 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++IFP P Q H+  +L LA LL  A  H+T+    + H RL A     S  F T    +
Sbjct  7     HVIIFPFPLQGHMKPLLCLAELLCHAGLHVTYVNTHHNHQRL-ANRQALSTHFPT-LHFE  64

Query  233   SFPPGIYDG---ALNSKEVFVELCDSLRRIGKPFLK--QYIAQNRDSGLPF-TCFISDLL  394
             S   G+ +     LNS ++ + L  S+R   +  LK     A++ D+ +P  +C ++D L
Sbjct  65    SISDGLPEDDPRTLNS-QLLIALKTSIRPHFRELLKTISLKAESNDTLVPPPSCIMTDGL  123

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             V+ A DV+EE   LP+  F        WT   LP L E G+LP + + ++   IT V GM
Sbjct  124   VTFAFDVAEE-LGLPILSFNVPCPRYLWTCLCLPKLIENGQLPFQDDDMNVE-ITGVPGM  181

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E  L  +DL  FCR    D         E +   +A  LIL+T  +L+ P +S +   +P
Sbjct  182   EGLLHRQDLPGFCRVKQADHPSLQFAINETQTLKRASALILDTVYELDAPCISHMALMFP  241

Query  743   NVYTIGPLHAHLKATLASKS---THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              +YT+GPLHA L + +   S       SL + D  CM WLDSQ  KS+IYVSFG++  +T
Sbjct  242   KIYTLGPLHALLNSQIGDMSRGLASHGSLWKSDLNCMTWLDSQPSKSIIYVSFGTLVHLT  301

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             R Q++EFWYGLVNSG  FLWVMRSD+ +G    +  IP+EL+ GTK  G IV W  QE V
Sbjct  302   RAQVIEFWYGLVNSGHPFLWVMRSDITSG----DHQIPAELENGTKERGCIVDWVSQEEV  357

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H +VGGFLTHSGWNSTLESI AG+PMICWP   D    S  V   WK+GL + + CDR
Sbjct  358   LAHKSVGGFLTHSGWNSTLESIVAGLPMICWPKLGDHYIISSTVCRQWKIGLQLNENCDR  417

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
             S++E +++ LM  ++ E     + + KL++++++EGGSS+ N + LI+
Sbjct  418   SNIESMVQTLMGSKREEIQSSMDAISKLSRDSVAEGGSSHNNLEQLIE  465



>gb|KEH28097.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=483

 Score =   339 bits (869),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 200/475 (42%), Positives = 277/475 (58%), Gaps = 23/475 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
             H++  P PAQ H+N MLKLA LL   ++FH+TF      H RLL     +S      FR 
Sbjct  12    HVVCVPFPAQGHINPMLKLAKLLHFKSDFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRF  71

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ--NRDSGLPFTCFISDLLVSI  403
             ++ P G+ +  L+S +    LC+S  +   P  K+ I++  N     P TC I D ++S 
Sbjct  72    ETIPDGLPESDLDSTQDIPSLCESTSKTCLPHFKKLISKLNNAIDTPPVTCIIGDGVMSF  131

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVK  568
              +D +EE  N+P   F   SAC F  Y     L E G  P+K      NG   + I  V 
Sbjct  132   TIDAAEE-LNIPAVLFWTTSACGFMCYMQFRQLIEKGLTPLKDSSYLTNGYLETTIDWVP  190

Query  569   GMEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRT-  733
             G+++ +R+RD+  F R  D +  VL +   E + A++A  +ILNTF+ LE  +L    + 
Sbjct  191   GIKE-IRLRDIPTFIRTTDPNDIVLNFALGECQRALKASAIILNTFDALEHNVLEAFSSI  249

Query  734   -KYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDET-CMAWLDSQEPKSVIYVSFGSISV  907
                P VY+IGP++  LK     +     S L +DET C+ WL S+EP SV+YV+FGSI+V
Sbjct  250   DNLPPVYSIGPINFLLKNVTDEELNSIGSNLWKDETDCLEWLASKEPNSVVYVNFGSITV  309

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +T  QL+EF +GL NS K FLWV+R DLV+GK+   + +P E  E TK  G +  W PQE
Sbjct  310   MTNDQLVEFAWGLANSKKTFLWVIRPDLVSGKN---AVLPQEFLEETKNRGLLSSWCPQE  366

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H ++GGFLTHSGWNSTLES+  GVPMICWPFFA+QQTN RF    W +GL+++D  
Sbjct  367   EVLGHSSIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEIEDA-  425

Query  1268  DRSSVEKLIRELMEKRKG-EFLERAENMGKLAKE-AISEGGSSYCNFDCLIQDMI  1426
              R  +E L++ELME  KG E  E+A  + +LA + A    GSS  N D +I  ++
Sbjct  426   KRDKIEILVKELMEGEKGKEMKEKALRLKELAHDNAYGAFGSSLVNLDNMIHHVL  480



>gb|EAZ03904.1| hypothetical protein OsI_26038 [Oryza sativa Indica Group]
Length=498

 Score =   339 bits (870),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 194/474 (41%), Positives = 262/474 (55%), Gaps = 32/474 (7%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP PAQ H+N M+  A  L  A  H+TF + S+   R L          + R R  
Sbjct  9     HVLVFPFPAQGHINCMMHFATGLLGAGLHVTF-LHSDRSLRRLGGAAAALAAGSPRLRFL  67

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIG----KPFLKQYIAQNRDSGL------PFTCFI  382
             S P G+ D    +    +E  +S+R  G    +  L   + +  D G       P TC +
Sbjct  68    SIPDGLPDDHARAAGDLLEHMESIRTKGSVAYRRVLLASLVRAGDDGSTGVQFPPVTCVV  127

Query  383   SDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  562
             +D ++ +A+D++EE   +P   FR +SAC+F  Y S+P LFE GELP    G    P+  
Sbjct  128   ADGIMPLAIDIAEE-IGVPALGFRTVSACSFLAYLSIPRLFELGELPFPAGGDLDEPVRG  186

Query  563   VKGMEDFLRVRDLSPFCR---------DEDLAVLYYTEARLAVQARGLILNTFEDLEGPI  715
             V GME FLR RDL  FCR         D  L  +    A  + +AR L+LNT   +EGP 
Sbjct  187   VPGMETFLRRRDLPSFCRGGGGGESQNDPMLQTVNEVTAH-SRKARALVLNTSASMEGPA  245

Query  716   LSQIRTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFG  895
             L+ I     +V+ IGPLH    A  A+      SL + D+ CMAWLD Q  +SV+YVS G
Sbjct  246   LAHIAPHMRDVFAIGPLHTMFPAPAAA-----GSLWRADDGCMAWLDGQPDRSVVYVSLG  300

Query  896   SISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGW  1075
             S +VI+ +Q  EF +GLV +G  FLWV+R D+V           +     ++A   +V W
Sbjct  301   SFTVISLEQFTEFLHGLVAAGHAFLWVLRPDMVGASQSAALREAAAAAGDSRAR--VVEW  358

Query  1076  APQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDM  1255
             APQ  VL H AVG FLTH+GWNSTLE+   GVP +CWPFFADQQ NSRFVG VW+ GLDM
Sbjct  359   APQLDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQINSRFVGGVWRTGLDM  418

Query  1256  KDVCDRSSVEKLIRELMEKRKGEFLERAENMGK-LAKEAISEGGSSYCNFDCLI  1414
             KDVCD + VE+++RE ME    E    A+ + + L ++   +GGSS   F  L+
Sbjct  419   KDVCDAAVVERMVREAME--SAEIRASAQALARQLRRDIADDGGSSAAEFQRLV  470



>ref|XP_004957723.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Setaria italica]
Length=483

 Score =   338 bits (867),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 201/490 (41%), Positives = 268/490 (55%), Gaps = 40/490 (8%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP+P Q H+N+ML  A  L  A  H+TF    +   R+     V S   + R R  
Sbjct  5     HVLVFPVPVQGHINAMLPFAAALLDAGAHVTFLHTDHNLRRVGRAASVAS---SPRLRFL  61

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLP-------------FT  373
             S P G+ D +  S     EL  SLR +G    +   A    +G P              T
Sbjct  62    SIPDGLPDDSRRSVGDLGELDRSLREVGSVRYRALFASLLSAGSPNRAGADDEHRFPPLT  121

Query  374   CFISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSP  553
             C ++D L+  A+D++EE   +P   FR  SAC+F  + S P LFE G+LP    G    P
Sbjct  122   CVVADGLMPWAIDIAEE-LGVPALAFRTSSACSFLAFMSAPGLFELGDLPFPAGGDLDEP  180

Query  554   ITKVKGMEDFLRVRDL-SPFCR-------DEDLAVLYYTEARLAVQARGLILNTFEDLEG  709
             +  V GME FLR RDL S F R       D  L V+    A    +AR L+LNT   LE 
Sbjct  181   VRGVPGMESFLRRRDLPSSFRRRGDTDDVDPSLHVVAKASAHCG-KARALVLNTAASLER  239

Query  710   PILSQIRTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVS  889
               L+ I  +  ++++IGPLHA   A  AS      SL +ED+ C+AWLD Q  +SV+YVS
Sbjct  240   SALAHIAPRMRDLFSIGPLHAMSPALAAS-----CSLWREDDGCLAWLDGQADRSVVYVS  294

Query  890   FGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANG--Y  1063
              GS +VI+R+Q  EF  G+  +G  FLWV+R D+V    D    +  E       +G   
Sbjct  295   LGSFTVISREQFKEFLSGIAATGYPFLWVLRPDMVWASQDG---VLHEAAMAAAGDGKAR  351

Query  1064  IVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKV  1243
             IV WAPQ  VL H AVG FLTH+GWNSTLE++  GVPM+CWPFFADQ  NSRFVG VW+ 
Sbjct  352   IVAWAPQRDVLRHRAVGCFLTHAGWNSTLEAVVEGVPMVCWPFFADQHVNSRFVGAVWRN  411

Query  1244  GLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             GLDMKDVC+R  VE+ +RE ME    E    A+ + +L K  ++ GGSS    + L+  +
Sbjct  412   GLDMKDVCERGVVERTVREAME--SDEIRRAAQALAQLVKRDVAAGGSSATELERLVGFI  469

Query  1424  --IKVNEATR  1447
               +  ++ATR
Sbjct  470   RELSASKATR  479



>ref|XP_007026846.1| UDP-glucosyl transferase 85A3, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07348.1| UDP-glucosyl transferase 85A3, putative isoform 2 [Theobroma 
cacao]
Length=448

 Score =   336 bits (862),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 181/382 (47%), Positives = 250/382 (65%), Gaps = 15/382 (4%)
 Frame = +2

Query  317   KPFLKQ-YIAQNRDSGL--PFTCFISD-LLVSIALDVSEECFNLPVYYFRPISACAFWTY  484
             KP L+Q +I+  +  G   P TC I D +L S  +DV+EE F +PV+ FR  SAC  WTY
Sbjct  54    KPALRQLFISLCKKKGRWQPATCIIEDGILSSSVIDVAEE-FQVPVFAFRTSSACCIWTY  112

Query  485   FSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCRDE---DLAVLYYTEAR  655
             F +  L E G++P+  +     P+T + G+E+ +R RDL    R E   D  + ++   +
Sbjct  113   FHVRKLVEEGDVPVVQDKDMDKPVTCIPGLENVVRRRDLPGIFRIERADDPGLEFFINDQ  172

Query  656   LAVQARG--LILNTFEDLEGPILSQIRTKYPNVYTIGPLH--AHLKATLASKSTHSNSLL  823
               V  R   +I+NTF+ LE  ++S++ + +  +YT+GPLH  ++ +A   + S  SNS+L
Sbjct  173   TLVMPRAFAIIINTFDGLEATMISKLASVFTKMYTVGPLHGLSNARAKEETTSASSNSIL  232

Query  824   -QEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAG  1000
              +ED  CM WLDSQ  +SV++VSFGS   +TR +++EF +GLVNSG  FLWV+R D + G
Sbjct  233   WKEDRGCMFWLDSQPSRSVVFVSFGSFVGLTRDKMLEFGHGLVNSGYPFLWVIRPDSITG  292

Query  1001  KDDEESPIPSELKEGTKAN-GYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPM  1177
             + D  S I  ELK   + N G +V WAPQE VL H A+G FLTHSGWNSTLES+ AGVPM
Sbjct  293   EVDP-SLILGELKAMIEDNKGLMVSWAPQEEVLAHPAIGVFLTHSGWNSTLESVYAGVPM  351

Query  1178  ICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKL  1357
             ICWP   DQQ NSRFV +VWK+GLDMKD CDRS++EK++R LME ++ E ++    + KL
Sbjct  352   ICWPAIGDQQINSRFVSDVWKIGLDMKDTCDRSTIEKMVRSLMEDKREEIMKSVNEIKKL  411

Query  1358  AKEAISEGGSSYCNFDCLIQDM  1423
             A E I EGGSS+ N + LI D+
Sbjct  412   AHETIKEGGSSFSNLEKLIDDI  433



>ref|NP_001175206.1| Os07g0489950 [Oryza sativa Japonica Group]
 dbj|BAC80059.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
 dbj|BAH93934.1| Os07g0489950 [Oryza sativa Japonica Group]
Length=490

 Score =   337 bits (863),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 193/473 (41%), Positives = 257/473 (54%), Gaps = 29/473 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP P Q HLN ML LA  L  A  H+TF   ++ + R L      +   +   R  
Sbjct  9     HVLVFPWPIQGHLNVMLHLAVALAGAGVHVTFLH-TDYNLRRLGAAAAAA-VASPWLRFM  66

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRD----------SGLPFTCFI  382
             S   G+ D    +     E+  SL   G+   +  +A +            +  P T  +
Sbjct  67    SVTDGLPDDHPRTVANLGEISRSLHTAGRAAYRALLASSSQLVPADAAGGGAFPPVTTVV  126

Query  383   SDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITK  562
             +D L+  A+DV+EE   +P   FR  SAC+F  Y S+P L E GELP    G    P+  
Sbjct  127   ADALLPFAIDVAEE-LGVPALAFRTASACSFLAYMSVPRLVELGELPFPPGGDLDEPVRG  185

Query  563   VKGMEDFLRVRDLSPFCR------DEDLAVLYYTEARLAV---QARGLILNTFEDLEGPI  715
             V GME FLR RDL   CR      ++D A L    A  AV   +AR LILNT   LE P 
Sbjct  186   VPGMEGFLRRRDLPSPCRHHGANNNDDAAALLGRLADAAVHCSKARALILNTAASLEAPA  245

Query  716   LSQIRTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFG  895
             L+ I  +  +V+ +GPLHA   A  A+      SL + D+ CMAWLD Q  +SV+YVS G
Sbjct  246   LAHIAPRMRDVFAVGPLHAMSPAPAAA-----TSLWRADDGCMAWLDCQADRSVVYVSLG  300

Query  896   SISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGW  1075
             S++VI+ +Q  EF  GLV +G  FLWV+R D+V  +        S       +   +VGW
Sbjct  301   SLTVISPEQFTEFLSGLVAAGNPFLWVLRPDMVTARRRHADLQESVTAAAGDSKARVVGW  360

Query  1076  APQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDM  1255
             APQ  VL H AVG FLTH+GWNSTLE+   GVP +CWPFF DQQ NSRFVG VW+ GLDM
Sbjct  361   APQRDVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFTDQQINSRFVGGVWRTGLDM  420

Query  1256  KDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             KDVCD + V +++RE ME   GE    A+++ +  +  ++EGGSS      L+
Sbjct  421   KDVCDAAVVARMVREAME--SGEIRASAQSVARQLRRDVAEGGSSAMELKRLV  471



>gb|KEH17174.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   336 bits (862),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 278/475 (59%), Gaps = 21/475 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTTRF  223
             + H++  P PAQ H+N ML +A LL     FH+TF      H R L     DS      F
Sbjct  10    VPHVVCVPYPAQGHINPMLNIAKLLHFKGGFHVTFVNTEYNHKRHLKARGPDSLNGLPTF  69

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDS--GLPFTCFISDLLV  397
             R ++ P G+ +  ++S +    LC+S R+   P  K  +++  D+    P TC +SD ++
Sbjct  70    RFETIPDGLPESNVDSTQDIPSLCESTRKTCLPHFKNLLSKLNDALDTPPVTCIVSDGVM  129

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITK  562
             S  LD ++E  N+P   F   SAC F  Y     L E G  P+K      NG   +PI  
Sbjct  130   SFTLDAAQE-LNIPQVLFWTTSACGFMCYAQYRQLMEKGLTPLKDWSDMTNGYLETPIDW  188

Query  563   VKGMEDFLRVRDLSPFCRDED----LAVLYYTEARLAVQARGLILNTFEDLEGPILSQIR  730
             V G+++ +R++DL  F R  D    +      E + A +A  +ILNTF+ LE  +L    
Sbjct  189   VPGIKE-IRLKDLPSFIRTTDPNDPMIEFMSRECQRAQKASAIILNTFDALEHDVLEAFS  247

Query  731   TKYPNVYTIGPLHAHLK-ATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             + +P +Y+IGPL+  LK  T    ++  ++L +ED  C+ WL+++EP +V+YV+FGS++V
Sbjct  248   SIFPPIYSIGPLNLLLKDVTNEELNSIGSNLWKEDSKCLKWLNNKEPNTVVYVNFGSVTV  307

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +T++Q++EF +GL NS K FLWV+R DLVAG   E + +P E  E TK  G +  W  Q 
Sbjct  308   MTKEQMIEFAWGLSNSKKPFLWVIRPDLVAG---ENAVLPLEFLEETKDRGLLSSWCLQG  364

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H A+GGFLTHSGWNSTLES+ AGVPMICWPFFA+QQTN RF    W++GL+++D  
Sbjct  365   EVLAHSAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCNEWEIGLEIEDA-  423

Query  1268  DRSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAIS-EGGSSYCNFDCLIQDMI  1426
              R  +E L++EL++  KG E   +A    KLA  A S   GSS+ N + L +D++
Sbjct  424   KRDKIESLVKELLDGEKGKEMKAKALQWKKLAHNAASGPHGSSFMNLENLFRDVL  478



>ref|XP_003615138.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES98096.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|KEH28099.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=480

 Score =   336 bits (861),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 193/475 (41%), Positives = 274/475 (58%), Gaps = 21/475 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTTRF  223
             + H++  P PAQ H+N MLKLA LL     FH+TF      H RLL     +S      F
Sbjct  10    LSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSF  69

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ--NRDSGLPFTCFISDLLV  397
             R ++ P G+ +  ++  +    LC+S R    P  K+ +++  N     P TC +SD  +
Sbjct  70    RFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPVTCIVSDGCM  129

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITK  562
             S  LD ++E  N+P   F   SAC F  Y     L E G  P+K      NG   + I  
Sbjct  130   SFTLDAAQE-LNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYITNGYLETTIDW  188

Query  563   VKGMEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIR  730
             V G+++ +R++D+  F R    ++ +      E + A +A  +I NTF++LE  +L    
Sbjct  189   VPGIKE-IRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNLEHDVLEAFS  247

Query  731   TKYPNVYTIGPLHAHLK-ATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             +  P VY+IGPLH  +K  T     +  ++L +E+  C+ WL+S+EP SV+YV+FGSI+V
Sbjct  248   SILPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYVNFGSITV  307

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +T +Q++EF +GL NS   FLWV+R DLVAG   E + +P E  E TK  G +  W PQE
Sbjct  308   MTSEQMIEFAWGLSNSKMPFLWVIRPDLVAG---ENAVLPLEFLEETKNRGLLSSWCPQE  364

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H ++GGFLTH+GWNSTLES+  GVPMICWPFFA+QQTN RF    W +GL+++D  
Sbjct  365   EVLGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEIEDA-  423

Query  1268  DRSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAIS-EGGSSYCNFDCLIQDMI  1426
              R  +E L++ELME  KG E  E+A    KLA  A S   GSS+ N + LI D++
Sbjct  424   KRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVL  478



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   336 bits (861),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 268/473 (57%), Gaps = 21/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N ML+LA LL    FHITF      H RLL     +S      FR +
Sbjct  11    HAVCIPFPAQGHINPMLELAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ-NRDSGLP-FTCFISDLLVSIA  406
             + P G+     N+ +    LC+S R+   P+ +  +++ N  +G P  +C +SD ++S  
Sbjct  71    TIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSSTGCPPVSCIVSDGVMSFT  130

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  571
             LD + E   +P   F   SAC F  Y     L E G  P+K      NG   + I  + G
Sbjct  131   LDAAHE-LGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTNGYLETEIDWIPG  189

Query  572   MEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             M   +R++D+  F R  D D  +L +   E     +A  +ILNTF D E  +L  + T  
Sbjct  190   MRG-IRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVILNTFHDFEHEVLDALSTLL  248

Query  740   PNVYTIGPLHAHLKATLAS---KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             P +Y+IGPLH  +    A    K   SN L  E+  C+ WLDS+EP SV+YV+FGSI+V+
Sbjct  249   PPIYSIGPLHVQINQIPADSELKEIRSN-LWTEEPECLEWLDSKEPNSVVYVNFGSITVM  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T +QL+EF +GL NS + F WV+R DLV G   + + +P E  E TK    +  W PQE 
Sbjct  308   TAEQLIEFAWGLANSNQTFFWVIRPDLVGG---DSAVVPPEFVEDTKERSLLANWCPQEQ  364

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNST+ES+ +GVPMICWPFFA+QQTN R+  + W +G++++    
Sbjct  365   VLKHPAVGGFLTHSGWNSTIESVCSGVPMICWPFFAEQQTNCRYSEKEWGIGMEIESDVK  424

Query  1271  RSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
             R+ VE L+R+LME  +G E  ++A    KLA EA S  GSS+   D ++  ++
Sbjct  425   RNYVEGLVRKLMEGDEGKEMRKKALEWKKLATEATSPNGSSFLCLDKMVNQVL  477



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   336 bits (861),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 193/473 (41%), Positives = 269/473 (57%), Gaps = 21/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    FHITF      H RLL     +S      FR +
Sbjct  11    HAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ-NRDSGLP-FTCFISDLLVSIA  406
             + P G+     N+ +    LC+S R+   P+ +  +++ N  +G P  +C +SD ++S  
Sbjct  71    TIPDGLPLTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSSTGCPPVSCIVSDGVMSFT  130

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  571
             LD + E   +P   F   SAC F  Y     L E G  P+K      NG   + I  + G
Sbjct  131   LDAAHE-LGIPEVLFWTTSACGFLAYVHYHRLIENGLTPLKDASYLTNGYLETQIDWIPG  189

Query  572   MEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             M   +R++D+  F R  D D  +L +   E     +A  ++LNTF DLE   L  + T  
Sbjct  190   MRG-IRLKDIPSFIRTTDRDDLMLDFLVHETERTRKASAVVLNTFHDLEHEALDALSTLL  248

Query  740   PNVYTIGPLHAHLKATLAS---KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             P +Y+IGPLH  +    A    K   SN L  E+  C+ WLDS+EP SV+YV+FGSI+V+
Sbjct  249   PPIYSIGPLHLQINQIPADSELKEIRSN-LWTEEPECLEWLDSKEPNSVVYVNFGSITVM  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T +QL+EF +GL NS + F WV+R DLV G   + + +P E  E TK    +  W PQE 
Sbjct  308   TAEQLIEFAWGLANSNQTFFWVIRPDLVGG---DSAVVPPEFVEETKERSLLAHWCPQEQ  364

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNST+ES+ AGVPMICWPFFA+QQTN R+  + W +G+++++   
Sbjct  365   VLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIGMEIENDVK  424

Query  1271  RSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
             R+ VE L+R+LME  +G +  ++A    KLA EA S  GSS+   D +I  ++
Sbjct  425   RNYVEGLVRKLMEGEEGKDMRKKALEWKKLAMEATSPNGSSFVALDKMINQVL  477



>ref|XP_003563101.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=495

 Score =   336 bits (861),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 194/493 (39%), Positives = 271/493 (55%), Gaps = 46/493 (9%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARL------LALTDVDSGRF  211
              H+L+FP PAQ H+N ML+    L  A  H+TF    +   RL             +   
Sbjct  4     AHVLVFPCPAQGHINCMLQFTAGLLAAGLHVTFLHSDHNLRRLRHANNNNNNESTAAANS  63

Query  212   TTRFRLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNR---------DSGL  364
             + R R  S P G+ D    S    VE  +S+        +  ++  R         D GL
Sbjct  64    SPRLRFMSVPDGLPDDHPRSAGNLVEFMESMFAKTSVAYRALLSSLRAPAPPLDANDDGL  123

Query  365   ---PFTCFISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGN  535
                P TC ++D ++  A+ VSEE   +P   FR  SAC+F  Y S+PDL   GE+P+  +
Sbjct  124   LFPPVTCVVADGMLPFAITVSEE-LGVPALAFRTASACSFLAYLSVPDLVALGEVPVPES  182

Query  536   GIDSSPITKVKGMEDFLRVRDLSPFCR------------DEDLAVLYYTEARLAVQARGL  679
                 +P+  V GME FLR+RDL  FCR            D  L +L  +  + +  AR  
Sbjct  183   ADLDAPVRGVPGMEAFLRLRDLPSFCRGRSDPAGTADGLDPMLRILVDSVPQ-SRNARAF  241

Query  680   ILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDS  859
             ILNT   LE   LS I     +++ +GPLHA  +A  A       +L +ED+ CM WLD+
Sbjct  242   ILNTSASLERDALSHIAPHMRDLFAVGPLHAMFQAPGAG-----GALWREDDACMRWLDA  296

Query  860   QEPKSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELK  1039
             Q   +V+YVS GS++VI+ +Q  EF  GLVN+G  FLWV+R D+V    +      + L+
Sbjct  297   QADGTVVYVSLGSLAVISLEQFTEFLSGLVNAGHPFLWVLRPDMVDASQN------AVLQ  350

Query  1040  EGTK-ANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNS  1216
             +  K + G +V WAPQ  VL H AVG FLTH+GWNSTLE +  GVP +CWPFFADQQTNS
Sbjct  351   DAVKQSKGCVVEWAPQRDVLRHRAVGCFLTHAGWNSTLECVVEGVPTVCWPFFADQQTNS  410

Query  1217  RFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYC  1396
             RF+G VW  GLDMKDVC+R+ VE+++RE +E   GE    A+ + +  +  I+EGGSS  
Sbjct  411   RFMGAVWGTGLDMKDVCERAVVERMVREAVE--SGELRRSAQELAREVRRDIAEGGSSAT  468

Query  1397  NFDCLIQDMIKVN  1435
              F  L++ +I+++
Sbjct  469   EFRRLVEFIIELS  481



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   335 bits (859),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 265/473 (56%), Gaps = 21/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N +LKLA LL    FHITF      H RLL     +S      FR +
Sbjct  11    HAVCIPFPAQGHINPLLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSG--LPFTCFISDLLVSIA  406
             + P G+     N+ +    LCDS R+   P+ +  +++   S    P +C +SD  +   
Sbjct  71    TIPDGLPPTDANATQDIPSLCDSTRKRSLPYFRDLLSKLNSSPDCPPVSCVVSDGAMGFT  130

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  571
             LD ++E F LP   F   SAC F  Y       E G  P+K      NG   + I  + G
Sbjct  131   LDAAQE-FGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLKDASYLTNGYLETEIDWIPG  189

Query  572   MEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             M   +R++D+  F R  D D  +L +   E     +A  +I NTF D E  +L  + T  
Sbjct  190   MRG-IRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVIFNTFHDFEHEVLDALSTLL  248

Query  740   PNVYTIGPLHAHLKATLAS---KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             P +Y+IGPLH  +    A    K   SN L  E+  C+ WLDS+EP SV+YV+FGSI+V+
Sbjct  249   PPIYSIGPLHLQINQIPADSELKEIRSN-LWTEEPECLEWLDSKEPNSVVYVNFGSITVM  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T +QL+EF +GL +S + F WV+R DLV G   + + +P E  E TK    +  W PQE 
Sbjct  308   TAEQLIEFAWGLASSNQTFFWVIRPDLVGG---DSAVVPPEFVEETKERSLLAHWCPQEQ  364

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNST+ES+ AGVPMICWPFFA+QQTN R+  + W +G+++K    
Sbjct  365   VLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVK  424

Query  1271  RSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
             R+ +E L+R+LME  +G +  ++A    KLAKEA S  GSS+   D +I  ++
Sbjct  425   RNYIEGLVRKLMEGEEGKDMRKKALEWKKLAKEATSPNGSSFVPLDKMINQVL  477



>ref|XP_007141198.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
 gb|ESW13192.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
Length=484

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 197/471 (42%), Positives = 282/471 (60%), Gaps = 19/471 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL L  FHITF        RLL      S    + FR +
Sbjct  11    HAVCIPYPAQGHINPMLKLAKLLHLKGFHITFVNSEYNQKRLLKSRGSSSLHALSSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ-NRDSGLPFTCFISDLLVSIAL  409
             + P G+ D  +++ +    LC+S  R   P  ++ +A+ N   G P +C +SD +++  L
Sbjct  71    TIPDGLPDSDVDATQDIPSLCESTVRTCLPHFRKLLAKLNNSDGPPVSCIVSDGVMTFTL  130

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGM  574
             D ++E   LP   F   SAC F  Y     LF  G  P+K      NG   + I  + G+
Sbjct  131   DAAQE-LGLPEVLFWTTSACGFMCYLQYEQLFRKGITPLKDSSDVTNGYLETTIDWIPGI  189

Query  575   EDFLRVRDLSPFCR--DEDLAVLYY--TEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             ++ ++++D+  F R  D D  +L Y  +E + A +A  +ILNTF+ LE  +L  + +  P
Sbjct  190   KE-IQLKDIPSFIRTTDSDDIMLNYFRSECKNAPRASAIILNTFDTLEHDVLEALSSILP  248

Query  743   NVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
              VY+IGPL+  LK     + +   ++L +ED  CM WL+++EP SV+YV+FGSI+V+T  
Sbjct  249   PVYSIGPLNLLLKNVDDKELNAIESNLWKEDSECMEWLNTKEPNSVVYVNFGSITVVTSA  308

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             QL+EF +GL NS K FLWV+R DLVAG   E   +P E  E TK  G +  W  QE VL+
Sbjct  309   QLVEFAWGLGNSNKTFLWVIRPDLVAG---ENVVLPPEFVEQTKNRGLLSSWCSQEQVLN  365

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H A+GGFLTHSGWNSTLES+ AGVPMICWPFFA+QQTN RF  + W +G++++DV  R  
Sbjct  366   HPAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGMEIEDV-KRDK  424

Query  1280  VEKLIRELMEKRKGEFL-ERAENMGKLAKEAISEG-GSSYCNFDCLIQDMI  1426
             +E L++ELM+  KG+ + E+A    KLAK A S   G+S+ N D ++ +++
Sbjct  425   IESLVKELMDGEKGKQMKEKALQWKKLAKSAASGPYGTSFLNLDNMVHEVL  475



>ref|XP_010273031.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 190/476 (40%), Positives = 273/476 (57%), Gaps = 24/476 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++  P PAQ H+N MLKLA LL    FH+TF      H RL+     DS +    FR +
Sbjct  11    HVVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVNTEYNHRRLVKSRGPDSVKGLPGFRFE  70

Query  233   SFPPGI-YDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL----PFTCFISDLLV  397
             + P G+ +   + + +    LCDS R+      +  +++  DS      P +C +SD ++
Sbjct  71    TIPDGLPHSDDIEATQHIPSLCDSTRKTCLSPFRNLLSKLNDSSSSDTPPVSCIVSDGVM  130

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITK  562
             S  L  ++EC  +P   F   SAC F +Y   P L   G  P+K      NG   + I  
Sbjct  131   SFTLTAAQEC-GIPEVLFWTTSACGFMSYVHYPHLIHRGLTPLKDINYLTNGYLDTTIDW  189

Query  563   VKGMEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIR  730
             + G+   +R+RDL  F R  D D  +L +   E + A +A  +ILNTF+ LE  +L+ + 
Sbjct  190   IPGLVKDIRLRDLPSFLRTTDPDDIMLDFVKGEVQRAKKAEAIILNTFDALEHDVLNVLS  249

Query  731   TKYPNVYTIGPL---HAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSI  901
               +P VY+IGPL   H  +      KS  SN L QE   C+ WLDSQ+P SV+YV+FGSI
Sbjct  250   FMFPRVYSIGPLQLLHNQIPEN-GLKSIGSN-LWQEQPGCLDWLDSQKPNSVVYVNFGSI  307

Query  902   SVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAP  1081
             +V+T +QL+EF +GL NS   FLWV+R DLV G   + + +P +    T+  G +  W P
Sbjct  308   TVMTPEQLVEFAWGLANSNXTFLWVIRPDLVVG---DSALLPPKFITDTRERGLLASWCP  364

Query  1082  QEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKD  1261
             QE VL+H ++G FLTH+GWNST+ESI  GVPMICWPFFA+QQTN R+V   W +G+++  
Sbjct  365   QEQVLNHPSIGAFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYVCTEWGMGMEIDS  424

Query  1262  VCDRSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
                R  VE L++++ME  KG E  +R     K A+EA  + GSSY N D +I++++
Sbjct  425   NVKRDEVESLVKQIMEGEKGKEMKKRTLEWKKKAEEATYQDGSSYSNLDKMIKEVL  480



>ref|XP_008242286.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=474

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 198/470 (42%), Positives = 276/470 (59%), Gaps = 22/470 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H++IFP P Q H+  +L LA LL  A  H+TF V ++ + + LA  +  S  F T    +
Sbjct  7     HVVIFPFPLQGHIKPLLCLAELLCHAGLHVTF-VNTHPNHKHLANPEALSTHFPT-LHFE  64

Query  233   SFPPGIYDG---ALNSKEVFVELCDSLRRIGKPFLK--QYIAQNRDSGLP-FTCFISDLL  394
             S   G+ D    ALN  E+ + L  S+R   +  L+     A++ D+ +P   C I+D L
Sbjct  65    SISDGLPDDHPRALNG-ELLMALKTSIRPHFRELLETISLKAESNDASVPPLNCIITDGL  123

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             V+ A D++EE   +P+  +    A   WT   LPDL E G+LP   + + S  IT V GM
Sbjct  124   VTFAFDLAEE-LEIPILSYNVPCARYLWTCLCLPDLIEQGQLPFPDDDM-SVEITGVSGM  181

Query  575   EDFLRVRDLSPFCR--DEDLAVLYYTEARLAVQAR--GLILNTFEDLEGPILSQIRTKYP  742
             +  L  +DL  FCR    D   L +       Q R   LIL+T  +L+   LS +   +P
Sbjct  182   DGPLHRQDLPSFCRVKQTDHPALQFAITWTQAQRRSSALILDTVYELDASCLSHMALMFP  241

Query  743   NVYTIGPLHAHLKATLA--SKSTHSNS-LLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              +YT+GPLHA L A +   SKS  S+  L + D  CM WLD Q  +SVIYVSFG++  +T
Sbjct  242   KIYTLGPLHALLNAQIGNVSKSLASHGGLWKSDPNCMTWLDFQPSRSVIYVSFGTLVNLT  301

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
             R Q++EFWYGLVNS   F+WV+RSD++         IP+EL+ GTK  GYIV W  QE V
Sbjct  302   RAQIIEFWYGLVNSRHPFMWVIRSDIIYRAHQ----IPAELEIGTKERGYIVDWVSQEEV  357

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVGGFLTHSGWNSTLESI AG+PMICWP   D    SR V + WK+GL +K+ CDR
Sbjct  358   LAHKAVGGFLTHSGWNSTLESIVAGLPMICWPNLGDHYIISRTVSQKWKIGLQLKENCDR  417

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              ++E +I+ LM  ++ E     + + KLA++++ +GGSS+ N + LI+ +
Sbjct  418   CNIETMIQTLMGPKREEIQSSMDTISKLARDSVVKGGSSHNNLEQLIEHI  467



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 192/473 (41%), Positives = 266/473 (56%), Gaps = 21/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H++ MLKLA LL    FHITF      H RLL     +S      FR +
Sbjct  11    HAVCIPFPAQGHIDPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSG--LPFTCFISDLLVSIA  406
             + P G+      + +    LCDS R+   P+ ++ +++   S    P +C +SD  +   
Sbjct  71    TIPDGLPPTDAIATQDIPSLCDSTRKHSLPYFRELLSKLNSSPDCPPVSCVVSDGAMGFT  130

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  571
             LD ++E F LP   F   SAC F  Y       E G  P+K      NG   + I  + G
Sbjct  131   LDAAQE-FGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLKDASYLTNGYLETEIDWIPG  189

Query  572   MEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             M   +R++D+  F R  D D  +L +   E     +A  +ILNTF D E  +L  + T  
Sbjct  190   MRG-IRLKDIPSFIRTTDPDDIMLDFLVHETERTRKASAVILNTFHDFEHEVLDALSTLL  248

Query  740   PNVYTIGPLHAHLKATLAS---KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             P +Y+IGPLH  +    A    K   SN L  E+  C+ WLDS+EP SV+YV+FGSI+V+
Sbjct  249   PPIYSIGPLHLQINQIPADSELKEIRSN-LWTEEPECLEWLDSKEPNSVVYVNFGSITVM  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T +QL+EF +GL NS + F WV+R DLV G   + + +P E  E TK    +  W PQE 
Sbjct  308   TAEQLIEFAWGLANSNQTFFWVIRPDLVGG---DSAVVPPEFVEETKERSLLANWCPQEQ  364

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNSTLES+ AGVPMICWPFFA+QQTNSR+  + W +G++++    
Sbjct  365   VLSHSAVGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNSRYSEKEWGIGMEIERDVK  424

Query  1271  RSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
             R+ +E L+R+LME  +G E  ++A    KLA EA S  GSS+   D ++  ++
Sbjct  425   RNYIEGLVRKLMEGDEGKEMRKKALEWKKLATEATSPNGSSFVGLDKMVNQVL  477



>ref|XP_003544800.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=482

 Score =   334 bits (856),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 191/471 (41%), Positives = 279/471 (59%), Gaps = 19/471 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    FHITF      H RLL     DS    + FR +
Sbjct  11    HAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDS-GLPFTCFISDLLVSIAL  409
             + P G+ +  L++ +    LC++ RR   P  K  +A+  DS   P +C +SD +++  L
Sbjct  71    TIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDSDAPPVSCIVSDGVMTFTL  130

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGM  574
             D +EE   +P   F   SAC F  Y     L E    P+K      NG   + I  + G+
Sbjct  131   DAAEE-LGVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLKDSSYITNGYLETTIDWIPGI  189

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             ++ +R++D+  F R    DE +      E   A +A  +ILNTF+ LE  +L    +  P
Sbjct  190   KE-IRLKDIPSFVRTTNPDEFMLDFIQWECGRARRASAIILNTFDALEHDVLEAFSSILP  248

Query  743   NVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
              VY+IGPL+ H+K     + +   ++L +E+  C+ WLD+++P SV+YV+FGSI+V+T +
Sbjct  249   PVYSIGPLNLHVKHVDDKELNAIGSNLWKEESKCVEWLDTKQPSSVVYVNFGSIAVMTSE  308

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             QL+EF +GL NS K FLWV+R+DLVAG   E + +P E  + T+  G +  W  QE VL 
Sbjct  309   QLIEFAWGLANSNKNFLWVIRADLVAG---ENAVLPPEFVKQTENRGLLSSWCSQEQVLA  365

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H +VGGFLTHSGWNSTLES+  GVPMICWPFFA+QQTN RF  + W +GL+++DV +R  
Sbjct  366   HPSVGGFLTHSGWNSTLESMCGGVPMICWPFFAEQQTNCRFCCKDWGIGLEIEDV-EREK  424

Query  1280  VEKLIRELME-KRKGEFLERAENMGKLAKEAISEG-GSSYCNFDCLIQDMI  1426
             +E L+RELM+ ++  E  ++A    +LA+ A     GSS+ N D +++D++
Sbjct  425   IESLVRELMDGEKGKEMKKKALQWKELAESAAFRSVGSSFANLDNMVRDVL  475



>gb|EAZ03912.1| hypothetical protein OsI_26045 [Oryza sativa Indica Group]
Length=490

 Score =   334 bits (856),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 191/474 (40%), Positives = 255/474 (54%), Gaps = 29/474 (6%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              H+L+FP P Q HLN ML LA  L  A  H+TF   ++ + R L      +   +   R 
Sbjct  8     AHVLVFPWPIQGHLNVMLHLAVALAGAGVHVTFL-HTDYNLRRLGAAAAAA-VASPWLRF  65

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRD----------SGLPFTCF  379
              S   G+ D    +     E+  SL   G+   +  +A +            +  P T  
Sbjct  66    MSVTDGLPDDHPRTVANLGEISRSLHTAGRAAYRALLASSSQLVPADAAGGGAFPPVTTV  125

Query  380   ISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPIT  559
             ++D L+  A+DV+EE   +P   FR  SAC+F  Y S+P L E GELP    G    P+ 
Sbjct  126   VADALLPFAIDVAEE-LGVPALAFRTASACSFLAYMSVPRLVELGELPFPPGGDLDEPVR  184

Query  560   KVKGMEDFLRVRDLSPFCR------DEDLAVLYYTEARLAV---QARGLILNTFEDLEGP  712
              V GME FLR RDL   CR      ++D A L       AV   +AR LILNT   LE P
Sbjct  185   GVPGMEGFLRRRDLPSPCRHHGANNNDDAAALLGRLVDAAVHCSKARALILNTAASLEAP  244

Query  713   ILSQIRTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSF  892
              L+ I  +  +V+ +GPLHA   A  A+      SL + D+ CMAWLD Q  +SV+YVS 
Sbjct  245   ALAHIAPRMRDVFAVGPLHAMSPAPAAA-----TSLWRADDGCMAWLDCQADRSVVYVSL  299

Query  893   GSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVG  1072
             GS++VI+ +Q  EF  GLV +G  FLWV+R D+V  +        S       +   +VG
Sbjct  300   GSLTVISPEQFTEFLSGLVAAGNPFLWVLRPDMVTARRRHADLQESVTAAAGDSKARVVG  359

Query  1073  WAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLD  1252
             WAPQ  VL H AVG FLTH+GWNSTLE+   GVP +CWPFF DQQ NSR VG VW+ GLD
Sbjct  360   WAPQRDVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFVDQQINSRLVGAVWRTGLD  419

Query  1253  MKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             MKDVCD + V +++RE ME   GE    A+++ +  +  ++EGGSS      L+
Sbjct  420   MKDVCDAAVVARMVREAME--SGEIRASAQSVARQLRRDVAEGGSSAMELKRLV  471



>gb|AFK33787.1| unknown [Medicago truncatula]
Length=480

 Score =   333 bits (855),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 192/475 (40%), Positives = 273/475 (57%), Gaps = 21/475 (4%)
 Frame = +2

Query  47    IGHILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTTRF  223
             + H++  P PAQ H+N MLKLA LL     FH+TF      H RLL     +S      F
Sbjct  10    LSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSF  69

Query  224   RLQSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ--NRDSGLPFTCFISDLLV  397
             R ++ P G+ +  ++  +    LC+S R    P  K+ +++  N     P TC +SD  +
Sbjct  70    RFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPVTCIVSDGCM  129

Query  398   SIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITK  562
             S  LD ++E  N+P   F   SAC F  Y     L E G  P+K      NG   + I  
Sbjct  130   SFTLDAAQE-LNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYITNGYLETTIDW  188

Query  563   VKGMEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIR  730
             V G+++ +R++D+  F R    ++ +      E + A +A  +I NTF++LE  +L    
Sbjct  189   VPGIKE-IRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNLEHDVLEAFS  247

Query  731   TKYPNVYTIGPLHAHLK-ATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             +  P VY+IGPLH  +K  T     +  ++L +E+  C+ WL+S+EP SV+YV+FGSI+V
Sbjct  248   SILPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYVNFGSITV  307

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +T +Q++EF +GL NS   FLWV+R DLVAG   E + +P E  E TK  G +  W PQE
Sbjct  308   MTSEQMIEFAWGLSNSKMPFLWVIRPDLVAG---ENAVLPLEFLEETKNRGLLSSWCPQE  364

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H ++GGFLTH+ WNSTLES+  GVPMICWPFFA+QQTN RF    W +GL+++D  
Sbjct  365   EVLGHSSIGGFLTHNDWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEIEDA-  423

Query  1268  DRSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAIS-EGGSSYCNFDCLIQDMI  1426
              R  +E L++ELME  KG E  E+A    KLA  A S   GSS+ N + LI D++
Sbjct  424   KRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVL  478



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   333 bits (854),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 268/473 (57%), Gaps = 21/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    F+ITF      H RLL     +S      FR +
Sbjct  11    HAVCIPFPAQGHINPMLKLAKLLHYKGFYITFVNTEFNHKRLLKSRGPNSLDGLPSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ-NRDSGLP-FTCFISDLLVSIA  406
             + P G+     N+ +    LC+S R+   P+ +  +++ N  +G P  +C +SD ++S  
Sbjct  71    TIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSSTGCPPVSCIVSDGVMSFT  130

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  571
             LD + E   +P   F   SAC    Y     L E G  P+K      NG   + I  + G
Sbjct  131   LDAAHE-LGIPEVLFWTTSACGLLAYVHYHRLIEKGLTPLKDASYLTNGYLETEIDWIPG  189

Query  572   MEDFLRVRDLSPFCR--DEDLAVLYYT--EARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             M   +R++D+  F R  D D  +L +   E     +A  ++LNTF DLE   L  + T  
Sbjct  190   MRG-IRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVLLNTFHDLEHEALDALSTLL  248

Query  740   PNVYTIGPLHAHLKATLAS---KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             P +Y+IGPLH  +    A    K   SN L  E+  C+ WLDS+EP SV+YV+FGSI+V+
Sbjct  249   PPIYSIGPLHLQINQIPADSELKEIRSN-LWTEEPECLEWLDSKEPNSVVYVNFGSITVM  307

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T +QL+EF +GL +S + F WV+R DLV G   + + +P E  E TK    +  W PQE 
Sbjct  308   TAEQLIEFAWGLASSNQTFFWVIRPDLVGG---DSAVVPPEFVEETKERSLLAHWCPQEQ  364

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H AVGGFLTHSGWNST+ES+ AGVPMICWPFFA+QQTN R+  + W +G+++K    
Sbjct  365   VLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVK  424

Query  1271  RSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
             R+ +E L+R+LME  +G +  ++A    KLAKEA S  GSS+   D +I  ++
Sbjct  425   RNYIEGLVRKLMEGEEGKDMRKKALEWKKLAKEATSPNGSSFVPLDKMINQVL  477



>emb|CBI31568.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   328 bits (842),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 221/351 (63%), Gaps = 41/351 (12%)
 Frame = +2

Query  341   AQNRDSGLPFTCFISDLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGEL  520
              Q  D+  P +C I+D ++S  +D++ E   +P+  FR +SAC+FW YFS   L E+GEL
Sbjct  5     GQGSDTRPPVSCIIADGMMSFTIDIANE-VGIPIISFRTVSACSFWAYFSALKLIESGEL  63

Query  521   PIKGNGIDSSPITKVKGMEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILN  688
             P+KGN +D   +T + GME FLR RDL    R    D++  +L   E +   +A  LILN
Sbjct  64    PLKGNDMDQL-VTSIPGMEGFLRKRDLPSLLRVSNLDDEGLLLVTKETQQTPRAHALILN  122

Query  689   TFEDLEGPILSQIRTKYPNVYTIGPLHAHLKATLASKST---HSNSLLQEDETCMAWLDS  859
             TFEDLEGPIL QIR   P  YTIGPLHAHLK  LAS+ST    SNS  QED +C+AWLD 
Sbjct  123   TFEDLEGPILGQIRNHCPKTYTIGPLHAHLKTRLASESTTSQSSNSFRQEDRSCIAWLDH  182

Query  860   QEPKSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELK  1039
             Q  KSVIYVSFGS+ VI+R+QL+EF YGLVNS  +FLWV+R+D +A ++D E   P+EL 
Sbjct  183   QPSKSVIYVSFGSMVVISRKQLIEFCYGLVNSSSRFLWVIRTDSLA-EEDGEHQTPAELM  241

Query  1040  EGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSR  1219
             EG K   YIV WAPQE VL H AVGGFLTHS                             
Sbjct  242   EGAKERSYIVEWAPQEEVLAHPAVGGFLTHS-----------------------------  272

Query  1220  FVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAI  1372
               G VWK+G DMKD CDR  VEK++R+LME+RK E LE A+ M   A++ +
Sbjct  273   --GHVWKLGSDMKDTCDRLIVEKMVRDLMEERKDELLETADMMATRARKCL  321



>gb|KHN42553.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=482

 Score =   333 bits (853),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 191/471 (41%), Positives = 278/471 (59%), Gaps = 19/471 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    FHITF      H RLL     DS    + FR +
Sbjct  11    HAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLP-FTCFISDLLVSIAL  409
             + P G+ +  L++ +    LC++ RR   P  K  +A+  DS  P  +C +SD +++  L
Sbjct  71    TIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDSDAPPVSCIVSDGVMTFTL  130

Query  410   DVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGM  574
             D +EE   +P   F   SAC F  Y     L E    P+K      NG   + I  + G+
Sbjct  131   DAAEE-LGVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLKDSSYITNGYLETTIDWIPGI  189

Query  575   EDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             ++ +R++D+  F R    DE +      E   A +A  +ILNTF+ LE  +L    +  P
Sbjct  190   KE-IRLKDIPSFVRTTNPDEFMLDFIQWECGRARRASAIILNTFDALEHDVLEAFSSILP  248

Query  743   NVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
              VY+IGPL+ H+K     + +   ++L +E+  C+ WLD+++P SV+YV+FGSI+V+T +
Sbjct  249   PVYSIGPLNLHVKHVDDKELNAIGSNLWKEESKCVEWLDTKQPSSVVYVNFGSIAVMTSE  308

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             QL EF +GL NS K FLWV+R+DLVAG   E + +P E  + T+  G +  W  QE VL 
Sbjct  309   QLSEFAWGLANSNKNFLWVIRADLVAG---ENAVLPPEFVKQTENRGLLSSWCSQEQVLA  365

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H +VGGFLTHSGWNSTLES+  GVPMICWPFFA+QQTN RF  + W +GL+++DV +R  
Sbjct  366   HPSVGGFLTHSGWNSTLESMCGGVPMICWPFFAEQQTNCRFCCKDWGIGLEIEDV-EREK  424

Query  1280  VEKLIRELME-KRKGEFLERAENMGKLAKEAISEG-GSSYCNFDCLIQDMI  1426
             +E L+RELM+ ++  E  ++A    +LA+ A     GSS+ N D +++D++
Sbjct  425   IESLVRELMDGEKGKEMKKKALQWKELAESAAFRSVGSSFANLDNMVRDVL  475



>gb|ACJ84649.1| unknown [Medicago truncatula]
Length=480

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 272/473 (58%), Gaps = 21/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
             H++  P PAQ H+N MLKLA LL     FH+TF      H RLL     +S      FR 
Sbjct  12    HVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRF  71

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ--NRDSGLPFTCFISDLLVSI  403
             ++ P G+ +  ++  +    LC+S R    P  K+ +++  N     P TC +SD  +S 
Sbjct  72    ETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPVTCIVSDGCMSF  131

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVK  568
              LD ++E  N+P   F   SAC F  Y     L E G  P+K      NG   + I  V 
Sbjct  132   TLDAAQE-LNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYITNGYLETTIDWVP  190

Query  569   GMEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTK  736
             G+++ +R++D+  F R    ++ +      E + A +A  +I NTF++LE  +L    + 
Sbjct  191   GIKE-IRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNLEHDVLEAFSSI  249

Query  737   YPNVYTIGPLHAHLK-ATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              P VY+IGPLH  +K  T     +  ++L +E+  C+ WL+S+EP SV+YV+FGSI+V+T
Sbjct  250   LPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYVNFGSITVMT  309

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
              +Q++EF +GL NS   FLWV+R DLVAG   E + +P E  E T+  G +  W PQE V
Sbjct  310   SEQMIEFAWGLSNSKMPFLWVIRPDLVAG---ENAVLPLEFLEETQNRGLLSSWCPQEEV  366

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H ++GGFLTH+GWNSTLES+  GVPMICWPFF +QQTN RF    W +GL+++D   R
Sbjct  367   LGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGLEIEDA-KR  425

Query  1274  SSVEKLIRELMEKRKG-EFLERAENMGKLAKEAIS-EGGSSYCNFDCLIQDMI  1426
               +E L++ELME  KG E  E+A    KLA  A S   GSS+ N + LI D++
Sbjct  426   DKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVL  478



>gb|EMT06489.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=461

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 198/465 (43%), Positives = 259/465 (56%), Gaps = 39/465 (8%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP P Q H+N ML L   L  A F +TF    +  +RL A   +  G      RL 
Sbjct  6     HVLVFPWPLQGHINCMLHLTAALLDAGFRVTFLHTEHNLSRL-ARAALPPG-----LRLL  59

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDS--GLPFTCFISDLLVSIA  406
             S P G+ D    S     EL +S+   G    +  +   R      P TC I+D ++  A
Sbjct  60    SVPDGLPDDHPRSVRSLKELTESMFTTGSAAYRALLLSLRSDSDAPPLTCVIADGIMPFA  119

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFL  586
             +D++EE   +P   FR  SAC++  Y S+P L E GE+P   +     P+  V GME FL
Sbjct  120   VDIAEE-LGVPALAFRTASACSYLAYLSVPTLVELGEVPFPAD----DPVRGVPGMEGFL  174

Query  587   RVRDL-SPFCRDEDLA----VLYYTEA-RLAVQARGLILNTFEDLEGPILSQIRTKYPNV  748
             R RDL     R ED A    +L   E    A +AR LILNT   +EGP L++I     ++
Sbjct  175   RRRDLPRGVGRSEDGAFDPMLLAIAEGIAHAGKARALILNTAASMEGPALARIAPHMRDL  234

Query  749   YTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLM  928
             + IGPLHA   A        + SL  ED++CMAWLD    +SV+YVS GS++VI+ +Q  
Sbjct  235   FAIGPLHAEHDA--------AASLWSEDDSCMAWLDGHGDRSVVYVSLGSLAVISHEQFT  286

Query  929   EFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANG---YIVGWAPQEAVLD  1099
             EF  GLV +G  FLWV+R D+V           S L+E  K  G    +V WAPQ  VL 
Sbjct  287   EFLAGLVATGYAFLWVLRPDMVKTTG-------SVLREAVKEAGSKARVVEWAPQRGVLR  339

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H AVG FLTH GWNSTLE+ A GVPM+CWPFFADQQ NSRFVG VW+ GLDMKD+C+R+ 
Sbjct  340   HRAVGCFLTHGGWNSTLEAAAEGVPMVCWPFFADQQINSRFVGAVWRTGLDMKDLCNRAI  399

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             V+  +RE ME   GE   RA  M +  K  ++ GGSS  + + L+
Sbjct  400   VQGKVREAME--SGELRGRAHAMAQQLKLDVAVGGSSSSDLERLV  442



>ref|NP_001059664.1| Os07g0486700 [Oryza sativa Japonica Group]
 dbj|BAF21578.1| Os07g0486700 [Oryza sativa Japonica Group]
Length=492

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 190/474 (40%), Positives = 260/474 (55%), Gaps = 29/474 (6%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              H+L+FP P   H+  ML  A  L  A  H+TF    +   R  A +       + R R 
Sbjct  10    AHVLMFPCPVHGHITCMLHFATGLLAAGLHVTFLHSDHNLRRAAAAS-------SPRLRY  62

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIG----KPFLKQYIAQNRDSGLP-FTCFISDLL  394
              S P G+           VEL +SL+       +  L   +  +   G P  TC ++D +
Sbjct  63    VSIPDGLPVEHPRDVGRIVELMESLKTKASVAYRSLLASLLLGDATGGFPPVTCVVADGI  122

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIK-GNGIDSSPITKVKG  571
             +S A+DV+EE   +P   FR  SAC+F  Y SLP L E GELP K G+ +D  P+  V G
Sbjct  123   MSFAVDVAEE-LGIPALAFRTDSACSFLAYLSLPRLLELGELPFKDGDDLDE-PVRGVPG  180

Query  572   MEDFLRVRDLSPFCRD------EDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRT  733
             ME FLR RDL   CRD      + L  + Y     +  AR L+LNT   +E   L+ I  
Sbjct  181   MESFLRRRDLPSQCRDCSDPDNDPLLQIVYGFTAHSGNARALVLNTAASMERAALAHIAP  240

Query  734   KYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
                +V+ IGPLHA      A+      SL +ED+ C+AWLD Q   SV+YVS GS++VI+
Sbjct  241   HMRDVFAIGPLHAMSPTAPAA----GGSLWREDDGCLAWLDGQADGSVVYVSLGSLTVIS  296

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
              +Q  EF +GLV +G  FLWV+R D+V                 +KA   +V WAPQ  V
Sbjct  297   LEQFTEFLHGLVAAGYPFLWVLRPDMVGASQSAALREAVAAAGKSKAR--VVEWAPQRGV  354

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVG FLTH+GWNSTLE+   GVPM+CWPFF DQQ NSRFVG VW+ GLDMKDVCD 
Sbjct  355   LRHRAVGCFLTHAGWNSTLEAAVEGVPMVCWPFFTDQQINSRFVGGVWRTGLDMKDVCDA  414

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             + V +++RE ME   G+    A+ + +  +  +++GGSS   F  L++ +++++
Sbjct  415   AVVARMVREAME--SGQIRASAQALAREVRRDVADGGSSTAEFKRLVEFIVELS  466



>dbj|BAC57706.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
Length=485

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 190/474 (40%), Positives = 260/474 (55%), Gaps = 29/474 (6%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              H+L+FP P   H+  ML  A  L  A  H+TF    +   R  A +       + R R 
Sbjct  10    AHVLMFPCPVHGHITCMLHFATGLLAAGLHVTFLHSDHNLRRAAAAS-------SPRLRY  62

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIG----KPFLKQYIAQNRDSGLP-FTCFISDLL  394
              S P G+           VEL +SL+       +  L   +  +   G P  TC ++D +
Sbjct  63    VSIPDGLPVEHPRDVGRIVELMESLKTKASVAYRSLLASLLLGDATGGFPPVTCVVADGI  122

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIK-GNGIDSSPITKVKG  571
             +S A+DV+EE   +P   FR  SAC+F  Y SLP L E GELP K G+ +D  P+  V G
Sbjct  123   MSFAVDVAEE-LGIPALAFRTDSACSFLAYLSLPRLLELGELPFKDGDDLDE-PVRGVPG  180

Query  572   MEDFLRVRDLSPFCRD------EDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRT  733
             ME FLR RDL   CRD      + L  + Y     +  AR L+LNT   +E   L+ I  
Sbjct  181   MESFLRRRDLPSQCRDCSDPDNDPLLQIVYGFTAHSGNARALVLNTAASMERAALAHIAP  240

Query  734   KYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
                +V+ IGPLHA      A+      SL +ED+ C+AWLD Q   SV+YVS GS++VI+
Sbjct  241   HMRDVFAIGPLHAMSPTAPAA----GGSLWREDDGCLAWLDGQADGSVVYVSLGSLTVIS  296

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
              +Q  EF +GLV +G  FLWV+R D+V                 +KA   +V WAPQ  V
Sbjct  297   LEQFTEFLHGLVAAGYPFLWVLRPDMVGASQSAALREAVAAAGKSKAR--VVEWAPQRGV  354

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H AVG FLTH+GWNSTLE+   GVPM+CWPFF DQQ NSRFVG VW+ GLDMKDVCD 
Sbjct  355   LRHRAVGCFLTHAGWNSTLEAAVEGVPMVCWPFFTDQQINSRFVGGVWRTGLDMKDVCDA  414

Query  1274  SSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIKVN  1435
             + V +++RE ME   G+    A+ + +  +  +++GGSS   F  L++ +++++
Sbjct  415   AVVARMVREAME--SGQIRASAQALAREVRRDVADGGSSTAEFKRLVEFIVELS  466



>gb|KHG03787.1| hypothetical protein F383_26945 [Gossypium arboreum]
Length=314

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/299 (54%), Positives = 204/299 (68%), Gaps = 9/299 (3%)
 Frame = +2

Query  554   ITKVKGMEDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILS  721
             IT V GME +LR RDL   CR  D+      L   + R ++QA  LILNT E+L+GPILS
Sbjct  6     ITTVPGMETYLRCRDLPTICRKLDIEDSIIKLVVKQTRKSLQADALILNTAEELDGPILS  65

Query  722   QIRTKYPNVYTIGPLHAHLKATLASKSTHS-----NSLLQEDETCMAWLDSQEPKSVIYV  886
             QIRTK P VY +GPLHA     L +K   S     N+L + D++C+ WL+ Q  +SVIYV
Sbjct  66    QIRTKCPLVYAVGPLHAQFNTRLNAKHGESYDHFSNTLWEVDKSCIFWLNKQPNRSVIYV  125

Query  887   SFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYI  1066
             SFGSI+  +R+QL++ WYGL+NS  KFL V+R + V GKD E   +  EL E +K  GYI
Sbjct  126   SFGSITSTSREQLVKLWYGLLNSKTKFLIVVRPNSVIGKDGEGEDVVMELMEKSKDRGYI  185

Query  1067  VGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVG  1246
             V WAPQE VL H A+GGF TH+GWNSTLES+ AGVPMICWP FADQ  NSR V EVW++G
Sbjct  186   VNWAPQEEVLSHPAIGGFFTHNGWNSTLESVVAGVPMICWPQFADQHVNSRVVSEVWEIG  245

Query  1247  LDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             +DMKDVCD   VEK++ ++M  RK EF + A  M K+  + ++ GGSSY N D LI+D+
Sbjct  246   MDMKDVCDSKIVEKMVNDVMVDRKEEFAKSAYEMAKVTNQCVNVGGSSYSNLDRLIEDI  304



>ref|XP_009413574.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=475

 Score =   332 bits (850),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 197/474 (42%), Positives = 270/474 (57%), Gaps = 25/474 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVD-SGRFTTRFRL  229
             H ++ P PAQ H+N  LKLA LL    FHITF      H RL      D +      FR 
Sbjct  10    HAVVVPFPAQGHINPHLKLAKLLHARGFHITFVNTEYNHRRLTLSRGPDWATAGLDGFRF  69

Query  230   QSFPPGIYDGA-LNSKEVFVELCDSLRRIG-KPFLKQYIAQNRDSGLP-FTCFISDLLVS  400
             ++ P G+   +  N+ +    LC S R     PF       +R + +P  TC +SD  +S
Sbjct  70    ETIPDGLPPSSDENNTQDVPALCASTRATCLAPFRDLMARLSRAADVPPVTCIVSDGAMS  129

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKV  565
               +D   E F +PV  F   SAC  W+YF   +L   G  P+K      NG   +PI  +
Sbjct  130   FTVD---EDFGVPVLLFFTHSACGCWSYFHFGELVRRGYTPLKDESFLTNGYLDTPIDWI  186

Query  566   KGMEDFLRVRDLSPFCRDED-----LAVLYYTEARLAVQARGLILNTFEDLEGPILSQIR  730
              G+E+ +R RDL  F R  D     L+++    A  A QA G+ILNTF+DLEGP+L +IR
Sbjct  187   VGLEN-IRFRDLPSFVRTTDPDDVMLSIMARRAAHDAPQAAGIILNTFDDLEGPVLYRIR  245

Query  731   TKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVI  910
             +K+PN+Y++GP+ +   AT A  S   N L +ED  C+ WLD Q   SV+YV+FGSI+V+
Sbjct  246   SKFPNLYSVGPVSS--IATTAFTSISGN-LWKEDTECIKWLDDQADGSVLYVNFGSITVV  302

Query  911   TRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEA  1090
             T +QL+EF +GL  SG  FLWV+R D+V G   E + +P E     +  G +VGW  QE 
Sbjct  303   TAEQLLEFAWGLARSGYPFLWVVRPDMVRG---EAAVLPEEFAAEVEGRGLLVGWCNQEE  359

Query  1091  VLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCD  1270
             VL H A   FL+H GWNSTLESI+ GVPMICWPFFA+QQTN R++   W +G ++     
Sbjct  360   VLSHPATAVFLSHCGWNSTLESISEGVPMICWPFFAEQQTNCRYLCTKWGMGTEIGSNAR  419

Query  1271  RSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMIK  1429
             R  VE  IRE+M   KG E  +RA    + A++AI  GGSS  N + L++++ +
Sbjct  420   RGEVEGCIREVMTGDKGREMRKRALEWKERARKAIGPGGSSSVNLERLVEELTR  473



>ref|XP_004299647.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 188/475 (40%), Positives = 273/475 (57%), Gaps = 23/475 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    FHITF      H RLL     +S      F  +
Sbjct  9     HAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRLLKSRGPNSLDGLPSFTFE  68

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ-NRDSGLP-FTCFISDLLVSIA  406
             + P G+     N+ +  + LC S R    P  +  +++ N  S +P  +C +SD ++S  
Sbjct  69    TIPDGLPPTDANATQDILSLCVSTRTKCLPHFRDLLSKLNSSSNIPPVSCIVSDGVMSFT  128

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  571
             ++ ++E   +P   F   SAC F  Y    +L + G +P+K      NG   + I  + G
Sbjct  129   VEAAQE-LGIPEVLFWTTSACGFMGYMQYQNLIDEGLIPLKDASCLTNGYLETEIDWLPG  187

Query  572   MEDFLRVRDLSPFCRDED----LAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKY  739
             M   +R+RDL  F R  D    +      E   A +A  +ILNT +DLE  +L  ++   
Sbjct  188   MRG-IRLRDLPAFIRTTDPEDGMMKTMLIETERAKRASAIILNTIDDLEHEVLDALKNLL  246

Query  740   PNVYTIGPLHAHLKATLAS----KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
             P +Y+IGPLH  L    +     KS  SN L +++  C+ WLDS+ P SV+YV+FGSI+V
Sbjct  247   PPIYSIGPLHLQLDQVQSEGTDLKSIQSN-LWKDEPECLEWLDSRAPNSVVYVNFGSITV  305

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +T +QL+EF +GL NS K FLWV+R DLV G   E + +P E  E TK    +  W PQE
Sbjct  306   MTSEQLIEFAWGLANSSKTFLWVIRPDLVGG---ESAVVPPEFVEETKERSLLTTWCPQE  362

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL+H A+GGFLTHSGWNSTLES+ AGVPM+CWPFFA+QQTN R+  + W +G++++   
Sbjct  363   QVLNHPAIGGFLTHSGWNSTLESVCAGVPMLCWPFFAEQQTNCRYCCKEWGIGMEIEGDV  422

Query  1268  DRSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAIS-EGGSSYCNFDCLIQDMI  1426
              RS++E+L+ +LME  +G E  ++A    KLAKEA +   G S+ + D ++ +++
Sbjct  423   HRSNIEELVTKLMEGEEGKEMRKKAMEWKKLAKEAATGPNGLSFLDLDKMVNEVL  477



>ref|XP_003526577.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
 gb|KHN08945.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   332 bits (850),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 201/473 (42%), Positives = 270/473 (57%), Gaps = 22/473 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+  MLKLA +L    FHITF      H RLL     DS      FR +
Sbjct  13    HAVCIPYPAQGHITPMLKLAKVLHFKGFHITFVNTEFNHKRLLKSRGADSLNGFPSFRFE  72

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIG-KPFLKQYIAQNRDSGLP-FTCFISDLLVSIA  406
             + P G+ +  +++ +    LC+SLR+    PF       N    +P  +C +SD ++S  
Sbjct  73    TIPDGLPESDVDATQDTPTLCESLRKTCLVPFRNLLAKLNHSRHVPPVSCIVSDGVMSFT  132

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  571
             L  SEE   +P  +F  ISAC    Y     L + G +P+K      NG   + I  + G
Sbjct  133   LIASEE-LGIPEVFFWTISACGLLCYLHNGQLVKKGLVPLKDSSYMTNGYLETAIDWLPG  191

Query  572   MEDFLRVRDLSPFCRDED-----LAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTK  736
             +++ L +RD   F R  D     L VL     R A  A  +ILNTFE LE  +L  + + 
Sbjct  192   IKEIL-LRDFPSFFRTIDPHDIMLQVLQEECGR-AKHASAIILNTFEALEHDVLEALSSM  249

Query  737   YPNVYTIGPLHAHLK-ATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              P VY IGPL   L   T     T  ++L +ED  C+ WLD+ EPKSVIYV+FGSI+V+T
Sbjct  250   LPPVYPIGPLTLLLNHVTDEDLKTIGSNLWKEDRECLKWLDTNEPKSVIYVNFGSITVMT  309

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
               QL+EF +GL NSGK FLWV+R DLV    DE + +P E    TK  G + GW PQE V
Sbjct  310   NHQLIEFAWGLANSGKTFLWVIRPDLV----DENTILPYEFVLETKDRGQLSGWCPQEEV  365

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H A+GGFLTHSGWNST+ES+  GVPMICWPFFA+Q TN RF  + W VG+ ++    R
Sbjct  366   LAHPAIGGFLTHSGWNSTIESLCNGVPMICWPFFAEQPTNCRFCCKEWGVGMQIEGDVTR  425

Query  1274  SSVEKLIRELMEKRKG-EFLERAENMGKLAKEA-ISEGGSSYCNFDCLIQDMI  1426
               VE+L+RELME +KG E   +A    KLA++A I + GSS+ N+D +++ ++
Sbjct  426   DRVERLVRELMEGQKGKELTMKALEWKKLAEDATILKEGSSFLNYDNMVRQVL  478



>ref|XP_009380209.1| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetin glucosyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=485

 Score =   330 bits (847),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 188/470 (40%), Positives = 265/470 (56%), Gaps = 18/470 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+  MLKLA LL    FH+TF      H RL+    + +      FR  
Sbjct  10    HAVCVPYPAQGHITPMLKLAKLLHSHGFHVTFVNTLFNHKRLIRSRAISALHALPSFRFA  69

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALD  412
             S P G+     ++ +    LC+++ R   P  +  + Q  +   P +C +SD +++  LD
Sbjct  70    SIPDGLPPSDEDATQDIPSLCEAIPRTALPPFRHVLRQLNEESPPVSCIVSDGVMTFTLD  129

Query  413   VSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSS-----PITKVKGME  577
              ++E   +P   F   SAC F  Y     L E G  P+K  G  +S     P+  + G  
Sbjct  130   AAQE-LGVPEVVFWTTSACGFMGYLHYQHLRERGLTPLKDEGDITSGYLDMPVDWIPGF-  187

Query  578   DFLRVRDLSPFCRD---EDLAVLYYT-EARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
             D +R+RD   F R    +D+ + + T EA+ A  A  +ILNTFE+LE P+L  + +  P 
Sbjct  188   DNMRLRDFPSFIRTTDPKDVMLNFCTREAQRASMASAVILNTFEELERPVLEAMASILPA  247

Query  746   VYTIGPLH--AHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             VYT+GPL   +   A     S HSN L +ED  CM WL+ + P SV+YV+FGSI+V++  
Sbjct  248   VYTVGPLTLLSQRVADSPLTSIHSN-LWKEDSGCMEWLEGRRPGSVVYVNFGSITVMSNT  306

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             QL+EF +GL NSG  FLWV+R DLV G   + + +P E  E TK  G +  W PQEAVL 
Sbjct  307   QLLEFAWGLANSGYDFLWVIRPDLVRG---DAAVLPQEFVEETKERGLLASWCPQEAVLS  363

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H +VGGFLTHSGWNST+ESI+ GVPM+ WPFFA+QQTN R+    W + +++ +   R  
Sbjct  364   HASVGGFLTHSGWNSTIESISGGVPMLSWPFFAEQQTNCRYACTEWGIAMEIDNDVKREE  423

Query  1280  VEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
             VE LIR+LM   KG E  ++     + A  A   GGSS+ N + LI+D++
Sbjct  424   VEALIRKLMGGDKGKEMRKKTMEWNEKAMRATQPGGSSFVNLERLIKDVM  473



>ref|XP_003546715.1| PREDICTED: UDP-glycosyltransferase 85A3 [Glycine max]
Length=478

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 197/479 (41%), Positives = 276/479 (58%), Gaps = 19/479 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL +  FHITF      H RLL     DS      F+ +
Sbjct  5     HAVCIPYPAQGHINPMLKLAKLLHVRGFHITFVNTEYNHKRLLKSRGSDSLNSVPSFQFE  64

Query  233   SFPPGIYDGA-LNSKEVFVELCDSLRRIG-KPFLKQYIAQNRDSGLP-FTCFISDLLVSI  403
             + P G+ D   +++ +  V L +S RR    PF       N  S  P  TC +SD  +S 
Sbjct  65    TIPDGLSDNPDVDATQDVVSLSESTRRTCLTPFKNLLSKLNSASDTPPVTCIVSDSGMSF  124

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
              LD ++E   +P  +    SAC +  Y   P L + G   +K +    + I  V G+++ 
Sbjct  125   TLDAAQE-LGIPDVFLSTASACGYMCYMKYPRLVDMGLTHLKDSSYLENSIDWVPGIKE-  182

Query  584   LRVRDLSPFCRD---EDLAVL--YYTEARLAVQARGLILNTFEDLEGPILSQIRT-KYPN  745
             +R++DL  F R    +DL ++   Y++   A +A  +I+NTF+ LE  +L    +   P 
Sbjct  183   IRLKDLPSFMRTTNPQDLMMMDFIYSQCERAQKASAIIVNTFDALEHDVLDAFSSILLPP  242

Query  746   VYTIGPLHAHLKATLASK---STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             +Y+IGPL+  L   + +     T  ++L +E+  C+ WL+S+EP SV+YV+FGSI V+T 
Sbjct  243   IYSIGPLNLLLNNDVTNNEELKTIGSNLWKEEPKCLEWLNSKEPNSVVYVNFGSIMVMTS  302

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
              QL E  +GL NS K FLWV+R DLVAG+ +    +P+E  + TK  G +  W PQE VL
Sbjct  303   DQLTELAWGLANSNKNFLWVIRPDLVAGEIN--CALPNEFVKETKDRGMLASWCPQEEVL  360

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H AVGGFLTH GWNSTLES+  GVPM+CWPFFA+QQTN RF  + W +GL+++DV  R 
Sbjct  361   AHPAVGGFLTHCGWNSTLESVCEGVPMLCWPFFAEQQTNCRFCCKEWGIGLEIEDV-KRE  419

Query  1277  SVEKLIRELMEKRKG-EFLERAENMGKLAKEAISE-GGSSYCNFDCLIQDMIKVNEATR  1447
              VE L+RELME  KG E  ERA    KLA EA S   GSS+ N D +++ ++    AT+
Sbjct  420   KVEALVRELMEGEKGKEMKERALEWKKLAHEAASSPHGSSFVNMDNVVRQVLMNKIATK  478



>ref|XP_008242262.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=456

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 190/456 (42%), Positives = 265/456 (58%), Gaps = 22/456 (5%)
 Frame = +2

Query  89    LNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSFPPGIYDG---  259
             +  +L LA LL  A  H T+  P   H RL A     S  F T    +S   G+ +    
Sbjct  1     MKPLLCLAELLCHAGLHATYVNPPPTHQRL-ANRQALSTHFPT-LHFESISDGLPEDDPR  58

Query  260   ALNSKEVFVELCDSLRRIGKPFLK--QYIAQNRDSGLPF-TCFISDLLVSIALDVSEECF  430
              LNS ++ + L  S+R   +  LK     A++ D+ +P  +C ++D LV+ A DV+EE  
Sbjct  59    TLNS-QLLIALKTSIRPHFRELLKTISLKAESNDALVPPPSCIVTDGLVTFAFDVAEE-L  116

Query  431   NLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPF  610
              LP+  +        WT   LP L E G+LP + + ++   IT V GME  LR +DL  F
Sbjct  117   GLPILSYNVPCPRYLWTCLCLPKLIENGQLPFQDDDMNVE-ITGVPGMEGLLRRQDLPGF  175

Query  611   CR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHL  778
             CR    D         E +   ++  LIL+T  +L+ P +S +   +P +YT+GPLHA L
Sbjct  176   CRVKQADHPSLQFAINETQTLKRSSALILDTVYELDAPCISHMALTFPKIYTLGPLHALL  235

Query  779   KATLASKS---THSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLV  949
              + +   S       SL + D  CM WLDSQ  KSVIYVSFG++  +T  Q++EFWYGLV
Sbjct  236   NSQIGDMSRGLASHGSLWKSDLNCMTWLDSQPSKSVIYVSFGTLVHLTHAQVIEFWYGLV  295

Query  950   NSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTH  1129
             NSG  FLWVMRSD+ +G    +  IP+EL++GTK  GYIV W  QE VL H +VGGFLTH
Sbjct  296   NSGHPFLWVMRSDITSG----DHQIPAELEKGTKERGYIVDWVSQEEVLAHKSVGGFLTH  351

Query  1130  SGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELME  1309
             SGWNSTLESI AG+PMICWP   D    SR V   WK+GL + + CDRS++E +++ LM 
Sbjct  352   SGWNSTLESIVAGLPMICWPNLGDHYIISRTVCRQWKIGLQLNENCDRSNIESMVQTLMG  411

Query  1310  KRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQ  1417
              ++ E     + + KLA+++++EGGSS+ N + LI+
Sbjct  412   PKREEIQSSMDAISKLARDSVAEGGSSHNNLEQLIE  447



>gb|AFK37311.1| unknown [Medicago truncatula]
Length=480

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 189/472 (40%), Positives = 269/472 (57%), Gaps = 21/472 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDL-ANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
             H++  P PAQ H+N MLKLA LL     FH+TF      H RLL     +S      FR 
Sbjct  12    HVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGPNSLNGLPSFRF  71

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ--NRDSGLPFTCFISDLLVSI  403
             ++ P G+ +  ++  +    LC+S R    P  K+ +++  N     P TC +SD  +S 
Sbjct  72    ETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPVTCIVSDGCMSF  131

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVK  568
              LD ++E  N+P   F   SAC F  Y     L E G  P+K      NG   + I  V 
Sbjct  132   TLDAAQE-LNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYITNGYLETTIDWVP  190

Query  569   GMEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTK  736
             G+++ +R++D+  F R    ++ +      E + A +A  +I NTF++LE  +L    + 
Sbjct  191   GIKE-IRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNLEHDVLEAFSSI  249

Query  737   YPNVYTIGPLHAHLK-ATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              P VY+IGPLH  +K  T     +  ++L +E+  C+ WL+S+EP SV+YV+FGSI+V+T
Sbjct  250   LPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYVNFGSITVMT  309

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
              +Q++EF +GL NS   FLWV+R DLVAG   E + +P E  E T+  G +  W PQE V
Sbjct  310   SEQMIEFAWGLSNSKMPFLWVIRPDLVAG---ENAVLPLEFLEETQNRGLLSSWCPQEEV  366

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H ++GGFLTH+GWNSTLES+  GVPMICWPFF +QQTN RF    W +GL+++D   R
Sbjct  367   LGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGLEIEDA-KR  425

Query  1274  SSVEKLIRELMEKRKG-EFLERAENMGKLAKE-AISEGGSSYCNFDCLIQDM  1423
               +E  ++ELME  KG E  E+A    KLA   A    GSS+ N + LI D+
Sbjct  426   DKIEIFVKELMEGEKGKEMKEKALQWKKLAHNAAFGPHGSSFMNLENLIHDV  477



>ref|XP_004136284.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 ref|XP_004167272.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 gb|KGN60220.1| hypothetical protein Csa_3G889760 [Cucumis sativus]
Length=486

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 189/476 (40%), Positives = 267/476 (56%), Gaps = 23/476 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    FHITF      H RLL      +    + F+ +
Sbjct  12    HAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPTALDGISSFQFE  71

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIG-KPFLKQYIAQNRDSGLP-FTCFISDLLVSIA  406
             S P G+    +++ +    LC S RR+  +PF +     N D  +P  +C +SD ++S  
Sbjct  72    SIPDGLPPTDVDATQDIPSLCQSTRRLCLQPFKELVSKLNCDPNVPQVSCIVSDGVMSFT  131

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDS------SPITKVK  568
             +D +EE   +PV  F   SAC F  Y     L E G  P K     S      + I  + 
Sbjct  132   VDAAEE-LGVPVVLFWTTSACGFLAYLHYQQLVERGYTPFKDESYLSNEQYLDTKIDWIP  190

Query  569   GMEDFLRVRDLSPFCRDED----LAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTK  736
             GM+D +R+RD+  F R  D    +     +E + A +A  ++LNT   LE   L+ + + 
Sbjct  191   GMKD-VRLRDIPTFIRTTDPEDGMIDFIISETKRAKRANAIVLNTVASLEQEALNAMSSL  249

Query  737   YPNVYTIGPLHAHLKATLASKSTH----SNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
              P V++IGPL   L+   +  S H     ++L +ED +C+ WLD + P SV+YV+FGSI+
Sbjct  250   LPPVFSIGPLQLLLQQVASHDSDHLKFLGSNLWKEDTSCLQWLDQKSPNSVVYVNFGSIT  309

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
             V+T+ QL EF +GL NSG+ FLW++R DLVAG   + + +P E  + TK  G +  W PQ
Sbjct  310   VMTKDQLKEFAWGLANSGQTFLWIIRPDLVAG---DTAVLPPEFIDVTKERGMLTNWCPQ  366

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL H A+GGFLTH+GWNST ESI AGVPMICWPFFA+QQTN R+    W +G+++   
Sbjct  367   EEVLQHPAIGGFLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWGIGMEVDSD  426

Query  1265  CDRSSVEKLIRELMEKRKG-EFLERAENMGKLAKEAIS-EGGSSYCNFDCLIQDMI  1426
               R  +EK ++ELME  KG E   RAE   KL  +A +   GSS  N + L+  ++
Sbjct  427   VKREEIEKQVKELMEGEKGKEMRNRAEEWKKLVGDAATPHSGSSSRNLNDLVHKVL  482



>ref|XP_003520949.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Glycine max]
Length=477

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 194/478 (41%), Positives = 265/478 (55%), Gaps = 34/478 (7%)
 Frame = +2

Query  50    GHILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRL  229
              HIL  P PA+ H+  M  LA LL   +  ITF    + H RLL  TD+ S  F T+F  
Sbjct  7     SHILAIPFPAEGHIKPMFNLAKLLSHRSHRITFVNTHHNHNRLLQFTDLPS--FHTQFPD  64

Query  230   QSFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ------------NRDSGLPFT  373
               F   I DG  +       L + L  +  P  +  +A+            N D     +
Sbjct  65    FHFA-SITDGIPSDNPRKGALINYLPMLITPSARSLVAKEFRELFSRLLEKNGDQWQQPS  123

Query  374   CFISD-LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGID--  544
             C I D L+ +I + V++E F +PV  FR  SA   W    +  L + G   ++ N     
Sbjct  124   CIIVDGLMSTIVMGVAQE-FRIPVIAFRTYSATCTWVTIFMSKLAKEGAQQLRSNQDAEN  182

Query  545   -SSPITKVKGMEDFLRVRDLSPFCRDEDLAVLYYTEARLAVQARGLILNTFEDLEGPILS  721
               S    + G+E+ LR  DL P   D       + E     QA  +ILNTFE LE  I++
Sbjct  183   LKSASANIPGLENLLRNCDLPP---DSGTRDFIFEETLAMTQASAIILNTFEQLEPSIIT  239

Query  722   QIRTKYPNVYTIGPLHAHLKATLASKSTHS----NSLLQEDETCMAWLDSQEPKSVIYVS  889
             ++ T +P VY+IGPLH   K  + + ST S      L +ED +C+ WLD Q+ KSV+YVS
Sbjct  240   KLATIFPKVYSIGPLHTLCKTMITTNSTSSPHKDGRLRKEDRSCITWLDHQKAKSVLYVS  299

Query  890   FGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIV  1069
             FG++  ++ +QLMEFW+GLVNS K FLWV++ +L+  K+     +P EL+ GTK  G++V
Sbjct  300   FGTVVNLSYEQLMEFWHGLVNSLKPFLWVIQKELIIQKN-----VPIELEIGTKERGFLV  354

Query  1070  GWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGL  1249
              WAPQE VL + AVGGFLTH GWNSTLESIA GVPM+CWP   DQ  NSR V E WK+GL
Sbjct  355   NWAPQEEVLANPAVGGFLTHCGWNSTLESIAEGVPMLCWPSITDQTVNSRCVSEQWKIGL  414

Query  1250  DMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
             +M   CDR  VE ++R++ME    + +  A ++ K A   I E GSSY N + LI+D+
Sbjct  415   NMNGSCDRFVVENMVRDIMENE--DLMRSANDVAKKALHGIKENGSSYHNLENLIKDI  470



>gb|KHN13067.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=478

 Score =   328 bits (841),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 197/479 (41%), Positives = 275/479 (57%), Gaps = 19/479 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL +  FHITF      H RLL     DS      F+ +
Sbjct  5     HAVCIPYPAQGHINPMLKLAKLLHVRGFHITFVNTEYNHKRLLKSRGSDSLNSVPSFQFE  64

Query  233   SFPPGIYDGA-LNSKEVFVELCDSLRRIG-KPFLKQYIAQNRDSGLP-FTCFISDLLVSI  403
             + P G+ D   +++ +  V L +S RR    PF       N  S  P  TC +SD  +S 
Sbjct  65    TIPDGLSDNPDVDATQDVVSLSESTRRTCLTPFKNLLSKLNSASDTPPVTCIVSDGGMSF  124

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDF  583
              LD ++E   +P       SAC +  Y   P L + G   +K +    + I  V G+++ 
Sbjct  125   TLDAAQE-LGIPEVILSTASACGYMCYMKYPRLVDMGLTHLKDSSYLENSIDWVPGIKE-  182

Query  584   LRVRDLSPFCRD---EDLAVL--YYTEARLAVQARGLILNTFEDLEGPILSQIRT-KYPN  745
             +R++DL  F R    +DL ++   Y++   A +A  +I+NTF+ LE  +L    +   P 
Sbjct  183   IRLKDLPSFMRTTNPQDLMMMDFIYSQCERAQKASAIIVNTFDALEHDVLDAFSSILLPP  242

Query  746   VYTIGPLHAHLKATLASK---STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             +Y+IGPL+  L   + +     T  ++L +E+  C+ WL+S+EP SV+YV+FGSI V+T 
Sbjct  243   IYSIGPLNLLLNNDVTNNEELKTIGSNLWKEEPKCLEWLNSKEPNSVVYVNFGSIMVMTS  302

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
              QL E  +GL NS K FLWV+R DLVAG+ +    +P+E  + TK  G +  W PQE VL
Sbjct  303   DQLTELAWGLANSNKNFLWVIRPDLVAGEIN--CALPNEFVKETKDRGMLASWCPQEEVL  360

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H AVGGFLTH GWNSTLES+  GVPM+CWPFFA+QQTN RF  + W +GL+++DV  R 
Sbjct  361   AHPAVGGFLTHCGWNSTLESVCEGVPMLCWPFFAEQQTNCRFCCKEWGIGLEIEDV-KRE  419

Query  1277  SVEKLIRELMEKRKG-EFLERAENMGKLAKEAISE-GGSSYCNFDCLIQDMIKVNEATR  1447
              VE L+RELME  KG E  ERA    KLA EA S   GSS+ N D +++ ++    AT+
Sbjct  420   KVEALVRELMEGEKGKEMKERALEWKKLAHEAASSPHGSSFVNMDNVVRQVLMNKIATK  478



>gb|KGN54319.1| hypothetical protein Csa_4G303180 [Cucumis sativus]
Length=471

 Score =   328 bits (840),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 184/473 (39%), Positives = 273/473 (58%), Gaps = 31/473 (7%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP PA+ H+     LAHLL  A   +TF    + H +L  LT + +   +  F+  
Sbjct  8     HVLLFPFPAKGHIKPFFCLAHLLCNAGLRVTFLSTEHHHQKLHNLTHLAAQIPSLHFQSI  67

Query  233   S------FPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLL  394
             S       P  + DG         +L  S+ ++ KP  +Q +   +D   P TC I+DL+
Sbjct  68    SDGLSLDHPRNLLDG---------QLFKSMPQVTKPLFRQLLLSYKDGTSPITCVITDLI  118

Query  395   VSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKGNGIDSSPITKVKGM  574
             +   +DV++E  ++PV+ F   SA   + YFS+P L E G++P    G  +  +  + G 
Sbjct  119   LRFPMDVAQE-LDIPVFCFSTFSARFLFLYFSIPKLLEDGQIPYP-EGNSNQVLHGIPGA  176

Query  575   EDFLRVRDLSPFCRDEDLA----VLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYP  742
             E  LR +DL  +   E +A    + +  +     ++ GLILNTF++LE P ++ +   Y 
Sbjct  177   EGLLRCKDLPGYWSVEAVANYNPMNFVNQTIATSKSHGLILNTFDELEVPFITNLSKIYK  236

Query  743   NVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQ  922
              VYTIGP+H+ LK ++ ++        +ED +C+AWLDSQ P+SV++VSFGSI  +   Q
Sbjct  237   KVYTIGPIHSLLKKSVQTQY----EFWKEDHSCLAWLDSQPPRSVMFVSFGSIVKLKSSQ  292

Query  923   LMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSEL--KE--GTKANG--YIVGWAPQ  1084
             L EFW GLV+SGK FL V+RSD +  +  EE     EL  KE   TK  G   IV WAPQ
Sbjct  293   LKEFWNGLVDSGKAFLLVLRSDALVEETGEEDEKQKELVIKEIMETKEEGRWVIVNWAPQ  352

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL+H A+GGFLTHSGWNSTLES+A GVPM+ WP   DQ +N+ ++ +VWK+G++M+D 
Sbjct  353   EKVLEHKAIGGFLTHSGWNSTLESVAVGVPMVSWPQIGDQPSNATWLSKVWKIGVEMEDS  412

Query  1265  CDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDM  1423
              DRS+VE  +R +ME    +       + K   + +S+ G+SY N   LI+D+
Sbjct  413   YDRSTVESKVRSIMEHEDKKMENAIVELAKRVDDRVSKEGTSYQNLQRLIEDI  465



>ref|XP_007018744.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOY15969.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=487

 Score =   328 bits (841),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 265/475 (56%), Gaps = 22/475 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA +L    FHITF      H RLL     D+      FR +
Sbjct  11    HAVCIPYPAQGHINPMLKLAKILHHRGFHITFVNTEFNHKRLLKARGPDALNGLPSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGL----PFTCFISDLLVS  400
             + P G+    +++ +    LC+S R+   P  KQ + +  DS      P +C +SD ++S
Sbjct  71    TIPDGLPPTDVDATQDIPSLCESTRKTCLPHFKQLLHKLNDSSSANVPPVSCIVSDGVMS  130

Query  401   IALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKV  565
               LD +EE   +P   F   SAC F  Y     L E G  P+K      NG   + I  +
Sbjct  131   FTLDAAEE-LGVPEVLFWTTSACGFLGYVHYRQLMEKGYTPLKDESYLTNGYLDTVIDWI  189

Query  566   KGMEDFLRVRDLSPFCRDED----LAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRT  733
               ME  +R+RDL  F R  D    +    + E   A++A  +ILNTF+DLE  +L  +  
Sbjct  190   PAMEG-IRLRDLPTFIRTTDPNFIMLDFVFVETERALKASAIILNTFDDLEHEMLGALSP  248

Query  734   KYPNVYTIGPLHAHLKATLASKSTH--SNSLLQEDETCMAWLDSQEPKSVIYVSFGSISV  907
               P +Y++GPLH  L   +         ++L +E+  C+ WLDS+EP SV+YV+FGSI+V
Sbjct  249   MLPPIYSVGPLHLALNHHVHDNDLKQLGSNLWKEEPECIQWLDSKEPNSVVYVNFGSIAV  308

Query  908   ITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQE  1087
             +T  QL EF +GL NS + FLWV+R DLV G   E + +P+E    TK  G +  W PQE
Sbjct  309   MTADQLTEFAWGLANSNQTFLWVIRPDLVGG---ESAVVPAEFVAETKDRGLMATWCPQE  365

Query  1088  AVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVC  1267
              VL H +VGGFLTHSGWNST+ESI+ GVPMICWPFFA+QQTN R+    W +G+++    
Sbjct  366   QVLSHPSVGGFLTHSGWNSTIESISGGVPMICWPFFAEQQTNCRYSCTKWGIGMEINSDV  425

Query  1268  DRSSVEKLIREL-MEKRKGEFLERAENMGKLAKEAI-SEGGSSYCNFDCLIQDMI  1426
              R  VE L+REL   ++  E  ++A    + A+EA  S  GSSY N D +I  ++
Sbjct  426   KRDEVEGLVRELMEGEKGKEMKKKALEWKRKAEEATGSSKGSSYKNLDQMINQVL  480



>ref|XP_002285771.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   328 bits (840),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 190/467 (41%), Positives = 265/467 (57%), Gaps = 19/467 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA  L    FHITF      H RLL     DS +    F+ +
Sbjct  11    HAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSFQFK  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALD  412
             + P G+    +++ +    LC S R+   P  +  ++     G P TC +SD  +S  LD
Sbjct  71    TIPDGLLPSNVDATQDIPALCVSTRKHCLPPFRDLLSNLNHDGPPVTCIVSDGAMSFTLD  130

Query  413   VSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGME  577
              ++E   +P   F   SAC F  Y    +L + G  P+K      NG   + I  + GM+
Sbjct  131   AAQE-LGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLKDESYLTNGYLDTVIDWIPGMK  189

Query  578   DFLRVRDLSPFCRDED----LAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPN  745
               +R+RD+  F R  D    +      EA  A +A  LI NTF+ LE  +L  +   +P 
Sbjct  190   G-IRLRDIPSFIRTTDPNEIMLEFPLREAERARKASALIFNTFDALEHEVLDALSQMFPP  248

Query  746   VYTIGPLHAHLKATLAS--KSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQ  919
             +YTIGPLH  +     +  K   SN L +E+  C+ WLDS+EP SV+YV+FGSI+V+T Q
Sbjct  249   IYTIGPLHQLMSQIQDNDLKLMESN-LWKEEPECLEWLDSKEPNSVVYVNFGSITVMTSQ  307

Query  920   QLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLD  1099
             QL EF +GLVNS + FLW++R DLV+G   + + +P E    TK  G + GW PQE VL 
Sbjct  308   QLNEFAWGLVNSNQTFLWIIRPDLVSG---DAAILPPEFVAETKERGLLAGWCPQEQVLS  364

Query  1100  HLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSS  1279
             H AVGGFLTH+GWNST+ES++AGVPMICWPFFA+QQTN R+    W +G+++     R  
Sbjct  365   HPAVGGFLTHNGWNSTIESVSAGVPMICWPFFAEQQTNCRYCCTEWGIGMEIDSDVKRDE  424

Query  1280  VEKLIRELMEKRKGEFLERAENMGKLAKEAISEG--GSSYCNFDCLI  1414
             +E+L++ELME  KG+ L++     K   E  + G  GSS+ N D +I
Sbjct  425   IERLVKELMEGEKGKELKKKALEWKTLAEEATRGPKGSSFSNLDKMI  471



>ref|XP_004489451.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cicer arietinum]
 gb|AGU14130.1| UDP-glycosyltransferase [Cicer arietinum]
Length=485

 Score =   328 bits (841),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 182/476 (38%), Positives = 276/476 (58%), Gaps = 24/476 (5%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+ P PAQ H+N +LKLA +L    FHITF      H RL+     +S    T F  +
Sbjct  10    HVLLIPYPAQGHINPLLKLAKILHFKGFHITFVNTEYNHKRLVESKGPNSLDGFTDFNFE  69

Query  233   SFPPGI--YDGALNSKEVFVELCDSLRR-IGKPFLKQYIAQNRDSGL-----PFTCFISD  388
             + P G    +G  +  +  + LC+S+R+   +PF K  +A+  DS +     P TC +SD
Sbjct  70    TIPDGFTPMEGDDDVSQKILSLCESIRKNFLEPFHK-LLAKLHDSAIAGFIPPLTCIVSD  128

Query  389   LLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSP  553
               +S  +  SEE  +LP+  F P +AC F     LP LFE G +P+K      NG   + 
Sbjct  129   YSMSFTIQASEE-LSLPIILFSPANACNFLCSLHLPTLFEKGLIPLKDKSYLTNGYLETK  187

Query  554   ITKVKGMEDFLRVRDLSPFCR----DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILS  721
             +  + G+++F R++DL  + R    ++ L          A +A  +I NT  +LE   ++
Sbjct  188   VDCIPGLKNF-RLKDLPDYVRITDPNDSLVEFIIESIDRAPRAAAIIFNTSNELENDAMN  246

Query  722   QIRTKYPNVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGS  898
              + + +P++Y IGPL ++L  +L +   + S++L +ED  C+ WL+S+EPKSV+YV+FGS
Sbjct  247   ALSSMFPSIYAIGPLSSYLNESLQNHLVSLSSNLWKEDTKCLEWLESKEPKSVVYVNFGS  306

Query  899   ISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWA  1078
             ++V+T ++L+EF +GL NS K FLW++R DLV G       + SE        G I  W 
Sbjct  307   MTVMTLEKLLEFAWGLANSKKPFLWIIRPDLVIGGS---VVLSSEFVNEISDRGLIASWC  363

Query  1079  PQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMK  1258
             PQE VL+H ++GGFLTH GWNST ESI AGVPM+CWPFFA+Q  N R++ + W++GL++ 
Sbjct  364   PQEKVLNHPSIGGFLTHCGWNSTTESICAGVPMLCWPFFAEQTANCRYICKEWEIGLEID  423

Query  1259  DVCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
                 R  VEKL+ ELM   KG+ + +     K  ++    GGSSY N D +I +++
Sbjct  424   TNVKREEVEKLVNELMVGEKGKKMRQKSIELKKVEKDTRLGGSSYMNLDKVINEVL  479



>gb|KHN34757.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=459

 Score =   327 bits (837),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 189/456 (41%), Positives = 265/456 (58%), Gaps = 19/456 (4%)
 Frame = +2

Query  98    MLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSFPPGIYDGALNSKE  277
             MLKLA LL    FHITF      H RLL     DS    + FR ++ P G+ +  L++ +
Sbjct  1     MLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFRFETIPDGLPETDLDATQ  60

Query  278   VFVELCDSLRRIGKPFLKQYIAQ-NRDSGLPFTCFISDLLVSIALDVSEECFNLPVYYFR  454
                 LC++ RR   P  K  + + N     P +C +SD ++S  LD +EE   LP   F 
Sbjct  61    DIPSLCEATRRTCSPHFKNLLTKINNSDAPPVSCIVSDGVMSFTLDAAEE-LGLPEVLFW  119

Query  455   PISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKGMEDFLRVRDLSPFCR-  616
               SAC F  Y     L E G  P+K      NG   + I  + G+++ +R++DL  F R 
Sbjct  120   TTSACGFMCYVQYEQLIEKGLTPLKDSSYITNGYLETTIDWIPGIKE-IRLKDLPSFIRT  178

Query  617   ---DEDLAVLYYTEARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKAT  787
                DE +      E     +A  +ILNTF+ LE  +L    +  P VY+IGPL+  +K  
Sbjct  179   TNPDEFMLDFIQWECGRTRRASAIILNTFDALEHDVLEAFSSILPPVYSIGPLNLLVKHV  238

Query  788   LASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNSGKK  964
                  +   ++L +E+  C+ WLD++EP SV+YV+FGSI+V+T +QL+EF +GL NS K 
Sbjct  239   DDKDLNAIGSNLWKEESECVEWLDTKEPNSVVYVNFGSIAVMTSEQLIEFAWGLANSNKT  298

Query  965   FLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNS  1144
             FLWV+R DLVAG   E + +PSE  + T+  G +  W  QE VL H A+GGFLTHSGWNS
Sbjct  299   FLWVIRPDLVAG---ENALLPSEFVKQTEKRGLLSSWCSQEQVLTHPAIGGFLTHSGWNS  355

Query  1145  TLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRKG-  1321
             TLES+  GVPMICWPFFA+QQTN  F  + W +GL+++DV +R  +E L+RELM+  KG 
Sbjct  356   TLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEIEDV-ERDKIESLVRELMDGEKGK  414

Query  1322  EFLERAENMGKLAKE-AISEGGSSYCNFDCLIQDMI  1426
             E  E+A    +LAK  A    GSS+ N D +++D++
Sbjct  415   EMKEKALQWKELAKSAAFGPVGSSFANLDNMVRDVL  450



>gb|EAZ39840.1| hypothetical protein OsJ_24281 [Oryza sativa Japonica Group]
Length=486

 Score =   327 bits (839),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 192/471 (41%), Positives = 260/471 (55%), Gaps = 27/471 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP P Q H+N M+  A  L  A  H+TF   ++   R L       G  + R R  
Sbjct  9     HVLVFPAPGQGHINCMMHFATGLVGAGLHVTFL-HTDHSLRRLGCAAAAGGADSPRLRFM  67

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGK-PF--LKQYIAQNRDSGL------PFTCFIS  385
             S P G+ D    +    VEL +SLR  G  P+  L   + +  D G       P TC ++
Sbjct  68    SIPDGLPDDHPRAVGDIVELLESLRTNGSVPYRSLLASLVRAGDDGASSGGFPPVTCVVA  127

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPI-KGNGIDSSPITK  562
             D  +  A DV+EE   +P   FR  SAC+   Y S+  LFE GE+ +   +G    P+  
Sbjct  128   DGSMPFAADVAEE-IGVPSLVFRTASACSVLAYLSVDRLFELGEVVLFPADGDLDEPVRG  186

Query  563   VKGMEDFLRVRDLSPFCRD-----EDLAVLYYTEARLAVQ-ARGLILNTFEDLEGPILSQ  724
             V GME FLR RDL    R+      D  V    E     + AR ++LNT   +EGP L+ 
Sbjct  187   VPGMESFLRRRDLPGNFRNCTEDQNDPIVQMLIEVTAHSRGARAVVLNTAASMEGPALAH  246

Query  725   IRTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
             +  +  +V+ IGPLHA      A+      SL + D+ C+AWLD Q  +SV+YVS GS +
Sbjct  247   VAPRMRDVFAIGPLHAMFPVPAAA-----GSLWRADDGCVAWLDGQPDRSVVYVSLGSFA  301

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKAN-GYIVGWAP  1081
             VI+ +Q  EF +GLV +G  FLWV+R D+V G       +   +    K N   +VGWAP
Sbjct  302   VISLEQFTEFLHGLVAAGYPFLWVLRPDMV-GASQSAGALREAVAAAEKNNKARVVGWAP  360

Query  1082  QEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKD  1261
             Q  VL H AVG FLTH+GWNSTLE+   GVP +CWPFFADQQ NSRFVG VW  GLDMKD
Sbjct  361   QRDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQINSRFVGAVWGTGLDMKD  420

Query  1262  VCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             VCD + VE+++RE ME   GE    A+ + +  ++ +++GGSS   F+ L+
Sbjct  421   VCDAAVVERMVREAME--SGEIRASAQALAREVRQDVADGGSSAAEFERLV  469



>ref|XP_008229788.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=485

 Score =   327 bits (839),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 186/475 (39%), Positives = 266/475 (56%), Gaps = 21/475 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P+PAQSH+ +MLK A LL    FHITF      H R L     +S      F+ +
Sbjct  11    HAVCIPVPAQSHIKAMLKFAKLLHHRGFHITFVNTEFNHKRFLKSLGPNSLDGLPDFQFK  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIG--KPFLKQYIAQNRD-----SGLPFTCFISDL  391
             S P  I D   ++ +    LC+S+R+     PFL      N D     S  P TC +SD 
Sbjct  71    SIPDSIPDSDEDATQDITLLCESVRKQNFLAPFLALLAKLNNDAISTSSNPPVTCIVSDG  130

Query  392   LVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPI  556
              +S    ++ E    P+  F  I+AC+F  +  L  + E G  P+K      NG   + I
Sbjct  131   FMSTFTSIAAEEIGAPIVLFYTIAACSFMGFKQLRAVVEKGLAPLKDESCFTNGYLETVI  190

Query  557   TKVKGMEDFLRVRDLSPFCR---DEDLAVLYYTEAR-LAVQARGLILNTFEDLEGPILSQ  724
               + GM D +R+RDL  F R    +D+ + +  EA   A ++  ++L+TF+ LE  +L  
Sbjct  191   DWIPGMRD-IRLRDLPTFLRTTNSDDIMLNFVMEATDGAHESSAVLLHTFDALEPDVLDA  249

Query  725   IRTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
             + +  P+VYT+GPL  HL            SL +E+  C+ WL+++ P SV+YV+FGSI+
Sbjct  250   LSSMLPHVYTVGPLQLHLNQIPEHPLKMGYSLWKEETECLEWLNTRAPNSVVYVNFGSIA  309

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQ  1084
             ++T QQL+EF +GL NS   F WV+R DLV G   E + +P E    T+    I GW PQ
Sbjct  310   IVTPQQLVEFGWGLANSKLPFFWVIRPDLVIG---ESAILPPEFVAETRERSLIAGWCPQ  366

Query  1085  EAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDV  1264
             E VL+H +VGGFLTHSGWNST+ESI AGVPM+CWPFF DQQ + R+    W +G+++ + 
Sbjct  367   EQVLNHPSVGGFLTHSGWNSTVESITAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISND  426

Query  1265  CDRSSVEKLIRELMEKRKGEFLE-RAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
               R  VEKL++ELME  KG+ ++ +     KLA+EA    GSS  N D L+  ++
Sbjct  427   VKRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEEATGPHGSSSTNLDNLVNQVL  481



>ref|XP_004305165.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Fragaria vesca 
subsp. vesca]
Length=503

 Score =   328 bits (840),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 189/442 (43%), Positives = 258/442 (58%), Gaps = 17/442 (4%)
 Frame = +2

Query  128   ANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQSFPPGI---YDGALNSKEVFVELCD  298
             +  H+TF    + H RL  L  + S RF T    +S   G+   +   L S E+ + L  
Sbjct  60    SGLHVTFVNTRHNHNRLANLPAL-SARFPT-LNFESISDGLPLEHPRTLGS-ELLMALKT  116

Query  299   SLRRIGKPFLKQYIAQNRDSGLPFTCFISDLLVSIALDVSEECFNLPVYYFRPISACAFW  478
             S++   K  L+  +  N  +    TC I+D LV+ A DV+EE   LP+  +        W
Sbjct  117   SIKPHFKELLQSPLKANGVALPAPTCIITDGLVTFAFDVAEE-LGLPILGYNVPCTRYMW  175

Query  479   TYFSLPDLFEAGELPIKGNGIDSSPITKVKGMEDFLRVRDLSPFCR----DEDLAVLYYT  646
             T   LP+L E G+LP   + ++   IT V GME  LR  DL  FCR    +         
Sbjct  176   TCLCLPNLIEQGQLPFPDDDMNVE-ITGVPGMEGLLRRVDLPGFCRVKQSNHPGLQFAIR  234

Query  647   EARLAVQARGLILNTFEDLEGPILSQIRTKYPNVYTIGPLHAHLKATLA--SKSTHS-NS  817
             E +   +A  LIL+T  +L+ P LS +   +P +YT+GPLH+ L + +   S+S  S   
Sbjct  235   ETQTQKRASALILDTIYELDAPCLSHMANMFPKIYTLGPLHSLLHSQIGDVSRSLASYGG  294

Query  818   LLQEDETCMAWLDSQEPKSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVA  997
             L ++D  CM WLDSQ  KSV+YVSFG++  +TR Q+MEFWYGL+ SG  FLWV+RSD+ +
Sbjct  295   LWKDDPNCMTWLDSQATKSVLYVSFGTLVTLTRTQIMEFWYGLIYSGHPFLWVIRSDITS  354

Query  998   GKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPM  1177
               D    PIP EL+ GTK  GYIV W  QE VL H +VGGFLTHSGWNSTLESI AG+PM
Sbjct  355   --DLGGDPIPMELEIGTKERGYIVNWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAGIPM  412

Query  1178  ICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEKLIRELMEKRKGEFLERAENMGKL  1357
             ICWP   D    SR V E WK+GL +K+ CDR  +E +IR LME ++GE     + + K+
Sbjct  413   ICWPNLGDHYIISRTVSEKWKIGLQLKENCDRKEIETMIRMLMEFKRGEIQSSMDVISKV  472

Query  1358  AKEAISEGGSSYCNFDCLIQDM  1423
             A++++ +GGSS  N + LIQD+
Sbjct  473   ARDSVVKGGSSNHNLEMLIQDI  494



>ref|XP_008779905.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 191/472 (40%), Positives = 266/472 (56%), Gaps = 19/472 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H ++ P PAQ H+  MLKLA LL    F+ITF        RLL    + S    + FR Q
Sbjct  10    HAVLIPFPAQGHVTPMLKLAKLLHSRGFYITFVNTHFNQNRLLRSGAISSLDSLSEFRFQ  69

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQNRDSGLP---FTCFISDLLVSI  403
             S P G+     ++ +    LCDS+ +   P  +  I +  D   P    +C +SD  +S 
Sbjct  70    SIPDGLPPTDKDATQDIPSLCDSIPKNCIPPFRDLITELNDPSSPTPAVSCIVSDGAMSF  129

Query  404   ALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVK  568
              LDV++E   +P   F   SAC    Y     L E G  P+K      NG   +PI  + 
Sbjct  130   TLDVAKE-LRIPEVLFWTPSACGVMGYLHYQHLIERGIFPLKDASDLTNGYLETPIDWIS  188

Query  569   GMEDFLRVRDLSPFCRDEDLAVLYY----TEARLAVQARGLILNTFEDLEGPILSQIRTK  736
             GM++ +R+RDL  F R  D   + +     EA+ A  A  +ILNTF++LE P+L  + + 
Sbjct  189   GMKN-VRLRDLPTFLRTLDSKDIMFHFCNREAQRASMASAIILNTFDELERPVLDAMASI  247

Query  737   YPNVYTIGPLHA-HLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVIT  913
              P +YTIGPL     + T +  ++ S++L +ED  C+ WL  +EP SV+YV++GSI+++T
Sbjct  248   LPPIYTIGPLSLLSRQITTSPTTSISSNLWKEDPACLEWLQGREPGSVVYVNYGSITMMT  307

Query  914   RQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAV  1093
              +QL+EF +GL NS   FLWV+R DLV G   + + +P E    TK  G +  W PQEAV
Sbjct  308   NEQLIEFAWGLANSKHDFLWVIRPDLVKG---DSTVLPQEFLSETKERGLLASWCPQEAV  364

Query  1094  LDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDR  1273
             L H ++GGFLTHSGWNSTLESI +GVP I WPFFA+QQTN R+    W +G+++     R
Sbjct  365   LSHPSIGGFLTHSGWNSTLESICSGVPTISWPFFAEQQTNCRYACTEWGIGMEIDSNVKR  424

Query  1274  SSVEKLIRELMEKRKG-EFLERAENMGKLAKEAISEGGSSYCNFDCLIQDMI  1426
               VE+L+RELME  KG E   RA      A  A   GGSS+ NFD L+ + +
Sbjct  425   EEVERLVRELMEGEKGKEMRRRAVEWKGSAISATQPGGSSFQNFDRLVNEAL  476



>ref|NP_001059665.1| Os07g0487100 [Oryza sativa Japonica Group]
 dbj|BAC57710.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
 dbj|BAC84366.1| putative UDP-glucose glucosyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF21579.1| Os07g0487100 [Oryza sativa Japonica Group]
Length=486

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 192/471 (41%), Positives = 260/471 (55%), Gaps = 27/471 (6%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H+L+FP P Q H+N M+  A  L  A  H+TF   ++   R L       G  + R R  
Sbjct  9     HVLVFPAPGQGHINCMMHFATGLVGAGLHVTFL-HTDHSLRRLGGAAAAGGADSPRLRFM  67

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGK-PF--LKQYIAQNRDSGL------PFTCFIS  385
             S P G+ D    +    VEL +SLR  G  P+  L   + +  D G       P TC ++
Sbjct  68    SIPDGLPDDHPRAVGDIVELLESLRTNGSVPYRSLLASLVRAGDDGASSGGFPPVTCVVA  127

Query  386   DLLVSIALDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPI-KGNGIDSSPITK  562
             D  +  A DV+EE   +P   FR  SAC+   Y S+  LFE GE+ +   +G    P+  
Sbjct  128   DGSMPFAADVAEE-IGVPSLVFRTASACSVLAYLSVDRLFELGEVVLFPADGDLDEPVRG  186

Query  563   VKGMEDFLRVRDLSPFCRD-----EDLAVLYYTEARLAVQ-ARGLILNTFEDLEGPILSQ  724
             V GME FLR RDL    R+      D  V    E     + AR ++LNT   +EGP L+ 
Sbjct  187   VPGMESFLRRRDLPGNFRNCTEDQNDPIVQMLIEVTAHSRGARAVVLNTAASMEGPALAH  246

Query  725   IRTKYPNVYTIGPLHAHLKATLASKSTHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSIS  904
             +  +  +V+ IGPLHA      A+      SL + D+ C+AWLD Q  +SV+YVS GS +
Sbjct  247   VAPRMRDVFAIGPLHAMFPVPAAA-----GSLWRADDGCVAWLDGQPDRSVVYVSLGSFA  301

Query  905   VITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKAN-GYIVGWAP  1081
             VI+ +Q  EF +GLV +G  FLWV+R D+V G       +   +    K N   +VGWAP
Sbjct  302   VISLEQFTEFLHGLVAAGYPFLWVLRPDMV-GASQSAGALREAVAAAEKNNKARVVGWAP  360

Query  1082  QEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKD  1261
             Q  VL H AVG FLTH+GWNSTLE+   GVP +CWPFFADQQ NSRFVG VW  GLDMKD
Sbjct  361   QRDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQINSRFVGAVWGTGLDMKD  420

Query  1262  VCDRSSVEKLIRELMEKRKGEFLERAENMGKLAKEAISEGGSSYCNFDCLI  1414
             VCD + VE+++RE ME   GE    A+ + +  ++ +++GGSS   F+ L+
Sbjct  421   VCDAAVVERMVREAME--SGEIRASAQALAREVRQDVADGGSSAAEFERLV  469



>dbj|BAB86928.1| glucosyltransferase-10 [Vigna angularis]
Length=485

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 190/473 (40%), Positives = 276/473 (58%), Gaps = 20/473 (4%)
 Frame = +2

Query  53    HILIFPLPAQSHLNSMLKLAHLLDLANFHITFFVPSNIHARLLALTDVDSGRFTTRFRLQ  232
             H +  P PAQ H+N MLKLA LL    F+ITF      H RLL    ++S      FR +
Sbjct  11    HAVCVPFPAQGHINPMLKLAKLLHFNGFYITFVNTHYNHKRLLKSRGLNSLNGLPSFRFE  70

Query  233   SFPPGIYDGALNSKEVFVELCDSLRRIGKPFLKQYIAQ-NRDSGLP-FTCFISDLLVSIA  406
             + P G+ +  +        LCDS      P  +  +++ N +SG+P  +C ISD ++S  
Sbjct  71    TIPDGLPEPEVEGTHHVPSLCDSTSTTCLPHFRNLLSKLNNESGVPAVSCIISDGVMSFT  130

Query  407   LDVSEECFNLPVYYFRPISACAFWTYFSLPDLFEAGELPIKG-----NGIDSSPITKVKG  571
             LD S+E   LP   F   SAC F  Y     L + G +P K      NG   + I  V G
Sbjct  131   LDASQE-LGLPNVLFWTSSACGFMCYVHYHQLIQRGIVPFKDASDLTNGYLDTTIDWVAG  189

Query  572   MEDFLRVRDLSPFCRDEDLAVLYYTEAR----LAVQARGLILNTFEDLEGPILSQIRTKY  739
             +++ +R++D+  F R  D   +    AR     A +A  +ILNTF+ LE  +L    +  
Sbjct  190   IKE-IRLKDIPSFIRTTDPEDIMLNFARDECIRAEKASAIILNTFDALEHDVLEAFSSIL  248

Query  740   PNVYTIGPLHAHLKATLASK-STHSNSLLQEDETCMAWLDSQEPKSVIYVSFGSISVITR  916
             P VY+IGPL   L      + +   ++L +E+  C+ WLD++E  +V+YV+FGS++V+T 
Sbjct  249   PPVYSIGPLSFLLNNVTDKRLNAIGSNLWREEPGCLEWLDTKEANTVVYVNFGSVTVMTN  308

Query  917   QQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEESPIPSELKEGTKANGYIVGWAPQEAVL  1096
             +Q++EF +GL NS K F+WV+R DLV G   E + +P E    TK  G + GW PQE VL
Sbjct  309   EQMIEFAWGLANSKKSFVWVIRPDLVVG---ERAVLPQEFVTQTKNRGMLSGWCPQEQVL  365

Query  1097  DHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRS  1276
              H A+G FLTHSGWNSTLES+ AGVPMICWPFFA+QQTN RF  + W +G++++DV +R 
Sbjct  366   GHPAIGVFLTHSGWNSTLESLCAGVPMICWPFFAEQQTNCRFCCKEWGIGVEIEDV-ERD  424

Query  1277  SVEKLIRELMEKRKGEFLER-AENMGKLAKEAISE-GGSSYCNFDCLIQDMIK  1429
              +E+L+R +M+  KG+ ++R A N   LA++A S   GSS+  F  LI++++K
Sbjct  425   HIERLVRAMMDGEKGKDMKRKAVNWKILAEKAASAPTGSSFVQFQKLIREVLK  477



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4732378313600