BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25233_g2_i1 len=1584 path=[2973:0-753 2166:754-779 2192:780-1583]

Length=1584
                                                                      Score     E

ref|XP_009802463.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    712   0.0      
ref|XP_009608691.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    712   0.0      
gb|AIE12477.1|  UGT4                                                    607   0.0      
ref|XP_002276823.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    598   0.0      Vitis vinifera
emb|CDO99846.1|  unnamed protein product                                595   0.0      
ref|XP_002281029.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    596   0.0      Vitis vinifera
ref|XP_011085130.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    592   0.0      
ref|XP_010277669.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    590   0.0      
ref|XP_010658496.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    588   0.0      
ref|XP_002276771.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    587   0.0      Vitis vinifera
ref|XP_002276617.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    586   0.0      Vitis vinifera
gb|AGX93067.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    586   0.0      
ref|XP_010650608.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    578   0.0      
gb|AGX93068.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    576   0.0      
ref|XP_002280470.2|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    574   0.0      Vitis vinifera
gb|AGX93071.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    574   0.0      
gb|EYU19962.1|  hypothetical protein MIMGU_mgv1a005720mg                573   0.0      
ref|XP_010650643.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    573   0.0      
ref|XP_010262685.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    571   0.0      
sp|U3U992.1|UGT8_CATRO  RecName: Full=7-deoxyloganetic acid gluco...    569   0.0      
gb|AGX93072.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    568   0.0      
gb|AGX93065.1|  7-deoxyloganetic acid UDP-glucosyltransferase           568   0.0      
ref|XP_010262684.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    567   0.0      
ref|XP_006379615.1|  hypothetical protein POPTR_0008s06270g             567   0.0      
ref|XP_002280528.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    565   0.0      Vitis vinifera
gb|AGX93069.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    564   0.0      
ref|XP_002280624.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    563   0.0      Vitis vinifera
ref|XP_011038346.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    563   0.0      
gb|AGX93066.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    563   0.0      
ref|XP_011076758.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    559   0.0      
ref|XP_011084978.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    560   0.0      
ref|XP_006486448.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       558   0.0      
ref|XP_002276555.2|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    560   0.0      Vitis vinifera
ref|XP_007009131.1|  UDP-glucosyltransferase family 1 protein           558   0.0      
ref|XP_006435571.1|  hypothetical protein CICLE_v10031408mg             557   0.0      
gb|AIS39472.1|  flavonoid UDP-glucosyltransferase 3                     556   0.0      
gb|AGX93070.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    555   0.0      
gb|KDO69251.1|  hypothetical protein CISIN_1g011832mg                   553   0.0      
ref|XP_009613526.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    554   0.0      
ref|XP_007009132.1|  UDP-glucosyltransferase family 1 protein           553   0.0      
ref|XP_007009133.1|  UDP-glucosyltransferase family 1 protein           552   0.0      
ref|XP_006435573.1|  hypothetical protein CICLE_v10031368mg             550   0.0      
ref|XP_009590620.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    551   0.0      
ref|XP_009795416.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    548   0.0      
gb|ACS87994.1|  UDP-glucosyltransferase family 1 protein                548   0.0      Citrus sinensis [apfelsine]
ref|XP_009800319.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    546   0.0      
ref|XP_011084985.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    546   0.0      
ref|XP_010032069.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    545   0.0      
gb|EYU19961.1|  hypothetical protein MIMGU_mgv1a005050mg                546   0.0      
emb|CBI31575.3|  unnamed protein product                                544   0.0      
ref|XP_010032068.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    542   0.0      
ref|XP_011100060.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    542   0.0      
gb|EYU19963.1|  hypothetical protein MIMGU_mgv1a005336mg                540   0.0      
emb|CDP19643.1|  unnamed protein product                                536   0.0      
emb|CDP05607.1|  unnamed protein product                                537   0.0      
ref|XP_009597174.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    536   0.0      
ref|XP_011076757.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    535   0.0      
ref|XP_006355163.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       534   0.0      
emb|CDP16024.1|  unnamed protein product                                533   0.0      
ref|XP_006367216.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       533   0.0      
gb|KDP44850.1|  hypothetical protein JCGZ_01350                         532   0.0      
emb|CDP05611.1|  unnamed protein product                                531   0.0      
ref|XP_011084983.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    533   0.0      
gb|KDO69253.1|  hypothetical protein CISIN_1g011848mg                   530   0.0      
ref|XP_006435572.1|  hypothetical protein CICLE_v10031404mg             529   1e-180   
ref|XP_010318076.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    528   3e-180   
ref|XP_006367215.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       527   5e-180   
ref|XP_009597175.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    525   4e-179   
ref|XP_007158356.1|  hypothetical protein PHAVU_002G145900g             524   1e-178   
ref|XP_006355679.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       522   5e-178   
ref|XP_006355680.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       521   1e-177   
ref|XP_008464643.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       518   4e-176   
ref|XP_004239922.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    518   4e-176   
ref|XP_008464907.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    517   8e-176   
ref|XP_008464906.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    516   1e-175   
ref|XP_010674287.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    515   4e-175   
ref|XP_004235055.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    513   1e-174   
ref|XP_010032067.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    515   1e-174   
emb|CAN77812.1|  hypothetical protein VITISV_010344                     517   1e-173   Vitis vinifera
ref|XP_004162780.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       509   5e-173   
dbj|BAP90373.1|  UDP-glycose: glycosyltransferase UGT709H1              509   8e-173   
ref|XP_004150245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       509   1e-172   
gb|KGN50615.1|  UDP-glucosyltransferase family 1 protein                508   2e-172   
gb|KGN50614.1|  hypothetical protein Csa_5G196570                       508   3e-172   
ref|XP_004172562.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       508   3e-172   
ref|XP_004149949.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       507   4e-172   
gb|KHG01935.1|  UDP-glycosyltransferase 85A1                            522   1e-171   
ref|XP_010318075.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    505   2e-171   
ref|XP_010674283.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    505   3e-171   
ref|XP_004171873.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       504   7e-171   
ref|XP_010674284.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    504   8e-171   
gb|KDO69252.1|  hypothetical protein CISIN_1g011848mg                   503   1e-170   
ref|XP_008811497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       504   2e-170   
ref|XP_003517688.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       502   5e-170   
ref|XP_009589440.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    502   7e-170   
ref|XP_009804549.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    501   1e-169   
ref|XP_004150246.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       499   6e-169   
emb|CDP04614.1|  unnamed protein product                                497   7e-168   
emb|CDP19644.1|  unnamed protein product                                496   9e-168   
ref|XP_010905381.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    496   1e-167   
ref|XP_010666054.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    496   1e-167   
gb|AFJ53009.1|  UDP-glycosyltransferase 1                               494   5e-167   
ref|XP_006373896.1|  hypothetical protein POPTR_0016s10010g             492   4e-166   
gb|KDO61155.1|  hypothetical protein CISIN_1g037374mg                   489   3e-165   
ref|XP_011000049.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    488   1e-164   
gb|AGZ84549.1|  glycosyltransferase KGT31                               488   2e-164   
ref|XP_008785471.1|  PREDICTED: UDP-glycosyltransferase 85A4-like       487   2e-164   
ref|XP_011014019.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    486   1e-163   
ref|XP_010666049.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    486   4e-163   
ref|XP_010923184.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    484   5e-163   
ref|XP_007009137.1|  UDP-glucosyltransferase family 1 protein, pu...    483   8e-163   
ref|XP_006362115.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       483   1e-162   
ref|XP_003517692.2|  PREDICTED: UDP-glycosyltransferase 85A3-like       484   2e-162   
ref|XP_009589441.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    482   3e-162   
gb|KHN04919.1|  UDP-glycosyltransferase 85A3                            482   3e-162   
emb|CAN68538.1|  hypothetical protein VITISV_039646                     481   3e-162   Vitis vinifera
ref|XP_004235101.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    482   5e-162   
dbj|BAK55741.1|  UDP-glucose glucosyltransferase                        482   5e-162   
ref|XP_011014018.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    481   1e-161   
ref|XP_007158359.1|  hypothetical protein PHAVU_002G146200g             480   1e-161   
dbj|BAK55740.1|  UDP-glucose glucosyltransferase                        481   2e-161   
ref|XP_009759439.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    478   9e-161   
ref|XP_003613025.1|  UDP-glucuronosyltransferase 1-1                    478   9e-161   
ref|XP_010923186.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    478   1e-160   
ref|XP_004512576.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       478   1e-160   
ref|XP_008359771.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       476   1e-159   
ref|XP_006357782.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       476   1e-159   
ref|XP_008388093.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       475   1e-159   
gb|KHG01936.1|  UDP-glycosyltransferase 85A1                            489   1e-159   
ref|XP_010688868.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    475   3e-159   
ref|XP_007158358.1|  hypothetical protein PHAVU_002G146100g             474   4e-159   
gb|AFJ53008.1|  UDP-glycosyltransferase 1                               473   9e-159   
ref|XP_006357780.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       473   1e-158   
ref|XP_010316061.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    471   8e-158   
ref|XP_008785470.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       470   1e-157   
ref|XP_004231996.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    464   2e-155   
ref|XP_003613026.1|  UDP-glucuronosyltransferase 1-6                    464   3e-155   
ref|XP_006429244.1|  hypothetical protein CICLE_v10013877mg             464   4e-155   
gb|KHN04913.1|  UDP-glycosyltransferase 85A2                            462   7e-155   
ref|XP_003613028.1|  Cis-zeatin O-glucosyltransferase                   462   9e-155   
gb|AIE12478.1|  UGT5                                                    462   1e-154   
gb|AFJ53010.1|  UDP-glycosyltransferase 1                               462   1e-154   
emb|CBI36709.3|  unnamed protein product                                461   1e-154   
gb|AFK79038.1|  glycosyltransferase UGT6                                462   1e-154   
ref|XP_006423294.1|  hypothetical protein CICLE_v10030404mg             462   1e-154   
ref|XP_007026849.1|  UDP-glucosyl transferase 85A3, putative            459   1e-153   
ref|XP_009346996.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    460   1e-153   
ref|XP_006481394.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       459   1e-153   
dbj|BAB86920.1|  glucosyltransferase-2                                  459   3e-153   Vigna angularis [azuki bean]
gb|KDO43669.1|  hypothetical protein CISIN_1g011792mg                   459   3e-153   
ref|XP_008388092.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       456   4e-152   
ref|XP_010923185.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    454   2e-151   
ref|XP_002530397.1|  UDP-glucuronosyltransferase, putative              454   2e-151   Ricinus communis
ref|XP_010674282.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    454   9e-151   
ref|XP_008353149.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       452   1e-150   
ref|XP_010316060.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    452   1e-150   
gb|KDO38335.1|  hypothetical protein CISIN_1g044936mg                   450   3e-150   
ref|XP_008370121.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       447   1e-148   
ref|XP_006361975.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       446   2e-148   
dbj|BAB86930.1|  glucosyltransferase-12                                 444   7e-148   Vigna angularis [azuki bean]
gb|KDO38337.1|  hypothetical protein CISIN_1g011531mg                   443   4e-147   
ref|XP_004302685.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       440   4e-146   
ref|XP_006429243.1|  hypothetical protein CICLE_v10011602mg             440   8e-146   
gb|KDO58004.1|  hypothetical protein CISIN_1g037999mg                   436   7e-145   
gb|KHG08953.1|  hypothetical protein F383_15475                         437   2e-144   
dbj|BAB86929.1|  glucosyltransferase-11                                 436   2e-144   Vigna angularis [azuki bean]
ref|XP_007026847.1|  UDP-glucosyl transferase 85A3, putative isof...    435   8e-144   
ref|XP_007026848.1|  UDP-glucosyl transferase 85A3, putative isof...    434   1e-143   
gb|EPS60746.1|  hypothetical protein M569_14056                         432   3e-143   
ref|XP_007026845.1|  UDP-glucosyl transferase 85A3, putative isof...    433   6e-143   
emb|CBI36705.3|  unnamed protein product                                426   2e-141   
ref|XP_007207618.1|  hypothetical protein PRUPE_ppa019804mg             424   1e-139   
ref|XP_010676681.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    424   2e-139   
gb|AFJ53007.1|  UDP-glycosyltransferase 1                               422   5e-139   
ref|XP_007207791.1|  hypothetical protein PRUPE_ppa025605mg             422   1e-138   
ref|XP_004305167.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       420   3e-138   
emb|CAN67315.1|  hypothetical protein VITISV_036458                     420   4e-138   Vitis vinifera
ref|XP_010044032.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    419   7e-138   
ref|XP_007207170.1|  hypothetical protein PRUPE_ppa022102mg             419   7e-138   
dbj|BAM63146.1|  uncharacterized glucosyltransferase 2                  419   9e-138   
ref|XP_008242286.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       419   1e-137   
emb|CDP14405.1|  unnamed protein product                                413   2e-137   
ref|XP_007206751.1|  hypothetical protein PRUPE_ppa025141mg             417   4e-137   
ref|XP_010674285.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    412   2e-134   
emb|CBI31566.3|  unnamed protein product                                410   1e-133   
gb|EPS61663.1|  hypothetical protein M569_13131                         407   5e-133   
emb|CDP05613.1|  unnamed protein product                                403   2e-132   
ref|XP_003520949.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       403   1e-131   
ref|XP_007026846.1|  UDP-glucosyl transferase 85A3, putative isof...    400   1e-130   
ref|XP_009594030.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    395   1e-129   
ref|XP_008242262.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       397   2e-129   
ref|XP_003522179.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       397   4e-129   
ref|XP_006379614.1|  hypothetical protein POPTR_0008s06270g             392   6e-129   
ref|XP_004957723.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       394   5e-128   
ref|XP_006361974.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       389   3e-127   
ref|XP_007133898.1|  hypothetical protein PHAVU_010G001300g             390   2e-126   
dbj|BAC57706.1|  putative glucosyltransferase-2                         389   4e-126   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059664.1|  Os07g0486700                                       389   9e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007026850.1|  UDP-glucosyl transferase 85A4-like protein i...    387   5e-125   
ref|XP_008346926.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       386   7e-125   
ref|XP_007219664.1|  hypothetical protein PRUPE_ppa023956mg             382   1e-124   
ref|XP_003563101.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    385   4e-124   
ref|XP_008450117.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       382   1e-123   
ref|XP_007026851.1|  UDP-Glycosyltransferase superfamily protein ...    381   1e-122   
gb|KGN54319.1|  hypothetical protein Csa_4G303180                       380   2e-122   
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       379   3e-122   
dbj|BAJ98857.1|  predicted protein                                      378   5e-122   
ref|XP_004305165.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       379   7e-122   
gb|EAZ03912.1|  hypothetical protein OsI_26045                          378   1e-121   Oryza sativa Indica Group [Indian rice]
ref|XP_007133982.1|  hypothetical protein PHAVU_010G009000g             377   2e-121   
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       377   2e-121   
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             375   9e-121   
gb|ACD03242.1|  UDP-glycosyltransferase UGT709A10                       375   1e-120   Avena strigosa
ref|XP_004299647.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       375   1e-120   
gb|EMT06489.1|  Cytokinin-O-glucosyltransferase 2                       374   2e-120   
gb|EAZ03904.1|  hypothetical protein OsI_26038                          375   2e-120   Oryza sativa Indica Group [Indian rice]
ref|NP_001175206.1|  Os07g0489950                                       375   2e-120   
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       374   3e-120   
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       374   5e-120   
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      375   7e-120   
ref|NP_001059665.1|  Os07g0487100                                       373   1e-119   Oryza sativa Japonica Group [Japonica rice]
gb|AFK34769.1|  unknown                                                 372   2e-119   
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       372   2e-119   
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    372   3e-119   
gb|EAZ39840.1|  hypothetical protein OsJ_24281                          371   5e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008467017.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       364   7e-119   
emb|CBI31568.3|  unnamed protein product                                365   1e-118   
emb|CDP01076.1|  unnamed protein product                                370   2e-118   
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             370   2e-118   
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         369   3e-118   Populus trichocarpa [western balsam poplar]
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    368   5e-118   Vitis vinifera
dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          368   7e-118   
gb|KHN15666.1|  UDP-glycosyltransferase 85A7                            367   9e-118   
ref|XP_003576916.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    368   1e-117   
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    368   1e-117   
ref|XP_003560193.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    367   1e-117   
gb|ACF88457.1|  unknown                                                 367   2e-117   Zea mays [maize]
ref|NP_001148991.1|  cytokinin-O-glucosyltransferase 2                  367   3e-117   Zea mays [maize]
gb|EEC82058.1|  hypothetical protein OsI_26044                          366   3e-117   Oryza sativa Indica Group [Indian rice]
ref|NP_001059671.1|  Os07g0490100                                       366   4e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    366   5e-117   
gb|KDP41399.1|  hypothetical protein JCGZ_15806                         365   1e-116   
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       365   1e-116   
ref|XP_003560194.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    364   2e-116   
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       363   4e-116   
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       364   5e-116   
ref|XP_004299648.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       363   5e-116   
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    363   6e-116   
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    363   9e-116   
ref|XP_006351766.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       363   9e-116   
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       362   1e-115   
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    362   2e-115   
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    362   2e-115   
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       362   2e-115   
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     361   3e-115   
ref|XP_004173134.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    355   3e-115   
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    361   3e-115   
ref|NP_001175205.1|  Os07g0489200                                       361   4e-115   
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     361   4e-115   
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    361   4e-115   
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    361   4e-115   
gb|KDO69249.1|  hypothetical protein CISIN_1g0487532mg                  354   5e-115   
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       361   5e-115   
gb|ACJ84649.1|  unknown                                                 360   6e-115   Medicago truncatula
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  360   1e-114   
gb|KDP41397.1|  hypothetical protein JCGZ_15804                         360   1e-114   
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    359   2e-114   
gb|AFK33787.1|  unknown                                                 359   2e-114   
gb|AFK37311.1|  unknown                                                 359   3e-114   
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    358   8e-114   
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    357   1e-113   Vitis vinifera
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            357   1e-113   
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    357   2e-113   
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       357   2e-113   
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    357   3e-113   
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    356   5e-113   
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    355   6e-113   
dbj|BAD93690.1|  glycosyltransferase                                    355   7e-113   Nicotiana tabacum [American tobacco]
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      355   7e-113   
gb|EAZ03903.1|  hypothetical protein OsI_26037                          355   8e-113   
dbj|BAG80542.1|  glycosyltransferase                                    355   9e-113   
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  355   9e-113   
ref|XP_002462874.1|  hypothetical protein SORBIDRAFT_02g033570          355   9e-113   
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  355   9e-113   
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              355   1e-112   
ref|XP_008242242.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       353   1e-112   
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    355   1e-112   
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    355   2e-112   
dbj|BAB86928.1|  glucosyltransferase-10                                 354   2e-112   
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    354   2e-112   
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    354   2e-112   
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       354   3e-112   
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    353   3e-112   
ref|XP_008350015.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       351   4e-112   
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             353   4e-112   
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    353   4e-112   
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    353   5e-112   
emb|CDY38225.1|  BnaC05g17420D                                          353   5e-112   
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       353   5e-112   
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    353   5e-112   
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    353   6e-112   
ref|XP_008219458.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       352   8e-112   
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    352   1e-111   
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    352   1e-111   
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    352   1e-111   
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       352   1e-111   
ref|XP_006416204.1|  hypothetical protein EUTSA_v10007489mg             352   1e-111   
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    352   2e-111   
ref|XP_004299646.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       352   2e-111   
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             352   2e-111   
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    352   2e-111   
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    352   2e-111   
ref|XP_006658565.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       352   2e-111   
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             352   3e-111   
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             351   3e-111   
ref|XP_003579567.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    351   3e-111   
emb|CDO97432.1|  unnamed protein product                                351   3e-111   
gb|EEE67190.1|  hypothetical protein OsJ_24292                          352   4e-111   
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       351   4e-111   
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              351   4e-111   
ref|XP_002462875.1|  hypothetical protein SORBIDRAFT_02g033580          352   4e-111   
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    350   5e-111   
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    350   7e-111   
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            350   8e-111   
gb|ADG65641.1|  glycosyltransferase                                     350   1e-110   
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             349   1e-110   
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    350   1e-110   
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             349   2e-110   
ref|XP_010937416.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    348   3e-110   
ref|XP_004252532.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    348   3e-110   
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       348   3e-110   
gb|EYU18466.1|  hypothetical protein MIMGU_mgv1a005711mg                348   4e-110   
ref|XP_011087902.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    348   4e-110   
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       348   4e-110   
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             348   4e-110   
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             348   5e-110   
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    348   5e-110   
ref|NP_001277170.1|  UDP-glycosyltransferase 85A2-like                  348   5e-110   
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       348   5e-110   
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       348   5e-110   
ref|XP_008789350.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    348   6e-110   
ref|XP_004963489.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       348   6e-110   
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    348   6e-110   
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    347   7e-110   
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       347   9e-110   
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    347   1e-109   
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    347   1e-109   
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            347   1e-109   
gb|EMT17620.1|  Cytokinin-O-glucosyltransferase 2                       367   1e-109   
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            347   2e-109   
ref|XP_006351765.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       347   2e-109   
gb|KHG03787.1|  hypothetical protein F383_26945                         341   2e-109   
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             347   2e-109   
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             347   2e-109   
ref|XP_009413574.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    346   2e-109   
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       347   2e-109   
ref|XP_008229476.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    346   2e-109   
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                    346   2e-109   
ref|XP_009781211.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    342   2e-109   
ref|XP_004306404.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       346   3e-109   
ref|XP_009790488.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    346   3e-109   
ref|XP_009350671.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    346   3e-109   
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    346   3e-109   
ref|XP_004305885.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       345   3e-109   
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    346   4e-109   
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             346   4e-109   
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       346   4e-109   
emb|CDO97426.1|  unnamed protein product                                346   4e-109   
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             346   4e-109   
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       346   4e-109   
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       345   4e-109   
gb|AIE12476.1|  UGT7                                                    346   5e-109   
gb|KHN24338.1|  UDP-glycosyltransferase 85A3                            345   5e-109   
ref|XP_008219457.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       345   6e-109   
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    345   7e-109   
ref|XP_008229477.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    345   7e-109   
gb|EMT24598.1|  Cytokinin-O-glucosyltransferase 2                       344   1e-108   
gb|EMT23148.1|  Cytokinin-O-glucosyltransferase 2                       345   1e-108   
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like       345   1e-108   
ref|XP_006416205.1|  hypothetical protein EUTSA_v10007502mg             344   1e-108   
ref|XP_008229743.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       345   1e-108   
ref|XP_009604519.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    344   1e-108   
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         344   1e-108   
ref|XP_003575790.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    344   1e-108   
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              344   1e-108   
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    344   1e-108   
gb|AFJ53000.1|  UDP-glycosyltransferase 1                               344   2e-108   
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    344   2e-108   
emb|CDP01079.1|  unnamed protein product                                344   2e-108   
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    344   2e-108   
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                            344   2e-108   
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                343   2e-108   
ref|XP_011009478.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    343   2e-108   
ref|XP_009349615.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    344   2e-108   
ref|XP_007141201.1|  hypothetical protein PHAVU_008G175600g             343   3e-108   
dbj|BAJ95377.1|  predicted protein                                      342   4e-108   
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       344   4e-108   
gb|AIL51400.1|  glycosyltransferase                                     343   4e-108   
ref|XP_011008547.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    343   5e-108   
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       343   5e-108   
ref|XP_010041627.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    343   5e-108   
ref|XP_002301060.1|  hypothetical protein POPTR_0002s09850g             343   5e-108   
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         343   6e-108   
ref|XP_010676160.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    343   6e-108   
gb|EMT31313.1|  Cytokinin-O-glucosyltransferase 2                       342   6e-108   
ref|XP_008229481.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       343   6e-108   
ref|XP_007227474.1|  hypothetical protein PRUPE_ppa004968mg             342   6e-108   
ref|XP_011092429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    342   7e-108   
ref|XP_009349618.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    342   7e-108   
ref|XP_007199429.1|  hypothetical protein PRUPE_ppa026557mg             343   7e-108   
gb|ABV68925.1|  mandelonitrile glucosyltransferase UGT85A19             342   7e-108   
ref|XP_008237171.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       343   7e-108   
ref|NP_001062593.1|  Os09g0119600                                       343   8e-108   
gb|AHL38933.1|  glycosyltransferase                                     342   9e-108   
ref|XP_011009482.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    342   1e-107   
ref|NP_001059667.1|  Os07g0489300                                       341   1e-107   
ref|XP_010025434.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    342   1e-107   
ref|XP_004230580.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    342   1e-107   
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         342   1e-107   
ref|XP_008358180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       342   1e-107   
gb|KHN33502.1|  UDP-glycosyltransferase 85A2                            342   1e-107   
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg             342   1e-107   
gb|EAZ03162.1|  hypothetical protein OsI_25314                          342   2e-107   
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       341   2e-107   
ref|XP_004231354.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    341   2e-107   
ref|XP_002263989.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    341   2e-107   
ref|XP_011008546.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    341   3e-107   
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    341   3e-107   
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          340   3e-107   
ref|XP_007207189.1|  hypothetical protein PRUPE_ppa017055mg             340   3e-107   
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       341   4e-107   
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             343   4e-107   
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g             340   4e-107   
ref|XP_009377941.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    340   5e-107   
ref|XP_003547073.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       340   5e-107   
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    340   6e-107   
ref|XP_004305884.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       340   6e-107   
ref|XP_002310553.1|  hypothetical protein POPTR_0007s05230g             340   6e-107   
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    340   6e-107   
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    340   7e-107   
ref|XP_008229741.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       340   7e-107   
ref|XP_008811183.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       339   9e-107   
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             340   9e-107   
dbj|BAJ97254.1|  predicted protein                                      340   9e-107   
gb|AEB61489.1|  UDP-glucosyltransferase                                 339   9e-107   
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...    340   9e-107   
ref|XP_011004479.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    339   9e-107   
ref|XP_011014733.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    339   1e-106   
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       339   1e-106   
gb|ABW96222.1|  glucosyltransferase                                     340   1e-106   
ref|XP_008229740.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       339   1e-106   
ref|XP_010459988.1|  PREDICTED: UDP-glycosyltransferase 85A2            339   1e-106   
ref|XP_004237926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    339   1e-106   
ref|XP_007148402.1|  hypothetical protein PHAVU_006G205500g             339   1e-106   
ref|XP_008229739.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       339   1e-106   
gb|EPS63474.1|  hypothetical protein M569_11308                         338   1e-106   
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             340   1e-106   
gb|AFK38894.1|  unknown                                                 339   2e-106   
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       339   2e-106   
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             339   2e-106   
ref|XP_002322559.2|  hypothetical protein POPTR_0016s02220g             338   2e-106   
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     338   2e-106   
gb|EYU19973.1|  hypothetical protein MIMGU_mgv1a005383mg                338   2e-106   
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    341   3e-106   
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    338   3e-106   
ref|XP_004155500.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       338   3e-106   
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       339   3e-106   
gb|ADV71371.1|  glycosyltransferase GT14M03                             338   3e-106   
dbj|BAG80547.1|  glycosyltransferase                                    338   3e-106   
gb|EMS53235.1|  UDP-glycosyltransferase 85A2                            338   3e-106   
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      338   3e-106   
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g             338   3e-106   
ref|XP_004299645.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       338   3e-106   
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    338   3e-106   
emb|CDY41486.1|  BnaA08g20880D                                          338   4e-106   
ref|XP_008229475.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    338   4e-106   
ref|XP_008229473.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       338   5e-106   
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             338   5e-106   
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    338   5e-106   
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       337   6e-106   
ref|XP_004155505.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       338   6e-106   
ref|XP_004300654.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       337   7e-106   
ref|XP_008378324.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       337   7e-106   
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    337   8e-106   
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    337   8e-106   
gb|AID16086.1|  flavonol-3-O-glucoside L-rhamnosyltransferase           336   1e-105   
gb|KGN43695.1|  hypothetical protein Csa_7G059660                       337   1e-105   
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       337   1e-105   
dbj|BAK01910.1|  predicted protein                                      337   1e-105   
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             337   1e-105   
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    336   1e-105   
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    336   1e-105   
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          337   2e-105   
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    336   2e-105   
ref|XP_002308829.1|  hypothetical protein POPTR_0006s02310g             336   2e-105   
ref|XP_006853259.1|  hypothetical protein AMTR_s00038p00231120          336   2e-105   
ref|XP_002323978.2|  hypothetical protein POPTR_0017s07940g             336   2e-105   
emb|CDY62992.1|  BnaC07g48400D                                          336   2e-105   
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             336   2e-105   
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       336   2e-105   



>ref|XP_009802463.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=480

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/479 (70%), Positives = 394/479 (82%), Gaps = 4/479 (1%)
 Frame = +2

Query  83    MDQRSS--SHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             MDQ +S  SHVLIFPFPVQGHVNCML+LA+LLC E  +HVTFLNS+F H+RLL YTD+HL
Sbjct  1     MDQPTSCLSHVLIFPFPVQGHVNCMLKLAQLLCREG-LHVTFLNSDFIHRRLLSYTDIHL  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
              +  YPN YF TI DGL  DHPRTGDRVVDLFNSI+ +TKP   EML +    +  RPP+
Sbjct  60    SYKQYPNLYFETIPDGLSDDHPRTGDRVVDLFNSIDTITKPLLMEMLIARRFSTLDRPPL  119

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TCII DGIMCF ID+G EL IPTILFRT SASCFWAFFC+P+LIE G+LP+ G+SDMD L
Sbjct  120   TCIITDGIMCFTIDIGRELNIPTILFRTISASCFWAFFCLPRLIEGGELPITGQSDMDTL  179

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             L NV GME+ LRLRDLPSFCR +DL+DRG   VI AT  T  A+GLILNTFE+LE  ALA
Sbjct  180   LTNVAGMESFLRLRDLPSFCRASDLTDRGLQLVISATQHTKSAHGLILNTFEELEGPALA  239

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             QI K+I  LYTIGPLH  L+ARV+++ G L   SSSSLWEEDRSC+ WLD+QP KSV+YV
Sbjct  240   QITKNISKLYTIGPLHVQLKARVATNIG-LTCTSSSSLWEEDRSCIDWLDQQPFKSVIYV  298

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWA  1156
             SFGSMTVLTR+QF+EF HG+VNSGK FLW +RP SV  D  IP EL+EGTR++GY+V WA
Sbjct  299   SFGSMTVLTRDQFMEFLHGLVNSGKPFLWVVRPKSVAEDYQIPEELLEGTRQRGYIVEWA  358

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEEVL HPA+GGFLTHSGWNSTLESI EG+PMICWPFYADQQVNSRL G VWK G+DMK
Sbjct  359   PQEEVLGHPAIGGFLTHSGWNSTLESIYEGVPMICWPFYADQQVNSRLAGEVWKIGLDMK  418

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMK  1513
             DTCDR+ +EKMVK+L+E R+DEF K +  MAKLARK+ +++GSSY NLDRL++D+K M+
Sbjct  419   DTCDRVIIEKMVKDLIETRKDEFAKSTRLMAKLARKSASENGSSYCNLDRLIKDIKLMR  477



>ref|XP_009608691.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/479 (71%), Positives = 394/479 (82%), Gaps = 4/479 (1%)
 Frame = +2

Query  83    MDQRSS--SHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             MDQ +S  SHVLIFPFPVQGHVNCML+LA+LLC E  +HVTFLNS+F H+RLL YT++HL
Sbjct  1     MDQPTSCLSHVLIFPFPVQGHVNCMLKLAQLLCREG-LHVTFLNSDFIHRRLLSYTNIHL  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
              +  YPN YF TI DGLP DHPRTGDRVVDLFNSI+ VTKPRF EML +       RPP+
Sbjct  60    SYKQYPNLYFETIPDGLPDDHPRTGDRVVDLFNSIDTVTKPRFMEMLIARRFSILDRPPL  119

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TCIIADGIMCF ID+G EL IPTILFRT SASCFWAFFC+P+LIE+G+LP+ G+SDMD L
Sbjct  120   TCIIADGIMCFTIDIGRELNIPTILFRTVSASCFWAFFCLPRLIEAGELPITGQSDMDTL  179

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             L NV GME  LRLRDLPSFCR +DL+DRG   VI AT  T  A+GLILNTFE+LE  ALA
Sbjct  180   LTNVVGMETFLRLRDLPSFCRASDLTDRGLQLVISATQLTKSAHGLILNTFEELEGPALA  239

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             QI  +I  LYTIGPLH  L+ARV+++  +L   SSSSLWEEDRSC+ WLD+QP KSV+YV
Sbjct  240   QITNNISKLYTIGPLHVQLKARVATNI-KLTCTSSSSLWEEDRSCIDWLDQQPFKSVIYV  298

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWA  1156
             SFGSMTVLTR+QF+EF HG VNSGK FLW +RP SV  D  IP EL+EGTR++GY+V WA
Sbjct  299   SFGSMTVLTRDQFMEFLHGFVNSGKPFLWVVRPKSVAEDYQIPEELLEGTRQRGYIVEWA  358

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEEVL HPA+GGFLTHSGWNSTLESI EG+PMICWPFYADQQVNSRLVG VWK G+DMK
Sbjct  359   PQEEVLAHPAIGGFLTHSGWNSTLESIYEGVPMICWPFYADQQVNSRLVGEVWKIGLDMK  418

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMK  1513
             DTCDR+ +E MVK+L+E R+DEF K +  M KLA K+V+++GSSY NLDRL++D+K M+
Sbjct  419   DTCDRVIIENMVKDLIETRKDEFAKSARLMTKLAMKSVSENGSSYCNLDRLIKDIKLMR  477



>gb|AIE12477.1| UGT4 [Panax ginseng]
Length=478

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/481 (59%), Positives = 364/481 (76%), Gaps = 6/481 (1%)
 Frame = +2

Query  83    MDQRSSS--HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             M+++ S+  HVLIFP P+QG VN M +LAELLC  + IH+TFL ++F H RLLRYTD+H 
Sbjct  1     MEKKDSTRPHVLIFPLPLQGPVNSMFKLAELLCL-AGIHITFLVTDFIHTRLLRYTDIHS  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
             RF+ YP F   TISDG+P DHPR GDR+++LF+S+   TKP F+E+L++GSL S    P+
Sbjct  60    RFNRYPGFRLETISDGMPEDHPR-GDRIMELFDSLKTNTKPLFKELLTTGSLGSDKGRPI  118

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TCIIADGIM F  DV NE+ IP I  RT SA C W FFC+P LIE+G+LP NG+ D+D  
Sbjct  119   TCIIADGIMGFTCDVANEIGIPIIYVRTISACCLWVFFCLPNLIEAGELPFNGD-DLDTP  177

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             +++V G EN LR+RDLPSFCR+ D+                RA GLILNTFEDLE   L+
Sbjct  178   IKSVPGTENSLRIRDLPSFCRSGDICHPSIQLYKTERQELRRAYGLILNTFEDLEGPILS  237

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             Q+R   PNLY IGPLH HL+ ++++     P  SS+SLW+ED+SC+ WLD QP KSV+YV
Sbjct  238   QMRTVCPNLYPIGPLHTHLKTKLAAESTS-PAISSNSLWKEDKSCITWLDSQPPKSVIYV  296

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWA  1156
             SFGS+ ++TR+Q +EFWHG+VNSG  FLW IRP+SV GD  IPAE+ EGT+++GY+VGWA
Sbjct  297   SFGSLAIMTRDQLMEFWHGLVNSGCKFLWVIRPDSVAGDSQIPAEVAEGTKERGYIVGWA  356

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEEVL HP+VGGFLTHSGWNSTLES+ EG PMICWP++ DQQVNSR V   WK G+DMK
Sbjct  357   PQEEVLAHPSVGGFLTHSGWNSTLESVIEGKPMICWPYFMDQQVNSRFVEEFWKLGLDMK  416

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
             DTCDR+  EKMVK+LM  RRDEF K +++MA+L +K +++ GSSY NLDRL+ED+K M +
Sbjct  417   DTCDRVIFEKMVKDLMVERRDEFMKSADQMARLGKKCLSEGGSSYCNLDRLIEDIKLMGV  476

Query  1517  Q  1519
             +
Sbjct  477   E  477



>ref|XP_002276823.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=480

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/480 (61%), Positives = 357/480 (74%), Gaps = 8/480 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQ   S HVLIFPFP QGHVN ML+LAELL   + +HVTFLNSE+   RLL +TD+  R
Sbjct  1     MDQGPVSPHVLIFPFPAQGHVNSMLKLAELLS-VAGLHVTFLNSEYNQHRLLLHTDIQTR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             FS YP F F+TISDGL  DHPRTG+RV+DLF  + A  KP FRE++ S    S   PPV 
Sbjct  60    FSGYPGFRFQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVN  119

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADGIM F ID+ NE+ IP I FRT SA  FWA+F   KLIESG+LPL G +DMD+L+
Sbjct  120   CIIADGIMSFTIDIANEVGIPIISFRTISACSFWAYFSALKLIESGELPLKG-NDMDQLV  178

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              ++ GME  LR RDLPS  R ++L D G L V+  T +T RA+ LILNTFEDLE   L Q
Sbjct  179   TSIPGMEGFLRKRDLPSLIRVSNLDDEGLLLVMKETQQTPRAHALILNTFEDLEGPILGQ  238

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P +YTIGPLHAHL+ R++S       +SS+S  +EDRSC+AWLD QP KSV+YVS
Sbjct  239   IRNHCPKIYTIGPLHAHLKTRLASE--STTSQSSNSFRQEDRSCIAWLDHQPSKSVIYVS  296

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVG  1150
             FGS+TV++R Q +EF HG+VNSG  FLW IR +S+    G+   PAEL+EG +++ Y+V 
Sbjct  297   FGSLTVISRKQLIEFCHGLVNSGSRFLWVIRTDSLAEEDGEHQTPAELMEGAKERSYIVE  356

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL HPAVGGFLTHSGWNSTLESIC G+PMICWP++ADQQ+NSR V  VWK G D
Sbjct  357   WAPQEEVLAHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSD  416

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR+ VEKMV++LME R+DE  K +++MA  ARK V++ GSSY NL  LV++++ M
Sbjct  417   MKDTCDRLIVEKMVRDLMEERKDELLKTADKMATRARKCVSEGGSSYCNLSSLVDEIRLM  476



>emb|CDO99846.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/469 (64%), Positives = 347/469 (74%), Gaps = 54/469 (12%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFPFPVQGH+NCML+LAELLC    +HVTFLNS   H+RLL  TD+H  FS YP+F+
Sbjct  6     HVLIFPFPVQGHINCMLKLAELLCCRG-LHVTFLNSHHIHERLLCCTDIHYHFSQYPSFH  64

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TISDGLPADHPRTGD ++         T  +F           +GRP +TCIIADGIM
Sbjct  65    FETISDGLPADHPRTGDHIL---------TGLQFH--------SPNGRPALTCIIADGIM  107

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              F +DV  EL IPTILFRT SASCFWAF CVPKL+E+G+LP NGE+DMDKLL +V G+E 
Sbjct  108   SFTVDVAKELHIPTILFRTVSASCFWAFLCVPKLLEAGELPFNGENDMDKLLSSVPGLER  167

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
               R+RDLPSFCRT++L+D GF  VI  TL+  +A+GL+LNTFEDLEESAL+ IR HIP L
Sbjct  168   -FRMRDLPSFCRTSNLADPGFQVVISETLQNLKADGLLLNTFEDLEESALSHIRTHIPKL  226

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             YT+GPLHAHL+AR +SS   L   SSSSLW+EDRSCMAWLD +P  SV+YVSFGSMTVLT
Sbjct  227   YTVGPLHAHLKAREASSPA-LQQPSSSSLWKEDRSCMAWLDRKPRNSVIYVSFGSMTVLT  285

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQEEVLVHP  1183
             RNQ  EFWHG+VNSGK FLW                                  EVL HP
Sbjct  286   RNQLFEFWHGLVNSGKPFLW----------------------------------EVLAHP  311

Query  1184  AVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVE  1363
             AVGGFLTHSGWNSTLESI EG+PMICWPFYADQQVNSRLVG VWK G+DMKDTC+R TVE
Sbjct  312   AVGGFLTHSGWNSTLESIYEGVPMICWPFYADQQVNSRLVGEVWKVGLDMKDTCERATVE  371

Query  1364  KMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             KM+K+LM+V+RDEF  C+   AKLAR++V Q GSS+ NLDRL++D+  M
Sbjct  372   KMIKDLMDVKRDEFMLCAKEKAKLARRSVEQAGSSHCNLDRLIDDINMM  420



>ref|XP_002281029.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=475

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/480 (60%), Positives = 367/480 (76%), Gaps = 11/480 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             M+ RS S HVL+FPFP+QGHVN ML+LAELL   + + +TFLNS++ H RLLRYT++  R
Sbjct  1     MEHRSVSPHVLVFPFPIQGHVNSMLKLAELLSL-AGLRITFLNSDYTHSRLLRYTNILDR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             F+ Y  F F+TISDGLP DHPRTG ++ D+F+ + A TKP FREM+ S    S    PVT
Sbjct  60    FTRYAGFRFQTISDGLPLDHPRTGVQLKDMFDGMKATTKPLFREMIMSWCRSSD---PVT  116

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADGIM FAIDVGNE+ +PTI FRT S   FWA+F +P+LIE+G++P   + DMD+L+
Sbjct  117   CIIADGIMGFAIDVGNEVGVPTISFRTSSPCAFWAYFSLPQLIEAGEVPFK-DDDMDQLV  175

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              +V GME  LR RDLPSFCRT D +D     V++ T +T RA+ LILNTFEDL+ + L+Q
Sbjct  176   TSVPGMEGFLRRRDLPSFCRTKDANDPNLQLVMIETRQTPRADALILNTFEDLDGATLSQ  235

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P LYTIGPLHAHL++R++S      +  S+SLWEED+ C+ WLD QP KSV+YVS
Sbjct  236   IRSHCPKLYTIGPLHAHLKSRLASETTASQF--SNSLWEEDKRCIPWLDRQPSKSVIYVS  293

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVG  1150
             FGS+TV+T+ + +EFWHG+VNSG  FLW IRP+S+    G+   PA+L E T+++G +VG
Sbjct  294   FGSLTVITKEELMEFWHGLVNSGSRFLWVIRPDSLTEKDGEFQPPAQLWEVTKERGQIVG  353

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQEEVL HPAVGGFLT+SGWNST+ESI  G+PMICWP++ADQQVNSR V  VWK G+D
Sbjct  354   WVPQEEVLAHPAVGGFLTYSGWNSTIESIFAGVPMICWPYFADQQVNSRFVSHVWKLGMD  413

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR+T+EKMV++LME RR EFTK +  MAKLAR ++++ GSSY N  RL+E ++ M
Sbjct  414   MKDTCDRVTIEKMVRDLMEKRRTEFTKSAEAMAKLARSSLSEGGSSYCNFSRLIESIRLM  473



>ref|XP_011085130.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=472

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/479 (61%), Positives = 354/479 (74%), Gaps = 16/479 (3%)
 Frame = +2

Query  83    MDQRSSS---HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLH  253
             M+Q S+S   HVL+FPFPVQ HVN ML LAE+    S   +TFL  +   Q   R+  + 
Sbjct  1     MEQGSTSVPPHVLVFPFPVQSHVNVMLNLAEIFSI-SGFQITFLIPDHI-QTGPRFDQIS  58

Query  254   LRFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPP  433
             LRF+ YP FYF+ ISDGLP DHPRTGDRV +LF+SIN  TKP+FR +L S +L S+ R P
Sbjct  59    LRFARYPAFYFQAISDGLPLDHPRTGDRVKELFDSINVTTKPQFRNVLKSRALSSNSRAP  118

Query  434   VTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDK  613
             +TCIIADGIM F ID+     IPT+LFR FSA+CFW  FCVPKLI++G+LPL  +SDMD+
Sbjct  119   LTCIIADGIMSFTIDIAQNFGIPTVLFRPFSATCFWTLFCVPKLIQAGELPLKEDSDMDR  178

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESAL  793
             L+EN+ GME VLR+RDLPSFCR  D +D     V+  T R T A+ LILNT EDLEE AL
Sbjct  179   LVENIPGMERVLRVRDLPSFCRVEDAADPQLQHVVSETHRATGAHSLILNTLEDLEEPAL  238

Query  794   AQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVY  973
             A+IR + P LY IGPLH + R          P  S +SL E+ RSC+ WLD+QPLKSVV+
Sbjct  239   ARIRANFPKLYVIGPLHGYFR----------PLWSPNSLNEQHRSCIEWLDDQPLKSVVF  288

Query  974   VSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGW  1153
             VSFG+MTVL   Q +EFW+G+VNSGK FLW + P ++     IP ELIEG+ K G +V W
Sbjct  289   VSFGNMTVLKSQQLVEFWYGLVNSGKPFLWVV-PANLTAGCRIPTELIEGSGKSGKVVDW  347

Query  1154  APQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDM  1333
             APQEEVL HPA GGFLTH GWNSTLESI EG+PMICWPFYADQQVNSRLV  VW+ GVDM
Sbjct  348   APQEEVLSHPATGGFLTHGGWNSTLESIYEGVPMICWPFYADQQVNSRLVEEVWRVGVDM  407

Query  1334  KDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             KD CDR TVEK V+ELMEVRR+EF K S  +A+LARK++++ GSSY+NLD L++D+K M
Sbjct  408   KDICDRKTVEKAVRELMEVRREEFLKSSKDIARLARKSISEGGSSYANLDCLIKDIKHM  466



>ref|XP_010277669.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=497

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/481 (60%), Positives = 363/481 (75%), Gaps = 9/481 (2%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV++FP PVQGHVN ML+L+ELL   + IHVTFL  E  H+RLLR+T++  RF+ +P F+
Sbjct  21    HVVVFPIPVQGHVNSMLKLSELLSL-TGIHVTFLTFEHIHRRLLRFTNVTSRFARWPGFH  79

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI   LP DHP +G ++++ F+S+   + P  REML S   +S  RPPVTCIIADG +
Sbjct  80    FATIPSDLPFDHPNSGPQLMEFFDSLKITSIPPLREMLVSNRRESDVRPPVTCIIADGTL  139

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              F IDV  EL IP I FRT SA  FWA+F +PKL+E+G+LP  G++DMD  +  V GME+
Sbjct  140   SFTIDVAQELNIPVIYFRTISACSFWAYFSIPKLVEAGELPFGGDADMDCPITCVPGMES  199

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILA-TLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
              LR RDLP+F RT +LSDR FL  I+A TL TTRA+ LILNTFE+LE   L+QIR H P 
Sbjct  200   FLRRRDLPNFLRTNNLSDR-FLQFIMAETLNTTRASALILNTFEELEGPILSQIRSHCPK  258

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             LYTIGPLHA L+ +++      P  SS+SLWEE++SC+ WLD +PL+SVVYVSFGS+TV+
Sbjct  259   LYTIGPLHALLQTQIADFS---PSVSSNSLWEENKSCIRWLDSKPLRSVVYVSFGSITVM  315

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVGWAPQEEV  1171
             TR + +EFWHG+VNSGK FLW IRP+ +    G+D I  EL+EGTR++GY+VGWAPQEEV
Sbjct  316   TREEIMEFWHGLVNSGKWFLWVIRPDLLAGKEGEDQILTELVEGTRERGYIVGWAPQEEV  375

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPAVGGFLTHSGWNSTLESIC G+PMICWP++ADQQVNSR V  VWK G+DMKDTCDR
Sbjct  376   LAHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQVNSRFVSEVWKLGLDMKDTCDR  435

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQL*YI  1531
               VE MVKELME + DE  K +++MAKLAR +V++ GSS  N D+L++D+K M L   Y 
Sbjct  436   WKVELMVKELMEKKMDEMLKSADKMAKLARMSVSEGGSSSCNWDKLIKDIKSMCLLQAYS  495

Query  1532  H  1534
             H
Sbjct  496   H  496



>ref|XP_010658496.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=480

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/480 (60%), Positives = 354/480 (74%), Gaps = 8/480 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             M+ RS S HVL+FPFP+QGHVN ML+LAELL   + + +TFLNS + H RLLRYT++  R
Sbjct  1     MEHRSVSPHVLVFPFPIQGHVNSMLKLAELLSL-AGLRITFLNSYYTHSRLLRYTNILDR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             F+ YP F F+TISDGL  DHPRTG+RV+DLF  + A  KP FRE++ S    S   PPV 
Sbjct  60    FTRYPGFRFQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVN  119

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADGIM F ID+ NE+ IP I FRT SA  FWA+F   KLIESG+LPL G +DMD+L+
Sbjct  120   CIIADGIMSFTIDIANEVGIPIISFRTISACSFWAYFSALKLIESGELPLKG-NDMDQLV  178

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              ++ GME  LR RDLPS  R ++L D   L V   T +T RA  LILNTFEDLE   L Q
Sbjct  179   TSIPGMEGFLRKRDLPSLIRVSNLDDERLLLVTKETQQTPRAYALILNTFEDLEGPILGQ  238

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P  YTIGPLHAHL  R++S       +SS+SL +EDRSC+AWL+ QP KSV+YVS
Sbjct  239   IRNHCPKTYTIGPLHAHLETRLASE--STTSQSSNSLRQEDRSCIAWLNRQPSKSVIYVS  296

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVG  1150
             FGS+TV+TR Q +EF +G+VNSG  FLW IR +S+    G+   PAEL+EG +++ Y+V 
Sbjct  297   FGSVTVITRKQLIEFCYGLVNSGSRFLWVIRTDSLAEEDGERQTPAELLEGAKERSYIVE  356

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL HPAVGGFLTHSGWNSTLESIC G+PMICWP++ADQQ+NSR V  VWK G D
Sbjct  357   WAPQEEVLAHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSD  416

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR+ VEKMV++LME RRDE  K ++ MA  ARK V++ GSSY NL  L+E+++ M
Sbjct  417   MKDTCDRLIVEKMVRDLMEERRDELLKTADMMATRARKCVSEGGSSYCNLSSLIEEIRLM  476



>ref|XP_002276771.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=480

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/480 (60%), Positives = 352/480 (73%), Gaps = 8/480 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQ   S HVLIFPFP QGHVN ML+LAELL     +HVTFLNS++   RL  +TD+  R
Sbjct  1     MDQGPVSPHVLIFPFPSQGHVNSMLKLAELLS-VVGLHVTFLNSDYNQHRLFLHTDIQTR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             FS YP F F+TISDGL  DHPRTG+RV+DLF  + A  KP FRE++ S    S  RPPV+
Sbjct  60    FSRYPGFRFQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELMISRGQGSDTRPPVS  119

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADG+M F ID+ NE+ IP I FRT SA  FWA+F   KLIESG+LPL G +DMD+L+
Sbjct  120   CIIADGMMSFTIDIANEVGIPIISFRTVSACSFWAYFSALKLIESGELPLKG-NDMDQLV  178

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              ++ GME  LR RDLPS  R ++L D G L +   T +T RA+ LILNTFEDLE   L Q
Sbjct  179   TSIPGMEGFLRKRDLPSLLRVSNLDDEGLLLLTKETQQTPRAHALILNTFEDLEGPILGQ  238

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P  YTIGPLHAHL+ R++S       +SS+S  +EDRSC+AWLD QP KSV+YVS
Sbjct  239   IRNHCPKTYTIGPLHAHLKTRLASE--STTSQSSNSFRQEDRSCIAWLDHQPSKSVIYVS  296

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVG  1150
             FGSM V++R Q +EF +G+VNS   FLW IR +S+    G+   PAEL+EG +++ Y+V 
Sbjct  297   FGSMVVISRKQLIEFCYGLVNSSSRFLWVIRTDSLAEEDGEHQTPAELMEGAKERSYIVE  356

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL HPAVGGFLTHSGWNSTLESIC G+PMICWP++ADQQ+NSR V  VWK G D
Sbjct  357   WAPQEEVLAHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSD  416

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR+ VEKMV++LME R+DE  K ++ MA  ARK V++ GSSY NL  L+E+++ M
Sbjct  417   MKDTCDRLIVEKMVRDLMEERKDELLKTADMMATRARKCVSEGGSSYCNLSSLIEEIRLM  476



>ref|XP_002276617.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
 ref|XP_010658495.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=478

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/480 (60%), Positives = 352/480 (73%), Gaps = 8/480 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQ   S HVLIFPFP QGHVN ML+LAELL     +HVTFLNS++   RL  +TD+  R
Sbjct  1     MDQGPVSPHVLIFPFPSQGHVNSMLKLAELLS-VVGLHVTFLNSDYNQHRLFLHTDIQTR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             FS YP F F+TISDGL  DHPRTG+RV+DLF  + A  KP FRE++ S    S  RPPV+
Sbjct  60    FSRYPGFRFQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELMISRGQGSDTRPPVS  119

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADG+M F ID+ NE+ IP I FRT SA  FWA+F   KLIESG+LPL G +DMD+L+
Sbjct  120   CIIADGMMSFTIDIANEVGIPIISFRTVSACSFWAYFSALKLIESGELPLKG-NDMDQLV  178

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              ++ GME  LR RDLPS  R ++L D G L V   T +T RA+ LILNTFEDLE   L Q
Sbjct  179   TSIPGMEGFLRKRDLPSLLRVSNLDDEGLLLVTKETQQTPRAHALILNTFEDLEGPILGQ  238

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P  YTIGPLHAHL+ R++S       +SS+S  +EDRSC+AWLD QP KSV+YVS
Sbjct  239   IRNHCPKTYTIGPLHAHLKTRLASE--STTSQSSNSFRQEDRSCIAWLDHQPSKSVIYVS  296

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVG  1150
             FGSM V++R Q +EF +G+VNS   FLW IR +S+    G+   PAEL+EG +++ Y+V 
Sbjct  297   FGSMVVISRKQLIEFCYGLVNSSSRFLWVIRTDSLAEEDGEHQTPAELMEGAKERSYIVE  356

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL HPAVGGFLTHSGWNSTLESIC G+PMICWP++ADQQ+NSR V  VWK G D
Sbjct  357   WAPQEEVLAHPAVGGFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSD  416

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR+ VEKMV++LME R+DE  + ++ MA  ARK V++ GSSY NL  L+E+++ M
Sbjct  417   MKDTCDRLIVEKMVRDLMEERKDELLETADMMATRARKCVSEGGSSYCNLSSLIEEIRLM  476



>gb|AGX93067.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Cinchona 
calisaya]
Length=483

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/481 (59%), Positives = 357/481 (74%), Gaps = 7/481 (1%)
 Frame = +2

Query  80    TMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             + D     HVLIFP P+QGHVN MLRLAELLC  S + +TF+ SEF+H RLL++T + LR
Sbjct  4     SQDSNLPPHVLIFPLPIQGHVNSMLRLAELLCL-SDLDITFIVSEFSHNRLLKHTSVALR  62

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRF-REMLSSGSLQSSGRPPV  436
             F+ YP F F+TISDGLP DHPR G++V+D+  +I  VT P F R M+      S+ R P+
Sbjct  63    FARYPGFRFQTISDGLPDDHPRAGEQVMDIMPAIKNVTGPLFKRMMIEKNCFASANRRPI  122

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TCIIADG++ FA D   + RIP + FRT SA  FWA FC+P+LIE+GD+P+ GE  MD  
Sbjct  123   TCIIADGVLSFAGDFAEQKRIPLVYFRTVSACSFWACFCMPQLIEAGDIPVKGEG-MDLP  181

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             +++V GME  LR RDLP FCR  D+++     +   T +T RA   ILNTFEDLE   LA
Sbjct  182   VKSVPGMEGFLRRRDLPGFCRVNDINEPKLQIIKNETRQTPRAQAAILNTFEDLEGPILA  241

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             +IRK++P LYTIGP H+ L AR+ +   +    SS S WEEDRSC+ WL+ QP KSV+YV
Sbjct  242   EIRKYMPRLYTIGPSHSQLTARLEAQNTKTSI-SSGSFWEEDRSCIEWLNSQPPKSVIYV  300

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+TV+TR Q LEFW G+VNSG+ FLW +RP+S++G D    IPAEL +GT+++GYMV
Sbjct  301   SFGSITVVTREQLLEFWCGLVNSGQRFLWVMRPDSLMGKDGESQIPAELEKGTKERGYMV  360

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GWAPQEEVL H A+GGF THSGWNSTLESI  G+PMICWP++ADQ +NSR V  VWK G+
Sbjct  361   GWAPQEEVLNHSAIGGFFTHSGWNSTLESIVTGVPMICWPYFADQMINSRFVSEVWKIGL  420

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKDTCDRI +EKMV++LM+VR+DEF++ ++ MAKLARKAV + GSSY NLD LVE +K 
Sbjct  421   DMKDTCDRIIIEKMVRDLMDVRKDEFSQRADDMAKLARKAVNEGGSSYQNLDALVEYIKS  480

Query  1508  M  1510
             M
Sbjct  481   M  481



>ref|XP_010650608.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=487

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/480 (59%), Positives = 359/480 (75%), Gaps = 11/480 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             M+ RS S HVLIFP PVQGHVN ML+LAELL   + + +TFLNS++ H RLLRYT++  R
Sbjct  1     MEHRSVSPHVLIFPLPVQGHVNPMLKLAELLSL-AGLRITFLNSDYNHHRLLRYTNILDR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             ++ YP F F+TISDGLP D PRTG  + D+ + I A TKP FREM+ S    S    PVT
Sbjct  60    YTRYPGFRFQTISDGLPLDRPRTGAGLRDMMDGIKATTKPLFREMVISWCRSSD---PVT  116

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADG+M FAIDV NE+ +P I  RT S  CF A+F   +LIE+G++P   + DMD+L+
Sbjct  117   CIIADGLMSFAIDVANEVGVPIISCRTVSPCCFLAYFSFAELIEAGEVPFK-DDDMDRLV  175

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
               V GME  LR RDLPSFCRT D +DRG   +I  T +T RA+ LILNTFEDL+   L+Q
Sbjct  176   TRVPGMEGFLRRRDLPSFCRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQ  235

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P +YTIGPLHAHL++R++S      +  S+S W EDRSC+AWLD QP KSV+YVS
Sbjct  236   IRNHCPKIYTIGPLHAHLKSRLASETTTSQF--SNSFWVEDRSCLAWLDRQPSKSVIYVS  293

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVG  1150
             FGS+TV+T+ Q +EFWHG+VNSG  FLW IRP+S+    G+  + A+L E T+++G +V 
Sbjct  294   FGSITVITKEQMMEFWHGLVNSGSRFLWVIRPDSLTEKDGEFQLQAQLWEVTKERGQIVD  353

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL HPAVGGFLTH GWNSTLESI  G+PMICWP++ DQQ+NSR V  VWK G+D
Sbjct  354   WAPQEEVLAHPAVGGFLTHGGWNSTLESIFAGVPMICWPYFTDQQLNSRFVSHVWKMGMD  413

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR+T+EKMV+++ME RR EFTK  + MAKLAR+++++ G+SY N DRL+ED++ M
Sbjct  414   MKDTCDRVTIEKMVRDVMEGRRAEFTKSVDAMAKLARRSLSEGGTSYCNFDRLIEDIRLM  473



>gb|AGX93068.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Amsonia 
hubrichtii]
Length=482

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/473 (59%), Positives = 358/473 (76%), Gaps = 7/473 (1%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QGHVN MLRLAELL   + + +TF+ SEF+H RL+++T++  RF+ YP F 
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELL-CLAELDITFIVSEFSHSRLVKHTNIASRFARYPGFQ  69

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSL-QSSGRPPVTCIIADGI  460
             F+TISDGLP DHPR G+RV+D+  +   VT P F++M+   +   ++ R P+TCIIADG+
Sbjct  70    FQTISDGLPDDHPRAGERVMDILPATKNVTGPLFKQMMVEKNFFATTTRRPITCIIADGV  129

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             + FA D   E  IP I FRT SA  FWA FC+P+LIE+GD+P+ G   MD ++++V GME
Sbjct  130   LSFAGDFAEETGIPLIYFRTVSACSFWACFCMPELIEAGDIPIKGNG-MDLIVKSVPGME  188

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
               LR RDLP FCR  D+++     +   T +TTRA   ILNTFEDLE   L+QIRKH+P 
Sbjct  189   CFLRRRDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIRKHMPR  248

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             L+TIGP H+HL +R+ S   +    SS S WEEDRSC+ WLD QP KSV+YVSFGS+TV+
Sbjct  249   LFTIGPSHSHLTSRLESKNIKTSI-SSGSFWEEDRSCVDWLDAQPPKSVLYVSFGSITVV  307

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQEEV  1171
             TR+Q LEFWHG+VNSG+ FLW +RP+S++G+D    IPAEL EGT+ +GYMVGWAPQEEV
Sbjct  308   TRDQLLEFWHGLVNSGQRFLWVMRPDSIMGEDGKSQIPAELEEGTKARGYMVGWAPQEEV  367

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPA+GGF THSGWNSTLESI  G+PMICWP++ADQ +NSR V  +WK G+DMKDTCDR
Sbjct  368   LNHPAIGGFFTHSGWNSTLESIVSGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCDR  427

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
               +EKMV+ELMEVR+DEF + S+ +AKLARKAV + GSSY+NLD LVE +K M
Sbjct  428   DAIEKMVRELMEVRKDEFLQRSDHIAKLARKAVGEGGSSYANLDGLVEYIKSM  480



>ref|XP_002280470.2| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetic acid glucosyltransferase-like 
[Vitis vinifera]
Length=479

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/479 (57%), Positives = 357/479 (75%), Gaps = 9/479 (2%)
 Frame = +2

Query  83    MDQRSSS-HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQ S S HVLIFPFP+QG+VN ML+LAELLC  + I VTFLN  + H+RLL Y+++  R
Sbjct  1     MDQGSGSPHVLIFPFPIQGNVNSMLKLAELLCL-AGIQVTFLNCHYPHRRLLSYSNIQAR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG-RPPV  436
             FS YP F F TISDGLP +HPRT ++ +D+ + +   TKP F +M+ S    +S  R P+
Sbjct  60    FSRYPGFRFETISDGLPMEHPRTAEQFLDIVDGVKTTTKPLFMKMMISWCRSASDTRSPL  119

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TC+IADG+M FAIDV NE+ +P I+FR  SA  FWA+F +P+LIE+G++P  G  DMD+L
Sbjct  120   TCVIADGLMSFAIDVANEVGLPVIIFRAISACSFWAYFSLPQLIEAGEVPFRG-GDMDRL  178

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             + +V GME  LR RDLPS C   D+ D    +++  T +T RA+ L++NTF+DLE   L+
Sbjct  179   VASVPGMEGFLRRRDLPSCCXLKDVDDPDLQNLMKNTRQTHRAHALVINTFDDLEGPILS  238

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             QIR H P  YTIGPLHA L+ ++++       +SS+S WEEDRSC+ WLD QP KSV+YV
Sbjct  239   QIRNHCPRTYTIGPLHALLKTKLATETSTS--QSSNSFWEEDRSCIPWLDRQPSKSVIYV  296

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+ ++T+ +  EFWHG+VNSG  FLW IRP++++G D     PAEL+EGT+ +GY+V
Sbjct  297   SFGSLAIITKEELREFWHGLVNSGSRFLWVIRPDALVGKDEERQTPAELLEGTKDRGYVV  356

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GWAPQEEVL HPAVGGFLTH GWNSTLESI EGLPMICWP++ADQQ+NSR V  VWK G+
Sbjct  357   GWAPQEEVLKHPAVGGFLTHGGWNSTLESIVEGLPMICWPYFADQQINSRFVSHVWKLGM  416

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             DMKD+CDR+TVEKMV++LM  +RDEF + ++ +A LA+K V   GSS  NL+ L+ED++
Sbjct  417   DMKDSCDRVTVEKMVRDLMVEKRDEFMEAADTLATLAKKCVGDSGSSSCNLNSLIEDIR  475



>gb|AGX93071.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Vinca 
minor]
Length=482

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/473 (58%), Positives = 351/473 (74%), Gaps = 7/473 (1%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QGHVN MLRLAELLC  + + +TF+ S+F+H RL+++T++  RF+ YP F 
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELLCL-AKLDITFVVSDFSHNRLIKHTNVASRFARYPGFQ  69

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRF-REMLSSGSLQSSGRPPVTCIIADGI  460
             F+TISDGLP DHPR G++V+D+  S   VT P F R M+ +    SS R P TCIIADG+
Sbjct  70    FQTISDGLPDDHPRAGEKVMDILPSTKNVTGPLFKRMMIENNCFASSTRRPTTCIIADGV  129

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             + FA D   E  +P I FRT SA  FWA F +P+LIESGD+P+ G + MD L++ V GME
Sbjct  130   LSFAGDFAEENGVPLIYFRTVSACAFWACFSMPELIESGDIPIKG-NGMDLLVKGVAGME  188

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
               LR RDLP FCR  D+S+     +   T +TTRA   ILNTFEDLE   L+QIRKHIP 
Sbjct  189   TFLRRRDLPGFCRVNDMSEPKLQIIKTETRQTTRAQAAILNTFEDLEGPILSQIRKHIPR  248

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             L+TIGP H+HL +R+ +   +    SS S WEEDRSC+ WLD QP +SV+YVSFGS+TV+
Sbjct  249   LFTIGPSHSHLNSRLETQNIKTSI-SSGSFWEEDRSCVDWLDSQPPRSVLYVSFGSITVV  307

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVGWAPQEEV  1171
             TR Q LEFWHG+VNSG  FLW +RP+S++G D    +P EL EGT+++GYMVGWAPQEEV
Sbjct  308   TRAQLLEFWHGLVNSGHRFLWVMRPDSIMGKDGENRVPHELEEGTKERGYMVGWAPQEEV  367

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L H A+GGF TH GWNSTLESI  G+PMICWP++ADQ +NSR V  +WK G+DMKD+CDR
Sbjct  368   LNHSAIGGFFTHCGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDSCDR  427

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
               + KMV+ELMEV++DEF + ++ MAKLARKAV++ GSSYSNLD LVE ++ +
Sbjct  428   EIIVKMVRELMEVKKDEFMERADEMAKLARKAVSEGGSSYSNLDALVEYIRSL  480



>gb|EYU19962.1| hypothetical protein MIMGU_mgv1a005720mg [Erythranthe guttata]
Length=473

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/478 (58%), Positives = 362/478 (76%), Gaps = 10/478 (2%)
 Frame = +2

Query  83    MDQRS--SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             MD+++    HVLIFP P+QG VN ML+LAELLC  + +HVTFL +++ + RL R++++  
Sbjct  1     MDEKAVPPPHVLIFPLPLQGPVNSMLKLAELLCL-ADLHVTFLVTDYIYARLQRHSNIQT  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
             RFSSYP F+ RTISDGLP +HPR GD+ ++LF S+   TKP F++MLS+GSL S     V
Sbjct  60    RFSSYPGFHIRTISDGLPENHPR-GDKFLELFESLMTNTKPLFKDMLSNGSLGSR----V  114

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             +CIIADGI+ F  DV N++R+P    RT SA+C W FF +P+LI++GDLP  G+ D+D  
Sbjct  115   SCIIADGILGFTCDVANQIRVPIFYVRTISAACLWVFFRLPELIQAGDLPFQGD-DLDVA  173

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             +++V GME  LR RDLPSFCR+ D+SD         +    RA GLILNTFEDLE   L 
Sbjct  174   VKSVPGMERYLRRRDLPSFCRSADISDPIIEMYKAESTENARAYGLILNTFEDLEGPILN  233

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             ++R   PN+YTIGPLHAHL+A+++++    P   S+SLWEEDR+CM WLD QP KSV+YV
Sbjct  234   EMRTICPNIYTIGPLHAHLKAQLAANSTSAPPAFSNSLWEEDRTCMTWLDSQPPKSVIYV  293

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWA  1156
             SFGS+ V+T +Q +EFW+G+VNSG+ FLW IRP+S+ G + IP EL +GTR++GY+VGWA
Sbjct  294   SFGSLAVMTNDQLMEFWYGLVNSGQKFLWVIRPDSISGYE-IPVELSQGTRERGYIVGWA  352

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEEVL H AVGGFLTHSGWNSTLES+ EG+PMICWP++ DQQVNSRLV   WK G+DMK
Sbjct  353   PQEEVLAHRAVGGFLTHSGWNSTLESVYEGVPMICWPYFMDQQVNSRLVEEEWKLGLDMK  412

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             DTCDR  +EK +K LMEVR+DEF   ++ MAK A+ ++T+ GSS+SNL RL++D+K +
Sbjct  413   DTCDRSLIEKTIKNLMEVRKDEFLLRADDMAKSAKTSLTEGGSSFSNLKRLIDDIKSL  470



>ref|XP_010650643.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=476

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/480 (59%), Positives = 358/480 (75%), Gaps = 11/480 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             M+ RS S HVLIFP PVQGHVN ML+LAELL   + + +TFLNS++ H RLLRYT++  R
Sbjct  1     MEHRSVSPHVLIFPLPVQGHVNPMLKLAELLSL-AGLRITFLNSDYNHHRLLRYTNILDR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             ++ YP F F+TISDGLP D P TG  + D+ + I A TKP FREM+ S    S    PVT
Sbjct  60    YTRYPGFRFQTISDGLPLDRPWTGAGLRDMMDGIKATTKPLFREMVISWCQSSD---PVT  116

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADG+M FAIDV NE+ +P I  RT S  CF A+F   +LIE+G++P   + DMD+L+
Sbjct  117   CIIADGLMSFAIDVANEVGVPIISCRTVSPCCFLAYFSFAELIEAGEVPFK-DDDMDRLV  175

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
               V GME  LR RDLPSFCRT D +DRG   +I  T +T RA+ LILNTFEDL+   L+Q
Sbjct  176   TRVPGMEGFLRRRDLPSFCRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQ  235

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P +YTIGPLHAHL++R++S      +  S+S WEEDRSC+AWLD QP KS +YVS
Sbjct  236   IRNHCPKIYTIGPLHAHLKSRLASETTTSQF--SNSFWEEDRSCLAWLDRQPSKSFIYVS  293

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVG  1150
             FGS+TV+T+ Q +EFWHG+VNSG  FLW IRP+S+    G+  + A+L E T+++G +V 
Sbjct  294   FGSITVITKEQMMEFWHGLVNSGSRFLWVIRPDSLTEKDGEFQLQAQLREVTKERGQIVD  353

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL HPAVGGFLTH GWNSTLESI  G+PMICWP+++DQQ+NSR V  VWK G+D
Sbjct  354   WAPQEEVLAHPAVGGFLTHGGWNSTLESIFAGVPMICWPYFSDQQLNSRFVSHVWKIGMD  413

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR+TVEKMV+++ME RR EFTK  + MAKLAR ++++ G+SY N +RL+ED++ M
Sbjct  414   MKDTCDRVTVEKMVRDVMEERRAEFTKSVDAMAKLARSSLSEGGTSYCNFNRLIEDIRLM  473



>ref|XP_010262685.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262687.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262688.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262689.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/472 (59%), Positives = 351/472 (74%), Gaps = 8/472 (2%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+ P P+QGH+N ML+L+EL+   +  HVTFLN+E  H+ LL +T++  RF+ +P F+
Sbjct  10    HVLVLPIPLQGHINSMLKLSELI-SLAGFHVTFLNTEHIHRLLLHFTNVTSRFARWPGFH  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP DHPR+G  +V+LF+S+   + P  REML S    S  RPPVTCIIADGIM
Sbjct  69    FATIPDGLPFDHPRSGPGLVELFDSLKITSIPLLREMLVSNRWGSDVRPPVTCIIADGIM  128

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              F IDV  +L IPTI FRT SA  FWA+FCVPKLIE+G++P   ++DMD  +  V GMEN
Sbjct  129   SFTIDVARDLNIPTIFFRTVSACSFWAYFCVPKLIEAGEIPFR-DADMDCPITCVPGMEN  187

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
              LR  DLP  CRT +L DR    ++  T+ TTRA+ LILNTFEDLE   L QIR H P L
Sbjct  188   FLRRADLPGSCRTNNLGDRTLQFLVTETINTTRASALILNTFEDLEGPILCQIRSHCPRL  247

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             YTIGPLHA L+ ++S S       SS+SLWEE++SC+ WLD +PL+SVVYVSFGS+  +T
Sbjct  248   YTIGPLHALLKTQISDSSPS---VSSNSLWEENKSCIRWLDSKPLRSVVYVSFGSLATMT  304

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVGWAPQEEVL  1174
             R++ LEFWHG+VNSGK FLW IRP+ +    G+D I  EL+EGTR++ Y+V WAPQEEVL
Sbjct  305   RDEVLEFWHGLVNSGKPFLWVIRPDLLARKEGEDQILTELVEGTRERAYIVEWAPQEEVL  364

Query  1175  VHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRI  1354
              HPAVGGFLTHSGWNSTLESI  G+PMICWP++ADQQ+NSR V  VWK G+DMKDTCDR+
Sbjct  365   AHPAVGGFLTHSGWNSTLESIYAGVPMICWPYFADQQINSRFVSEVWKLGLDMKDTCDRL  424

Query  1355  TVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
              VE MVKE+ME +RDE  K +  MAKLAR +V + GSS  NLD+L++D++ M
Sbjct  425   KVELMVKEVMERKRDEMIKSAENMAKLARMSVGEGGSSSCNLDKLIQDIRSM  476



>sp|U3U992.1|UGT8_CATRO RecName: Full=7-deoxyloganetic acid glucosyltransferase; AltName: 
Full=UDP-glucose glucosyltransferase 8; Short=CrUGT8; AltName: 
Full=UDP-glycosyltransferase 709C2 [Catharanthus roseus]
 dbj|BAO01109.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=482

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/475 (58%), Positives = 359/475 (76%), Gaps = 7/475 (1%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             + HVLIFP P+QGHVN MLRLAELL   + + +TF+ SEF+H RL+++T++  RF+ YP 
Sbjct  9     APHVLIFPLPIQGHVNSMLRLAELL-CLAELDITFIVSEFSHSRLIKHTNVASRFARYPG  67

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREML-SSGSLQSSGRPPVTCIIAD  454
             F F+ ISDGLP DHPR G+RV+D+  S   VT P F++M+  +    S+ R P+TCIIAD
Sbjct  68    FQFQPISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIAD  127

Query  455   GIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEG  634
             G++ FA D   E  IP I FRT SA  FWA FC+P+LIESGD+P+ G   MD ++++V G
Sbjct  128   GVLSFAGDFAQEKGIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNG-MDLIVKSVPG  186

Query  635   MENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHI  814
             ME  LR RDLP FCR  D+++     +   T +TTRA   ILNTFEDLE   L+QIRKH+
Sbjct  187   METFLRRRDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIRKHM  246

Query  815   PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMT  994
             P L+TIGP H+HL +R+ +   +    SS S WEEDRSC+ WLD QP +SV+YVSFGS+T
Sbjct  247   PRLFTIGPSHSHLTSRLETKNIKT-LISSGSFWEEDRSCVDWLDAQPPRSVLYVSFGSIT  305

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQE  1165
             V+TR+Q LEFW+G+VNSG+ FLW +RP+S++G D    IPA+L EGT+ +GYMVGWAPQE
Sbjct  306   VVTRDQLLEFWYGLVNSGQRFLWVMRPDSIMGKDGQSQIPADLEEGTKARGYMVGWAPQE  365

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             EVL HPA+GGFLTHSGWNSTLESI  G+PMICWP++ADQ +NSR V  +WK G+DMKDTC
Sbjct  366   EVLNHPAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTC  425

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             DR T+ KMV+ELME+R+DEF + ++ MAKLA++AV++ GSSYSNLD LV+ +K +
Sbjct  426   DRETIVKMVRELMEIRKDEFLQRADHMAKLAKEAVSEGGSSYSNLDGLVDYIKSL  480



>gb|AGX93072.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Catharanthus 
longifolius]
Length=482

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/473 (58%), Positives = 358/473 (76%), Gaps = 7/473 (1%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QGHVN MLRLAELL   + + +TF+ SEF+H RL+++T++  RF+ YP F 
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELL-CLAELDITFIVSEFSHSRLIKHTNVASRFARYPGFQ  69

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREML-SSGSLQSSGRPPVTCIIADGI  460
             F+ ISDGLP DHPR G+RV+D+  S   VT P F++M+  +    S+ R P+TCIIADG+
Sbjct  70    FQPISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGV  129

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             + FA D   E  IP I FRT SA  FWA FC+P+LIESGD+P+ G   MD ++++V GME
Sbjct  130   LSFAGDFAQEKGIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNG-MDLIVKSVPGME  188

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
               LR RDLP FCR  D+++     +   T +TTRA   ILNTFEDLE   L+QIRKH+P 
Sbjct  189   TFLRRRDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIRKHMPR  248

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             L+TIGP H+HL +R+ +   +    SS S WEEDRSC+ WLD QP +SV+YVSFGS+TV+
Sbjct  249   LFTIGPSHSHLTSRLETKNIKT-LISSGSFWEEDRSCVDWLDAQPPRSVLYVSFGSITVV  307

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQEEV  1171
             TR+Q LEFW+G+VNSG+ FLW +RP+S++G D    IPA+L EGT+ +GYMVGWAPQEEV
Sbjct  308   TRDQLLEFWYGLVNSGQRFLWVMRPDSIMGKDGQSQIPADLEEGTKARGYMVGWAPQEEV  367

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPA+GGFLTHSGWNSTLESI  G+PMICWP++ADQ +NSR V  +WK G+DMKDTCDR
Sbjct  368   LNHPAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCDR  427

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
              T+ KMV+ELME+R+DEF + ++ MAKLA++AV++ GSSYSNLD LV+ +K +
Sbjct  428   ETIMKMVRELMEIRKDEFLQRADHMAKLAKEAVSEGGSSYSNLDGLVDYIKSL  480



>gb|AGX93065.1| 7-deoxyloganetic acid UDP-glucosyltransferase [Catharanthus roseus]
 gb|AGX93073.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Catharanthus 
ovalis]
 gb|AHK60835.1| 7-deoxyloganetic acid-O-glucosyl transferase [Catharanthus roseus]
Length=482

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/473 (58%), Positives = 358/473 (76%), Gaps = 7/473 (1%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QGHVN MLRLAELL   + + +TF+ SEF+H RL+++T++  RF+ YP F 
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELL-CLAELDITFIVSEFSHSRLIKHTNVASRFARYPGFQ  69

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREML-SSGSLQSSGRPPVTCIIADGI  460
             F+ ISDGLP DHPR G+RV+D+  S   VT P F++M+  +    S+ R P+TCIIADG+
Sbjct  70    FQPISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVENKCFSSATRRPITCIIADGV  129

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             + FA D   E  IP I FRT SA  FWA FC+P+LIESGD+P+ G   MD ++++V GME
Sbjct  130   LSFAGDFAQEKGIPLIYFRTVSACSFWACFCMPELIESGDIPIKGNG-MDLIVKSVPGME  188

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
               LR RDLP FCR  D+++     +   T +TTRA   ILNTFEDLE   L+QIRKH+P 
Sbjct  189   TFLRRRDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPILSQIRKHMPR  248

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             L+TIGP H+HL +R+ +   +    SS S WEEDRSC+ WLD QP +SV+YVSFGS+TV+
Sbjct  249   LFTIGPSHSHLTSRLETKNIKT-LISSGSFWEEDRSCVDWLDAQPPRSVLYVSFGSITVV  307

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQEEV  1171
             TR+Q LEFW+G+VNSG+ FLW +RP+S++G D    IPA+L EGT+ +GYMVGWAPQEEV
Sbjct  308   TRDQLLEFWYGLVNSGQRFLWVMRPDSIMGKDGQSQIPADLEEGTKARGYMVGWAPQEEV  367

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPA+GGFLTHSGWNSTLESI  G+PMICWP++ADQ +NSR V  +WK G+DMKDTCDR
Sbjct  368   LNHPAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTCDR  427

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
              T+ KMV+ELME+R+DEF + ++ MAKLA++AV++ GSSYSNLD LV+ +K +
Sbjct  428   ETIVKMVRELMEIRKDEFLQRADHMAKLAKEAVSEGGSSYSNLDGLVDYIKSL  480



>ref|XP_010262684.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/475 (59%), Positives = 357/475 (75%), Gaps = 7/475 (1%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL-RFSSYPNF  280
             HVL+ P PVQGH+N M++L+ELL   +  HVTFL SE  H+RLLR+T+L+  RF+  P F
Sbjct  9     HVLLCPLPVQGHINPMIKLSELL-SLAGFHVTFLTSEHIHRRLLRFTNLNSSRFARCPGF  67

Query  281   YFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGI  460
             +F TI DGLP DHPR+G ++V+LF+S+   + P  REML S    S  RPPVTCIIADG+
Sbjct  68    HFATIPDGLPFDHPRSGPQLVELFDSLKLTSIPLLREMLVSNRWGSDVRPPVTCIIADGL  127

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             + F IDV  EL IP I FRT SA  FWA+FC+PKL+E+G+LP  G++DMD  +  V GME
Sbjct  128   LSFTIDVAEELNIPIISFRTTSACSFWAYFCIPKLVEAGELPFGGDADMDCPVTCVPGME  187

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
             + LR RDLPSFCRT +L +R F  ++   L  TRA+ LILNT+EDLE   L++IR H P 
Sbjct  188   SFLRRRDLPSFCRTNNLGERPFQFLVTENLNATRASALILNTYEDLEGPILSRIRSHCPK  247

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             LYTIGPLHA L+++++ S   +   SSSSLWEE++SC+ WLD + L+SVVYVSFGS+  +
Sbjct  248   LYTIGPLHALLKSQLADSSHSV--SSSSSLWEENKSCITWLDSKALRSVVYVSFGSLATM  305

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVGWAPQEEV  1171
             TR++ LEFWHG+VNSGK FLW IR + +    G+D I  EL++GTR++GY+VGWAPQEEV
Sbjct  306   TRDEVLEFWHGLVNSGKPFLWVIRSDLLSVKEGEDEILTELVKGTRERGYIVGWAPQEEV  365

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPAVGGFLTHSGWNSTLES+  G+PMICWP  ADQQVNSR V  +W+ G+DMKDTCDR
Sbjct  366   LAHPAVGGFLTHSGWNSTLESVYAGVPMICWPKLADQQVNSRFVSEMWRLGLDMKDTCDR  425

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
             + VE MVKE+ME +RDE  K +  MAKLAR +V++ GSS  N D+L++D+K M L
Sbjct  426   LKVELMVKEVMEQKRDEMMKSAENMAKLARMSVSEGGSSSCNFDKLIQDIKSMCL  480



>ref|XP_006379615.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
 gb|ERP57412.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
Length=481

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/486 (56%), Positives = 359/486 (74%), Gaps = 14/486 (3%)
 Frame = +2

Query  83    MDQRSSS--HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             M+ RS+   HVLIFP P QGHVN ML+LAELL   + I++TFLNSE  H+ L RYT++  
Sbjct  1     MENRSNPPPHVLIFPLPCQGHVNSMLKLAELLSL-AGINITFLNSEHNHELLARYTNIED  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
             RF+ YP F F+TI+DGLP DHPR+G ++++LF ++  VTKP F+++L    L++  +PPV
Sbjct  60    RFTKYPGFQFQTIADGLPVDHPRSGGKLMELFEAMKLVTKPVFKKIL----LET--KPPV  113

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
              CII DGI+ F  DV  E+ +P I FRT SA  FWA+F +  +IE G LP+ G  DMD+L
Sbjct  114   NCIIGDGILGFVGDVAIEVGVPFIYFRTVSACSFWAYFSIFDIIEGGQLPIRGNEDMDRL  173

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             +  V GME  LR RDLPSFCR +D++    L V+  T ++ RA  LILNTFEDLE   ++
Sbjct  174   ITKVPGMETFLRCRDLPSFCRVSDMTHPNLLLVMNETRQSPRAKALILNTFEDLEGPLMS  233

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             QIR H P +Y+IGPLH HL+A++S+ + E   +SS+SL E DRSCM WLD QP KSV+YV
Sbjct  234   QIRTHCPEIYSIGPLHEHLQAKLSA-KNEKSCQSSNSLREIDRSCMTWLDNQPEKSVLYV  292

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD----NIPAELIEGTRKKGYM  1144
             SFGS TV+TR+Q LEFW+G+V+S K FLW IRP+S+   D     IP E+ EGT+++G++
Sbjct  293   SFGSFTVMTRHQLLEFWYGLVSSKKRFLWVIRPDSIATKDGEFEKIPVEVEEGTKERGFI  352

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
              GW PQEEVL H A+ GFLTHSGWNSTLESI  G+PMICWP++ADQQVNSR VG VWK G
Sbjct  353   AGWVPQEEVLAHKAIAGFLTHSGWNSTLESIVAGVPMICWPYFADQQVNSRFVGEVWKLG  412

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +DMKD CDR  VEKMV +LM  RR+EF + + RMA+L+RK+V + GSSY NL+RL+ED++
Sbjct  413   LDMKDQCDREIVEKMVNDLMVERREEFVRSATRMAELSRKSVREGGSSYCNLNRLIEDIR  472

Query  1505  KMKLQL  1522
              M +++
Sbjct  473   TMSVRV  478



>ref|XP_002280528.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=479

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/479 (56%), Positives = 353/479 (74%), Gaps = 9/479 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQ S S HVLIFPFP+QG+VN ML+L ELLC  + I VTFLN  + H+RLL Y+++  R
Sbjct  1     MDQGSVSPHVLIFPFPIQGNVNSMLKLTELLCL-AGIQVTFLNCHYPHRRLLSYSNIQAR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG-RPPV  436
             FS YP F F TISDGLP +HPRT ++ +D+ + +   T P F EM+ S    +S  R P+
Sbjct  60    FSRYPGFRFETISDGLPMEHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSASDTRSPL  119

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TCIIADG+M F+IDV NE+ +P I+FR  SA  FWA+F +P+LIE+G++P  G  DMD+L
Sbjct  120   TCIIADGLMSFSIDVANEVGLPVIIFRAISACSFWAYFSLPQLIEAGEVPFRG-GDMDRL  178

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             + +V GME  LR RDLPS CR  D+ +    + +    +T  A+  ++NTF+DLE   L+
Sbjct  179   VASVPGMEGFLRRRDLPSCCRVKDVDNPDLQNPMKNIRKTHGAHAQVINTFDDLEGPILS  238

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             QIR H P  YTIGPLHA L++++++       +SS+S WEEDRSC+ WLD QP KSV+YV
Sbjct  239   QIRNHFPRTYTIGPLHALLKSKLATETSTS--QSSNSFWEEDRSCIPWLDRQPSKSVIYV  296

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+ ++T+ +  EFWHG+VNSG  FLW IRP++++G D     PAEL+EGT+ +GY+V
Sbjct  297   SFGSLAIITKEELREFWHGLVNSGSRFLWVIRPDALVGKDEERQTPAELLEGTKDRGYVV  356

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GWAPQEEVL HPAVGGFLTH GWNSTLESI EGLPMICWP++ADQQ+NSR V  VWK G+
Sbjct  357   GWAPQEEVLKHPAVGGFLTHGGWNSTLESIVEGLPMICWPYFADQQINSRFVSHVWKLGM  416

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             DMKD+CDR+TVEKMV++LM  +RDEF + ++ +A LA+K V   GSS  NL+ L+ED++
Sbjct  417   DMKDSCDRVTVEKMVRDLMVEKRDEFMEAADTLATLAKKCVGDGGSSSCNLNSLIEDIR  475



>gb|AGX93069.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Rauvolfia 
serpentina]
Length=482

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/473 (59%), Positives = 353/473 (75%), Gaps = 7/473 (1%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QGHVN MLRLAELL   + + +TF+ SEF+H RL+++TD+  RF+ YP F 
Sbjct  11    HVLIFPLPIQGHVNSMLRLAELL-CLAELDITFVVSEFSHSRLIKHTDVASRFARYPGFR  69

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREM-LSSGSLQSSGRPPVTCIIADGI  460
             F+TISDGL  DHPR G+RV+D+  S   VT P F++M L      S+ R P+TCIIADG+
Sbjct  70    FQTISDGLADDHPRAGERVMDILPSTKNVTGPLFKQMMLEKNCFASATRRPITCIIADGV  129

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             + FA D   E  IP I FRT SA  FWA FC+P+LIE+GD+P+ G   MD  +++V GME
Sbjct  130   LSFAGDFAEEKGIPLIYFRTVSACSFWACFCMPELIEAGDIPIKGNG-MDLTVKSVPGME  188

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
               LR RDLP FCR  D+++     +   T +TTRA   ILNTFEDLE   L+QIRKH+P 
Sbjct  189   TFLRRRDLPGFCRVNDINEPKLQILKTETRQTTRAQAAILNTFEDLEGPTLSQIRKHMPR  248

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             L+TIGP H+HL +R+ + R      SS S WEEDRSC+ WLD QP +SV+YVSFGS+TV+
Sbjct  249   LFTIGPSHSHLTSRLET-RNIKTSISSGSFWEEDRSCVDWLDSQPPRSVLYVSFGSITVV  307

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQEEV  1171
             TR+Q LEFWHG+V+SG+ FLW +RP+S++G D    IP EL EGTR +GYMVGWAPQEEV
Sbjct  308   TRDQLLEFWHGLVDSGQRFLWVMRPDSILGKDGENQIPPELEEGTRARGYMVGWAPQEEV  367

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPA+GGFLTHSGWNSTLESI  G+PMICWP++ADQ +NSR V  +WK G+DMKDTCDR
Sbjct  368   LYHPAIGGFLTHSGWNSTLESIVVGVPMICWPYFADQMINSRFVSELWKIGLDMKDTCDR  427

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
              T+ KMV+ELME R+DEF + +++MAKLAR AV++ GSSY NLD LVE ++ +
Sbjct  428   DTIVKMVRELMEHRKDEFLQRADQMAKLARMAVSEGGSSYCNLDGLVEYIQSL  480



>ref|XP_002280624.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=479

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/479 (56%), Positives = 354/479 (74%), Gaps = 9/479 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQ S S HVLIFPFP+QG++N ML+LAELLC  + I VTFLN  + H+RLL Y+++  R
Sbjct  1     MDQGSISPHVLIFPFPIQGNINSMLKLAELLCL-ADIQVTFLNCHYPHRRLLSYSNIQAR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG-RPPV  436
             FS YP F F TISDGLP +HPRT ++ +D+ + +   T P F EM+ S    +S  R P+
Sbjct  60    FSRYPGFRFETISDGLPMEHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSASDTRSPL  119

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TCIIADG+M FAIDV NE+ +P I+FR  SA  FWA+F +P+LIE+G++P  G  DMD+L
Sbjct  120   TCIIADGLMSFAIDVANEVGLPVIIFRPISACSFWAYFSLPQLIEAGEVPFRG-GDMDRL  178

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             + +V GME  LR R LPS  R  D++  G   ++    +  RA+ L++NTF+DLE   L+
Sbjct  179   VASVPGMEGFLRRRHLPSSGRVNDVAYPGLQHLMKIFRQAQRAHSLVINTFDDLEGPVLS  238

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             QIR H P  Y IGPLHAHL+++++S       +SS+S  +ED+SC+ WLD QP KSV+YV
Sbjct  239   QIRDHYPRTYAIGPLHAHLKSKLASETSTS--QSSNSFRKEDKSCIPWLDRQPPKSVIYV  296

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+ ++T+++  EFWHG+VNSG  FLW IRP++++G D     PAEL+EGT+ +GY+V
Sbjct  297   SFGSLAIITKDELGEFWHGLVNSGNRFLWVIRPDALVGKDEERQTPAELLEGTKDRGYVV  356

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GWAPQEEVL HPAVGGFLTH GWNSTLESI EGLPMICWP++ADQQ+NSR V  VWK G+
Sbjct  357   GWAPQEEVLKHPAVGGFLTHGGWNSTLESIVEGLPMICWPYFADQQINSRFVSHVWKLGM  416

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             DMKD+CDR+TVEKMV++LM  +RDEF K ++ +A LA+K V   GSS  NL+ L+ED++
Sbjct  417   DMKDSCDRVTVEKMVRDLMVEKRDEFMKAADTLATLAKKCVGDGGSSSCNLNSLIEDIR  475



>ref|XP_011038346.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Populus 
euphratica]
Length=481

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/486 (56%), Positives = 357/486 (73%), Gaps = 14/486 (3%)
 Frame = +2

Query  83    MDQRSSS--HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             M+ RS+   HVLIFP P QGHVN ML+LAELL   + I++TFLNSE  H+ L R+T++  
Sbjct  1     MENRSNPPPHVLIFPLPCQGHVNSMLKLAELLSL-AGINITFLNSEHNHELLARHTNIED  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
             RF+ YP F F+TI+DGLP DHPR+GDR+++LF+++  V KP F+++L    L++  +PPV
Sbjct  60    RFTKYPGFQFQTIADGLPVDHPRSGDRLMELFDAMKVVAKPIFKKIL----LET--KPPV  113

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
              CII DG++ F  DV  E+ +P I FRT SA  FWA+F +  +IE G LP+ G  DMD+L
Sbjct  114   NCIIGDGVLGFVGDVAIEVGVPIIYFRTISACSFWAYFSISDIIEGGQLPIRGNEDMDRL  173

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             +  V GME  LR RDLP FCR +D++    L V+  T ++ RA  LILNTFEDLE   L+
Sbjct  174   ITKVPGMETFLRCRDLPGFCRVSDMTHPNLLLVMNETRQSPRAKALILNTFEDLEGPILS  233

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              IR   P +Y+IGPLH HL+A++S+ + E   +SS+SL E DRSCM WLD QP KSV+YV
Sbjct  234   HIRTQCPEVYSIGPLHEHLQAKLSA-KNEKSCQSSNSLREIDRSCMTWLDNQPEKSVLYV  292

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD----DNIPAELIEGTRKKGYM  1144
             SFGS+TV+TR+Q LEFW+G+V+S K FLW IRP+S+       + IP E+ EGTR +G++
Sbjct  293   SFGSITVMTRHQLLEFWYGLVSSKKRFLWVIRPDSIATKNGEFEKIPVEVEEGTRDRGFI  352

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
              GW PQEEVL H A+ GFLTHSGWNSTLESI  G+PMICWP++ADQQVNSR VG VWK G
Sbjct  353   AGWVPQEEVLAHKAIAGFLTHSGWNSTLESIVAGVPMICWPYFADQQVNSRFVGEVWKLG  412

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +DMKD CDR  VEKMV +LM  RR+EF + + RMA+L+RK+V + GSSY NL+RL+ED++
Sbjct  413   LDMKDQCDREIVEKMVNDLMVERREEFVRSATRMAELSRKSVREGGSSYCNLNRLIEDIR  472

Query  1505  KMKLQL  1522
              M +++
Sbjct  473   SMSVRV  478



>gb|AGX93066.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Lonicera 
japonica]
Length=489

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/480 (55%), Positives = 358/480 (75%), Gaps = 14/480 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+FP P+QGHVN ML+LAELLC  + + V+F+ S+F+H RLLR+T++  RFS YP F 
Sbjct  11    HVLVFPLPIQGHVNSMLKLAELLCL-ADLDVSFMVSDFSHTRLLRHTNIESRFSKYPGFR  69

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLS-SGSLQSSGRPPVTCIIADGI  460
             F+TISDGLP DHPR G++++D+  SI  VT P F++M+  SG L + GR PVTCIIADG+
Sbjct  70    FQTISDGLPDDHPRAGEKIMDIMPSIKNVTGPLFKKMMEESGCLVAEGRRPVTCIIADGV  129

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             + FA D+  E  IP I FRT SA  FWA +C+ +LIE+ ++P+ G + MD L+ +V GM+
Sbjct  130   LSFAGDLAEEKGIPLIYFRTVSACSFWACYCMEELIEADEIPVKG-NGMDLLVTSVPGMD  188

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
               LR RDLP FCR  D+++     +   + +T RA   I+N+FEDLE   ++ IR  IP 
Sbjct  189   GFLRRRDLPGFCRVNDINEPKLQIIKSESRQTPRAQAAIVNSFEDLEGPIISHIRTQIPR  248

Query  821   LYTIGPLHAHLRARVSSSRGELPWRS-------SSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             LY +GPLHAHL++R++    + P ++       + S WEEDR+C+ WL+ Q  KSV+YVS
Sbjct  249   LYPLGPLHAHLKSRLALKTNQ-PLKTDQSSSSSTGSFWEEDRTCVDWLNSQQPKSVIYVS  307

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVG  1150
             FGS+TV+TR Q LEFW+G+VNSG+ FLW +RP+S+ G +    IP EL EGT+ +G+MVG
Sbjct  308   FGSITVVTRGQLLEFWYGLVNSGQKFLWVMRPDSIAGKEGESQIPVELEEGTKARGFMVG  367

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL HPA+GGF THSGWNSTLES+  G+PMICWP++ADQ +NSR VG VWK G+D
Sbjct  368   WAPQEEVLDHPAIGGFFTHSGWNSTLESVYAGVPMICWPYFADQMINSRFVGEVWKLGLD  427

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKD+CDRIT+EKMV+ELMEVR+DE+ + + +MA LA+K+V++ GSSY NLDR+VE ++ +
Sbjct  428   MKDSCDRITIEKMVRELMEVRKDEYLERAGQMAALAKKSVSEGGSSYCNLDRMVEYIRSL  487



>ref|XP_011076758.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=475

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/478 (56%), Positives = 353/478 (74%), Gaps = 15/478 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QG VN  L+LAELLC  + I VTFL ++  H RLLR++++  RFSSYP F 
Sbjct  9     HVLIFPLPLQGPVNSTLKLAELLCL-AHIDVTFLVTDHIHARLLRHSNIQTRFSSYPGFR  67

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
              +TISDGLP  HPR GDR ++LF+S+ + TKP F+E+L  G          +C+IADGI+
Sbjct  68    IQTISDGLPEAHPR-GDRFLELFDSLKSKTKPLFKEVLRCGGF--------SCVIADGIL  118

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              F  DV NE+R+P    RT SA+C W FFC+PK+IE+G++P  G+ D+D L+++V GME 
Sbjct  119   GFTCDVANEVRVPIFYIRTISAACLWVFFCIPKIIEAGEIPFEGD-DLDILVKSVPGMER  177

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
              LR RDLPSFCR+ DL+D         +    RA GLILNTFE+LE   LA++R   PN+
Sbjct  178   YLRRRDLPSFCRSGDLADPNIQLYKTESEENPRAYGLILNTFEELEGPILAEMRSMCPNI  237

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             YTIGPLHAHL+A++++ +   P   S+SLWEEDRSC+AWLD QP KSV+YVSFGS+ V T
Sbjct  238   YTIGPLHAHLKAKLAA-KATSPTAFSNSLWEEDRSCIAWLDSQPPKSVIYVSFGSLAVTT  296

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKGYMVGWAPQEEVL  1174
              NQ +EFWHG+VNSG+ FLW IRP+S+     +  +P EL + T+++GY+VGW PQEEVL
Sbjct  297   SNQLMEFWHGLVNSGQRFLWVIRPDSIAAKSWESEVPVELSKATKERGYIVGWTPQEEVL  356

Query  1175  VHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRI  1354
              HP+VGGFLTHSGWNSTLESI EG+PMICWP++ DQQVNSRLV   WK G+DMKDTCDR 
Sbjct  357   AHPSVGGFLTHSGWNSTLESIYEGVPMICWPYFIDQQVNSRLVEEAWKLGLDMKDTCDRS  416

Query  1355  TVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQL*Y  1528
              +EKMV+ LM+V +++F + +++MAK A++ ++  GSS++N +RLVED+K M   + Y
Sbjct  417   IIEKMVRSLMDVGKEKFLERADQMAKSAKRCLSNGGSSHNNFERLVEDIKSMSAPVPY  474



>ref|XP_011084978.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=499

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/487 (57%), Positives = 350/487 (72%), Gaps = 18/487 (4%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             S  HVLIFP P+QGHVN ML LAELLC  S +HVT L S++ H RLLR+  L  RFS + 
Sbjct  10    SPPHVLIFPVPLQGHVNSMLNLAELLCL-SGLHVTILLSDYTHNRLLRHASLQSRFSRHS  68

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG--RPPVTCII  448
              F   TISDGLPADHPR G+R+VD+  S+  V   +FR ++ S    S G  R  V+C+I
Sbjct  69    GFRVVTISDGLPADHPRVGERIVDIVLSLKEVGGQQFRHLMESTDGLSDGGARRRVSCLI  128

Query  449   ADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD--------  604
              DG+  FAI V  E+ IP I FRT SA  FW +FC+ ++I++G++PL G+++        
Sbjct  129   VDGVFRFAIPVVEEMGIPYIYFRTISACSFWPYFCLQEIIDAGEVPLKGKNEDKLTYWKK  188

Query  605   --MDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDL  778
               MD ++ +V GME VLR RD+P FC+  D++  G  ++   T RT  A+GLILNTFEDL
Sbjct  189   KEMDLMVTSVPGMERVLRRRDIPRFCQVEDINHPGLQTMKTETRRTIDASGLILNTFEDL  248

Query  779   EESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPL  958
             E   L +IRKHIPNLY+IGPLHA L+A + S   E     SSS WEED++C+AWLD QP 
Sbjct  249   EGPILDEIRKHIPNLYSIGPLHALLKAGLESEGMESSRNRSSSFWEEDQNCIAWLDSQPA  308

Query  959   KSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN-----IPAELIEG  1123
              SV+YVSFGS+T+LTR++ LEFW+G+VNSG  FLW IRP+S+IG+DN     IP EL EG
Sbjct  309   SSVIYVSFGSVTILTRDELLEFWYGLVNSGHRFLWVIRPDSIIGNDNGNGNEIPVELEEG  368

Query  1124  TRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLV  1303
             T+ +GYMVGW PQ++VL HPA+G F THSGWNSTLESI  GLPM+CW ++ADQ  NSR V
Sbjct  369   TKSRGYMVGWVPQQQVLAHPAIGAFFTHSGWNSTLESITLGLPMLCWAYFADQITNSRFV  428

Query  1304  GAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLD  1483
               VWK G+DMKDTCDRI VEKMVKE+MEVRR+EF + ++ MA LARKA+++ GSSY NL+
Sbjct  429   SEVWKVGLDMKDTCDRIIVEKMVKEVMEVRREEFLERADSMATLARKAISEGGSSYLNLN  488

Query  1484  RLVEDLK  1504
              L+E LK
Sbjct  489   GLIEFLK  495



>ref|XP_006486448.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Citrus sinensis]
Length=476

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/480 (55%), Positives = 348/480 (73%), Gaps = 9/480 (2%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             ++  S H+LIFP P Q HVN ML+LAE+    + + VTFLNS+  H+RL+RYTD+H RF 
Sbjct  3     EKPKSPHILIFPLPCQSHVNSMLKLAEIFGL-AGLKVTFLNSKHNHERLIRYTDIHDRFL  61

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
              Y  F F+TISDGLPADHPR GDR++++F+S++  T+P  ++ML   S      PPV+CI
Sbjct  62    QYSEFQFKTISDGLPADHPRAGDRLMEIFDSLSLNTRPLLKQMLIDTS------PPVSCI  115

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNG-ESDMDKLLE  622
             I D  M F +DV  EL IP I FR  SA  FWA+F +P++I++G+LP+   + DMD+L+ 
Sbjct  116   IGDACMEFVVDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLIT  175

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              V GME  LR RDLPSFCR +D++DR    +   T ++ R + LILNTFEDLEE  L+ I
Sbjct  176   KVPGMETFLRFRDLPSFCRVSDVTDRDLQVLKNVTQQSPRTHALILNTFEDLEEPILSHI  235

Query  803   RKHIPNLYTIGPLHAHLRARVSSSR-GELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             R   P +YTIGPLH  L+ R++S+       +S +SLWE DRSC+ WL +QP++SV+YVS
Sbjct  236   RTKCPKVYTIGPLHLQLKTRLASNVISSSSQKSLNSLWEVDRSCIEWLGKQPVRSVLYVS  295

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAP  1159
             FGS+T+L R Q +EFWHG+V+S + FLW IRP+SVIG+ + PAEL+EGT+++G++V W P
Sbjct  296   FGSITLLKREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDAPAELVEGTKERGHLVSWVP  355

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             QEEVL H AV GFLTHSGWNSTLESI  G+PMICWP++ADQQ+NSR V  VW  G+DMKD
Sbjct  356   QEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD  415

Query  1340  TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
              CDR  VEKMV +LM  R++EF + ++RMA +AR    + G SY NLDRL++D+K M  Q
Sbjct  416   VCDRNVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDIKMMSSQ  475



>ref|XP_002276555.2| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=509

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/505 (53%), Positives = 359/505 (71%), Gaps = 18/505 (4%)
 Frame = +2

Query  5     NTAYFPARHHLITLNSADNYSLITPTMDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHE  181
              T Y P  H            ++   MDQRS S HVLI P P+QG+VN ML+LAELLC  
Sbjct  11    QTMYLPGNH---------TKCIVGSQMDQRSVSPHVLILPSPLQGNVNSMLKLAELLCL-  60

Query  182   SSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSI  361
             + I VTFLN  + H  LL Y+++  RFS YP F F TISDGLP +HPRT ++ +D+ + +
Sbjct  61    AGIQVTFLNCHYPHHCLLSYSNVQARFSRYPGFRFETISDGLPMEHPRTAEQFLDIVDGV  120

Query  362   NAVTKPRFREMLSSGSLQSSG-RPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCF  538
                T P F EM+ S    +S  RPP+TCI+AD +M FA DV NE+ +P ++F   SA  F
Sbjct  121   KTTTAPLFMEMMISWCRSTSDTRPPLTCIMADQLMSFATDVANEVGLPIVIFCAISACSF  180

Query  539   WAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVI  718
             WA+F  P+LIE+G++P+ G+ DMD+L+ +V GME  LR RDLPS  R  D++  G   ++
Sbjct  181   WAYFSFPQLIEAGEVPITGD-DMDRLVVSVPGMEGFLRRRDLPSSGRVNDVAYPGLQHLM  239

Query  719   LATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRS  898
                 +  RA+ L++NTF+DLE   L+QIR H P  Y +GPLHAHL+++++S       +S
Sbjct  240   KIFRQAQRAHALVINTFDDLEGPVLSQIRDHYPRTYAVGPLHAHLKSKLASETSTS--QS  297

Query  899   SSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPN  1078
             S+S  EED+SC+ WLD QP KSV+YVSFGS+ ++T+++  EFWHG+VNSG  FLW IRP+
Sbjct  298   SNSFREEDKSCILWLDRQPPKSVIYVSFGSLAIITKDELREFWHGLVNSGSRFLWVIRPD  357

Query  1079  SVIGDD---NIPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGL  1249
             +++G D     PAEL+EGT+ +GY+VGWAPQEEVL HPAVGGFLTHSGWNSTLESI  GL
Sbjct  358   ALVGKDEERQTPAELLEGTKDRGYVVGWAPQEEVLQHPAVGGFLTHSGWNSTLESIIAGL  417

Query  1250  PMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMA  1429
             PMICWP++ADQQ+NSR V  VWK G+DMKDTCDR+TVEKMV++LME +R EF K ++ MA
Sbjct  418   PMICWPYFADQQINSRFVSHVWKLGMDMKDTCDRVTVEKMVRDLMEEKRAEFMKAADTMA  477

Query  1430  KLARKAVTQHGSSYSNLDRLVEDLK  1504
               A+K+V++ GSSY NL  L+E+++
Sbjct  478   TSAKKSVSEGGSSYCNLGSLIEEIR  502



>ref|XP_007009131.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17941.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=479

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/480 (56%), Positives = 340/480 (71%), Gaps = 11/480 (2%)
 Frame = +2

Query  83    MDQ----RSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDL  250
             MDQ    ++  HVL+FP P QGHVN ML+LAEL    + + VTFLNS+  H+RL+R+TD+
Sbjct  1     MDQEQQPQAYPHVLLFPLPAQGHVNSMLKLAELFAL-AGLEVTFLNSDHNHERLVRHTDV  59

Query  251   HLRFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRP  430
               RF+ YP F F TI DGL  DHPR G   ++LF S+   TKP  REML   +      P
Sbjct  60    GFRFAKYPRFKFETIPDGLREDHPRLGVSFMELFESMELRTKPILREMLVKIN------P  113

Query  431   PVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMD  610
             PV CII DG +   +DV +EL IP   FRT SAS  WA+F +P +IE+G+LP+ G  DMD
Sbjct  114   PVDCIIGDGALGLVLDVADELGIPIFQFRTISASGIWAYFAIPDMIEAGELPIRGNEDMD  173

Query  611   KLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESA  790
             +L+  V GME  LR RDLPSFCR +D++D     +   T +   A GLILNTFEDLE + 
Sbjct  174   RLITRVPGMETFLRCRDLPSFCRDSDMTDSNLQLIAKETRKNLSAPGLILNTFEDLEGAI  233

Query  791   LAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVV  970
             L+ +R   P +YT+GPLH HL  R++ + G +  +S +SLWE DRSC++WLDEQP +SVV
Sbjct  234   LSHMRSKCPKIYTVGPLHLHLNTRLAETNGTMVHQSPNSLWEVDRSCLSWLDEQPKESVV  293

Query  971   YVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVG  1150
             YVSFGS+ VL+R Q +EFW G+VNS K FLW  RP+ +    +IPAEL+EGT+++GYMVG
Sbjct  294   YVSFGSIAVLSREQIMEFWFGLVNSRKRFLWVFRPDFMPEKGSIPAELVEGTKQRGYMVG  353

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL H A+GGFLTHSGWNSTLES+  G+PMICWP++ADQQ+NSR V  VWK G+D
Sbjct  354   WAPQEEVLAHCAIGGFLTHSGWNSTLESLVAGVPMICWPYFADQQLNSRFVSEVWKLGLD  413

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKD CDR  VEKMV +L+  +R+EF K S  +AKLA+  V   GSSY NLDRL+ED++ M
Sbjct  414   MKDVCDRRVVEKMVNDLIVDKREEFVKSSAEIAKLAKACVNVGGSSYCNLDRLIEDIRSM  473



>ref|XP_006435571.1| hypothetical protein CICLE_v10031408mg [Citrus clementina]
 gb|ESR48811.1| hypothetical protein CICLE_v10031408mg [Citrus clementina]
Length=476

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/477 (55%), Positives = 347/477 (73%), Gaps = 9/477 (2%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             ++  S H+LIFP P Q HVN ML+LAE+    + + VTFLNS+  H+RL+RYTD+H RF 
Sbjct  3     EKPKSPHILIFPLPCQSHVNSMLKLAEIFGL-AGLKVTFLNSKHNHERLIRYTDIHDRFL  61

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
              Y  F F+TISDGLPADHPR GDR++++F+S++  T+P  ++ML   S      PPV+CI
Sbjct  62    QYSEFQFKTISDGLPADHPRAGDRLMEIFDSLSLNTRPLLKQMLIDTS------PPVSCI  115

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNG-ESDMDKLLE  622
             I D  M F +DV  EL IP I FR  SA  FWA+F +P++I++G+LP+   + DMD+L+ 
Sbjct  116   IGDACMEFVVDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLIT  175

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              V GME  LR RDLPSFCR +D++DR    +   T ++ R + LILNTFEDLEE  L+ I
Sbjct  176   KVPGMETFLRFRDLPSFCRVSDVTDRDLQVLKNVTQQSPRTHALILNTFEDLEEPILSHI  235

Query  803   RKHIPNLYTIGPLHAHLRARVSSSR-GELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             R   P +YTIGPLH  L+ R++S+       +S +SLWE DRSC+ WL +QP++SV+YVS
Sbjct  236   RTKCPKVYTIGPLHLQLKTRLASNVISSSSQKSLNSLWEVDRSCIEWLGKQPVRSVLYVS  295

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAP  1159
             FGS+T+L R Q +EFWHG+V+S + FLW IRP+SVIG+ + PAEL+EGT+++G++V W P
Sbjct  296   FGSITLLKREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDAPAELVEGTKERGHLVSWVP  355

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             QEEVL H AV GFLTHSGWNSTLESI  G+PMICWP++ADQQ+NSR V  VW  G+DMKD
Sbjct  356   QEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD  415

Query  1340  TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
              CDR  VEKMV +LM  R++EF + ++RMA +AR    + G SY NLDRL++D+K M
Sbjct  416   VCDRNVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDIKMM  472



>gb|AIS39472.1| flavonoid UDP-glucosyltransferase 3 [Citrus x paradisi]
Length=476

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/480 (54%), Positives = 347/480 (72%), Gaps = 9/480 (2%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             ++  S H+LIFP P Q HVN ML+LAE+    + + VTFLNS+  H+RL+RYTD+H RF 
Sbjct  3     EKPKSPHILIFPLPCQSHVNSMLKLAEIFGL-AGLKVTFLNSKHNHERLIRYTDIHDRFL  61

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
              Y  F F+TISDGLPADHPR GDR++++F+S++  T+P  ++ML   S      PPV+CI
Sbjct  62    QYSEFQFKTISDGLPADHPRAGDRLMEIFDSLSLNTRPLLKQMLIDTS------PPVSCI  115

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNG-ESDMDKLLE  622
             I D  M F +DV  EL IP I FR  SA  FWA+F +P++I++G+LP+   + DMD+L+ 
Sbjct  116   IGDACMEFVVDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLIT  175

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              V GME  LR RDLPSFCR +D++DR    +   T ++ R + LILNTFEDLEE  L+ I
Sbjct  176   KVPGMETFLRFRDLPSFCRVSDVTDRDLQVLKNVTQQSPRTHALILNTFEDLEEPILSHI  235

Query  803   RKHIPNLYTIGPLHAHLRARVSSSR-GELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             R   P +YTIGPLH  L+ R++S+       +S +SLWE DRSC+ W  +QP++SV+YVS
Sbjct  236   RTKCPKVYTIGPLHLQLKTRLASNVISSSSQKSLNSLWEVDRSCIEWFGKQPVRSVLYVS  295

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAP  1159
             FGS+T+L R Q +EFWHG+V+S + FLW IRP+SVIG+ + PAEL+EGT+++G++V W P
Sbjct  296   FGSITLLKREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDAPAELVEGTKERGHLVSWVP  355

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             QEEVL H AV GFLTHSGWNSTLESI  G+PMICWP++ADQQ+NSR V  VW  G+DMKD
Sbjct  356   QEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD  415

Query  1340  TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
              CDR  VEKMV +LM  R++EF + ++RMA +AR    + G SY NLDRL++D+K M  Q
Sbjct  416   VCDRNVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDIKMMSSQ  475



>gb|AGX93070.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Tabernaemontana 
elegans]
Length=482

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/473 (58%), Positives = 351/473 (74%), Gaps = 7/473 (1%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             + HVLIFP P+QGHVN MLRLAELL   + + +TF+ SEF+H RLL++T++  RF+ YP 
Sbjct  9     APHVLIFPLPIQGHVNSMLRLAELL-CLAELDITFIVSEFSHSRLLKHTNVASRFARYPG  67

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSL-QSSGRPPVTCIIAD  454
             F F+ ISDGLP DHPR G+RV+D+  S   VT P F++M+   +   S+ R P+TC+IAD
Sbjct  68    FQFQGISDGLPDDHPRAGERVMDILPSTKNVTGPLFKQMMVEKNFFASATRRPITCMIAD  127

Query  455   GIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEG  634
             G++ F  D      I  I FRT SA  FWA FC+P+LIE+GD+P+ G   MD ++++V G
Sbjct  128   GVLSFVGDFAEATGISLIYFRTVSACSFWACFCMPELIEAGDIPIKGNG-MDLVVKSVPG  186

Query  635   MENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHI  814
             M+  LR RDLP FCR  D+++     +   T ++TRA   ILNTFEDLE   L+QIRKH+
Sbjct  187   MDKYLRRRDLPGFCRVNDINEPKLQILKNETRQSTRAQAAILNTFEDLEGPILSQIRKHM  246

Query  815   PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMT  994
             P L+TIGP H+HL  R+ S   +    SS S WEEDRSC+ WLD QP +SV+YVSFGS+T
Sbjct  247   PRLFTIGPSHSHLTYRLESKNIQSSI-SSGSFWEEDRSCVDWLDSQPPRSVLYVSFGSIT  305

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVGWAPQE  1165
             V+T +Q LEFWHG+VNSG+ FLW +RP+S++G D    IPAEL EGT+ +GYMVGWAPQE
Sbjct  306   VVTSDQLLEFWHGLVNSGQRFLWVMRPDSIMGKDGKSRIPAELEEGTKARGYMVGWAPQE  365

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             EVL HPA+GGFLTHSGWNSTLESI  G+PMICWP++ADQ +NSR V  +WK G+DMKDTC
Sbjct  366   EVLNHPAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQMINSRFVSEIWKIGLDMKDTC  425

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             DR T+EK+VKELM VR+DEF + ++ MAKLAR AV + GSSYSNLD LV+ ++
Sbjct  426   DRDTIEKIVKELMVVRKDEFLQRADHMAKLARGAVREGGSSYSNLDGLVDYIR  478



>gb|KDO69251.1| hypothetical protein CISIN_1g011832mg [Citrus sinensis]
Length=476

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/480 (54%), Positives = 347/480 (72%), Gaps = 9/480 (2%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             ++  S H+LIFP P Q H+N ML+LAE+    + + VTFLNS+  H+RL+RYTD+H RF 
Sbjct  3     EKPKSPHILIFPLPCQSHMNSMLKLAEIFGL-AGLKVTFLNSKHNHERLIRYTDIHDRFL  61

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
              Y  F F+TISDGLPADHPR GD+++++F+S++  T+P  ++ML   S      PPV+CI
Sbjct  62    QYSEFQFKTISDGLPADHPRAGDQLMEMFDSLSLNTRPLLKQMLIDTS------PPVSCI  115

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNG-ESDMDKLLE  622
             I D  M F +DV  EL IP I FR  SA  FWA+F +P++I++G+LP+   + DMD+L+ 
Sbjct  116   IGDACMEFVVDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDMDRLIT  175

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              V GME  LR RDLPSFCR +D++DR    +  AT ++ RA+ LILNTFEDLEE  L+ I
Sbjct  176   KVPGMETFLRFRDLPSFCRVSDVTDRDLQVLKNATQQSPRAHALILNTFEDLEEPILSHI  235

Query  803   RKHIPNLYTIGPLHAHLRARVSSSR-GELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             R   P +YTIGPLH  L+ R +S+       +S +SLWE DRSC+ WL +QP++SV+YVS
Sbjct  236   RTKCPKVYTIGPLHLQLKTRFASNMISSSSQKSLNSLWEVDRSCIEWLGKQPVRSVLYVS  295

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAP  1159
             FGS+T+L R Q +EFWHG+V+S + FLW IRP+SVIG+ +  AEL+EGT+++G +V W P
Sbjct  296   FGSITLLKREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGLLVSWVP  355

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             QEEVL H AV GFLTHSGWNSTLESI  G+PMICWP++ADQQ+NSR V  VW  G+DMKD
Sbjct  356   QEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD  415

Query  1340  TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
              CDR  VEKMV +LM  R++EF + ++RMA +AR    + G SY NLDRL++D+K M  Q
Sbjct  416   VCDRNVVEKMVNDLMVERKEEFMRAADRMATMARTTANEGGPSYCNLDRLIDDIKMMSSQ  475



>ref|XP_009613526.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=498

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/481 (55%), Positives = 341/481 (71%), Gaps = 6/481 (1%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             ++ +  HVLIFP P+QG VNCML+LAEL C    IHVTFLNSE   QRLL  TD+ +RF 
Sbjct  20    ERMAVPHVLIFPLPLQGPVNCMLKLAELFCLHQDIHVTFLNSEHIQQRLLNCTDVQIRFK  79

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
              YPNF   TI DGLP D+PRTGD+V +L   +  V+ P FREM++SGSL  +   PVTC+
Sbjct  80    KYPNFKIMTIPDGLPEDNPRTGDQVRNLVKGVEDVSSPLFREMVTSGSLSPNSEKPVTCL  139

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
             + DGI  FA+D+  E+ IP + F T S    W + C+PKLIE+G++P  G +D+D L+ N
Sbjct  140   LVDGIFPFAVDIAEEIGIPLLYFDTISPCALWTYLCIPKLIEAGEIPFKG-NDLDALVNN  198

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             V GME V+R RDLPSFCR  DL +      I       +A GLI NTFE LE   L+Q R
Sbjct  199   VPGMEGVIRRRDLPSFCRVPDLDNPTLQFFIKEGKHIFQAQGLIFNTFEGLEGPILSQFR  258

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRS-SSSLWEEDRSCMAWLDEQPLKSVVYVSF  982
                PN+Y++GPLH HL+  + SS+  +P  S S+S+W+ED SCM WLDE P KSV++VS 
Sbjct  259   AVCPNIYSVGPLHIHLKKSL-SSKCSVPKTSLSNSIWKEDMSCMHWLDEHPKKSVLFVSI  317

Query  983   GSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKGYMVGW  1153
             GS+  +++ QFLE W+G+VNS   FLW  RP SVIG   ++++P EL + T+++G +V W
Sbjct  318   GSLATISKAQFLEIWYGLVNSKTRFLWVQRPGSVIGLEENNDVPVELSKSTKERGCIVSW  377

Query  1154  APQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDM  1333
             APQEEVL HP+VGGFLTHSGWNSTLESI EG+PMICWP++ DQQVNSR VG VWK G+DM
Sbjct  378   APQEEVLAHPSVGGFLTHSGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGLDM  437

Query  1334  KDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMK  1513
             KD CDR  VEKMV+E+MEVR+ EF +    M  LA ++V + GSSY +LDRLVED++ M+
Sbjct  438   KDICDRAIVEKMVREMMEVRKIEFLERVREMRNLAIESVNEGGSSYKDLDRLVEDIRLMR  497

Query  1514  L  1516
             +
Sbjct  498   I  498



>ref|XP_007009132.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17942.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=482

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/487 (54%), Positives = 342/487 (70%), Gaps = 12/487 (2%)
 Frame = +2

Query  71    ITPTMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDL  250
             + P   Q  S H+LIFP P+QG VN ML+LAEL C  + + VTFLNSE+ H RL+R+ ++
Sbjct  1     MEPGKSQAPSPHILIFPLPIQGPVNAMLKLAEL-CATAGLKVTFLNSEYNHSRLVRFANI  59

Query  251   HLRFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRP  430
               RF  YP F FRTISDGLP DH R+G+R +++F ++N  TKP  ++ML          P
Sbjct  60    PSRFDKYPGFEFRTISDGLPGDHSRSGNRFMEIFEAMNIRTKPLLKDMLVEMI------P  113

Query  431   PVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMD  610
             PV CII DGI+ F +DV NEL IP I  RT  A   W+ + +P +IE+G+LP+ G  DMD
Sbjct  114   PVDCIIGDGILEFVLDVANELGIPIINCRTIGACFLWSNYSIPDMIEAGELPIKGSEDMD  173

Query  611   KLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESA  790
             + +  V GME  LR RDLPSFCR +++SD   L     T ++  A+G+ILNTFE+LE   
Sbjct  174   RPITAVPGMEKFLRCRDLPSFCRASNMSDSTLLRYGTVTRKSFTASGVILNTFEELEGPI  233

Query  791   LAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVV  970
             L+QIR   PN+YTIGPL+ H + R+S   G +  +SS+  WE DRSCM+WLD QP +SVV
Sbjct  234   LSQIRSKCPNVYTIGPLNEHFKTRMSLENG-VSSQSSNYFWEVDRSCMSWLDRQPNQSVV  292

Query  971   YVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD----DNIPAELIEGTRKKG  1138
             YVSFGS+ V++  Q +EFWHG+VNS + FLW +RP+SV G     ++ P EL+EGT+ +G
Sbjct  293   YVSFGSIAVMSDEQIMEFWHGLVNSKRRFLWVVRPDSVAGKGFQGEDTPKELVEGTKDRG  352

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
             Y+VGWA QEEVL H AVGGFLTHSGWNST+ESI  G+PM+CWP++ADQQ+NSR VG VWK
Sbjct  353   YIVGWAAQEEVLSHRAVGGFLTHSGWNSTMESIVAGVPMLCWPYFADQQLNSRFVGEVWK  412

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G+DMKD CDR  VEKMV +LM  R+DEF K +  MA LA+  V+  G SY N DRL+ED
Sbjct  413   LGIDMKDVCDRKVVEKMVNDLMVERKDEFVKSAAAMASLAKDCVSVGGPSYCNFDRLIED  472

Query  1499  LKKMKLQ  1519
             +K + L+
Sbjct  473   IKTISLK  479



>ref|XP_007009133.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17943.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=481

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/476 (55%), Positives = 345/476 (72%), Gaps = 12/476 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QGHVN M +LAELL   +   VTFL SE  H RL++YT++   F+SYP F 
Sbjct  12    HVLIFPLPLQGHVNSMFKLAELLAL-TGFKVTFLYSEHNHGRLVKYTNVSAHFASYPGFE  70

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             FRT+ DGLP DHPR+GD  ++++ ++    K   REML + +      PPV CII DG +
Sbjct  71    FRTVPDGLPDDHPRSGDWFLEMYYAMETKAKLSLREMLLNIN------PPVDCIIGDGFL  124

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              F +DV  EL IP   FRT SA CFWA++ +P +I++G++P+ G  DM++L+  V GME 
Sbjct  125   GFVLDVAKELGIPVFYFRTSSACCFWAYYSIPDIIQAGEIPIRGIEDMNRLITTVPGMET  184

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
              LR RDLPSFCR +D+++     V+  T ++ +A+ LILNTFEDL+   L+ IR   P++
Sbjct  185   FLRCRDLPSFCRASDMANSTIQLVVEQTRKSPQAHALILNTFEDLDRPILSHIRTKCPHV  244

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             YTIGP+HA L  R+ + RG    + S+SLWE DR+C++WLD+QP +SVVYVSFGS+T+ +
Sbjct  245   YTIGPIHALLNTRLKAKRGASS-QFSNSLWEVDRNCISWLDKQPKQSVVYVSFGSITIPS  303

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD----NIPAELIEGTRKKGYMVGWAPQEEV  1171
             R Q  E W+G+VNS + FLW +RPNSV G D    ++P EL+EGT+++G +VGWAPQEEV
Sbjct  304   REQLTELWYGLVNSKRRFLWVVRPNSVTGKDGQGEDVPVELLEGTKERGCIVGWAPQEEV  363

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPAVGGFLTHSGWNSTLES+  G+PMICWP++ADQQVNSR V  VWK G+DMKD CDR
Sbjct  364   LNHPAVGGFLTHSGWNSTLESVVAGVPMICWPYFADQQVNSRFVSEVWKLGLDMKDVCDR  423

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
               VEKMV +LM  RR+EF K +  MAKLA+++V   GSSY NLDRL+ED++ M L+
Sbjct  424   KVVEKMVNDLMMDRREEFVKSAAEMAKLAKESVNVGGSSYCNLDRLIEDIRLMSLK  479



>ref|XP_006435573.1| hypothetical protein CICLE_v10031368mg [Citrus clementina]
 ref|XP_006486447.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
 gb|ESR48813.1| hypothetical protein CICLE_v10031368mg [Citrus clementina]
Length=484

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/473 (56%), Positives = 341/473 (72%), Gaps = 16/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYT-DLHLRFSSYPNF  280
             HVLI+P P  GHVN ML+LAELL H + I +TFLNSE  H+RL+R++ D+  R+ + P F
Sbjct  17    HVLIWPLPALGHVNSMLKLAELLSH-AGIKITFLNSEHYHERLVRHSSDVFSRYMNLPGF  75

Query  281   YFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGI  460
              F+TI+DGLP DHP+T D   +L NS+ +VT P  ++ML+        + PV CII+DG+
Sbjct  76    QFKTITDGLPKDHPQTVDNFHELLNSLASVTPPLLKDMLTDA------KSPVHCIISDGL  129

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             M FAIDV  ++ IP I FRT SA  FWA+FC+P++I++G+LP+ G  DMD+L+++V GME
Sbjct  130   MSFAIDVAKQVGIPIIYFRTVSACAFWAYFCIPEIIDAGELPIKGNEDMDRLIKHVPGME  189

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
               LR RDLPSFCR  D  D     V+  T  + RA+GL+LNTFEDLE   L+QIR H P 
Sbjct  190   KFLRCRDLPSFCRAEDPMDMNLQLVVSETRSSVRADGLVLNTFEDLEGPVLSQIRAHCPK  249

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             +YTIGPL+AHL+AR+  +       SS+SLWE DRSC+AWLD QP KSV++VSFGS+ V+
Sbjct  250   IYTIGPLNAHLKARIPENT-----HSSNSLWEVDRSCIAWLDNQPSKSVIFVSFGSVAVM  304

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQEEV  1171
              R+Q +EFW+G+VNS K FLW IRP+ + G D    IP EL + T+++GY+ GW PQEEV
Sbjct  305   QRDQLIEFWYGLVNSHKRFLWVIRPDLISGKDGENQIPKELDKATKERGYIAGWVPQEEV  364

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L H AVGGFLTH GWNSTLESI   +PMICWP +ADQQ+NSR V  VWK G+DMKD CDR
Sbjct  365   LGHKAVGGFLTHCGWNSTLESIVARMPMICWPSFADQQINSRFVDEVWKLGLDMKDLCDR  424

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
               VEKMV EL+  RR  F K ++RMA LA K+V + GSSY NLD L+ D++ M
Sbjct  425   KIVEKMVNELLVERRAAFMKSADRMANLAIKSVNEGGSSYCNLDHLINDIRMM  477



>ref|XP_009590620.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=524

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/482 (55%), Positives = 346/482 (72%), Gaps = 8/482 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQ S   HVLIFP P+QG VN   +LAELLC  S +H+TFL +E  H RL+ +T++  R
Sbjct  46    MDQESLPPHVLIFPLPLQGPVNSTFKLAELLCI-SGLHITFLLTENIHNRLVSHTNISSR  104

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG-RPPV  436
             F  +P F  +TISDGLP DHPR G + ++LF+S+   TKP F++ML+SG L S G R PV
Sbjct  105   FERFPGFQIKTISDGLPQDHPRKGSKYMELFDSLKCKTKPLFKDMLTSGWLSSDGKRRPV  164

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             +CIIADG++ F  DV NE+ IP    RT S  C W FFC+P+LIESG+ P  G+ D+D+ 
Sbjct  165   SCIIADGVLGFTCDVANEIGIPIFSIRTISPCCLWIFFCLPQLIESGEYPFKGD-DLDEP  223

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             +++V G E  LR RDLP FCRT DL+D             +RA GLILNTFE+L+   L+
Sbjct  224   IKSVPGAETFLRRRDLPDFCRTGDLTDSNVQLYKTEGQENSRAYGLILNTFEELDGHLLS  283

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             Q+R   PN+Y IGPLHAHL+ ++S     LP  SS+SL+EED+SC+ WL+ Q   SV+YV
Sbjct  284   QMRTVCPNIYPIGPLHAHLKKKLSEENNSLP-PSSNSLFEEDKSCINWLNNQLPNSVIYV  342

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+  +T+ Q +EFW+G+VNS + FLW IR +SV GDD    IP EL+EGT+++GY+V
Sbjct  343   SFGSIATMTKEQLMEFWYGLVNSKQNFLWVIRLDSVAGDDWKNKIPLELVEGTKERGYIV  402

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GWAPQEEVL HP+VGGF TH GWNS LE++ EG PMICWP++ DQQVNSR V A WK G+
Sbjct  403   GWAPQEEVLAHPSVGGFWTHCGWNSILETVYEGKPMICWPYFMDQQVNSRFVEAAWKLGL  462

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKDTCDR  VEKMVK+LM V+++EF + +N+M+  A+K + + GSSYSN +RLV D+K 
Sbjct  463   DMKDTCDRKIVEKMVKDLMVVKKEEFLERANQMSNFAKKCLKEGGSSYSNFERLVNDIKS  522

Query  1508  MK  1513
              K
Sbjct  523   FK  524



>ref|XP_009795416.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=478

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/475 (55%), Positives = 334/475 (70%), Gaps = 5/475 (1%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLC-HESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNF  280
             HVLIFP P+QG VNCML+LAEL C H   IHVTFLNSE   QRLL  TD+ +RF  YPNF
Sbjct  5     HVLIFPLPIQGPVNCMLKLAELFCLHHQEIHVTFLNSEHIQQRLLNCTDVQIRFKKYPNF  64

Query  281   YFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGI  460
              F TI DGL  D+PRTGD+V +L   +  V+ P  REM++SG L  +   PVTC++ DGI
Sbjct  65    KFMTIPDGLAEDNPRTGDQVRNLVKGVEDVSSPLLREMVTSGLLSPNSEKPVTCLLVDGI  124

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             + FA+D+  E+ IP + F T S    W   CVPKLIE+G++P  G +D+D L+ NV GME
Sbjct  125   VTFAVDIAKEVGIPLLYFDTISPCALWTCLCVPKLIEAGEIPFKG-NDLDALVNNVPGME  183

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
              V+R RDLPSFCR  DL++     ++       +A GLI NTFE LE   L Q R   PN
Sbjct  184   GVIRRRDLPSFCRAPDLNNPTIQRIVKEGKHIVQAQGLIFNTFEGLEGPILPQFRTLCPN  243

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             +Y+IGPLH HL+  +SS        +S+S+W+ED SCM WLDEQP KSV++VS GS+  +
Sbjct  244   IYSIGPLHIHLKKSLSSKCSVPKTSTSNSIWKEDMSCMDWLDEQPNKSVLFVSIGSVATM  303

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKGYMVGWAPQEEV  1171
             ++ Q LE W+G+VNS   FLW  RP SVIG   +++IP EL + T+++G +V WAPQEEV
Sbjct  304   SKAQLLEIWYGLVNSKTRFLWVQRPGSVIGLEENNDIPMELSKYTKERGCIVSWAPQEEV  363

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HP++GGFLTH GWNSTLESI EG+PMICWP++ DQQVNSR VG VWK G+DMKD CDR
Sbjct  364   LAHPSIGGFLTHCGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKDVCDR  423

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
               VEKMV+E+MEVR+ EF +    M KLA ++V + GSSY +LD LVED++ M++
Sbjct  424   AIVEKMVREIMEVRKIEFLERGREMRKLAIESVNEGGSSYKDLDSLVEDIRLMRI  478



>gb|ACS87994.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis]
Length=484

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/473 (56%), Positives = 341/473 (72%), Gaps = 16/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYT-DLHLRFSSYPNF  280
             HVLI+P P  GHVN ML+LAELL H + I +TFLNSE  H+RL+R++ D+  R+ + P F
Sbjct  17    HVLIWPLPALGHVNSMLKLAELLSH-AGIKITFLNSEHYHERLVRHSSDVFSRYMNLPGF  75

Query  281   YFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGI  460
              F+TI+DGLP DHP+T D   +L NS+ +VT P  ++ML+        + PV CII+DG+
Sbjct  76    QFKTITDGLPKDHPQTVDNFHELLNSLASVTPPLLKDMLTDA------KSPVHCIISDGL  129

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             M FAIDV  ++ IP I FRT SA  FWA+FC+P++I++G+LP+ G  DMD+L+++V GME
Sbjct  130   MSFAIDVAKQVGIPIIYFRTVSACAFWAYFCIPEIIDAGELPIKGNEDMDRLIKHVPGME  189

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
               LR RDLPSFCR  D  +     V+  T  + RA+GL+LNTFEDLE   L+QIR H P 
Sbjct  190   KFLRCRDLPSFCRAEDPMNMNLQLVVSETRSSVRADGLVLNTFEDLEGPVLSQIRAHCPK  249

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             +YTIGPL+AHL+AR+  +       SS+SLWE DR C+AWLD QP KSV++VSFGS+ V+
Sbjct  250   IYTIGPLNAHLKARIPENT-----HSSNSLWEVDRGCIAWLDNQPSKSVIFVSFGSVAVM  304

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQEEV  1171
              R+Q +EFW+G+VNS K FLW IRP+ + G D    IP EL + T+++GY+ GW PQEEV
Sbjct  305   QRDQLIEFWYGLVNSHKRFLWVIRPDLISGKDGENQIPKELDKATKERGYIAGWVPQEEV  364

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L H AVGGFLTH GWNSTLESI   +PMICWP +ADQQ+NSR V  VWK G+DMKD CDR
Sbjct  365   LGHKAVGGFLTHCGWNSTLESIVARMPMICWPSFADQQINSRFVDEVWKLGLDMKDLCDR  424

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
               VEKMV EL+  RR  F K ++RMA LA K+V + GSSY NLDRL+ D++ M
Sbjct  425   KIVEKMVNELLVERRAAFMKSADRMANLAIKSVNEGGSSYCNLDRLINDIRMM  477



>ref|XP_009800319.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=479

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/482 (55%), Positives = 346/482 (72%), Gaps = 8/482 (2%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQ S   HVLIFP P+QG VN   +LAELLC  S + +TFL +E  H RL+ +T+++ R
Sbjct  1     MDQESLPPHVLIFPLPLQGPVNSTFKLAELLCF-SGLDITFLLTENIHNRLISHTNINSR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG-RPPV  436
             F  +P F  +TISDGLP DHPR G + ++LF+S+ + TKP F++ML+SG L S G R  V
Sbjct  60    FERFPGFQIKTISDGLPQDHPRKGSKYMELFDSLKSKTKPLFKDMLTSGWLSSDGKRREV  119

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             +CIIADG++ F  DV NE+ IP    RT S  C W FFC+P+LIESG+ P   + D+D+ 
Sbjct  120   SCIIADGVLGFTCDVANEIGIPIFSIRTISPCCLWIFFCLPQLIESGEYPFK-DDDLDEP  178

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             +++V G E  LR RDLP FCRT DL+D             +RA GLILNTFE+L+ + L+
Sbjct  179   IKSVPGAETFLRRRDLPDFCRTGDLTDSNVQLYKTEGQENSRAYGLILNTFEELDGNLLS  238

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             Q+R   PN+Y IGPLHAHL+ ++S     +P  SS+SL+EED+SC+ WL+ Q   SV+YV
Sbjct  239   QMRNVCPNIYPIGPLHAHLKNKLSEENNSMP-PSSNSLFEEDKSCINWLNNQLPNSVIYV  297

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+  +T+ Q +EFW+G+VNS + FLW IR +SV GDD    IP EL EGT+++GY+V
Sbjct  298   SFGSIATMTKEQLMEFWYGLVNSKQRFLWVIRLDSVAGDDWKNKIPVELAEGTKERGYIV  357

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GWAPQEEVL HP+VGGF TH GWNS LE++ EG PMICWP++ DQQVNSR V A WK G+
Sbjct  358   GWAPQEEVLAHPSVGGFWTHCGWNSILETVYEGKPMICWPYFMDQQVNSRFVEAAWKLGL  417

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKDTCDR  VEKMVK+LM VR+DEF + +N+M+K A+K + + GSSYSN +RLV D+K 
Sbjct  418   DMKDTCDREIVEKMVKDLMMVRKDEFLERANQMSKFAKKCLVEGGSSYSNFERLVNDIKS  477

Query  1508  MK  1513
              K
Sbjct  478   FK  479



>ref|XP_011084985.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=495

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/489 (56%), Positives = 343/489 (70%), Gaps = 14/489 (3%)
 Frame = +2

Query  77    PTMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             P  D     H+LIFP P+QGHVN ML LAELLC  S +HVT L S +AH RLLR+  L  
Sbjct  4     PETDTELPPHILIFPLPLQGHVNSMLNLAELLCL-SGLHVTILLSNYAHNRLLRHASLRS  62

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG--RP  430
              FS +  F   T SDGLPADHPR G+R++DL  S+  +   +FR ++ S    S G  R 
Sbjct  63    LFSRHSGFRVATFSDGLPADHPRAGERLMDLAFSLKELGGSQFRRLMESTDGLSDGGARR  122

Query  431   PVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD--  604
              V+C+I DG++ F I V  E+ IP I FRT  A  FW  FC+ ++I++G++PL G+++  
Sbjct  123   GVSCLIIDGLLSFIISVVEEMGIPYIYFRTIGACSFWPHFCIQEIIDAGEVPLKGKNEDK  182

Query  605   --------MDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLIL  760
                     MD ++ +V GME VLR RD+P      +  D  F ++   T RT  A GLIL
Sbjct  183   LTYWKKKEMDMMVTSVPGMEKVLRRRDIPRSFGVANGDDPTFKTMKTDTKRTVEACGLIL  242

Query  761   NTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAW  940
             NTFEDLE   L QIRKHIPNLY+IGP+HA L+ R+ S   E     SSSLWEEDRSC+AW
Sbjct  243   NTFEDLEAPILDQIRKHIPNLYSIGPIHALLKDRLESEGMESSHNYSSSLWEEDRSCIAW  302

Query  941   LDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN-IPAELI  1117
             LD QP  SV+YVSFGS+T LTR++ LEFW+G+VNSG  FLW +RP+S+ G+ N IP EL 
Sbjct  303   LDSQPTCSVIYVSFGSITTLTRDELLEFWYGLVNSGHKFLWVMRPDSISGNGNEIPVELE  362

Query  1118  EGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSR  1297
             EGT+ +G+MVGW PQ+EVL HPA+G F THSGWNST+ESI  GLPM+CWP++ADQ  NSR
Sbjct  363   EGTKSRGWMVGWVPQQEVLAHPAIGAFFTHSGWNSTIESIAIGLPMLCWPYFADQMTNSR  422

Query  1298  LVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSN  1477
              V  VWK G+DMKDTCDRITVEKMVKE M+VRRDEF+K ++ MA LARKA+++ G+SY N
Sbjct  423   FVSEVWKVGLDMKDTCDRITVEKMVKEAMDVRRDEFSKRAHNMAMLARKAISEGGTSYLN  482

Query  1478  LDRLVEDLK  1504
             L+RL+E LK
Sbjct  483   LNRLIEFLK  491



>ref|XP_010032069.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51454.1| hypothetical protein EUGRSUZ_J00979 [Eucalyptus grandis]
Length=479

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/474 (56%), Positives = 343/474 (72%), Gaps = 11/474 (2%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+IFP   QGHVN ML+LAELL   S + +TF+NSE  H RLL++ D+  RF++YP+F 
Sbjct  10    HVVIFPLAAQGHVNSMLKLAELLA-LSGLRITFINSEHIHHRLLQHADIPARFAAYPDFQ  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F+ ISDG P  HPR  D  +  F+ + ++TK  F E++S+         PVTCIIADGI+
Sbjct  69    FKIISDGFPIHHPRPSDHFLTTFDYVKSITKQLFEELVSAPDR------PVTCIIADGIL  122

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              F ID   +L +P I FRT SASCFW +FC+P++IESGDLP+ G+ DMD+ + +V GME+
Sbjct  123   TFTIDFAGDLGVPVIAFRTISASCFWTYFCIPRMIESGDLPIKGDEDMDRDVTSVPGMED  182

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
             +LR RDLPSFCR  DLSD     V   TLRTT A  LILN+F+ LE  A++QIR H PNL
Sbjct  183   ILRCRDLPSFCRVADLSDWLLQYVTTQTLRTTGARALILNSFDHLEGPAISQIRTHFPNL  242

Query  824   YTIGPLHAHLRARV--SSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTV  997
             YTIGPLH H ++R+  SS     P  +S+SLWE DRSC++WLD+QP KSV+YVSFGS+T 
Sbjct  243   YTIGPLHLHHKSRLSSSSPSSPPPSSASNSLWEVDRSCISWLDKQPPKSVIYVSFGSITT  302

Query  998   LTRNQFLEFWHGIVNSGKAFLWAIRPNSVI--GDDNIPAELIEGTRKKGYMVGWAPQEEV  1171
             LTR+ F EFW+G+VNSG+ FLW IRP+S+   G+  +P EL E   ++G +VGWAPQEEV
Sbjct  303   LTRHDFTEFWYGLVNSGRRFLWVIRPDSLADGGNGAVPEELREAAAERGCIVGWAPQEEV  362

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L H AV  FLTHSGWNSTLES+  G PM+CWPF ADQQ+NSRLV  +WK G+DMKD CDR
Sbjct  363   LDHGAVAAFLTHSGWNSTLESVVAGKPMVCWPFSADQQLNSRLVSHLWKVGLDMKDVCDR  422

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMK  1513
               +E+MV E+M  R++EF   +  +A+ AR A ++ GSS+ NLDRL+ED++ MK
Sbjct  423   EVMERMVNEVMGERKEEFAAAAGDLARRARDAASEGGSSWDNLDRLIEDVRSMK  476



>gb|EYU19961.1| hypothetical protein MIMGU_mgv1a005050mg [Erythranthe guttata]
Length=499

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/480 (54%), Positives = 348/480 (73%), Gaps = 15/480 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QGH+N ML+LAELLC  S IHV+ L S+++H RL R+  +  RFS YP F 
Sbjct  19    HVLIFPLPMQGHINSMLKLAELLCL-SDIHVSMLISDYSHSRLRRHASIESRFSRYPGFR  77

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG--RPPVTCIIADG  457
               T++DGLP DHPR G+R +D+  S+  V    FR ++ +    S G  R  V+C+I DG
Sbjct  78    VATMTDGLPDDHPRAGERSMDIVMSLVRVGGTEFRRVMETTDALSDGGARRRVSCLIMDG  137

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGE----------SDM  607
             +  FA+ V  E+ IP + FRT SA  FWA FC  ++IE+G++PL G+           D 
Sbjct  138   VFSFAVPVVEEMGIPFLYFRTISACAFWANFCFKEVIEAGEIPLKGKDEDKYAYWKREDF  197

Query  608   DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEES  787
             D  + +V GME  LR RDLP+FCR  D+++  F ++I  + RT R+NGLILN+FEDLE  
Sbjct  198   DLPVTSVPGMEGYLRRRDLPAFCRVNDVNNPVFQTIITESKRTARSNGLILNSFEDLEGP  257

Query  788   ALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
              L QIR HIPNLY IGP+H HL+AR+ S + ELP   SSS WEEDRS + WL+ QP KSV
Sbjct  258   ILDQIRNHIPNLYPIGPIHTHLQARLVSKKTELPL-PSSSFWEEDRSSITWLNNQPTKSV  316

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD-NIPAELIEGTRKKGYM  1144
             +YVSFGS+T+LTR++  EFW+G+VNSG  FLW +RP+S+ G++ ++P EL  GT+++GY+
Sbjct  317   IYVSFGSITLLTRSEVFEFWYGLVNSGHRFLWVMRPDSITGEEYSVPEELDTGTKERGYL  376

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             VGW PQ EVL HP+VG F THSGWNST+ES+  G+PMICWP++ADQ +NSR V  VWK G
Sbjct  377   VGWVPQNEVLAHPSVGAFFTHSGWNSTMESVAAGVPMICWPYFADQTINSRFVSDVWKVG  436

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +DMKD+CDR+ VEKMV+E+ME +RDEF++   R A+LA+KAV++ GSSYS+L+RL++ +K
Sbjct  437   LDMKDSCDRVIVEKMVREVMEDKRDEFSERGVRFAELAKKAVSEGGSSYSSLNRLIDFIK  496



>emb|CBI31575.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/480 (57%), Positives = 338/480 (70%), Gaps = 28/480 (6%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQ   S HVLIFPFP QGHVN ML+LAELL   + +HVTFLNSE+   RLL +TD+  R
Sbjct  1     MDQGPVSPHVLIFPFPAQGHVNSMLKLAELLS-VAGLHVTFLNSEYNQHRLLLHTDIQTR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             FS YP F F+TISDGL  DHPRTG+RV+DLF  + A  KP FRE++ S    S   PPV 
Sbjct  60    FSGYPGFRFQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVN  119

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADGIM F ID+ NE+ IP I FRT SA  FWA+F   KLIESG+LPL G +DMD+L+
Sbjct  120   CIIADGIMSFTIDIANEVGIPIISFRTISACSFWAYFSALKLIESGELPLKG-NDMDQLV  178

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              ++ GME  LR RDLPS  R ++L D G L V+  T +T RA+ LILNTFEDLE   L Q
Sbjct  179   TSIPGMEGFLRKRDLPSLIRVSNLDDEGLLLVMKETQQTPRAHALILNTFEDLEGPILGQ  238

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P +YTIGPLHAHL+ R++S       +SS+S  +EDRSC+AWLD QP KSV+YVS
Sbjct  239   IRNHCPKIYTIGPLHAHLKTRLASE--STTSQSSNSFRQEDRSCIAWLDHQPSKSVIYVS  296

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVG  1150
             FGS+TV++R Q +EF HG+VNSG  FLW IR +S+    G+   PAEL+EG +++ Y+V 
Sbjct  297   FGSLTVISRKQLIEFCHGLVNSGSRFLWVIRTDSLAEEDGEHQTPAELMEGAKERSYIV-  355

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
                                 GWNSTLESIC G+PMICWP++ADQQ+NSR V  VWK G D
Sbjct  356   -------------------DGWNSTLESICAGVPMICWPYFADQQINSRFVSHVWKLGSD  396

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR+ VEKMV++LME R+DE  K +++MA  ARK V++ GSSY NL  LV++++ M
Sbjct  397   MKDTCDRLIVEKMVRDLMEERKDELLKTADKMATRARKCVSEGGSSYCNLSSLVDEIRLM  456



>ref|XP_010032068.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51453.1| hypothetical protein EUGRSUZ_J00977 [Eucalyptus grandis]
Length=479

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/474 (56%), Positives = 337/474 (71%), Gaps = 11/474 (2%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+IFP   QGHVN ML+LAELL   S + +TF+NSE  H RLL++ D+  RF++YP+F 
Sbjct  10    HVVIFPLAAQGHVNSMLKLAELLAL-SGLRITFINSEHIHHRLLQHADIQARFAAYPDFR  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F+ ISDG P DHPR GD  +  FN + ++TK    E++S+         PVTCIIADGI+
Sbjct  69    FKIISDGFPIDHPRAGDHALTTFNYVKSITKQLLEELVSAPDR------PVTCIIADGIL  122

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              F ID   +L +P I FRT SASCFWA+FC+P++IESGDLP+ G+ DMD+ + +V GME+
Sbjct  123   SFTIDFAGDLGVPVIAFRTISASCFWAYFCIPRMIESGDLPIKGDEDMDRDVTSVPGMED  182

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
             +LR RDLPSFCR  DLSD     V   TLRTT A  LILN+F+ LE  AL+QIR H PNL
Sbjct  183   ILRCRDLPSFCRVADLSDWNLQYVTTQTLRTTGARALILNSFDQLEGPALSQIRTHFPNL  242

Query  824   YTIGPLH--AHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTV  997
             YTIGPLH     R   SS        +S+SLWE DRSC+AWLD+QP KSVVYVSFGS+T 
Sbjct  243   YTIGPLHSHLKSRLSSSSPSSPPSSSASNSLWEVDRSCIAWLDKQPPKSVVYVSFGSITT  302

Query  998   LTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN--IPAELIEGTRKKGYMVGWAPQEEV  1171
             L R+ F EFW+G+VNSG+ FLW +R +S+    +  +P EL E   ++G +VGWAPQEEV
Sbjct  303   LNRHDFTEFWYGLVNSGRRFLWVLRSDSLPEGSSGAVPEELREAAAERGCIVGWAPQEEV  362

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L H A+  FLTHSGWNSTLES+  G PM+CWPF+ADQQ+NSRLV   WK G+DMKD CDR
Sbjct  363   LHHGAIAAFLTHSGWNSTLESVVAGKPMVCWPFFADQQLNSRLVSHAWKAGLDMKDVCDR  422

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMK  1513
               VE+MV E+M  R++EF   +  +A+ AR A ++ GSS+ NLDRL+ED++ MK
Sbjct  423   EVVERMVNEVMGERKEEFAAAAGDLARRARDAASEGGSSWDNLDRLIEDIRSMK  476



>ref|XP_011100060.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=493

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/482 (54%), Positives = 347/482 (72%), Gaps = 16/482 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QGH+N ML+LAEL C  S++HVT L SE+ H RL R+ ++  RFS YP F 
Sbjct  10    HVLIFPLPMQGHINSMLKLAELFCL-SNLHVTMLLSEYTHGRLRRHANIESRFSRYPGFR  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG--RPPVTCIIADG  457
               TI DGLP DHPR G+R +++  S+  V    FR+++ +    S G  R  VTC+I DG
Sbjct  69    VATIPDGLPEDHPRVGERTMEIVMSLLKVGGAEFRKLMETTDALSDGGARRRVTCLIMDG  128

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGE----------SDM  607
             ++ FA+ V  E+ IP I FRT  A  FWA FC   +IE+G+ PL G+           ++
Sbjct  129   VLSFAVPVAEEMGIPFIYFRTVGACSFWANFCFKDVIEAGEAPLKGKDEGKHEYWKKEEL  188

Query  608   DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEES  787
             D ++ +V GME  LR RDLP+FCR  D++D GF ++I  T RT  + GLILN+FEDLE  
Sbjct  189   DLMVTSVPGMEGYLRRRDLPAFCRVNDVNDPGFQTIIRETRRTALSRGLILNSFEDLEGP  248

Query  788   ALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
              L QIRK IPNLY+IGPLH HL+AR+ S + E     SSS +EEDRS M+WLD QP KSV
Sbjct  249   ILDQIRKPIPNLYSIGPLHTHLKARLESQKSEESSLPSSSFYEEDRSSMSWLDSQPPKSV  308

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKG  1138
             +YVSFGS+T+LTR++ LEFW+G+VNSG  FLW +RP+S++GD+    IPAEL E T+++G
Sbjct  309   LYVSFGSVTLLTRDELLEFWYGLVNSGHKFLWVMRPDSIVGDNKDNPIPAELEEATKERG  368

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
             Y+VGW PQ EVL HP+VG F THSGWNSTLE I   +PMICWP++ADQ +NSR V  VWK
Sbjct  369   YLVGWVPQNEVLAHPSVGAFFTHSGWNSTLEGIAAVMPMICWPYFADQTINSRFVSEVWK  428

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G+DMKD+CDR+ VEK V+++MEVRRDEF + +  MA+LA+K++++ G+SY+NL+RL+E 
Sbjct  429   VGLDMKDSCDRVIVEKTVRDIMEVRRDEFLERALHMAELAKKSISEGGTSYTNLNRLIEF  488

Query  1499  LK  1504
             ++
Sbjct  489   IR  490



>gb|EYU19963.1| hypothetical protein MIMGU_mgv1a005336mg [Erythranthe guttata]
Length=488

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/486 (53%), Positives = 341/486 (70%), Gaps = 8/486 (2%)
 Frame = +2

Query  77    PTMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             P  +   S HVLIFP P+QG VNCML+LAEL      I  TFLN+   H RLL  TD H 
Sbjct  2     PKNEASLSPHVLIFPLPLQGPVNCMLKLAELFSLRR-IRTTFLNTHHIHHRLLDCTDNHT  60

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGS-LQSSGRPP  433
              F+ YP   F T+ DGLP  +PRTGD++ +L NS++AV  P FR+M++SG         P
Sbjct  61    YFTRYPLLRFDTVPDGLPEGNPRTGDQIPNLLNSMDAVAVPIFRQMVTSGGPYGPDSENP  120

Query  434   VTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDK  613
             VTCIIADGI  FA ++  E+ +P + F T S    W + C+PKLIE+G++P   + ++D+
Sbjct  121   VTCIIADGIFTFAAEIAAEIGVPLLYFDTISPCGLWTYLCLPKLIEAGEVPFK-DDNLDE  179

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESAL  793
             ++ N  GME ++R RDLPSFCRT DL+DR    V+        A GLI NTF++LE   L
Sbjct  180   IIINAPGMEGIIRRRDLPSFCRTKDLNDRIIQLVLKEDKHIPLAQGLIFNTFQELESPIL  239

Query  794   AQIRKHIPNLYTIGPLHAHLRARVSSSRGE--LPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
             +Q+    PN+Y +GPLHAHL+ARV S  G    P  S++S+W+ED+SC++WLD Q  KSV
Sbjct  240   SQLLNISPNIYAVGPLHAHLKARVESLTGPEFRPETSTNSIWKEDKSCISWLDAQASKSV  299

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKG  1138
             ++VS GS+ V+T+ Q  E W+G+VNSG  FLW  RP SVIG D    IP EL EGT+++G
Sbjct  300   IFVSIGSLAVMTKEQLFEIWYGLVNSGSKFLWVRRPGSVIGADAELEIPLELSEGTKERG  359

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
             ++V WAPQEEVL HPA+GGFLTHSGWNSTLESI EG PMICWP++ DQQVNSR VG VWK
Sbjct  360   FIVKWAPQEEVLGHPAIGGFLTHSGWNSTLESIVEGKPMICWPYFVDQQVNSRYVGEVWK  419

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G+DMKDTCDR  VEKM++E+M +++DEF + + +MA+LA+ +V + GSS+ + DRLVED
Sbjct  420   LGLDMKDTCDRAVVEKMIREVMVLKKDEFLETAAKMAELAKSSVAEGGSSFLDFDRLVED  479

Query  1499  LKKMKL  1516
             +K MK+
Sbjct  480   VKTMKI  485



>emb|CDP19643.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/455 (58%), Positives = 331/455 (73%), Gaps = 8/455 (2%)
 Frame = +2

Query  149   MLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRT  328
             MLRLAELLC  + + VT++ S+F H RLL +T++   F+ YP F F+TISDGLP DHPR 
Sbjct  1     MLRLAELLCL-AGLDVTYIVSDFCHNRLLTHTNVSSHFARYPGFSFQTISDGLPDDHPRA  59

Query  329   GDRVVDLFNSINAVTKPRF-REMLSSGSLQSSG-RPPVTCIIADGIMCFAIDVGNELRIP  502
             G+  VD+  +I  VT P F R M+  G   SSG R PVTCIIADG++ FA D   E  I 
Sbjct  60    GEGFVDIMPAIKMVTGPLFKRMMIEKGCFASSGTRSPVTCIIADGVLSFAGDFAEENGIA  119

Query  503   TILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRT  682
              I FRT SA  FWA FC+P++IE+G++PL G   M+  +++V GMEN+LR RDLP F R 
Sbjct  120   LIYFRTVSACSFWACFCMPQVIEAGEIPLKGHG-MELAVKSVPGMENILRRRDLPGFYRV  178

Query  683   TDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRAR  862
              DL D  F  +   T +T RA  +ILNTFEDLE   L+ IRKH+P LYTIGP H HL AR
Sbjct  179   DDLDDTTFQIIKTETQQTPRAQAVILNTFEDLEGPILSHIRKHMPRLYTIGPNHFHLTAR  238

Query  863   VSSSRGELP-WRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIV  1039
             + +   E     SS+SLWEEDRSC+ WLD QP KSV+YVSFGS+T++ R Q LEFW+G+V
Sbjct  239   LGAKATETETLISSASLWEEDRSCLDWLDSQPPKSVIYVSFGSITIVRREQLLEFWYGLV  298

Query  1040  NSGKAFLWAIRPNSVIGD---DNIPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHS  1210
             NSG+ FLW +RP+S++G+     IPAEL   T+ +GYMVGWAPQ EVL HP+VGGFLTH 
Sbjct  299   NSGQRFLWVVRPDSIMGEAGGGKIPAELETATKARGYMVGWAPQLEVLNHPSVGGFLTHG  358

Query  1211  GWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEV  1390
             GWNSTLES+  G+PM+CWP++ADQ +NSR V  +WK G+DMKDTCDR+ ++KMV ELM  
Sbjct  359   GWNSTLESMAAGVPMLCWPYFADQTINSRFVSEIWKIGLDMKDTCDRVIIQKMVAELMHA  418

Query  1391  RRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
             R+DEF + ++ MAKLARKAVTQ G+SY+NLD LVE
Sbjct  419   RKDEFLRRADAMAKLARKAVTQGGTSYNNLDSLVE  453



>emb|CDP05607.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/489 (55%), Positives = 340/489 (70%), Gaps = 18/489 (4%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q+   HVLIFPFP QGHVN ML+LAELLC  + I++TFL S   H RLLR+T++  RFS 
Sbjct  5     QQLRPHVLIFPFPAQGHVNSMLKLAELLCL-AGINITFLVSNNIHNRLLRHTNVVSRFSK  63

Query  269   YPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSS--GRPPVTC  442
             YP F+     D            ++DL  ++ +V KP  +E+LS      +   RPP +C
Sbjct  64    YPGFHLDHYPDAYDESKVHIAQEIMDLCTALQSVVKPFLKELLSKDPAHGTRKDRPPFSC  123

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             II DG +  A+DV  E+ +P I FRT SA  FW +FC+P+L+E+G+LP  G+ +M+  +E
Sbjct  124   IIVDGFLSLALDVAEEIGLPLICFRTISAGAFWTYFCIPRLVEAGELPFPGD-EMNLPIE  182

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
             NV+GME  LR  DLPSF R  DL++  F  ++   L+T RA GLILNTFEDLE   L+  
Sbjct  183   NVKGMEGFLRRCDLPSFLRVGDLTNPDFNLLLKEALQTPRAKGLILNTFEDLEGCILSHF  242

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSF  982
             R H PNLYTIGPLHAHLRAR+          +S+SLWEED+SC+ WLD QP KSV+YVSF
Sbjct  243   RTHCPNLYTIGPLHAHLRARLQLQEANSNNSNSNSLWEEDKSCIKWLDNQPPKSVLYVSF  302

Query  983   GSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSV---IGDDNIPA-----------ELIE  1120
             GS+ ++TR   LEFWHGIVNSG  FLW IRPNSV   +GDD + +           EL E
Sbjct  303   GSIAIITRETLLEFWHGIVNSGVRFLWVIRPNSVNVGLGDDVLDSTKSKSKSTPEMELEE  362

Query  1121  GTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRL  1300
              T+++G MVGWAPQE+VL HPA+GGFLTHSGWNSTLESI EG+PMICWP +ADQQ NSR 
Sbjct  363   ATKERGCMVGWAPQEDVLAHPAIGGFLTHSGWNSTLESIAEGVPMICWPCFADQQPNSRF  422

Query  1301  VGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNL  1480
             VG +WK G+DMKDTCDR+ VEKMV++LM  R+DEF   ++ MAKLARK++ + GSS+ NL
Sbjct  423   VGEIWKIGLDMKDTCDRVIVEKMVRDLMVERKDEFLHRADEMAKLARKSIEEGGSSFCNL  482

Query  1481  DRLVEDLKK  1507
              RL++D+ K
Sbjct  483   VRLIDDIVK  491



>ref|XP_009597174.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/479 (56%), Positives = 343/479 (72%), Gaps = 12/479 (3%)
 Frame = +2

Query  92    RSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSY  271
             R   HV+IFPFP  GHV+ ML LAELL   S+IHVTF+N+   H RLLR TDL  RF  +
Sbjct  6     RQPPHVVIFPFPALGHVHPMLNLAELLSLSSNIHVTFINALSIHNRLLRCTDLQSRFGRF  65

Query  272   PNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREM--LSSGSLQSSGR-----P  430
             P F F+TI+ GL    P T D ++ +  S+    KP  +E+  L +  L ++ +     P
Sbjct  66    PGFRFKTINLGLGDGLPHTSDDIMAVLKSLRTTAKPLLKELFLLDNCELGTTDKIIGQVP  125

Query  431   PVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMD  610
             PVTC+I+DGI+  A++V  E  IPT  FRT SAS FWA++C+P+LI +G+LP +G +D+D
Sbjct  126   PVTCLISDGILIIALEVAEERGIPTFHFRTSSASSFWAYYCIPQLIHAGELPFSG-NDLD  184

Query  611   KLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESA  790
               + NV+GME+ LR RDLPSFCR  +L +  F  V   TL T R  GLI NTFE LE   
Sbjct  185   TPIANVKGMESFLRRRDLPSFCRVDNLGEGTFQCVRSVTLSTLRTKGLIFNTFEGLEGPI  244

Query  791   LAQIRKHIPNLYTIGPLHAHLRARVSS-SRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
             L QIR  IPN+YTIGPLHAHL+ +++S S+G+    SS+ LWEEDRSC+ WLDEQP +SV
Sbjct  245   LDQIRVDIPNIYTIGPLHAHLKNKLASESKGKSI--SSNGLWEEDRSCLKWLDEQPSRSV  302

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG-DDNIPAELIEGTRKKGYM  1144
             +YVSFGS+  LT+++  EFWHG+VNSG+ FLW IR + +   DD +  EL EG ++ GY+
Sbjct  303   LYVSFGSVITLTKHELTEFWHGLVNSGQQFLWVIRHDVIKDKDDVLEVELKEGRKENGYI  362

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             V WAPQEEVL HP++GGFLTHSGWNSTLES+ E +PMICWP  ADQQVNSR VG VWK G
Sbjct  363   VSWAPQEEVLAHPSIGGFLTHSGWNSTLESLYEAVPMICWPQLADQQVNSRFVGEVWKLG  422

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
             +D+KDTCDR+ +EKMV ELME RR+EF + +N M KLAR +V++ GSS  NLDRL++D+
Sbjct  423   LDLKDTCDRVIIEKMVSELMEARRNEFLQRANEMTKLARASVSEGGSSTRNLDRLIQDI  481



>ref|XP_011076757.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=489

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/484 (53%), Positives = 339/484 (70%), Gaps = 9/484 (2%)
 Frame = +2

Query  86    DQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             DQR+ S HVLIFP P+QG VNCML+LAELLC    I VTFLN+    +RL   T   + F
Sbjct  3     DQRAVSPHVLIFPLPLQGPVNCMLKLAELLCL-GQIQVTFLNTLHIQERLRNCTGAEVYF  61

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
               Y NF F T+ DGLP ++PRT D + +L  SI+AV  P FR M++SG        PVTC
Sbjct  62    KRYSNFRFDTVPDGLPEENPRTADEIWNLLQSIDAVAVPIFRCMVTSGVYGPGSENPVTC  121

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             IIADGI  FA  +  E+ +P + F T S    W + C+PKLIE+G+ P   + ++D+++ 
Sbjct  122   IIADGIFTFAAGIAGEIGVPLLYFDTISPCGLWTYLCLPKLIEAGEFPFK-DDNLDEIIR  180

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
             N  GME ++R RDLPSF RT D++      V+        A GLI NTFE+LE   L+Q+
Sbjct  181   NAPGMEGIIRRRDLPSFYRTNDVNHVTIQLVLKEDKHIPLAQGLIFNTFEELEAPILSQM  240

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRG--ELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
                 PN+Y +GPLHAHL+ R+++  G    P  +S+S+W ED SC++WLD QP KSV+YV
Sbjct  241   LNVCPNIYAVGPLHAHLKTRLAAETGPEAQPTITSNSIWREDSSCISWLDTQPSKSVIYV  300

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN----IPAELIEGTRKKGYM  1144
             S GS+ V+T++Q  E WHG+VNSG  FLW  RP SV G D+    IP+EL  GT+++GY+
Sbjct  301   SIGSLAVITKDQLFEIWHGLVNSGSRFLWVRRPGSVTGLDSETEEIPSELSRGTKERGYI  360

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             V WAPQ+EVL HPA+GGFLTHSGWNSTLESI EG PMICWP++ DQQVNSR VG VWK G
Sbjct  361   VTWAPQDEVLGHPAIGGFLTHSGWNSTLESIVEGKPMICWPYFVDQQVNSRYVGEVWKLG  420

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +DMKDTCDR+ VEKM++ELME R++EF + ++ MAKLA+ +V++ GSSY++LDRL++D+K
Sbjct  421   LDMKDTCDRVVVEKMIRELMESRKNEFLERADEMAKLAKASVSEGGSSYADLDRLIDDIK  480

Query  1505  KMKL  1516
              M +
Sbjct  481   FMNI  484



>ref|XP_006355163.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Solanum tuberosum]
Length=471

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/475 (52%), Positives = 337/475 (71%), Gaps = 12/475 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV IFP P+QG VNCML+LAELLC    IHVTF+N+E+ HQRLL YTD+ +RF+ YPNF 
Sbjct  5     HVFIFPLPLQGPVNCMLKLAELLCLHQEIHVTFINTEYIHQRLLNYTDVLIRFAKYPNFK  64

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP D+PR G++V  +   +  V+ P FREM+    + ++     TC+I DGI 
Sbjct  65    FVTIPDGLPEDNPRNGEQVGKIIEGVEKVSSPLFREMVM---MTTTNYCAPTCLIVDGIF  121

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              FA+D+  + +IP + F T S    W +  VPKLIE G++P  G +D+D L+ +V GME 
Sbjct  122   TFAVDIAKDAKIPLLYFDTISPCAIWTYLAVPKLIEDGEIPFKG-NDLDALVNSVSGMEG  180

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
             V+R RDLPS+CR TDL       +I       +A  LILNTFE LE   L+Q R   PN+
Sbjct  181   VMRRRDLPSYCRATDLDIPIIQHIIKQGKHIVQAQALILNTFEALEGPILSQFRALCPNI  240

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             Y IGPLH  ++A+++S    LP  +S+SLW+ED SC+ WL++QP KSV++VS GS+  ++
Sbjct  241   YAIGPLHTQMKAKLASQ--SLP--TSNSLWKEDMSCIDWLNKQPNKSVLFVSIGSLATMS  296

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVIG----DDNIPAELIEGTRKKGYMVGWAPQEEV  1171
             + QFLEFW+G+VNS   FLW  RP S+IG    D N+P EL+E T+++G +V WAPQEEV
Sbjct  297   KAQFLEFWYGLVNSKTRFLWVQRPGSIIGLEDDDINVPMELVESTKERGCIVSWAPQEEV  356

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HP++GGFLTH GWNSTLESI EG+PMICWP++ DQQVNSR VG VWK G+DMKD CDR
Sbjct  357   LAHPSIGGFLTHCGWNSTLESIAEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKDVCDR  416

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
              T+E+MV E+M+V++ EF + + +M+ LA  +V + G+SY +L+RL+ED++ M++
Sbjct  417   ATIERMVIEVMDVKKIEFLERAKQMSNLAIASVGEGGASYQDLERLIEDIRLMRI  471



>emb|CDP16024.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/481 (52%), Positives = 338/481 (70%), Gaps = 8/481 (2%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q S+ HVL+FP P+QG VNCML LAEL C    +HVTF+N++    RL   +D+  RF  
Sbjct  6     QFSTPHVLVFPLPLQGPVNCMLNLAELFCL-GDLHVTFINTDHVQDRLRSCSDVESRFER  64

Query  269   YPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCII  448
             YPNF F TI DGLP D PRTG  ++ L  S+  V++P FR M++SGSL  +   P TCII
Sbjct  65    YPNFRFHTIPDGLPEDSPRTGGHILKLIQSLEVVSQPIFRAMVTSGSLGHNSEKPATCII  124

Query  449   ADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENV  628
             ADGI  FA+D+  E+ +P I F T S    W + C+PKLIE+ + P  G+ D+D  L ++
Sbjct  125   ADGIFSFAVDIAKEIGVPLIYFDTISPCGLWTYLCIPKLIEAQEFPFKGD-DLDAPLSSL  183

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
             + ME ++R RDLPSFCR  ++ D     ++    +   A  +I NTFE+L+   L+ +R 
Sbjct  184   QEMECIMRRRDLPSFCRVREIDDPLIRIILEEDRQLPLAQAIIFNTFEELDRGTLSLMRT  243

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
               P +Y IGPLH HL++R++++    P  SS SLW+ED+SC+AWL++QP+KSV+YVS GS
Sbjct  244   LGPTVYAIGPLHTHLKSRLAATTS--PPASSHSLWKEDKSCIAWLNDQPVKSVIYVSIGS  301

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD----DNIPAELIEGTRKKGYMVGWA  1156
             +  +T++Q +E W+G+VNSG  FLW  RP S+ G     D IP EL + T+++GY+V WA
Sbjct  302   LATMTKDQLMEIWYGLVNSGVRFLWVQRPGSIAGSAAKGDQIPEELAKATQERGYIVDWA  361

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEEVL HP +GGFLTHSGWNSTLESI EG+PMI WP++ DQQVNSR +  VWK G+DMK
Sbjct  362   PQEEVLGHPGIGGFLTHSGWNSTLESIAEGVPMIGWPYFVDQQVNSRYLLEVWKLGLDMK  421

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
             DTCDR+ VEKMVK++M++RRDEF   +N MAKLA  +V++ GSSY++LD L+ED+K M L
Sbjct  422   DTCDRVIVEKMVKDVMQLRRDEFLPRANEMAKLANSSVSEGGSSYNDLDNLIEDIKLMTL  481

Query  1517  Q  1519
             +
Sbjct  482   K  482



>ref|XP_006367216.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=474

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/476 (52%), Positives = 335/476 (70%), Gaps = 11/476 (2%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV IFP P+QG VNCML+LAELLC    IH+TF+N+E+ HQRL+ YTD+ +RF  YPNF 
Sbjct  5     HVFIFPLPLQGTVNCMLKLAELLCLHQEIHITFINTEYIHQRLMNYTDVLVRFEKYPNFK  64

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F T+ DGLP D+PR GD++  +   +  V+ P FREM+    + ++     TC+I DGI 
Sbjct  65    FVTVPDGLPEDNPRNGDQIGKIIEGVEKVSSPLFREMVM---MTTTNYCTPTCLIVDGIF  121

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              FA+D+  E +IP + F T S    W +  VPKLIE G++P  G +D+D L+  V GME 
Sbjct  122   SFAVDIAKEAKIPLLYFDTISPCSLWTYLAVPKLIEDGEIPFKG-NDLDALVNGVAGMEG  180

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
             V+R RDLPSFCRT DL       VI       +A GLI NTFEDLE   L+Q R   PN+
Sbjct  181   VMRRRDLPSFCRTPDLDIPIIKLVIKQGKHIVQAQGLIFNTFEDLEGPILSQFRALCPNI  240

Query  824   YTIGPLHAHLRARVSSSRGELP-WRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             Y IGPLH  ++A +SS    LP   +S+S+W+ED SC+ WL++QP KSV++VS GS+  +
Sbjct  241   YAIGPLHTQMKANLSSQY--LPNTPTSNSIWKEDMSCIDWLNKQPNKSVLFVSIGSLATM  298

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIG----DDNIPAELIEGTRKKGYMVGWAPQEE  1168
             ++ QFLEFW+G+VNS   FLW  RP S+IG    ++N+P EL++ T+++G ++ WAPQE+
Sbjct  299   SKAQFLEFWYGLVNSKTRFLWVQRPGSIIGLEDDNNNVPMELVKSTKERGCIISWAPQEK  358

Query  1169  VLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCD  1348
             VL HP++GGFLTHSGWNSTLESI EG+PMICWP++ DQQVNSR VG VWK G+DMKD CD
Sbjct  359   VLAHPSIGGFLTHSGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGIDMKDVCD  418

Query  1349  RITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
             R T+E+MV ++M+V + EF + +  M+ LA  +V + GSSY +LDRL+ED++ M++
Sbjct  419   RATIERMVIQVMDVEKIEFLEKAKHMSDLAIASVGEGGSSYQDLDRLIEDIRLMRI  474



>gb|KDP44850.1| hypothetical protein JCGZ_01350 [Jatropha curcas]
Length=490

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/481 (53%), Positives = 337/481 (70%), Gaps = 17/481 (4%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             SSSHVLIFPFP QGHVN ML+LAELL   S + +TFLN++ + + L R+TD+  RF  YP
Sbjct  8     SSSHVLIFPFPAQGHVNSMLKLAELLSL-SGLTITFLNTQHSQECLARFTDIKARFLKYP  66

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIAD  454
              F F T+ D LP D       V  + +++   +KP   ++L   +      P + C I D
Sbjct  67    GFRFVTVPDSLPID----SGNVAKVLDALKLESKPVIEKLLIESN------PRINCFIVD  116

Query  455   GIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEG  634
             GI+ F  D+ +EL IP I FRT SA  FW++FC+P +IE+G+LP+ GE +MD+L+  V G
Sbjct  117   GILGFVTDLASELAIPIIYFRTISACAFWSYFCIPDMIEAGELPIKGEEEMDRLITKVPG  176

Query  635   MENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHI  814
             ME  LR RDLPSFCR   +++  F  ++  T +TTRA  LI+NTFEDLE   L+QIR H 
Sbjct  177   METFLRKRDLPSFCRANGMTEPTFYMIMNETQQTTRAQALIMNTFEDLESPILSQIRNHC  236

Query  815   PNLYTIGPLHAHLRA-RVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSM  991
             P  YTIGPLH  L++ ++ S+  +   +SS+SLWE DR+C+AWLD QP +SV+YVSFGS 
Sbjct  237   PKTYTIGPLHELLKSIKIRSTNKQELHQSSNSLWEVDRTCIAWLDNQPSQSVIYVSFGSF  296

Query  992   TVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-----PAELIEGTRKKGYMVGWA  1156
               LT +Q +EFWHG++NS + FLW IRP+SV   + I     P EL EG ++ GY+V WA
Sbjct  297   ANLTLDQLIEFWHGLINSNRRFLWVIRPSSVTDKEGIVVEKFPEELQEGCKENGYIVKWA  356

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEEVL H A+GGFLTHSGWNSTLESI  G+PMICWP++ADQQ NSR V  VWK G+DMK
Sbjct  357   PQEEVLAHKAIGGFLTHSGWNSTLESIVAGVPMICWPYFADQQTNSRFVSEVWKLGLDMK  416

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
             D C+R  VEKMV +LM  +R+EF + + RMA+LARK++++ GSS+ NL+RL+ED++ M +
Sbjct  417   DVCNRKVVEKMVNDLMVNKREEFVRSAARMAELARKSISEGGSSFCNLNRLIEDIRLMSV  476

Query  1517  Q  1519
             Q
Sbjct  477   Q  477



>emb|CDP05611.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/491 (55%), Positives = 345/491 (70%), Gaps = 18/491 (4%)
 Frame = +2

Query  83    MDQ--RSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             MDQ  +   HVLIFPF  QGHVN ML+LAELLC  + I++TFL S   H RLLR+TD+  
Sbjct  1     MDQVEQHRPHVLIFPFQAQGHVNSMLKLAELLCL-AGINITFLVSYNIHNRLLRHTDVVS  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG--RP  430
             RFS YP F      D        T  ++++L++S+ +V KP  RE +S      +G  R 
Sbjct  60    RFSKYPGFNLDHYPDAYDESKIHTAQQIMELYSSLQSVVKPFLREFMSKDPAHGTGKNRS  119

Query  431   PVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMD  610
               + IIADGI+  A+DV  E+ +P I FRT SA  FW +FC+P+L+E+G+LP  G+ DM+
Sbjct  120   RFSSIIADGILSLALDVAEEIGLPLIYFRTISAGAFWTYFCIPQLVEAGELPFPGD-DMN  178

Query  611   KLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESA  790
               +ENV+GME  LR  DLPSFCR +DL+      ++  TL+T RA GLILNTFEDLE S 
Sbjct  179   IRIENVKGMEGFLRRCDLPSFCRVSDLTSPDLSLLLRETLQTPRAKGLILNTFEDLEGSI  238

Query  791   LAQIRKHIPNLYTIGPLHAHLRARVS--SSRGELPWRSSSSLWEEDRSCMAWLDEQPLKS  964
             L+ +R + PNLYTIGPLHAHL+ R+    +       +S+SLW+ED+SC+ WLD QP KS
Sbjct  239   LSHVRTYCPNLYTIGPLHAHLKTRLQLQVANSNNSNSNSNSLWQEDKSCIKWLDNQPPKS  298

Query  965   VVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSV---IGDDNIPA-------EL  1114
             V+YVSFGS+TV+TR +  EFWHGIVNSG  FLW IRP+S+    GDD +         EL
Sbjct  299   VLYVSFGSITVITREKLHEFWHGIVNSGVKFLWVIRPDSIKAEAGDDVLKTTKSTPEMEL  358

Query  1115  IEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNS  1294
              E T+++G MVGWAPQEEVL HPA+GGFLTHSGWNSTLESI EG+PMICWP++ADQQ NS
Sbjct  359   EEATKERGCMVGWAPQEEVLAHPAIGGFLTHSGWNSTLESIAEGVPMICWPYFADQQPNS  418

Query  1295  RLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYS  1474
             R VG VWK G+D+KDTCDR+ VEK +K+LM  R+DEF   ++ MAK+ARK+V + GSS+ 
Sbjct  419   RFVGEVWKIGLDIKDTCDRVIVEKAIKDLMVERKDEFLHRADEMAKMARKSVEEGGSSFC  478

Query  1475  NLDRLVEDLKK  1507
             NL RL++D+ K
Sbjct  479   NLVRLIDDIVK  489



>ref|XP_011084983.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=524

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/484 (55%), Positives = 343/484 (71%), Gaps = 18/484 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H+LIFP P+QGHVN ML LAELLC  S +HVT L S++ H RLLR+  L  RFS +  F 
Sbjct  38    HILIFPVPLQGHVNSMLNLAELLCL-SGLHVTILLSDYTHNRLLRHATLRSRFSRHSGFR  96

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS--GSLQSSGRPPVTCIIADG  457
               TISDGLP DHPR G+R+VD+  S+  +   +FR ++ S  G  +      V+C+I DG
Sbjct  97    VATISDGLPPDHPRVGERIVDMALSLKQIGGSQFRRLMESTDGLSEGGAMRRVSCLIMDG  156

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD----------M  607
             ++ FAI V  E+ IP I FRT SA  FW +FC+ +++++G++PL G+++          M
Sbjct  157   VLSFAISVVEEMGIPYIYFRTISACAFWPYFCIQEIMDAGEVPLRGKNEDKLTYWKKKEM  216

Query  608   DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEES  787
             D ++ +V GME  LR RD+P F    +  D  F ++   T +T  A GLILNTFEDLE  
Sbjct  217   DMMVTSVPGMERFLRRRDIPRFFGVANADDPTFKTMKTDTKKTVEACGLILNTFEDLEGP  276

Query  788   ALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
              L +IRKHIPNLY+IGPLHA L+A++ S   E     SSS WEEDRSC+AWLD QP  SV
Sbjct  277   ILDEIRKHIPNLYSIGPLHALLKAQLESKGMESSHNHSSSFWEEDRSCIAWLDSQPTCSV  336

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN-----IPAELIEGTRK  1132
             +YVSFGS+T+LTR++ LEFW+G+VNSG  FLW IRP+S++G+++     IP EL EGT+ 
Sbjct  337   IYVSFGSITILTRDELLEFWYGLVNSGHRFLWVIRPDSIVGNNSENWNEIPVELEEGTKS  396

Query  1133  KGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAV  1312
             +G MVGW PQ+EVL HPA+G F THSGWNSTLESI  GLPMICW ++ADQ  NSR V  V
Sbjct  397   RGCMVGWVPQQEVLAHPAIGAFFTHSGWNSTLESIAIGLPMICWAYFADQTTNSRFVSKV  456

Query  1313  WKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLV  1492
             WK G+DMKDTCDRI VEKMVK++M+VRRDEF + ++ MA L+ KA+++ GSSY NL+RLV
Sbjct  457   WKIGLDMKDTCDRIIVEKMVKDVMDVRRDEFLERAHSMAVLSGKAISEGGSSYLNLNRLV  516

Query  1493  EDLK  1504
             E LK
Sbjct  517   EFLK  520



>gb|KDO69253.1| hypothetical protein CISIN_1g011848mg [Citrus sinensis]
Length=476

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/484 (54%), Positives = 336/484 (69%), Gaps = 17/484 (4%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYT-DLHLR  259
             M+++   HV I P P  GHVN ML LAELL H + I +TFLN+E  + R++R++ D   R
Sbjct  1     MEKQDHVHVAILPLPAVGHVNSMLNLAELLGH-AGIKITFLNTEHYYDRVIRHSSDAFSR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             +   P F F+T++DGLP DHPRT D+  +L +S+N  T P  +EM+S        + PV 
Sbjct  60    YMQIPGFQFKTLTDGLPRDHPRTPDKFPELVDSLNCATPPLLKEMVSDS------KSPVN  113

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CII DG M  AID   E+ +  I FRT SA  FW+F C+P +I++G+LP+ G  DMD+L+
Sbjct  114   CIITDGYMSRAIDAAREVGVSIIYFRTISACAFWSFHCIPDIIDAGELPIKGTEDMDRLI  173

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
               V GME  LR RDLPSFCR  D  D   L     T  +  A+GLILNTFEDLE   L+Q
Sbjct  174   TTVPGMEGFLRCRDLPSFCRVNDPMDPHLLLFARETRLSAHADGLILNTFEDLEGPILSQ  233

Query  800   IRKH-IPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             IR H  PN+Y+IGPL+AHL+ R+          SSSSLW+ DRSCMAWLD+QP +SV+YV
Sbjct  234   IRNHSCPNIYSIGPLNAHLKVRIPEKT-----YSSSSLWKIDRSCMAWLDKQPKQSVIYV  288

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+ V++R+Q +EF++G+V+S K+FLW IRP+ + G D    IP EL+E T+++G + 
Sbjct  289   SFGSIAVMSRDQLIEFYYGLVHSKKSFLWVIRPDLISGKDGENQIPEELLEATKERGCIA  348

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GW PQEEVL H AVGGFLTH GWNSTLESI  G+PMICWP +ADQQ+NSR VG VWK G+
Sbjct  349   GWVPQEEVLAHSAVGGFLTHCGWNSTLESIVAGMPMICWPSFADQQINSRFVGEVWKLGL  408

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             D+KD CDR  VEK V +LM  R++EF + ++RMA LA+K+V + GSSY NLDRLV D+K 
Sbjct  409   DIKDLCDRNIVEKAVNDLMVERKEEFMESADRMANLAKKSVNKGGSSYCNLDRLVNDIKM  468

Query  1508  MKLQ  1519
             M  Q
Sbjct  469   MSSQ  472



>ref|XP_006435572.1| hypothetical protein CICLE_v10031404mg [Citrus clementina]
 ref|XP_006486449.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
 gb|ESR48812.1| hypothetical protein CICLE_v10031404mg [Citrus clementina]
Length=476

 Score =   529 bits (1362),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 259/484 (54%), Positives = 335/484 (69%), Gaps = 17/484 (4%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYT-DLHLR  259
             M+++   HV I P P  GHVN ML LAELL H + I +TFLN+E  + R++R++ D   R
Sbjct  1     MEKQDHVHVAILPLPAVGHVNSMLNLAELLGH-AGIKITFLNTEHYYDRVIRHSSDAFSR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             +   P F F+T++DGLP DHPRT D+  +L +S+N  T P  +EM+S        + PV 
Sbjct  60    YMQIPGFQFKTLTDGLPRDHPRTPDKFPELVDSLNCATPPLLKEMVSDS------KSPVN  113

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CII DG M  AID   E+ +  I FRT SA  FW+F C+P +I++G+LP+ G  DMD+L+
Sbjct  114   CIITDGYMSRAIDAAREVGVSIIYFRTISACAFWSFHCIPDIIDAGELPIKGTEDMDRLI  173

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
               V GME  LR RDLPSFCR  D  D   L     T  +  A+GLILNTFEDLE   L+Q
Sbjct  174   TTVPGMEGFLRCRDLPSFCRVNDPMDPHLLLFARETRLSAHADGLILNTFEDLEGPILSQ  233

Query  800   IRKH-IPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             IR H  PN+Y+IGPL+AHL+ R+          SSSSLW+ DRSCMAWLD+QP +SV+YV
Sbjct  234   IRNHSCPNIYSIGPLNAHLKVRIPEKT-----YSSSSLWKIDRSCMAWLDKQPKQSVIYV  288

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+ V++R+Q +EF++G+V+S K FLW IRP+ + G D    IP EL+E T+++G + 
Sbjct  289   SFGSIAVMSRDQLIEFYYGLVHSKKNFLWVIRPDLISGKDGENQIPEELLEATKERGCIA  348

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GW PQEEVL H AVGGFLTH GWNSTLESI  G+PMICWP +ADQQ+NSR VG VWK G+
Sbjct  349   GWVPQEEVLAHSAVGGFLTHCGWNSTLESIVAGMPMICWPSFADQQINSRFVGEVWKLGL  408

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             D+KD CDR  VEK V +LM  R++EF + ++RMA LA+K+V + GSSY NLDRLV D+K 
Sbjct  409   DIKDLCDRNIVEKTVNDLMVERKEEFMESADRMANLAKKSVNKGGSSYCNLDRLVNDIKM  468

Query  1508  MKLQ  1519
             M  Q
Sbjct  469   MSSQ  472



>ref|XP_010318076.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=471

 Score =   528 bits (1359),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 245/476 (51%), Positives = 337/476 (71%), Gaps = 14/476 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QG VNCML+LAELLC +  I +TF+N+E+ HQRL+ YTD+ +RF  YPNF 
Sbjct  5     HVLIFPLPLQGPVNCMLKLAELLCLDKEIQITFINTEYIHQRLMNYTDVEVRFGKYPNFK  64

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F T+ DGLP D+PR GD++  +   +  V+ P F+EM+    + ++  P  TC+I DGI 
Sbjct  65    FVTVPDGLPEDNPRIGDQIRLIIEGVEEVSSPLFKEMV----MTTNSAP--TCLIVDGIF  118

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              FA+ +  E +IP + F T S    W +  +PKLIE G++P  G +D+D L+  + GME 
Sbjct  119   TFALPIAKEAKIPLLYFDTISPCSLWTYLALPKLIEDGEIPFKG-NDLDVLVNGMPGMEG  177

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
             V+R RDLPSFCRT D+       VI       +A GLI NTFE LE   L+Q R   PN+
Sbjct  178   VMRRRDLPSFCRTPDVDIPIIKHVIKEGKHIVQAQGLIFNTFEALEGPILSQFRALCPNI  237

Query  824   YTIGPLHAHLRARVSSSRGELP-WRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             Y IGPLH  ++A++SS R  LP   +S+S+W+ED SC+ WLD+QP KSV++VS GS+  +
Sbjct  238   YAIGPLHTQMKAKLSSQR--LPNTPTSNSIWKEDVSCIDWLDKQPNKSVLFVSIGSLATM  295

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIG----DDNIPAELIEGTRKKGYMVGWAPQEE  1168
             ++ QF EFW+G+VNS   FLW  RP S+IG    ++N+P EL+E T+++G ++ WAPQEE
Sbjct  296   SKAQFFEFWYGLVNSDTRFLWVQRPGSIIGLEDDNNNVPMELVESTKERGCIISWAPQEE  355

Query  1169  VLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCD  1348
             VL  P++G FLTHSGWNSTLESI EG+PMICWP++ DQQVNSR VG VWK G+DMKD CD
Sbjct  356   VLARPSIGAFLTHSGWNSTLESIVEGVPMICWPYFVDQQVNSRYVGEVWKLGLDMKDVCD  415

Query  1349  RITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
             RIT+E+MV+E+M+V++ EF + +  M+ LA  +V + GSSY +LDRL+ED++ M++
Sbjct  416   RITIERMVREVMDVKKIEFLERAKYMSDLAIASVGEGGSSYQDLDRLIEDIRLMRI  471



>ref|XP_006367215.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=472

 Score =   527 bits (1358),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 247/476 (52%), Positives = 337/476 (71%), Gaps = 13/476 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV IFP P+QG VNCML+LAELLC    IH+TF+N+E+ HQRL+ YT++ +RF  YPNF 
Sbjct  5     HVFIFPLPLQGPVNCMLKLAELLCLHQEIHITFINTEYIHQRLMNYTNVLVRFEKYPNFK  64

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F T+ DGLP D+ R G++V  +   +  V+ P FREM+    + S+   P TC+I DGI 
Sbjct  65    FVTVPDGLPEDNLRNGEQVEKIIEGVEKVSSPLFREMV----MMSTTCAP-TCLIVDGIF  119

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              FA+D+  E +IP + F T S    W +  VPKLIE G++P  G +D+D L+  V GME 
Sbjct  120   TFAVDIAKEAKIPLLYFDTISPCSLWTYLAVPKLIEDGEIPFKG-NDLDVLVNGVAGMEG  178

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
             V+R RDLPSFCRT D+       VI       +A GLI NTFEDLE   L+Q R   PN+
Sbjct  179   VMRRRDLPSFCRTPDIDIPVIKLVIKQGKHIVQAQGLIFNTFEDLEGPILSQFRALCPNI  238

Query  824   YTIGPLHAHLRARVSSSRGELP-WRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
             Y IGPLH  ++A++SS    LP   +S+S+W+ED SC+ WLD+QP KSV++VS GS+  +
Sbjct  239   YAIGPLHTQMKAKLSSQY--LPNTPTSNSIWKEDMSCIDWLDKQPNKSVIFVSIGSLATM  296

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIG----DDNIPAELIEGTRKKGYMVGWAPQEE  1168
             ++ QFLEFW+G+VNS   FLW  RP S+IG    ++N+P EL++ T+++G ++ WAPQEE
Sbjct  297   SKAQFLEFWYGLVNSKTRFLWVQRPGSIIGLEDDNNNVPMELVKSTKERGCIISWAPQEE  356

Query  1169  VLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCD  1348
             VL HP++GGFLTHSGWNSTLESI EG+PMIC P++ DQQVNSR VG VWK G+DMKD CD
Sbjct  357   VLAHPSIGGFLTHSGWNSTLESIVEGVPMICVPYFVDQQVNSRYVGEVWKLGLDMKDVCD  416

Query  1349  RITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
             R T+E+MV+++M+V++ EF + +  M+ LA  +V + GSSY +LDRL+ED++ M++
Sbjct  417   RATIERMVRDVMDVKKIEFLERAKHMSDLAIASVGEGGSSYQDLDRLIEDIRLMRI  472



>ref|XP_009597175.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=489

 Score =   525 bits (1353),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 260/482 (54%), Positives = 346/482 (72%), Gaps = 16/482 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+IFPFPVQGHVN ML+LAELLC  S IHVTF+N+     RL R TD+  RF+ +P F 
Sbjct  9     HVVIFPFPVQGHVNPMLKLAELLCL-SGIHVTFINTLSIQNRLSRNTDIQSRFNRFPGFR  67

Query  284   FRTISDGLPADHPRT---GDRVVDLFNSINAVTKPRFREML-----SSGSLQSSGRPPVT  439
             F TI DGL    P+T     +V+ +F+S+ +  KP  +E++      SGS + + + PVT
Sbjct  68    FETIPDGLSNKVPQTYQETHKVMVIFDSLRSTAKPILKEIILAAGCPSGSSEVTRQGPVT  127

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             C+IADGI+  A++V  ++ IP + FRT SA+ FW + C+P+LI++G+LP  G +++D  +
Sbjct  128   CVIADGILSVALEVAEDVGIPILYFRTASAASFWIYLCLPQLIQNGELPFPG-NELDVPI  186

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILA-TLRTTRANGLILNTFEDLEESALA  796
              +++GME++LR RDLPSFCR  D  D   L ++L  T +T R  GLILNTFE++E   L 
Sbjct  187   ASIKGMESLLRRRDLPSFCRV-DSVDVPILQMVLTETQKTLRTKGLILNTFEEVEGPILD  245

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             QIR H+P LY+IGPLHAHL+ +++S        S+S +WEED+SC+ WLD+QP  SV+YV
Sbjct  246   QIRNHLPKLYSIGPLHAHLKNKIASESISQSIHSNS-IWEEDKSCLKWLDDQPANSVIYV  304

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+  +T+N   EFWHG+VNSG+ FLW IR +S+  +D    I  EL EG  + GY+V
Sbjct  305   SFGSLVTVTKNVLTEFWHGLVNSGQRFLWVIRHDSITDNDKEAQIEEELKEGVIENGYIV  364

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
              WAPQEEVL H A+GGFLTHSGWNSTLESI EG+PMICWP  ADQQ+NSR V  VWK G+
Sbjct  365   SWAPQEEVLAHTAIGGFLTHSGWNSTLESIIEGVPMICWPQLADQQINSRYVEEVWKLGL  424

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKDTCDR+ +EKMV++LME+RR EF + +N MAKLAR +V + GSS SNL RLV+D+  
Sbjct  425   DMKDTCDRVIIEKMVRDLMELRRSEFLQRANDMAKLARASVAEAGSSDSNLARLVQDIVS  484

Query  1508  MK  1513
             M+
Sbjct  485   MQ  486



>ref|XP_007158356.1| hypothetical protein PHAVU_002G145900g [Phaseolus vulgaris]
 gb|ESW30350.1| hypothetical protein PHAVU_002G145900g [Phaseolus vulgaris]
Length=484

 Score =   524 bits (1350),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 255/479 (53%), Positives = 340/479 (71%), Gaps = 13/479 (3%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             ++   +HV++ P P+QG+VN M++LA+LL      HVTFL ++F H+RL R+ D+     
Sbjct  6     EEAGVNHVVLLPGPLQGNVNSMMKLAQLLALHH-FHVTFLTTDFIHRRLHRFADIQALSQ  64

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             +YPN   +TISDGLP DHPR+ + + DL++ +N+  KP  R++L S   Q++ +P VTC+
Sbjct  65    TYPNLELKTISDGLPDDHPRSDNALADLYSFLNSHAKPLIRDILVS---QTAAKPKVTCL  121

Query  446   IADGIMC-FAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             I DG +     DV +E+ IP I FR  SASCFWA FC P L ES  LP+ GE DMD+++ 
Sbjct  122   IGDGFLGGLTADVADEVGIPLIHFRAISASCFWALFCAPNLFESNQLPIRGEEDMDRVIT  181

Query  623   NVEGMENVLRLRDLPSFCRTTDLS-DRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              + GMEN+LR RDLPSF R T+ +      S +    +T RA G+ILNTFEDL+   L+Q
Sbjct  182   TLPGMENILRCRDLPSFYRGTESNLVEPLKSTVFDCHQTLRARGVILNTFEDLDGPLLSQ  241

Query  800   IRKHIPNLYTIGPLHAHLRA-RVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             +R   P ++ +GPLHAHL + RV  ++   P  S SS WE DRSC+ WLD QPLKSV+YV
Sbjct  242   MRLKFPRVFAVGPLHAHLNSERVFDAK---PTPSMSSFWEVDRSCLTWLDSQPLKSVLYV  298

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMV  1147
             SFGS+T +TR + +EFW+G+VNS K FLW IRP+ V G+DN   +PAEL EGT+++G++V
Sbjct  299   SFGSITTITRERLMEFWYGLVNSKKRFLWVIRPDMVAGEDNNDRVPAELEEGTKERGFIV  358

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GWAPQEEVL H A+GGFLTHSGWNSTLES+  G+PMICWP++ADQQ+NSR V  VWK G+
Sbjct  359   GWAPQEEVLEHKAIGGFLTHSGWNSTLESVVAGVPMICWPYFADQQINSRFVSEVWKVGL  418

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             DMKD CDR  VEKMV +LM  RR+EF   +  MAKLA K+V+  GSSYS+L  L++ +K
Sbjct  419   DMKDVCDRDVVEKMVNDLMVHRREEFLNSAKAMAKLAHKSVSPGGSSYSSLLDLIQYIK  477



>ref|XP_006355679.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=482

 Score =   522 bits (1345),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 256/485 (53%), Positives = 340/485 (70%), Gaps = 16/485 (3%)
 Frame = +2

Query  83    MDQRSS--SHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             MD++ S   HVLIFP P+QG VN M +LAELLC  S +H+T L +E  H RL+ +TD+  
Sbjct  1     MDEQESLPPHVLIFPLPLQGPVNSMFKLAELLCF-SGLHITILLTENIHNRLVLHTDITS  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSG----SLQSSG  424
             RF   P F  +TISDGLP DHPR G + +++F S+   TK  F++ML+S      L    
Sbjct  60    RFDQCPGFQIKTISDGLPDDHPRDGGKFMEVFESLRTKTKTLFKDMLTSDLLCFDLDGKE  119

Query  425   RPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD  604
             R  V+CIIADGI+ F  DV +E+ +P    RT S  C W FFC+PKLIESG+ P   + +
Sbjct  120   RRRVSCIIADGILGFTCDVADEISVPIFCVRTISPCCLWIFFCLPKLIESGEYPFK-DDN  178

Query  605   MDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEE  784
             +D+ L++V G E  LR RDLPSFCR+ DL+D     +       +RA+GLILNTFE+L+E
Sbjct  179   LDEPLKSVPGTETFLRRRDLPSFCRSGDLTDSYIQLLKTEGQENSRAHGLILNTFEELDE  238

Query  785   SALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKS  964
               L Q+R   PNLY IGPLHAHL+ + ++ +      SS+SLW EDR+C+ WL++Q   S
Sbjct  239   PILNQLRTICPNLYPIGPLHAHLKKKQTTLQP-----SSNSLWAEDRTCIDWLNDQLPNS  293

Query  965   VVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKK  1135
             V+YVSFGS+  +T +Q +EFW+G+VNSG+ FLW IRP+S+ G++    IP +L  GT+++
Sbjct  294   VIYVSFGSIATMTNDQLIEFWYGLVNSGQKFLWVIRPDSIAGEEWRSKIPVDLATGTKER  353

Query  1136  GYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVW  1315
             GY+V WAPQEEVL HPAVGGF TH GWNS LES+ EG PMICWP++ DQQVNSR V  VW
Sbjct  354   GYIVEWAPQEEVLAHPAVGGFWTHCGWNSILESVYEGKPMICWPYFYDQQVNSRFVEKVW  413

Query  1316  KNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
               G+DMKDTCDR  VEKMVK+LM +R++EF + +N M+KLA+  + + GSSYSN DRLV+
Sbjct  414   GIGLDMKDTCDREIVEKMVKDLMVLRKEEFLERANHMSKLAKNCLMEGGSSYSNFDRLVK  473

Query  1496  DLKKM  1510
             D+K +
Sbjct  474   DIKSL  478



>ref|XP_006355680.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=482

 Score =   521 bits (1343),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 256/485 (53%), Positives = 339/485 (70%), Gaps = 16/485 (3%)
 Frame = +2

Query  83    MDQRSS--SHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             MD++ S   HVLIFP P+QG VN M +LAELLC  S +H+T L +E  H RL+ +TD+  
Sbjct  1     MDEQESLPPHVLIFPLPLQGPVNSMFKLAELLCF-SGLHITILLTENIHNRLVLHTDITS  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSG----SLQSSG  424
             RF   P F  +TISDGLP DHPR G + +++F+S+   TK  F++ML+S      L    
Sbjct  60    RFDQCPGFQIKTISDGLPDDHPRDGGKFIEVFDSLRTKTKTLFKDMLTSDMLCFDLDGKE  119

Query  425   RPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD  604
             R  V+CIIADG+  F  DV +E+ +P    RT S  C W FFC+PKLIESG+ P   + +
Sbjct  120   RRRVSCIIADGVWGFTCDVADEISVPIFCVRTISPCCLWIFFCLPKLIESGEYPFE-DDN  178

Query  605   MDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEE  784
             +D+ L++V G E  LR RDLPSFCR+ DL+D     +       +RA+GLILNTFE+L+E
Sbjct  179   LDEPLKSVPGTETFLRRRDLPSFCRSGDLTDSYIQLLKTEGQENSRAHGLILNTFEELDE  238

Query  785   SALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKS  964
               L Q+R   PNLY IGPLHAHL+ + ++ R      SS+SLW EDR+C+ WL++Q   S
Sbjct  239   PILNQLRTICPNLYPIGPLHAHLKKKQTTLRP-----SSNSLWAEDRTCIDWLNDQLPNS  293

Query  965   VVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKK  1135
             V+YVSFGS+  +T +Q +EFW+G+VNSG+ FLW IRP+S+ G++    IP +L  GT+++
Sbjct  294   VIYVSFGSIATMTNDQLIEFWYGLVNSGQKFLWVIRPDSIAGEEWRSKIPVDLATGTKER  353

Query  1136  GYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVW  1315
             GY+V WAPQEEVL HPAVGGF TH GWNS LES+ EG PMICWP++ DQQVNSR V  VW
Sbjct  354   GYIVEWAPQEEVLAHPAVGGFWTHCGWNSILESVYEGKPMICWPYFFDQQVNSRFVEKVW  413

Query  1316  KNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
               G+DMKDTCDR  VEKMVK+LM +R++EF   +N M+KLA+  + + GSSYSN DRLV+
Sbjct  414   GIGLDMKDTCDREIVEKMVKDLMVLRKEEFLGRANHMSKLAKNCLMEGGSSYSNFDRLVK  473

Query  1496  DLKKM  1510
             D+K +
Sbjct  474   DIKSL  478



>ref|XP_008464643.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
 ref|XP_008464644.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
Length=509

 Score =   518 bits (1335),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 254/473 (54%), Positives = 327/473 (69%), Gaps = 6/473 (1%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             ++ +  HVLIFPFP QGHVN ML+LAELL   S + +TFLN    H +L  +T+   RFS
Sbjct  32    NEETEPHVLIFPFPAQGHVNSMLKLAELLSL-SGLRITFLNIHRIHHKLTLHTNFQSRFS  90

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
              +PNF F+TI+DGLP ++   G+   DL NS+ ++TKP  ++ML SG L     P  TCI
Sbjct  91    RFPNFQFQTITDGLPLENRPIGN-FSDLINSLKSITKPLLKQMLLSGELG----PTPTCI  145

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
             I DG+  F  DV     IP   FRT SA  F A+  VPKLIE G LP+ GE DMD+++  
Sbjct  146   ILDGLFNFIFDVDAHPNIPVFSFRTISACSFSAYSFVPKLIEDGQLPIEGEEDMDRIING  205

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             V GMENVLR RDLPSFCR  D  D      +  T+++ +++ LI NTFEDLE   L+ +R
Sbjct  206   VVGMENVLRCRDLPSFCRLEDPFDPRLQYGVTQTIQSFKSHALIFNTFEDLEGPILSCLR  265

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
                 N+Y IGPLHAHL+ ++SS        S++ LWE DRSC+AWLD QP KSV+YVSFG
Sbjct  266   SRCSNIYAIGPLHAHLKTKLSSEISPTASESNNGLWEVDRSCLAWLDAQPPKSVIYVSFG  325

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQE  1165
             S+ V+  +Q  EFWHG+VNSGK FLW +RPNSV G D +PAEL E T+++GY+VGWAPQE
Sbjct  326   SVVVIDDDQLREFWHGLVNSGKRFLWVLRPNSVAGKDGVPAELEEETKERGYIVGWAPQE  385

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             EVL H A+G FLTHSGWNSTLESI  G+PMICWP +ADQQ NSR V  +WK G+DMKD C
Sbjct  386   EVLAHKAIGAFLTHSGWNSTLESIVAGVPMICWPQFADQQTNSRYVSEIWKIGLDMKDVC  445

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +R TV KMV ++ME R++E       +AKLA  +V + GSSY +L+R+++D++
Sbjct  446   NRETVAKMVNDVMENRKNELMGSVIEIAKLAITSVEEGGSSYCDLERMIKDIR  498



>ref|XP_004239922.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=487

 Score =   518 bits (1333),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 255/486 (52%), Positives = 339/486 (70%), Gaps = 18/486 (4%)
 Frame = +2

Query  83    MDQRSS--SHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             MD++ S   HVLIFP P+QG VN M +LAELLC  S +H+T L +E  H RL+ +TD+  
Sbjct  1     MDEQESLPPHVLIFPLPLQGPVNSMFKLAELLCF-SGLHITILLTENIHNRLVLHTDISS  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSL----QSSG  424
             RF   P F  +TISDGLP DHPR G + +++F+S+   TK  F++ML+S SL        
Sbjct  60    RFDQCPGFQIKTISDGLPDDHPRDGGKFLEVFDSLRTKTKTLFKDMLTSDSLCVDVDGKV  119

Query  425   RPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD  604
             R  V+CIIADG++ F  DV +E+ +P    RT S+ C W FFC+P+LIESG+ P   + +
Sbjct  120   RGRVSCIIADGVLGFTCDVADEVNVPIFCVRTISSCCLWIFFCLPELIESGEYPFK-DDN  178

Query  605   MDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEE  784
             +D+ +++V G E  LR RDLP FCR+ DL+D             +RA GLILNTFE+L++
Sbjct  179   LDEPIKSVPGTETFLRRRDLPEFCRSGDLTDPNIQLFKTEGRENSRAYGLILNTFEELDQ  238

Query  785   SALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKS  964
               L Q+R   PNLY IGPLHAHL+ + ++ R      SS+SLW EDR+C+ WLD+Q   S
Sbjct  239   PILNQMRTICPNLYPIGPLHAHLKKKQTTLRS-----SSNSLWAEDRTCIDWLDDQLPNS  293

Query  965   VVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD----NIPAELIEGTRK  1132
             V+YVSFGS+  +T +Q +EFW+G+VNS + FLW IRPNS IGD+     +P +L++GT++
Sbjct  294   VIYVSFGSIATMTNDQLIEFWYGLVNSKQNFLWVIRPNS-IGDEEWRSKMPVDLVKGTKE  352

Query  1133  KGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAV  1312
             +GY+V WAPQEEVL HPAVGGF TH GWNS LES+ EG PMICWP++ DQQVNSR V  V
Sbjct  353   RGYIVEWAPQEEVLAHPAVGGFWTHCGWNSILESVYEGKPMICWPYFFDQQVNSRFVEKV  412

Query  1313  WKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLV  1492
             W  G+DMKDTCDR  VEKMVK+LM +R+ EF   +N M+KLA+  + + GSSYSN DRLV
Sbjct  413   WGLGLDMKDTCDREIVEKMVKDLMVLRKQEFLGRANHMSKLAKNCLMEGGSSYSNFDRLV  472

Query  1493  EDLKKM  1510
             +D+K +
Sbjct  473   KDIKSL  478



>ref|XP_008464907.1| PREDICTED: UDP-glycosyltransferase 85A3-like isoform X2 [Cucumis 
melo]
Length=483

 Score =   517 bits (1331),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 256/480 (53%), Positives = 338/480 (70%), Gaps = 16/480 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q +S HVL+FP P QGH+N ML+LAELL   SS+ VTFL +E ++++L  ++D+  RFS 
Sbjct  5     QITSPHVLLFPAPAQGHINVMLKLAELLSL-SSVRVTFLTTEHSYRQLTLHSDVLHRFSL  63

Query  269   YPNFYFRTISDGLPADHPRTGD-RVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             +P+F FRTISDGLP  HPRT    + ++ +S  +VTKP FR+ML S    S     ++C+
Sbjct  64    FPSFQFRTISDGLPVSHPRTFSCHLPEMLHSFVSVTKPLFRDMLVSHHFSSD----LSCL  119

Query  446   IADGIMCFAIDVGNE-LRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             I DG   + +D+ ++ +++P   FRTF A   W    +P LI+ G LP+ GE DMD++L+
Sbjct  120   ILDGFFSYLLDIDDDFVKVPIFCFRTFGACSTWTILSIPNLIKQGQLPIKGEEDMDRILD  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVIL-ATLRTTRANGLILNTFEDLEESALAQ  799
             NV GMEN+LR RDLP FCR TD ++   L  I+ A +R+T+ N LI+NTFEDLE   L+ 
Sbjct  180   NVPGMENLLRCRDLPGFCRPTDPNNDPILQFIVSAFIRSTKFNALIMNTFEDLEGPILSN  239

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR   PNLY+IGPLHA L+ +VS     L     ++LWE DRSC+ WLD QP  SV+YVS
Sbjct  240   IRTLCPNLYSIGPLHALLKTKVSHETESL-----NNLWEVDRSCLTWLDNQPAGSVIYVS  294

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVG  1150
             FGS+TV+   + +EFWHG+VNSG+ FLW IRP+ V G +    IPAEL EGT+++GYMVG
Sbjct  295   FGSITVMGNRELMEFWHGLVNSGRNFLWVIRPDLVKGKNGEIEIPAELEEGTKQRGYMVG  354

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQE+VL H AVGGFLTHSGWNSTLESI  G PMICWPF  DQQVNSR V  +W  G+D
Sbjct  355   WTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPFGFDQQVNSRFVSNMWNLGLD  414

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKD CDR TV KMV ++M  R++EF + +  +A LAR++V   GSSY+N DRL+ED++ +
Sbjct  415   MKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARRSVKPGGSSYANFDRLIEDIRNL  474



>ref|XP_008464906.1| PREDICTED: UDP-glycosyltransferase 85A3-like isoform X1 [Cucumis 
melo]
Length=483

 Score =   516 bits (1330),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 256/480 (53%), Positives = 339/480 (71%), Gaps = 16/480 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q +S HVL F  P QG++N ML+LA+LL   SS+ VTFL +E ++++L  ++D+  RFS 
Sbjct  5     QTTSPHVLFFSAPAQGNINVMLKLAQLLSL-SSVRVTFLTTEHSYRQLTLHSDVLRRFSL  63

Query  269   YPNFYFRTISDGLPADHPRT-GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             +P+F FRTISDGLP  HPRT    + ++F+S  +VTKP FR+ML S    S     ++C+
Sbjct  64    FPSFQFRTISDGLPLSHPRTFSHHLPEMFHSFVSVTKPLFRDMLVSPHFSSD----LSCL  119

Query  446   IADGIMCFAIDVGNE-LRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             I DG   + +D+ ++ +++P   FRTFSA   W  F +P LI+ G LP+ GE DMD++L+
Sbjct  120   ILDGFFSYLLDIDDDFVKVPIFCFRTFSACSTWTIFSIPNLIKQGQLPIKGEEDMDRILD  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVIL-ATLRTTRANGLILNTFEDLEESALAQ  799
             NV GMEN+LR RDLP FCR TD ++   L  I+ A +R+T+ N LI+NTFEDLE   L+ 
Sbjct  180   NVPGMENLLRCRDLPGFCRPTDPNNDPILQFIVSAFIRSTKFNALIMNTFEDLEGPILSN  239

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR   PNLY+IGPLHA L+ +VS     L     ++LWE DRSC+ WLD QP  SV+YVS
Sbjct  240   IRTLCPNLYSIGPLHALLKTKVSHETESL-----NNLWEVDRSCLTWLDNQPAGSVIYVS  294

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVG  1150
             FGS+TV+   + +EFWHG+VNSG+ FLW IRP+ V G +    IPAEL EGT+++GYMVG
Sbjct  295   FGSITVMGNRELMEFWHGLVNSGRNFLWVIRPDLVKGKNGEIEIPAELEEGTKQRGYMVG  354

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQE+VL H AVGGFLTHSGWNSTLESI  G PMICWPF  DQQVNSR V  +W  G+D
Sbjct  355   WTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPFGFDQQVNSRFVSNMWNLGLD  414

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKD CDR TV KMV ++M  R++EF + +  +A LAR++V   GSSY+N DRL+ED++ +
Sbjct  415   MKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARRSVKPGGSSYANFDRLIEDIRNL  474



>ref|XP_010674287.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=492

 Score =   515 bits (1327),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 252/489 (52%), Positives = 338/489 (69%), Gaps = 19/489 (4%)
 Frame = +2

Query  83    MDQRSSS---HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLH  253
             +D + SS   HVLIFP P  GH+  ML+LAELLC  ++  VTFLN+   HQRL ++TD+ 
Sbjct  4     LDHKQSSVTPHVLIFPLPALGHLTPMLQLAELLCI-ANFKVTFLNTTHNHQRLTQHTDIE  62

Query  254   LRFSSYPNFYFRTISDGLPADHPRTGDR-----VVDLFNSINAVTKPRFREMLSSGSLQS  418
              RF  Y  F F+T+ DGL  D+PRTG       ++    S++   +P  RE+L    L S
Sbjct  63    ARFEQYSGFEFKTMPDGLSEDNPRTGQGDVKGLMISAIESLSTSAEPLLREIL----LGS  118

Query  419   SGRPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGE  598
             S    +TC+I DG M FA DV NE  +P I+FR  SASC W+++C+PKLIE+GDLP+  E
Sbjct  119   SETAKITCLIVDGWMSFASDVANEAEVPVIIFRCSSASCNWSYYCIPKLIEAGDLPIKDE  178

Query  599   SDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVIL--ATLRTTRANGLILNTFE  772
               MD+L++N  GM + LR RDLP+FCR  + S    L         +  +A+  ILNTFE
Sbjct  179   K-MDELVDNAPGMSSFLRYRDLPTFCRNQNTSSCQDLQDWFNGEIQQNKQAHSFILNTFE  237

Query  773   DLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQ  952
             DLE   L+ IR     +Y+IGP+HAHL+ ++   +  L    SS+LWE DRSC++WLD +
Sbjct  238   DLEGHTLSLIRSQCSRVYSIGPIHAHLKYKLGQQKTTLSNNFSSNLWEVDRSCISWLDRK  297

Query  953   PLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEG  1123
             P KSVVYVSFGS+TVLT++Q  EFW G+V S K FLW IRPN +IG   D+  P +L+EG
Sbjct  298   PNKSVVYVSFGSLTVLTKDQLREFWAGLVQSNKYFLWVIRPNLIIGSELDNQTPDDLLEG  357

Query  1124  TRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLV  1303
             T+K+G +V WAPQ+EVL H A+GGFLTHSGWNSTLESI  G+PM+CWP+++DQQVNSR V
Sbjct  358   TKKRGCLVKWAPQKEVLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWPYFSDQQVNSRFV  417

Query  1304  GAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLD  1483
               VW+ G+DMKDTCDR  VEKM+ +LM+  +DE  +  +RM+ LA+K++++ GSSYSNL+
Sbjct  418   SEVWRIGLDMKDTCDRTIVEKMINDLMDGNKDELQRSMDRMSYLAKKSISEGGSSYSNLN  477

Query  1484  RLVEDLKKM  1510
             +L+ED+K M
Sbjct  478   QLIEDIKAM  486



>ref|XP_004235055.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=468

 Score =   513 bits (1322),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 256/474 (54%), Positives = 332/474 (70%), Gaps = 19/474 (4%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             S HV+IFPFP QGHVN ML+LA+LL   S+  VTFL +   H RLL +TD+  RF S   
Sbjct  4     SPHVIIFPFPAQGHVNSMLKLAQLLSL-SNFQVTFLVTVDTHDRLLNHTDVLSRFGS--E  60

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADG  457
             F+ + +  G+  D   T D +  L++S+N + KP  RE ++         P  TC+IADG
Sbjct  61    FHLQPLPHGISMDVMNTRDGLSILYDSLNKIAKPFLREFIAYS-------PVTTCLIADG  113

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGM  637
             I+  A DV  E+ +P I FRT SAS FW++FC+P LI+ G+LPL  E+  D  L  V+GM
Sbjct  114   ILSMAGDVAEEINLPIIYFRTASASSFWSYFCMPDLIQVGELPLK-ENAKDLTLTKVKGM  172

Query  638   ENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIP  817
             E+ LR RDLPSFC+ +D++   F  V+  T +T RA GLILNTFEDLE   L+QIR   P
Sbjct  173   EDFLRGRDLPSFCQASDVTSPDFRIVMTETRQTPRARGLILNTFEDLEGPILSQIRTVCP  232

Query  818   NLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTV  997
             N+YTIGP+HAHL+A++ +        SS+SLW+ED SCM+WLD QP KSV+YVSFGS+  
Sbjct  233   NVYTIGPVHAHLKAKLVTKS-----TSSNSLWQEDESCMSWLDTQPPKSVIYVSFGSVAG  287

Query  998   LTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD---DNIPAELIEGTRKKGYMVGWAPQEE  1168
             LT+ + LEFW+GIVNS + FLW +RP+ +IG    D IP EL +GT+ +GYM  W PQE+
Sbjct  288   LTKEELLEFWYGIVNSEQKFLWVMRPDLIIGQERKDEIPVELEQGTKARGYMADWVPQEK  347

Query  1169  VLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCD  1348
             VL H A+GGFLTHSGWNSTLESI EG+PMICWP +ADQQVNSR VG VWK G+D+KDTCD
Sbjct  348   VLAHRAIGGFLTHSGWNSTLESIVEGVPMICWPRFADQQVNSRFVGEVWKMGLDIKDTCD  407

Query  1349  RITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             R  + K + +LME R  EF++ +  MA LA+KAV + GSSY NLDRL++D++ M
Sbjct  408   RDIIAKSITDLMEKRNGEFSQRTENMASLAKKAVNEGGSSYINLDRLMQDIRSM  461



>ref|XP_010032067.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51452.1| hypothetical protein EUGRSUZ_J00976 [Eucalyptus grandis]
Length=513

 Score =   515 bits (1326),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 269/501 (54%), Positives = 346/501 (69%), Gaps = 12/501 (2%)
 Frame = +2

Query  23    ARHHLITLNSADNYSLITPTMDQRSSS--HVLIFPFPVQGHVNCMLRLAELLCHESSIHV  196
             A H    +    N  +    MD       HV+IFP   QGHVN ML+L ELL   S + +
Sbjct  18    ANHSTSKVEHESNQRIQKTAMDPPPVPPPHVIIFPLAAQGHVNSMLKLTELLA-ISGLRI  76

Query  197   TFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTK  376
             TF+NSE  H RLLR+  +   F+++P+F F+ ISDG P DHPR  D  +  FN + ++TK
Sbjct  77    TFINSEHIHHRLLRHAHIQAHFAAFPDFRFKIISDGFPIDHPRPPDHFMTTFNYVKSITK  136

Query  377   PRFREMLSSGSLQSSGRPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCV  556
               F E++S+         PVTCIIADGI+ F ID   +L +P I FRT SAS FWA FC+
Sbjct  137   QLFEELVSAPDR------PVTCIIADGILTFTIDFAGDLGVPVIAFRTISASSFWACFCI  190

Query  557   PKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRT  736
             P++IESGDLPL G+ DMD+ + +V GME++LR RDLPSFCR  DLSD+    V   TL+T
Sbjct  191   PRMIESGDLPLKGDEDMDRDVTSVPGMEDILRCRDLPSFCRVADLSDQFLQYVTTQTLQT  250

Query  737   TRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWE  916
             T A  LILNTF+ LE  A++QIR   PNLYTIGPLH+HLR+R+SSS       +S+SLW+
Sbjct  251   TAARALILNTFDQLEGPAISQIRTQFPNLYTIGPLHSHLRSRLSSSSPSPS-SASNSLWK  309

Query  917   EDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD  1096
              DRSC+AWLD+QP KSV+YVSFGS+  L R+ F EFW+G+VNSG+ FLW +RP+S+    
Sbjct  310   VDRSCIAWLDKQPPKSVIYVSFGSIATLNRHDFTEFWYGLVNSGRRFLWVVRPDSLAEGS  369

Query  1097  N--IPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPF  1270
             +  +P EL E   ++G +VGWAPQEEVL H AV  FLTHSGWNSTLES+  G PM+CWPF
Sbjct  370   SGAVPEELREAAAERGCIVGWAPQEEVLHHGAVAAFLTHSGWNSTLESVVAGKPMVCWPF  429

Query  1271  YADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAV  1450
             +ADQQVNSRLV   WK G+DMKD CDR  VE+MV E+M  R++EF   +  +A+ AR A 
Sbjct  430   FADQQVNSRLVSHAWKVGLDMKDVCDREVVERMVNEVMGERQEEFAAAAGDLARRARNAA  489

Query  1451  TQHGSSYSNLDRLVEDLKKMK  1513
             ++ GSS+ NLDRL+ED++ MK
Sbjct  490   SEGGSSWDNLDRLIEDIRSMK  510



>emb|CAN77812.1| hypothetical protein VITISV_010344 [Vitis vinifera]
Length=642

 Score =   517 bits (1332),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 260/459 (57%), Positives = 328/459 (71%), Gaps = 24/459 (5%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             M+ RS S HVLIFP PVQGHVN ML+LAELL   + + +TFLNS++ H RLLRYT++  R
Sbjct  1     MEHRSVSPHVLIFPLPVQGHVNPMLKLAELLS-LAGLRITFLNSDYNHHRLLRYTNILDR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             ++ YP F F+TIS+GLP D P TG  + D+ + I A TKP FREM+ S    S    PVT
Sbjct  60    YTRYPGFRFQTISNGLPLDRPWTGAGLRDMMDGIKATTKPLFREMVISWCQSSD---PVT  116

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADG+M FAIDV NE+ +P I  RT S  CF A+F   +LIE+G++P   + DMD+L+
Sbjct  117   CIIADGLMSFAIDVANEVGVPIISCRTVSPCCFLAYFSFAELIEAGEVPFK-DDDMDRLV  175

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
               V GME  LR RDLPSF RT D +DRG   +I  T +T RA+ LILNTFEDL+   L+Q
Sbjct  176   TRVPGMEGFLRRRDLPSFXRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQ  235

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P +YTIGPLHAHL++R++S      +  S+S WEEDRSC+AWLD QP KS +YVS
Sbjct  236   IRNHCPKIYTIGPLHAHLKSRLASETTTSQF--SNSFWEEDRSCLAWLDRQPSKSXIYVS  293

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAP  1159
             FGS+TV+T+ Q +EFWH                   G+  + A+L E T+++G +V WAP
Sbjct  294   FGSITVITKEQMMEFWH----------------EKDGEFQLQAQLREVTKERGQIVDWAP  337

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             QEEVL HPAVGGFLTH GWNSTLESI  G+PMICWP+++DQQ+NSR V  VWK G+DMKD
Sbjct  338   QEEVLAHPAVGGFLTHGGWNSTLESIVAGVPMICWPYFSDQQLNSRFVSHVWKXGMDMKD  397

Query  1340  TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQ  1456
             TCDRITVEKMV+++ME RR EFTK  + MAKLAR ++++
Sbjct  398   TCDRITVEKMVRDVMEERRAEFTKSVDAMAKLARSSLSE  436



>ref|XP_004162780.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   509 bits (1312),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 251/483 (52%), Positives = 338/483 (70%), Gaps = 16/483 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q +S HVL+FP P QGH+N ML+ AELL   SSI VTFL +E ++++L  ++D+  RFS 
Sbjct  5     QTTSPHVLLFPVPAQGHINVMLKFAELLSL-SSIRVTFLTTEHSYRQLTLHSDVLPRFSL  63

Query  269   YPNFYFRTISDGLPADHPRT-GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             +P+F FRTISDGLP  HPR     + ++ +S  +VTKP FR+ML S    S     +TC+
Sbjct  64    FPSFQFRTISDGLPLSHPRIFAHHLTEMLHSFVSVTKPLFRDMLLSPHFSSD----LTCL  119

Query  446   IADGIMCFAIDVGNE-LRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             I DG   + +D+ ++ +++PT  FRT  A   W    +P LI+ G LP+ GE DMD++L+
Sbjct  120   ILDGFFSYLLDIDDDFVKVPTFCFRTSGACSTWTILSIPNLIKQGQLPIKGEDDMDRILD  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILAT-LRTTRANGLILNTFEDLEESALAQ  799
             NV GMEN+LR RDLP FCR TD ++   L  I++T +R+T+ + LI+NTFEDLE   L+ 
Sbjct  180   NVPGMENLLRCRDLPGFCRATDPNNDPILQFIMSTFIRSTKFSALIMNTFEDLEGPILSN  239

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR   PNLY+IGPLHA L+ +++     L     ++LWE DRSC+ WLD Q   SV+YVS
Sbjct  240   IRTLCPNLYSIGPLHALLKTKLTHETESL-----NNLWEVDRSCLTWLDNQAAGSVIYVS  294

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVG  1150
             FGS+TV+   + +EFWHG+VNSG++FLW IRP+ + G++    IPAEL EGT+++GYMVG
Sbjct  295   FGSITVMGNRELMEFWHGLVNSGRSFLWVIRPDLLKGENGEIEIPAELEEGTKQRGYMVG  354

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQE+VL H AVGGFLTHSGWNSTLES+  G PMICWP+  DQ VNSR V  VW  G+D
Sbjct  355   WTPQEKVLCHEAVGGFLTHSGWNSTLESMVAGKPMICWPYGFDQLVNSRFVSNVWNLGLD  414

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKD CDR TV KMV ++M  R++EF + +  +A LAR++V   GSSY+N DRL+ED+K +
Sbjct  415   MKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARQSVNPGGSSYANFDRLIEDIKIL  474

Query  1511  KLQ  1519
               Q
Sbjct  475   SRQ  477



>dbj|BAP90373.1| UDP-glycose: glycosyltransferase UGT709H1 [Fagopyrum esculentum]
Length=482

 Score =   509 bits (1311),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 247/484 (51%), Positives = 332/484 (69%), Gaps = 13/484 (3%)
 Frame = +2

Query  83    MDQRSSS----HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDL  250
             MD ++SS    HVLIFP P+ GH+N ML+LA+LLC  + ++VTFLN+ + H+RLL+YTD+
Sbjct  1     MDSQTSSSASPHVLIFPVPMLGHINPMLKLAQLLCL-AKLNVTFLNTAYNHRRLLQYTDV  59

Query  251   HLRFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRP  430
               R + +P F F  I DGLP DHPR+G+R  +++ S+     P  +E+L    L+     
Sbjct  60    EARLARFPGFRFEIIPDGLPDDHPRSGERANEVYRSLELTATPILKEILIR--LRDDLNS  117

Query  431   PVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMD  610
             PVTC IADG+  +A DVG E+ IP I FRT S+ CFW +F +P LI++  +P   + D+D
Sbjct  118   PVTCFIADGMFGYAYDVGEEVGIPVIAFRTISSCCFWIYFNMPNLIDAEQIPFQ-DDDLD  176

Query  611   KLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESA  790
             +L+ N+ GME  LR RDLPSFCR  D++D  F  V  AT RT RAN LILNTFE+LE   
Sbjct  177   ELVNNIPGMEAFLRYRDLPSFCRVKDVNDSHFRRVTNATRRTQRANSLILNTFEELEGPI  236

Query  791   LAQIRKHIP-NLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
             +  IR H   N+Y+IGPLH  L  R+  +  +     ++SLWE DRSC+ WLD++P KSV
Sbjct  237   VNLIRAHCSSNIYSIGPLHTQLNYRLGRTESD-KITLNNSLWEVDRSCIKWLDDKPKKSV  295

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPA---ELIEGTRKKG  1138
             VYVSFGS+T +++ Q +E W G+V S K FLW +RPNS+ GD+   A   E++EGT K+G
Sbjct  296   VYVSFGSITTISKEQLMEIWAGLVQSNKFFLWVMRPNSITGDNPTQAVDPEILEGTEKRG  355

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
             YMVGW PQEEVL H A+GGFLTHSGWNSTLESI  G+PM+CWP++ADQQVNSR V  VWK
Sbjct  356   YMVGWTPQEEVLAHQAIGGFLTHSGWNSTLESIEAGVPMVCWPYFADQQVNSRYVSHVWK  415

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G+DMKD C R  VE MV ++ME  +D         ++  +++V + G+S  NLDRL++D
Sbjct  416   IGLDMKDKCHRDIVENMVNDMMENMKDGLLSSVTEFSQAVKRSVAEGGTSSCNLDRLIDD  475

Query  1499  LKKM  1510
             ++ M
Sbjct  476   IRAM  479



>ref|XP_004150245.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   509 bits (1310),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 254/483 (53%), Positives = 336/483 (70%), Gaps = 16/483 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q +S HVL+FP P QGH+N ML+ AELL   SSI VTFL +E ++++L  ++D+  RFS 
Sbjct  5     QSTSPHVLLFPAPAQGHLNVMLKFAELLSL-SSIRVTFLTTEHSYRQLTLHSDVLPRFSL  63

Query  269   YPNFYFRTISDGLPADHPRT-GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             +P+F FRTISDGLP  HPRT    + ++ +S  +VTKP FR+ML S    S     +TC+
Sbjct  64    FPSFQFRTISDGLPLSHPRTFSHHLPEMLHSFVSVTKPLFRDMLLSPHFSSD----LTCL  119

Query  446   IADGIMCFAIDVGNE-LRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             I DG   + +D+ ++ +++P   FRTF A   W    +P LI+ G L + GE DMD++L+
Sbjct  120   ILDGFFSYLLDIDDDFVKVPVFCFRTFGACSTWTILSIPNLIKQGQLTIKGEEDMDRILD  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILAT-LRTTRANGLILNTFEDLEESALAQ  799
             NV GMEN+LR RDLP FCR TD ++   L  I++T +R+T+ + LI+NTFEDLE   L+ 
Sbjct  180   NVPGMENLLRCRDLPGFCRATDPNNDPILQFIMSTFIRSTKFSALIMNTFEDLEGPILSN  239

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR   PNLY+IGPLHA L+ +++     L     ++LWE DRSC+ WLD Q   SV+YVS
Sbjct  240   IRTLCPNLYSIGPLHALLKTKLNHETESL-----NNLWEVDRSCLTWLDNQAAGSVIYVS  294

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVG  1150
             FGS+TV+   + LEFWHG+VNSG+ FLW IRP+ V G +    IPAEL EGT+++GYMVG
Sbjct  295   FGSITVMGNRELLEFWHGLVNSGRRFLWVIRPDLVKGKNGEIEIPAELEEGTKQRGYMVG  354

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQE+VL H AVGGFLTHSGWNSTLESI  G PMICWP+  DQ VNSR V  VW  G+D
Sbjct  355   WTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQLVNSRFVSNVWNLGLD  414

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKD CDR TV KMV ++M  R++EF + +  +A LAR++V   GSSY+N DRLVED++ +
Sbjct  415   MKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARRSVNPGGSSYANFDRLVEDIRNL  474

Query  1511  KLQ  1519
               Q
Sbjct  475   SGQ  477



>gb|KGN50615.1| UDP-glucosyltransferase family 1 protein [Cucumis sativus]
Length=485

 Score =   508 bits (1308),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/483 (52%), Positives = 337/483 (70%), Gaps = 16/483 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q +S HVL+FP P QGH+N ML+ AELL   SSI VTFL +E ++++L  ++D+  RFS 
Sbjct  5     QTTSPHVLLFPVPAQGHINVMLKFAELLSL-SSIRVTFLTTEHSYRQLTLHSDVLPRFSL  63

Query  269   YPNFYFRTISDGLPADHPRT-GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             +P+F FRTISDGLP  HPR     + ++ +S  +VTKP FR+ML S    S     +TC+
Sbjct  64    FPSFQFRTISDGLPLSHPRIFAHHLTEMLHSFVSVTKPLFRDMLLSPHFSSD----LTCL  119

Query  446   IADGIMCFAIDVGNE-LRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             I DG   + +D+ ++ +++PT  FRT  A   W    +P LI+ G LP+ GE DMD++L+
Sbjct  120   ILDGFFSYLLDIDDDFVKVPTFCFRTSGACSTWTILSIPNLIKQGQLPIKGEDDMDRILD  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILAT-LRTTRANGLILNTFEDLEESALAQ  799
             NV GMEN+LR RDLP FCR TD ++   L  I++T +R+T+ + LI+NTFEDLE   L+ 
Sbjct  180   NVPGMENLLRCRDLPGFCRATDPNNDPILQFIMSTFIRSTKFSALIMNTFEDLEGPILSN  239

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR   PNLY+IGPLHA L+ +++     L     ++LWE DRSC+ WL  Q   SV+YVS
Sbjct  240   IRTLCPNLYSIGPLHALLKTKLTHETESL-----NNLWEVDRSCLTWLGNQAAGSVIYVS  294

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVG  1150
             FGS+TV+   + +EFWHG+VNSG++FLW IRP+ + G++    IPAEL EGT+++GYMVG
Sbjct  295   FGSITVMGNRELMEFWHGLVNSGRSFLWVIRPDLLKGENGEIEIPAELEEGTKQRGYMVG  354

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQE+VL H AVGGFLTHSGWNSTLESI  G PMICWP+  DQ VNSR V  VW  G+D
Sbjct  355   WTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQLVNSRFVSNVWNLGLD  414

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKD CDR TV KMV ++M  R++EF + +  +A LAR++V   GSSY+N DRL+ED+K +
Sbjct  415   MKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARQSVNPGGSSYANFDRLIEDIKIL  474

Query  1511  KLQ  1519
               Q
Sbjct  475   SRQ  477



>gb|KGN50614.1| hypothetical protein Csa_5G196570 [Cucumis sativus]
Length=485

 Score =   508 bits (1307),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 254/483 (53%), Positives = 336/483 (70%), Gaps = 16/483 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q +S HVL+FP P QGH+N ML+LAELL   SSI VTFL +E ++++L  ++D+  RFS 
Sbjct  5     QSTSPHVLLFPAPAQGHLNVMLKLAELLSL-SSIRVTFLTTEHSYRQLTLHSDVLPRFSL  63

Query  269   YPNFYFRTISDGLPADHPRT-GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             +P+F FRTISDGLP  HPRT    + ++ +S  +VTKP FR+ML S    S     +TC+
Sbjct  64    FPSFQFRTISDGLPLSHPRTFSHHLPEMLHSFVSVTKPLFRDMLLSPHFSSD----LTCL  119

Query  446   IADGIMCFAIDVGNE-LRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             I DG   + +D+ ++ +++P   FRTF A   W    +P LI+   L + GE DMD++L+
Sbjct  120   ILDGFFSYLLDIDDDFVKVPVFCFRTFGACSTWTILSIPNLIKQEQLTIKGEDDMDRILD  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILAT-LRTTRANGLILNTFEDLEESALAQ  799
             NV GMEN+LR RDLP FCR TD ++   L  I++T +R+T+ + LI+NTFEDLE   L+ 
Sbjct  180   NVPGMENLLRRRDLPGFCRATDPNNDPILQFIMSTFIRSTKFSALIMNTFEDLEGPILSN  239

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR   PNLY+IGPLHA L+ +++     L     ++LWE DRSC+ WLD Q   SV+YVS
Sbjct  240   IRTLCPNLYSIGPLHALLKTKLNHETESL-----NNLWEVDRSCLTWLDNQAAGSVIYVS  294

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVG  1150
             FGS+TV+   + LEFWHG+ NSG+ FLW IRP+ V G +    IPAEL EGT+++GYMVG
Sbjct  295   FGSITVMGNRELLEFWHGLFNSGRRFLWVIRPDLVKGKNGEIEIPAELEEGTKQRGYMVG  354

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQE+VL H AVGGFLTHSGWNSTLESI  G PMICWP+  DQQVNSR V  VW  G+D
Sbjct  355   WTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQQVNSRFVSNVWNLGLD  414

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKD CDR TV KMV ++M  R++EF + +  +A LAR++V   GSSY+N DRLVED++ +
Sbjct  415   MKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARQSVNPGGSSYANFDRLVEDIRNL  474

Query  1511  KLQ  1519
               Q
Sbjct  475   SGQ  477



>ref|XP_004172562.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   508 bits (1307),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 255/483 (53%), Positives = 336/483 (70%), Gaps = 16/483 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q +S HVL+FP P QGH+N ML+LAELL   SSI VTFL +E ++++L  ++D+  RFS 
Sbjct  5     QSTSPHVLLFPAPAQGHLNVMLKLAELLSL-SSIRVTFLTTEHSYRQLTLHSDVLPRFSL  63

Query  269   YPNFYFRTISDGLPADHPRT-GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             +P+F FRTISDGLP  HPRT    + ++ +S  +VTKP FR+ML S    S     +TC+
Sbjct  64    FPSFQFRTISDGLPLSHPRTFSHHLPEMLHSFVSVTKPLFRDMLLSPHFSSD----LTCL  119

Query  446   IADGIMCFAIDVGNE-LRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             I DG   + +D+ ++ +++P   FRTF A   W    +P LI+   L + GE DMD++L+
Sbjct  120   ILDGFFSYLLDIDDDFVKVPVFCFRTFGACSTWTILSIPNLIKQEQLTIKGEEDMDRILD  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVIL-ATLRTTRANGLILNTFEDLEESALAQ  799
             NV GMEN+LR RDLP FCR TD ++   L  I+ A +R+T+ + LI+NTFEDLE   L+ 
Sbjct  180   NVPGMENLLRRRDLPGFCRATDPNNDLILQFIVSAFIRSTKFSALIMNTFEDLEGPILSN  239

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR   PNLY+IGPLHA L+ +++     L     ++LWE DRSC+ WLD Q   SV+YVS
Sbjct  240   IRTLCPNLYSIGPLHALLKTKLNHETESL-----NNLWEVDRSCLTWLDNQAAGSVIYVS  294

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVG  1150
             FGS+TV+   + LEFWHG+VNSG+ FLW IRP+ V G +    IPAEL EGT+++GYMVG
Sbjct  295   FGSITVMGNRELLEFWHGLVNSGRRFLWVIRPDLVKGKNGEIEIPAELEEGTKQRGYMVG  354

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQE+VL H AVGGFLTHSGWNSTLESI  G PMICWP+  DQQVNSR V  VW  G+D
Sbjct  355   WTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWPYGFDQQVNSRFVSNVWNLGLD  414

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKD CDR TV KMV ++M  R++EF + +  +A LAR++V   GSSY+N DRLVED++ +
Sbjct  415   MKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARRSVNPGGSSYANFDRLVEDIRNL  474

Query  1511  KLQ  1519
               Q
Sbjct  475   SGQ  477



>ref|XP_004149949.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
 gb|KGN50608.1| hypothetical protein Csa_5G190520 [Cucumis sativus]
Length=478

 Score =   507 bits (1306),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 250/467 (54%), Positives = 318/467 (68%), Gaps = 8/467 (2%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFPFP QGHVN ML+LAELL   S + +TFLN    HQ+L  +TD+  RFS +PNF 
Sbjct  9     HVLIFPFPAQGHVNSMLKLAELLTL-SGLRITFLNILRIHQKLTLHTDIQSRFSRFPNFQ  67

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F+TI+DGL     R  D+  DL +S+ ++T P  ++ML SG       P  TCII DG+ 
Sbjct  68    FQTITDGLDN---RLIDKFSDLIDSLKSITMPLLKQMLLSGEFG----PTPTCIILDGLF  120

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              F +DV     IP   FRT SA  F A+  VPKLIE G LP+ GE DMD+++  + GMEN
Sbjct  121   NFIVDVDAHPNIPVFSFRTISACSFSAYSFVPKLIEDGQLPIKGEEDMDRIISGMGGMEN  180

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
             VLR RDLPSFCR  D  D G    +  T+++ ++  LI NTF DLE   L+ +R    N+
Sbjct  181   VLRCRDLPSFCRLEDPFDPGLQHGVTQTIQSFKSRALIFNTFNDLEGPILSSLRSRCSNI  240

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             Y IGPLHAHL+ R+S         SS+ LWE DRSC+AWLD+ P KSV+YVSFGS+ V+ 
Sbjct  241   YAIGPLHAHLKTRLSGEISPASSVSSNGLWEVDRSCLAWLDDHPPKSVIYVSFGSVVVIG  300

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQEEVLVHP  1183
              +QF EFWHG+VNSGK FLW +RPNS+ G D +PA+L E T ++GY+V WAPQEEVL H 
Sbjct  301   DDQFREFWHGLVNSGKRFLWVMRPNSLAGKDGVPADLKEKTNERGYIVDWAPQEEVLAHK  360

Query  1184  AVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVE  1363
             A+G FLTHSGWNSTLESI  G+PMICWP +ADQQ NSR V  VWK G+DMKD C+R TV 
Sbjct  361   AIGAFLTHSGWNSTLESIVAGVPMICWPQFADQQTNSRYVSDVWKIGLDMKDVCNRETVT  420

Query  1364  KMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             KMV ++ME R++E       MA+ A  +V + GSSY +L+R++ D++
Sbjct  421   KMVNDVMENRKNELMGSVIEMAESAITSVEEGGSSYCDLERMINDIR  467



>gb|KHG01935.1| UDP-glycosyltransferase 85A1 [Gossypium arboreum]
Length=948

 Score =   522 bits (1345),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 245/482 (51%), Positives = 334/482 (69%), Gaps = 12/482 (2%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q    HVL+FPFP+QGH+N M++LAELL   +   +TFLNS + H+RL+++ ++   F  
Sbjct  8     QPPPPHVLVFPFPLQGHINSMIKLAELLAL-AGFKLTFLNSHYNHERLVKFNNIAAHFER  66

Query  269   YPNFYFRTISDGLPADHPRTGDRVVDLFN-SINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             Y  F F+TI+DGLP DHPR+G+  +D++  ++    KP  REML + S      PPV CI
Sbjct  67    YQGFEFKTITDGLPLDHPRSGNWFLDMYEEALEMKMKPGLREMLENIS------PPVDCI  120

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
             IADG + FAIDV  EL IP I FRT S   FW ++ +P +I++G+LP+ G  DMD+LL  
Sbjct  121   IADGFLGFAIDVAKELEIPIIYFRTSSPCSFWVYYSIPDIIQAGELPIKGSEDMDRLLTT  180

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             V GME   R RDLPSFCR TD+ D      +  T ++++A+ LILNT E+L+   L+QIR
Sbjct  181   VPGMETYFRCRDLPSFCRETDIEDSIIKLYVKQTQKSSQADALILNTAEELDGPILSQIR  240

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
                P +Y IGPLHA L  R+ +  GE     S++LWE D+SC+ WLD+QP +SV+YVSFG
Sbjct  241   TKCPRVYAIGPLHAQLNTRLKAKHGESYDHFSNTLWEVDKSCIFWLDKQPNRSVIYVSFG  300

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD----NIPAELIEGTRKKGYMVGW  1153
             S+T  +R Q +E W+G++NS   FL  +RPNSVIG D    ++  EL+E ++ +GY+V W
Sbjct  301   SITSTSREQLVELWYGLLNSKTKFLLVVRPNSVIGKDGEGEDVVVELMEKSKDQGYIVNW  360

Query  1154  APQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDM  1333
             APQE VL HP VGGF TH+GWNSTLESI  G+PMICWP++ADQQVNSR+V  VWK G+DM
Sbjct  361   APQEAVLNHPTVGGFFTHNGWNSTLESIVAGVPMICWPYFADQQVNSRVVSEVWKIGLDM  420

Query  1334  KDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMK  1513
             KD CD+  VEKMVK++M  +++EF + +   AK+  ++V   GSSYSNLD L+ED++ M 
Sbjct  421   KDVCDKKIVEKMVKDVMVDQKEEFVQSAAETAKVTNQSVNVGGSSYSNLDHLIEDIRIMS  480

Query  1514  LQ  1519
             L+
Sbjct  481   LK  482


 Score =   461 bits (1187),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 226/463 (49%), Positives = 315/463 (68%), Gaps = 13/463 (3%)
 Frame = +2

Query  158   LAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRTGDR  337
             LAELL   +   +TFLNS   H+RL+++T +   F  YP F  +TI+DGLP DHPR+G+ 
Sbjct  489   LAELLAL-AGFKLTFLNSHHNHERLIKFTSIVAYFKRYPGFELKTITDGLPLDHPRSGNW  547

Query  338   VVDLFN-SINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIMCFAIDVGNELRIPTILF  514
              ++ +  +I    K  FREM+ + +      PPV C+IADG   +AIDV NEL IP I F
Sbjct  548   FLETYEEAILMKIKQSFREMMINSN------PPVDCVIADGFSGYAIDVANELGIPIIGF  601

Query  515   RTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTDLS  694
             RT S   FW ++ +  +I++G+LP+ G  DMD+L+  V GME  LR RDLPSFCR  D+ 
Sbjct  602   RTSSPRSFWVYYSITDIIKAGELPIRGSEDMDRLITTVPGMETYLRCRDLPSFCRKPDIE  661

Query  695   DRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSS  874
             D     ++  T ++T+A+ LI NT ++L+E  L+QIR    N+Y IGPLHA L  R+ + 
Sbjct  662   DSTVQLIVKQTRKSTQADALIFNTTDELDEPILSQIRTKCANIYPIGPLHAQLNTRLKAK  721

Query  875   RGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKA  1054
              GE   + S++L EED+SC+ WLD+QP +SV+YVSFGS+T  +R+Q +E W+G++NS   
Sbjct  722   HGESFDQFSNTLREEDKSCIPWLDKQPNRSVIYVSFGSITSTSRDQLVELWYGLLNSKTK  781

Query  1055  FLWAIRPNSVIGDD----NIPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNS  1222
             FL+ +RP+SVIG D    +   EL+E ++ +GY+V WAPQE VL H AVGGFLTHSGWNS
Sbjct  782   FLFVVRPDSVIGKDGEGEDFVKELMEKSKDRGYIVDWAPQEVVLNHEAVGGFLTHSGWNS  841

Query  1223  TLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDE  1402
             TLESI  G+PM+CWP++ADQQV SR+V  VWK G+DMKD  DR  VEKMV ++M V + E
Sbjct  842   TLESIVAGVPMVCWPYFADQQVTSRVVSTVWKIGLDMKDVSDRKIVEKMVNDVM-VDQKE  900

Query  1403  FTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQL*YI  1531
             F   +  MAK+  + V+  GSS +NLDRL+ED++  +L+  ++
Sbjct  901   FVNSATDMAKVINQCVSIGGSSSNNLDRLIEDIRMKRLKTTFV  943



>ref|XP_010318075.1| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetic acid glucosyltransferase-like 
[Solanum lycopersicum]
Length=469

 Score =   505 bits (1301),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 250/472 (53%), Positives = 334/472 (71%), Gaps = 18/472 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+IFPFP QGHVN ML+LA+LL   S+ H+TFL +   H RLL +TD+  RF S   F+
Sbjct  6     HVIIFPFPAQGHVNSMLKLAQLLSL-SNFHITFLVTVDTHDRLLNHTDVLSRFGS--GFH  62

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
              + +  G+  D   T D +  L+NS+N + K   RE + + +       PVTC+IADGI+
Sbjct  63    LQPLPHGISMDVMNTRDGLSILYNSLNKIAKLFLREFIVNMN------SPVTCLIADGIL  116

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
               A DV  E+ +P I FRT SA  FW++FC+P LI++G LPL  E+ MD +L  V+GMEN
Sbjct  117   SMAGDVAQEINLPLIYFRTISACAFWSYFCIPHLIQAGQLPLK-ENAMDLILTKVKGMEN  175

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
              LR RDLPS CR +D++   F  ++  TL+T RA GLILNT EDLE   L+QI+   PN+
Sbjct  176   FLRGRDLPSVCRASDVTRPDFRILMTETLQTPRARGLILNTIEDLEGPILSQIQTVCPNV  235

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             YTIGP+HAHL+A+++++       SS+SLW+ED SCM+WLD QP KSV+YVSFGS+  LT
Sbjct  236   YTIGPVHAHLKAKLATTS-----TSSNSLWQEDESCMSWLDTQPPKSVIYVSFGSIAGLT  290

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVIGD---DNIPAELIEGTRKKGYMVGWAPQEEVL  1174
             + + LEF +G+VNS + FLW +R + +IG    D IP EL +GT+ +GYM  W PQE+VL
Sbjct  291   KEELLEFXYGLVNSEQKFLWVMRSDLIIGQERKDEIPVELEQGTKARGYMADWVPQEKVL  350

Query  1175  VHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRI  1354
              H A+GGFLTHSGWNSTLESI EG+PMICWP +ADQQVNSR +G VWK G+D+KDTCDR 
Sbjct  351   AHKAIGGFLTHSGWNSTLESIVEGVPMICWPRFADQQVNSRFIGEVWKMGLDIKDTCDRD  410

Query  1355  TVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
              + K V+ELME R  EF++ + +MA LA+KA+ + GSS  NLDRL++D++ +
Sbjct  411   IIAKSVRELMEKRNGEFSQRTEQMASLAKKAINEGGSSCINLDRLIQDIRSV  462



>ref|XP_010674283.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   505 bits (1301),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 244/484 (50%), Positives = 339/484 (70%), Gaps = 16/484 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q S+ HVLIFP P+QGH+  ML LAELLC  +++ VTFLN+   H+ L R T++  RF+ 
Sbjct  4     QSSTPHVLIFPLPIQGHITPMLNLAELLCL-ANLKVTFLNTTQNHKLLTRNTNIEARFAR  62

Query  269   YPNFYFRTISDGLPADHPRTG-----DRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPP  433
             YP F F  + DGL  +HPR G     D   +L   +    +P  REML    + S+G   
Sbjct  63    YPGFVFSIVPDGLADEHPRAGVSKFKDWSSELVEKLALSGEPLLREML----VGSTGIDK  118

Query  434   VTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDK  613
             VTC+I DG + FA +V NE+ +P I FR  S    W +FC+PKLI++GD+P   E+ MD+
Sbjct  119   VTCLIIDGWISFANEVANEVEVPVIAFRCSSPCYMWTYFCIPKLIQAGDIPFKDEA-MDE  177

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSD-RGFLSVILATL-RTTRANGLILNTFEDLEES  787
             L+++  GM++ LR RDLPSFCR  D S  +  L +    + R  +A+  ILNTFEDLE+ 
Sbjct  178   LVKSSPGMDSFLRYRDLPSFCRNQDTSSCQDLLHLFNGEIQRNKQAHAFILNTFEDLEDP  237

Query  788   ALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
              L+ IR     +Y++GPLHAHL+ ++S     L   SSS+LWE D+SC++WLD++P KSV
Sbjct  238   TLSLIRSECSKVYSLGPLHAHLKYKLSQKETTLCNNSSSNLWEVDQSCISWLDQKPNKSV  297

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKG  1138
             VYVSFGS+T+LT++Q  EFW G+V+S K FLW IRPN +IG   D+  P +L+EGT+K+G
Sbjct  298   VYVSFGSLTILTKDQLREFWAGLVHSKKYFLWVIRPNLIIGSELDNPTPDDLLEGTKKRG  357

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              +V WAPQ+EVL H A+GGFLTHSGWNSTLESI  G+PM+CWP++ADQQVNSR V  VW+
Sbjct  358   CLVKWAPQQEVLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWPYFADQQVNSRFVSEVWR  417

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G+DMKD CDR  VEKM+ +LM+V++DE  +  +++++LA+ ++++ GSSYSN ++L+ED
Sbjct  418   IGLDMKDVCDRTIVEKMINDLMDVKKDELQRSMDKISQLAKTSISEGGSSYSNFNQLIED  477

Query  1499  LKKM  1510
             +K M
Sbjct  478   IKAM  481



>ref|XP_004171873.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
Length=478

 Score =   504 bits (1298),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 249/467 (53%), Positives = 318/467 (68%), Gaps = 8/467 (2%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFPFP QGHVN ML+LAELL   S + +TFLN    HQ+L  +TD+  RFS +PNF 
Sbjct  9     HVLIFPFPAQGHVNSMLKLAELLTL-SGLRITFLNILRIHQKLTLHTDIQSRFSRFPNFQ  67

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F+TI+DGL     R  D+  DL +S+ ++T P  ++ML SG       P  TCII DG+ 
Sbjct  68    FQTITDGLDN---RLIDKFSDLIDSLKSITMPLLKQMLLSGEFG----PTPTCIILDGLF  120

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              F +DV     IP   FRT SA  F A+  VPKLIE G LP+ GE DMD+++  + GMEN
Sbjct  121   NFIVDVDAHPNIPVFSFRTISACSFSAYSFVPKLIEDGQLPIKGEEDMDRIISGMGGMEN  180

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
             VLR RDLPSFCR  D  D G    +  T+++ ++  LI NTF DLE   L+ +R    N+
Sbjct  181   VLRCRDLPSFCRLEDPFDPGLQHGVTQTIQSFKSRALIFNTFNDLEGPILSCLRSRCSNI  240

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             Y IGPLHAHL+ R+S         SS+ LWE +RSC+AWLD+ P KSV+YVSFGS+ V+ 
Sbjct  241   YAIGPLHAHLKTRLSGEISPASSGSSNGLWEVNRSCLAWLDDHPPKSVIYVSFGSVVVIG  300

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQEEVLVHP  1183
              +QF EFWHG+VNSGK FLW +RPNS+ G D +PA+L E T ++GY+V WAPQEEVL H 
Sbjct  301   DDQFREFWHGLVNSGKRFLWVVRPNSLAGKDGVPADLKEKTNERGYIVDWAPQEEVLAHK  360

Query  1184  AVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVE  1363
             A+G FLTHSGWNSTLESI  G+PMICWP +ADQQ NSR V  VWK G+DMKD C+R TV 
Sbjct  361   AIGAFLTHSGWNSTLESIVAGVPMICWPQFADQQTNSRYVSDVWKIGLDMKDVCNRETVT  420

Query  1364  KMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             KMV ++ME R++E       MA+ A  +V + GSSY +L+R++ D++
Sbjct  421   KMVNDVMENRKNELMGSVIEMAESAITSVEEGGSSYCDLERMINDIR  467



>ref|XP_010674284.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   504 bits (1298),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 248/484 (51%), Positives = 332/484 (69%), Gaps = 16/484 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q S+ HVLIFP P+QGH+  ML LAELLC  +++ VTFLN+   H+ L R T++  RF+ 
Sbjct  4     QSSTPHVLIFPLPIQGHITPMLNLAELLCL-ANLKVTFLNTTQNHKLLTRNTNIEARFAR  62

Query  269   YPNFYFRTISDGLPADHPRTG-----DRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPP  433
             YP F F  + DGL  +HPR G     D   +L   +    +P  REML    + S+G   
Sbjct  63    YPGFVFSIVPDGLADEHPRAGVSKFKDWSSELVEKLALSGEPLLREML----VGSTGIDK  118

Query  434   VTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDK  613
             VTC+I DG + FA +V NE+ +P I FR  S    W +FC+PKLI++GD+P   +  MD+
Sbjct  119   VTCLIIDGWISFANEVANEVEVPVIAFRCSSPCYMWTYFCIPKLIQAGDIPFK-DDKMDE  177

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLS--VILATLRTTRANGLILNTFEDLEES  787
             L+EN  GM + LR R LP+FCR  D S    L   +I    R  +A+  ILNTFEDLE  
Sbjct  178   LVENAPGMSSFLRYRGLPTFCRNHDTSSCQDLKDWLIGEIQRNKQAHSFILNTFEDLEGP  237

Query  788   ALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
              L+ IR     +Y+IGPLHAHL+ ++   +  L    SS+LWE DRSC++WLD++P KSV
Sbjct  238   TLSLIRSQCSRVYSIGPLHAHLKYKLDQQKTTLSNNFSSNLWEVDRSCISWLDQKPNKSV  297

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKG  1138
             VYVSFGS+TVLT++Q  EFW G+V S K FLW IRPN +IG   D++ P +L+EGT K+G
Sbjct  298   VYVSFGSLTVLTKDQLREFWAGLVQSNKYFLWVIRPNLIIGSELDNSTPDDLLEGTEKRG  357

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              +V WAPQ+EVL H A+GGFLTHSGWNSTLESI  G+PM+CWP++ADQQVNSR V  VW+
Sbjct  358   CLVKWAPQKEVLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWPYFADQQVNSRFVSEVWR  417

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G+DMKDTCDR  VEKM+ +LM+ + DE  +  +RM+ LA+K++++ GSSYSNL++L+ED
Sbjct  418   IGLDMKDTCDRTIVEKMINDLMDGKNDELQRSMDRMSYLAKKSISEGGSSYSNLNQLIED  477

Query  1499  LKKM  1510
             +K +
Sbjct  478   IKAL  481



>gb|KDO69252.1| hypothetical protein CISIN_1g011848mg [Citrus sinensis]
Length=460

 Score =   503 bits (1295),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 251/484 (52%), Positives = 326/484 (67%), Gaps = 33/484 (7%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYT-DLHLR  259
             M+++   HV I P P  GHVN ML LAELL H + I +TFLN+E  + R++R++ D   R
Sbjct  1     MEKQDHVHVAILPLPAVGHVNSMLNLAELLGH-AGIKITFLNTEHYYDRVIRHSSDAFSR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             +   P F F+T++DGLP DHPRT D+  +L +S+N  T P  +EM+S        + PV 
Sbjct  60    YMQIPGFQFKTLTDGLPRDHPRTPDKFPELVDSLNCATPPLLKEMVSDS------KSPVN  113

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CII DG M  AID   E+ +  I FRT SA  FW+F C+P +I++G+LP+ G        
Sbjct  114   CIITDGYMSRAIDAAREVGVSIIYFRTISACAFWSFHCIPDIIDAGELPIKG--------  165

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
                      LR RDLPSFCR  D  D   L     T  +  A+GLILNTFEDLE   L+Q
Sbjct  166   --------FLRCRDLPSFCRVNDPMDPHLLLFARETRLSAHADGLILNTFEDLEGPILSQ  217

Query  800   IRKH-IPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             IR H  PN+Y+IGPL+AHL+ R+          SSSSLW+ DRSCMAWLD+QP +SV+YV
Sbjct  218   IRNHSCPNIYSIGPLNAHLKVRIPEKT-----YSSSSLWKIDRSCMAWLDKQPKQSVIYV  272

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+ V++R+Q +EF++G+V+S K+FLW IRP+ + G D    IP EL+E T+++G + 
Sbjct  273   SFGSIAVMSRDQLIEFYYGLVHSKKSFLWVIRPDLISGKDGENQIPEELLEATKERGCIA  332

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GW PQEEVL H AVGGFLTH GWNSTLESI  G+PMICWP +ADQQ+NSR VG VWK G+
Sbjct  333   GWVPQEEVLAHSAVGGFLTHCGWNSTLESIVAGMPMICWPSFADQQINSRFVGEVWKLGL  392

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             D+KD CDR  VEK V +LM  R++EF + ++RMA LA+K+V + GSSY NLDRLV D+K 
Sbjct  393   DIKDLCDRNIVEKAVNDLMVERKEEFMESADRMANLAKKSVNKGGSSYCNLDRLVNDIKM  452

Query  1508  MKLQ  1519
             M  Q
Sbjct  453   MSSQ  456



>ref|XP_008811497.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=499

 Score =   504 bits (1297),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 252/486 (52%), Positives = 337/486 (69%), Gaps = 18/486 (4%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M + S++HVLIFPFP QGHVNCML+L ELL  ++ +HVTFLN+++ H RL RY+  +   
Sbjct  9     MPKDSTAHVLIFPFPAQGHVNCMLKLGELLT-KTGLHVTFLNTDYNHHRLSRYSAAYALL  67

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR-PPVT  439
             +  P F F +I DGL  + PR+   ++DL  S+   +   +RE+L     +  G+ PPVT
Sbjct  68    AESPRFRFESIPDGLADEDPRSVLHLMDLEESLRVRSAVLYRELLIKRGRRDDGKWPPVT  127

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             C+IADGIM FA+D+  EL IP I FRT SA  FWA+F +P+L++SG+LP   E+D+D+ +
Sbjct  128   CVIADGIMTFAVDIAEELGIPAIAFRTVSACSFWAYFRLPQLLQSGELPFPDEADLDEPV  187

Query  620   ENVEGMENVLRLRDLPSFCRTT-DLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
              +V GME  LR RDLPSFCR   D +DR F  V   T  T RA  LILNTFE LE +AL+
Sbjct  188   RSVPGMEAFLRRRDLPSFCRLAGDRTDRTFEFVTTVTANTNRARALILNTFESLEATALS  247

Query  797   QIRKHIPNLYTIGPLHAHLRA---RVSSSRGELPWRS--SSSLWEEDRSCMAWLDEQPLK  961
              +R H P  + +GPL A LR+   R  S     P  S  S++LWEEDR+CM WLD QP K
Sbjct  248   HVRSHFPVTFAVGPLPALLRSYRSRCPSDPAVPPASSMPSATLWEEDRTCMTWLDSQPHK  307

Query  962   SVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN--------IPAELI  1117
             SVVYVSFGS+T++++  FLEFW G+VNSG+ FLW +RP+ ++G++         +  E+ 
Sbjct  308   SVVYVSFGSLTLVSQEAFLEFWVGLVNSGQRFLWVVRPD-LVGEEGRRWEEMLPVTEEVK  366

Query  1118  EGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSR  1297
              GT+++G +V W PQEEVL HPAVG FLTHSGWNSTLESI  G+PM+CWPF+ADQQ+NSR
Sbjct  367   VGTKERGCLVKWVPQEEVLAHPAVGCFLTHSGWNSTLESIVAGVPMLCWPFFADQQINSR  426

Query  1298  LVGAVWKNGVDMKDTCDRITVEKMVKELME-VRRDEFTKCSNRMAKLARKAVTQHGSSYS  1474
              V  VWK G+DMKD C R  VEKMV+E+ME  R +E+ + +  MAK+AR++V + GSSY+
Sbjct  427   FVSEVWKVGLDMKDLCSRSIVEKMVREMMEGPRAEEWRRSAKEMAKMARESVAEGGSSYT  486

Query  1475  NLDRLV  1492
             +  RL+
Sbjct  487   DFRRLI  492



>ref|XP_003517688.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Glycine max]
Length=481

 Score =   502 bits (1292),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 252/479 (53%), Positives = 330/479 (69%), Gaps = 15/479 (3%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             + +HVLIFP P+ GH+  ML+LAELL  ++ IHVTF+++E  H RL R+ D+      YP
Sbjct  2     AKAHVLIFPLPLPGHLGSMLKLAELLALDN-IHVTFVDTENIHIRLTRFGDIQELSECYP  60

Query  275   NFYFRTISDGL--PADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCII  448
               +F+TI D      +HP  GDRV D   S     KP  R++L S    S G P V+CII
Sbjct  61    TLHFKTIPDCYDEEGEHPGFGDRVGDFITSTAQHAKPFLRDILVSQ--HSPGIPKVSCII  118

Query  449   ADGIM-CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
              DGI    + D   ELRIP I FRT S+ CFWA+FCVPKL++  +LP+ GE DMD+++ N
Sbjct  119   QDGIFGALSSDFAAELRIPLIHFRTVSSCCFWAYFCVPKLLDCKELPIKGEEDMDRIIRN  178

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLS-VILATLRTTRANGLILNTFEDLEESALAQI  802
             + GMEN+LR RDLPSFCR    ++  FL   +  T ++  A+ L+LNTFEDLE S L+Q+
Sbjct  179   MPGMENLLRCRDLPSFCRPN--TEGNFLEWAVFRTRQSLAADALMLNTFEDLEGSVLSQM  236

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRG--ELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              +H P LYTIGP+H HL+ R + S    ++P    +SL++ DRSCMAWL+ QP  SV+YV
Sbjct  237   GQHFPKLYTIGPIHHHLKIRKAESNKAKDIP-TFKNSLFQVDRSCMAWLEAQPQGSVIYV  295

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKGYMV  1147
             SFGS T++ R   +E WHG+VNS K FLW +RP+ V     DD IPAE+ EGTR++G +V
Sbjct  296   SFGSSTIVKREDLMEIWHGLVNSKKRFLWVMRPDIVAAKDNDDRIPAEVEEGTRERGLIV  355

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GWAPQE+VL H AVGGF TH+GWNSTL+S+  G+PMICWP++ADQQ+NSR V  VWK G+
Sbjct  356   GWAPQEDVLAHKAVGGFFTHNGWNSTLDSVVAGVPMICWPYFADQQINSRFVSEVWKLGL  415

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             DMKD CDR  VEKMV +LM  R++EF K +  MA LA K+VT  GSSYS+ D L++ +K
Sbjct  416   DMKDVCDRHVVEKMVNDLMVHRKEEFLKSAQEMAMLAHKSVTPGGSSYSSFDDLIQYIK  474



>ref|XP_009589440.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=488

 Score =   502 bits (1292),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 242/475 (51%), Positives = 326/475 (69%), Gaps = 8/475 (2%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             SSHVL+FP P+Q  +N ML LAEL C  + + VTFLN+    + LLR+T++  RF  YP 
Sbjct  5     SSHVLLFPLPIQSPINSMLHLAELFCL-AGLQVTFLNTNHNQKLLLRHTNVESRFRQYPR  63

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADG  457
             F FRTISDGLP ++PR+  +  +L +S+ AV +P  RE+L S S      PPVTC+I DG
Sbjct  64    FRFRTISDGLPEENPRSSVQFGELISSLQAVAEPFLREILLSSSSDGVTEPPVTCVIPDG  123

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGM  637
             +  +A+D+GNE+ +P I F T S  C W + C+PKLI++ ++P  G +D+D L ENV GM
Sbjct  124   LFYYAVDIGNEIGVPVIPFDTISPCCLWVYLCIPKLIQAEEIPFKG-NDLDALFENVAGM  182

Query  638   ENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTT-RANGLILNTFEDLEESALAQIRKHI  814
             + +LR RD P F R  D +   +  + L  + +  R+NGLILNTFEDL+   L+ IR H 
Sbjct  183   QGLLRRRDFP-FYRLIDYATDPYCQIALKEVESIPRSNGLILNTFEDLDGPLLSLIRSHC  241

Query  815   PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMT  994
                Y IGPLH HL+ +++  R  +   SS+SLWEED S + WLD QP++SV+YVSFGSM 
Sbjct  242   QQTYAIGPLHLHLKTKLAEKRMPIS-ASSNSLWEEDHSSIQWLDAQPIESVIYVSFGSMA  300

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVGWAPQE  1165
              L++ + LEFWHG+VNSG  FLW +R N + G+++      EL EG  ++ Y+V WAPQE
Sbjct  301   TLSKEEILEFWHGLVNSGIRFLWVMRSNLLRGEESNHQFVKELAEGCIERAYIVSWAPQE  360

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL H A+GGFLTHSGWNST+ESI +G PMICW  Y DQ+V SR VG VWK GVDMKD C
Sbjct  361   KVLAHSAIGGFLTHSGWNSTMESIVQGKPMICWAVYVDQRVTSRFVGEVWKIGVDMKDIC  420

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             DR  +EKMVK+LM   RDEF K + +++ LA+++V   GSSY+ L  LV+D+KK+
Sbjct  421   DRYIIEKMVKDLMVTNRDEFKKSAEKLSNLAKESVGDGGSSYNALQCLVDDVKKL  475



>ref|XP_009804549.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=487

 Score =   501 bits (1291),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 242/475 (51%), Positives = 328/475 (69%), Gaps = 9/475 (2%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             S HVL+FP P+Q  +N ML+LAEL C  + + VTFLN+    + LL++T++  RF  YP 
Sbjct  5     SPHVLLFPLPIQSPINSMLQLAELFCL-AGLQVTFLNTNHNQKLLLQHTNVESRFRQYPR  63

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADG  457
             F FRTISDGLP ++PR+  +  +L +S+ AV +P  RE+L S S      PPVTC+I DG
Sbjct  64    FRFRTISDGLPVENPRSSVQFGELISSLQAVAEPFLREILLSSS-DGVTEPPVTCVIPDG  122

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGM  637
             +  +A+DVGNE+ +P I F T S  C W + C+PKLI++G++P  G +D+D L ENV GM
Sbjct  123   LFYYAVDVGNEIGVPVIPFDTISPCCLWVYLCIPKLIQAGEVPFKG-NDLDVLFENVAGM  181

Query  638   ENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTT-RANGLILNTFEDLEESALAQIRKHI  814
             + +LR RD P F R  D +   +  + L  + +  ++NGLILNTFEDL+   L+ IR H 
Sbjct  182   QGLLRRRDFP-FYRLIDYATDPYCQIALKEVESIPQSNGLILNTFEDLDGPLLSLIRSHC  240

Query  815   PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMT  994
             P  Y IGPLH HL+ +++  R  +   SS+SLWEED S + WLD QP++SV+YVSFGSM 
Sbjct  241   PQTYAIGPLHLHLKTKLAEKRMPIS-ASSNSLWEEDHSSIQWLDAQPIESVIYVSFGSMA  299

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQE  1165
              L++ + LEFWHG+VNSG  FLW IR N + G++       EL EG +++ Y+V WAPQE
Sbjct  300   TLSKEEILEFWHGLVNSGIRFLWVIRSNLLRGEEWNHQFAKELAEGCKERAYIVSWAPQE  359

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             EVL H A+GGFLTHSGWNST+ESI +G PMICW  Y DQ+V SR V  VWK GVDMKD C
Sbjct  360   EVLAHSAIGGFLTHSGWNSTMESIVQGKPMICWAVYVDQRVTSRFVSEVWKIGVDMKDIC  419

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             DR  +EKMVK+LM   RDEF K + +++ LA+++V + GSSY+ L+ LV+D+K +
Sbjct  420   DRYIIEKMVKDLMVTNRDEFKKSAEKLSNLAKESVGEGGSSYNALECLVDDIKNL  474



>ref|XP_004150246.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Cucumis sativus]
 gb|KGN50613.1| hypothetical protein Csa_5G196560 [Cucumis sativus]
Length=476

 Score =   499 bits (1285),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 253/483 (52%), Positives = 334/483 (69%), Gaps = 23/483 (5%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             + HVLIFP P QGH+N ML+LAELL   + I VTFLN+     +L R++D+  RFS +P 
Sbjct  7     APHVLIFPLPFQGHINSMLKLAELLSI-AGITVTFLNTPHFQSQLTRHSDVLSRFSRFPT  65

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADG  457
             F F TI DGLP DHPRT +    + +S++++TKP FR  L SG   S+    +TC++ DG
Sbjct  66    FRFHTIIDGLPPDHPRTIEFFAQIISSLDSITKPIFRNWLVSGHFGSN----LTCVVLDG  121

Query  458   IMCFAIDVG-NELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEG  634
              +   ID   +E++ P   FRT SA   W + C P LIE G LP+ GE DMD+++ N+ G
Sbjct  122   FLKNFIDGDEDEVKQPIFGFRTVSACSVWTYLCAPHLIEDGQLPIRGEEDMDRMITNLPG  181

Query  635   MENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRA----NGLILNTFEDLEESALAQI  802
             MEN+LR RDLP  CR TD +D    SV+  TL+ T+     + LILN+FEDLE   L++I
Sbjct  182   MENLLRCRDLPGLCRVTDTND----SVLQYTLKQTQGSYQFHALILNSFEDLEGPILSKI  237

Query  803   RKHI-PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             R ++ PNLYTIGPLH+ L+ ++S     L     ++LWE DR+C+AWLD QP  SV+YVS
Sbjct  238   RTNLCPNLYTIGPLHSLLKTKLSHETESL-----NNLWEVDRTCLAWLDNQPPGSVIYVS  292

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVG  1150
             FGS+TV+     +EFWHG+VNSG+ FLW IRP+ V G +    IPA+L EGT+++GY+VG
Sbjct  293   FGSITVMGNEGLMEFWHGLVNSGRNFLWVIRPDLVSGKNGEIEIPADLEEGTKQRGYVVG  352

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQE+VL H AVGGFLTHSGWNSTLESI  G  M+CWP+ ADQQVNSR V  VWK GVD
Sbjct  353   WAPQEKVLSHEAVGGFLTHSGWNSTLESIVAGKAMVCWPYTADQQVNSRFVSNVWKLGVD  412

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKD CDR  V KMV E+M  R++EF + +  MA LAR++V+  GSSY++ DRLV +++ +
Sbjct  413   MKDMCDREIVAKMVNEVMVNRKEEFKRSAIEMANLARRSVSLGGSSYADFDRLVNEIRLL  472

Query  1511  KLQ  1519
              L+
Sbjct  473   SLR  475



>emb|CDP04614.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   497 bits (1279),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 243/480 (51%), Positives = 321/480 (67%), Gaps = 11/480 (2%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN-F  280
             HVLIFP P+Q  VN ML+LAELLC      VTFLN++  H RLLR T++  R   Y   F
Sbjct  10    HVLIFPLPIQSPVNSMLKLAELLCLAGH-RVTFLNTKHNHNRLLRCTNIQSRLDQYQGRF  68

Query  281   YFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSG--SLQSSGRPPVTCIIAD  454
                 + DGLP + PRT ++  ++ +S+ +V +P  RE+L     S  SS RPP+TCIIAD
Sbjct  69    LLEKVDDGLPDEDPRTAEQFTEILDSLQSVAEPFLREVLCGERFSCNSSKRPPITCIIAD  128

Query  455   GIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEG  634
             G   + +DV  E+ IP I F T S  C W + CVPKLIE+G+LP  G +D+D  + ++ G
Sbjct  129   GSYYYVLDVAEEMGIPLIFFETISPCCLWVYMCVPKLIEAGELPFKG-NDLDAEVRSIPG  187

Query  635   MENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHI  814
             ME +LR RDLP FCR    +DR    V+       RA GLILNTFEDLE   L+ I    
Sbjct  188   MEGLLRCRDLPDFCRRDCTADRNAQLVMAEIRNIPRAAGLILNTFEDLEGPFLSHIHSQA  247

Query  815   PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMT  994
              NLY IGPL  HL+ ++++   ELP   S+S W ED SC+ WLD QPLKSV+Y+SFGS+ 
Sbjct  248   RNLYAIGPLQLHLKTKLAAQSRELPTAVSNSFWVEDTSCLCWLDSQPLKSVIYISFGSLK  307

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD-----DNIPAELIEGTRKKGYMVGWAP  1159
              +T+++FLEFWHGI+NSG+ FLW IRP S+ G      D+   EL  GT+ KG ++ W P
Sbjct  308   NITKDEFLEFWHGIMNSGQRFLWVIRPGSIKGQKLEQHDDFLKELNRGTKGKGLILSWVP  367

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             QEEV+ H A+GGFL+HSGWNSTLESI  G+PMICWP Y DQQV SR V   W  G+DMKD
Sbjct  368   QEEVIGHSAIGGFLSHSGWNSTLESIIAGVPMICWPCYVDQQVTSRFVSETWTLGLDMKD  427

Query  1340  TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
             TC R  +EKMV++++E RR +F + +++ +KLAR++V   GSS+ +LDRL+ D+KK+ L+
Sbjct  428   TCSRSIIEKMVRDIIE-RRCDFDQSADKFSKLARQSVAAGGSSHIDLDRLIGDIKKLSLE  486



>emb|CDP19644.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   496 bits (1278),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 246/480 (51%), Positives = 329/480 (69%), Gaps = 10/480 (2%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             S+ HVL+FP P+QG VNCML+LAEL C  S + VTFLN++   +RLL  TD+  RF  Y 
Sbjct  9     SAPHVLLFPLPLQGPVNCMLKLAELFC-SSHLQVTFLNTDHIQRRLLSCTDVSSRFKRYA  67

Query  275   -NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSS-GRPPVTCII  448
              +F F T+ DGLPAD   TG+++ +L +S+ AV+ P FRE++ S  L S   + P+TCII
Sbjct  68    GHFRFETVPDGLPADKTLTGEQIGELLDSMEAVSLPLFREIVRSSVLLSDDAQNPLTCII  127

Query  449   ADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENV  628
             ADG   FA+DV  E  +  + F T S    W+     +LI++GD P   + D+D  + ++
Sbjct  128   ADGAFGFAVDVAAEFGVALMYFDTISPCGLWSILSANRLIQAGDFPFK-DDDLDAPVTSI  186

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GME  LR RDLPSF R  D +D     V+    +  R  GLI N+FEDLE   L+Q++ 
Sbjct  187   PGMEGFLRRRDLPSFFRIPDQNDPIIQRVLKEERQMKRCQGLIFNSFEDLEGPILSQLKT  246

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSS-SLWEEDRSCMAWLDEQPLKSVVYVSFG  985
              +P++YTIGPLH H   R++S RG    R+S+ SLW+E++SC++WLD QP KSV+YVS G
Sbjct  247   LVPSVYTIGPLHTHKETRLASERGSKNDRNSTNSLWKENKSCISWLDNQPAKSVIYVSIG  306

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG-----DDNIPAELIEGTRKKGYMVG  1150
             S+ ++ + Q LE WHG+ NSG  FLW  RP S+ G     D  IP +L   T ++G +V 
Sbjct  307   SLALMGKKQLLEIWHGLANSGVRFLWVQRPGSITGLDEENDAGIPLKLCRATTERGCIVS  366

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL HPA+GGFLTHSGWNSTLESI EG+PMIC P++ADQQ+NSR VG VWK G+D
Sbjct  367   WAPQEEVLAHPAIGGFLTHSGWNSTLESIVEGVPMICCPYFADQQINSRYVGEVWKLGLD  426

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR  VE MV++LME R+DEF+K  + MA+LA+ +V+  GSSY+ L+RL+ED+K M
Sbjct  427   MKDTCDRDIVEMMVRDLMEERKDEFSKKVDHMARLAKASVSNGGSSYNALNRLIEDIKLM  486



>ref|XP_010905381.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=491

 Score =   496 bits (1277),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 246/486 (51%), Positives = 337/486 (69%), Gaps = 16/486 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             +R  +HVL+FPFP QG VNCML+LAELL  ++ +HVTFLNS++ H RL R +  +   + 
Sbjct  5     RRKEAHVLVFPFPGQGMVNCMLKLAELL-SKTGLHVTFLNSDYNHDRLSRSSSAYALLAQ  63

Query  269   YPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR-PPVTCI  445
              P F F +ISDGL  ++PR+  R+++L  S+   +  ++RE+L++      G+ PPVTC+
Sbjct  64    SPRFRFDSISDGLADENPRSAFRLMELEESLRTRSAVQYRELLTNRGRGDDGKWPPVTCV  123

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
             IADG M FA+D+  EL IP I FRT SA  FWA+FC+P+L+++G+LP   E+D+D+ + +
Sbjct  124   IADGAMTFAVDIAEELGIPAIAFRTISACSFWAYFCIPRLLQNGELPFPDEADLDEPVRS  183

Query  626   VEGMENVLRLRDLPSFCRTT-DLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
             V GME  LR RDLPSFCR   D +D+ F  V   T  T RA  LILNTFE LE +AL+ +
Sbjct  184   VPGMEAFLRRRDLPSFCRQAGDEADQTFEFVTTVTANTNRARALILNTFESLEATALSHV  243

Query  803   RKHIPNLYTIGPLHAHLRARVS--------SSRGELPWRSSSSLWEEDRSCMAWLDEQPL  958
             R H P  Y +GPL A LR+  S        S    +P   S+SLWEEDR+CM WLD QP 
Sbjct  244   RSHFPVTYAVGPLPALLRSYGSHCPSNPAVSPTSSMP---SASLWEEDRTCMTWLDSQPH  300

Query  959   KSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIE-GTRKK  1135
             KSVVYVSFGS+TV+++  FLEFW G+VNSG+ FLW +RP+ V  +     E ++ GT+++
Sbjct  301   KSVVYVSFGSLTVVSQEAFLEFWIGLVNSGQRFLWVVRPDLVEEEMLPLPEEVKVGTKER  360

Query  1136  GYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVW  1315
             G +V W PQE+VL HPAVG FLTHSGWNSTLES+  G+PM+CWPF+ADQQ+NSR V  VW
Sbjct  361   GCLVDWVPQEQVLAHPAVGCFLTHSGWNSTLESLVAGVPMLCWPFFADQQINSRFVSEVW  420

Query  1316  KNGVDMKDTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLV  1492
             K G+DMKD C R  VE MV+E+ME +R D + + +  MAK+A ++V + GSS+++  RL+
Sbjct  421   KVGLDMKDLCSRSIVEMMVREVMEGQRTDGWRRSAREMAKMAWESVAEGGSSHADFRRLI  480

Query  1493  EDLKKM  1510
             + +  +
Sbjct  481   QRIMSL  486



>ref|XP_010666054.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=495

 Score =   496 bits (1277),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 239/487 (49%), Positives = 326/487 (67%), Gaps = 16/487 (3%)
 Frame = +2

Query  101   SHVLIFPFPVQGHVNCMLRLAEL--LCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             +H+LIFP P+QG VN ML+LAEL  L  ++ IH+TFL +E  H+RL+ + +   RF SYP
Sbjct  8     AHILIFPLPIQGPVNSMLKLAELILLASDAQIHITFLTTELVHRRLMLHANAASRFESYP  67

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIAD  454
              F  RT SDGLP DHPR  D+  ++ +++ AV++P  REML +    S    P+TCII D
Sbjct  68    GFSLRTFSDGLPEDHPRGSDKFGEMVDAVEAVSRPLLREMLVTDRANSPQEIPITCIIPD  127

Query  455   GIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEG  634
             G   FA+DVG E+ IP I F T S SC W + C+PKLIE G++P     +M+ ++  V G
Sbjct  128   GSYNFALDVGKEVGIPVIYFDTISPSCLWVYLCLPKLIEDGEVPFQENWEMEAIV-GVPG  186

Query  635   MENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTR-ANGLILNTFEDLEESALAQIRKH  811
             +  +LR RD P FCR  + +    +  I    +  R A+G ILNTFEDLE   L+ +R H
Sbjct  187   IGTLLRRRDFPDFCRANNPASDVMIQRISKQAKQFRKASGFILNTFEDLEAPLLSYMRSH  246

Query  812   IPNLYTIGPLHAHLRARV----SSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
              PN+Y +GPLH HL+ R+    +++   L    S+SLW ED+SC+ WLD QPL+SV++ S
Sbjct  247   FPNMYVVGPLHLHLKERILRKETTTSTTLLSYCSNSLWHEDKSCIEWLDAQPLRSVIFCS  306

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN--------IPAELIEGTRKK  1135
             FGS   LT+ Q +EFW G+VNSG  FLW  R  SV G D+        IP+ L++G ++ 
Sbjct  307   FGSHVCLTKEQLMEFWQGLVNSGTRFLWIKRQRSVTGMDDDVHKWQEQIPSGLLKGMKEN  366

Query  1136  GYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVW  1315
             GY+  WAPQEEVL HP++GGFLTHSGWNSTLESI EG PM+CWP+Y DQ + SR V  VW
Sbjct  367   GYVTSWAPQEEVLSHPSIGGFLTHSGWNSTLESIVEGKPMLCWPYYVDQLIISRYVSHVW  426

Query  1316  KNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
             K G+DMKD CDR  +E MV++LM+ RR E+++  N +A LAR++V + GSSY +L++LV+
Sbjct  427   KVGLDMKDICDRDIIENMVRDLMDRRRGEYSQNVNALAYLARQSVHEDGSSYCSLNKLVD  486

Query  1496  DLKKMKL  1516
             D+  +KL
Sbjct  487   DIMSLKL  493



>gb|AFJ53009.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=485

 Score =   494 bits (1273),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 245/485 (51%), Positives = 337/485 (69%), Gaps = 18/485 (4%)
 Frame = +2

Query  92    RSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSY  271
             R   HVLIFP+P+QGHV  ML LAELLC  S+I VTF NS+   +RLL++T +  RF+ Y
Sbjct  6     RPPPHVLIFPYPLQGHVTSMLNLAELLCL-SNIRVTFFNSDHIQRRLLQFTSVQSRFAKY  64

Query  272   PN-FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCII  448
             P  F+F+TISDGLP DH R+G  V+DLF S++++T+P F+E+L S       +PP+ C+I
Sbjct  65    PYLFHFQTISDGLPPDHSRSGKDVLDLFLSMSSITRPLFKELLISN------QPPIDCVI  118

Query  449   ADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPL--NGESDMDKLLE  622
             +DG + F ++V +E+ IP + FRT  ASCFW +FC+P +IE+G+LP+    E DM++++ 
Sbjct  119   SDGGLEFTVEVADEVGIPLVYFRTIGASCFWVYFCIPDIIEAGELPIRVEEEEDMERVIT  178

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              V G E  LR RDLPS CR  DLSD    +++  T ++ +A  LILNTFEDLE   L +I
Sbjct  179   KVPGAEGFLRCRDLPSLCRVGDLSDPFLQAIVSTTRKSPKAYALILNTFEDLEGPILGRI  238

Query  803   RKHIPNLYTIGPLHAHLRARVSSSR--GELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             R   P  Y IGP+H  LR ++ + +   E    SSSSLWEEDRSCM WLD QP KSV+YV
Sbjct  239   RTRCPKTYPIGPIHEQLRLKLVNLKTPQESSSSSSSSLWEEDRSCMKWLDLQPPKSVLYV  298

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKG-YM  1144
             +FGS+TV+   + +E WHG++NS + FLW IR  ++   +N    P EL++G  K   +M
Sbjct  299   NFGSITVMKPEELVEIWHGLINSKQKFLWVIRQGTITSIENTSEFPEELVKGGSKGDEFM  358

Query  1145  V--GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
             V  GW  Q+EVL H ++GGFLTHSGWNSTLE+I  G+PMIC P++ADQQVNSR    VWK
Sbjct  359   VLSGWVAQKEVLDHESIGGFLTHSGWNSTLETIVAGVPMICLPYFADQQVNSRFTSEVWK  418

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G+DMKD+C+R  VE+MV ELM  R++EF +C+ +MA+LA  +V+  G S  NL+ L+E+
Sbjct  419   LGLDMKDSCERGVVERMVNELMVERKEEFGRCAAKMAELAGMSVSSDGCSSRNLEDLIEE  478

Query  1499  LKKMK  1513
             ++ M+
Sbjct  479   IRSMR  483



>ref|XP_006373896.1| hypothetical protein POPTR_0016s10010g [Populus trichocarpa]
 gb|ERP51693.1| hypothetical protein POPTR_0016s10010g [Populus trichocarpa]
Length=486

 Score =   492 bits (1266),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 246/483 (51%), Positives = 313/483 (65%), Gaps = 12/483 (2%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             MDQ    HV+  PFP QGHV  ML LAELL H +    TF+NS     RL   TD+   +
Sbjct  1     MDQPVVPHVVFLPFPAQGHVKPMLMLAELLSH-AGFEATFINSNHIQHRLEHSTDIATMY  59

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
               +P F FR+I DGLP+DHPR+G  +  L  +    T+  FR +L +   ++    P TC
Sbjct  60    CRFPKFQFRSIPDGLPSDHPRSGSSISQLLIASRDETRTEFRNLLVNLGQKNGRWEPPTC  119

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             IIADGIM FAID+  EL IP I FRTFSA C W +F + KLIE G++P  G+ DMDK + 
Sbjct  120   IIADGIMSFAIDIAEELTIPVITFRTFSACCTWTYFHLTKLIEEGEVPFQGDVDMDKTIT  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              + G+E  LR RDLPS CR  + +D  F   I  T    RA+GLILNTF+ LE S ++++
Sbjct  180   CIPGLEGTLRYRDLPSICRRKEANDPLFQFFIKETAAMPRASGLILNTFDRLEASMVSKL  239

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSS--LWEEDRSCMAWLDEQPLKSVVYV  976
                   +YT+GPL         S       R+SS+  LW+EDR CM WLD  P +SV+YV
Sbjct  240   GSFFSKIYTLGPLQGLFDTFAESPSA----RTSSNGLLWKEDRGCMTWLDSHPSRSVIYV  295

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMV  1147
             SFGS+  L R+Q LEFWHG+VNSGK FLW IR +S++ +D    +P +L   T ++G +V
Sbjct  296   SFGSLVGLFRDQLLEFWHGLVNSGKPFLWVIRSDSIMEEDGVSEVPLQLKAATEERGCIV  355

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
              WAPQEEVL HPA+GGFLTHSGWNSTLESI  G+PMICWP  ADQQVNSR V  +WK G 
Sbjct  356   DWAPQEEVLAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMIADQQVNSRCVSELWKIGF  415

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKD C+R  +EK+V++LME   DE  K ++  A +AR +V + GSSYSNL +LVED+K 
Sbjct  416   DMKDKCERAVIEKLVRDLME--SDEIVKSTDEFAGMARDSVKEGGSSYSNLQKLVEDIKS  473

Query  1508  MKL  1516
             M L
Sbjct  474   MSL  476



>gb|KDO61155.1| hypothetical protein CISIN_1g037374mg [Citrus sinensis]
Length=463

 Score =   489 bits (1259),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 242/483 (50%), Positives = 322/483 (67%), Gaps = 28/483 (6%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYT-DLHLR  259
             M+++  +HV+IFP P  GHVN ML+LAELL H + I +TFLN+E+ + R++R++ D   R
Sbjct  1     MEKQDPAHVVIFPLPGVGHVNSMLKLAELLSH-AGIKITFLNTEYYYDRVIRHSSDGFSR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             +   P    +T++DGLP DHPRT D+  +L +S+N    P  +EM++  +       PV 
Sbjct  60    YMQIPGLQLKTVTDGLPKDHPRTPDKFTELIDSLNLAIPPLLKEMVTDSN------SPVN  113

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
              IIADG M  AIDV  E+ I  I F T SA  FW+F C+P +I +G+LP+ G  DMD+L+
Sbjct  114   YIIADGYMSHAIDVAREVGISIIYFCTVSACAFWSFHCIPNIIIAGELPIKGTEDMDRLI  173

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              NV GME  LR RDLPSFCR  +  D   L     T  + RA GLILNTFEDLE      
Sbjct  174   TNVTGMEGFLRCRDLPSFCRVNNPMDLQLLLFARETRLSVRAGGLILNTFEDLEGPIF--  231

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
                       IGPL+AHL+ R+          SSS LW+ DRSC+AWLD+QP +SV+YVS
Sbjct  232   ----------IGPLNAHLKVRIPEKT-----HSSSGLWKVDRSCIAWLDKQPKQSVIYVS  276

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVG  1150
             FGS+ V++R+Q + F++G+VNS   FLW IRP+ + G D    IP E++E T+++GY+ G
Sbjct  277   FGSVAVMSRDQLIVFYYGLVNSKNGFLWVIRPDLISGKDGESQIPEEVVEATKERGYIAG  336

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQEEVL H AVGGFL H GWNSTLESI  G+PMICWP +ADQQ+NSR V  VWK G+D
Sbjct  337   WVPQEEVLAHKAVGGFLIHCGWNSTLESIMAGMPMICWPSFADQQINSRFVDEVWKLGLD  396

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             +KD  DR  VEK V +LM  R++EF + +++MA LA+K+V + GS Y NLDRLV+D+K M
Sbjct  397   IKDLFDRNIVEKAVNDLMVKRKEEFMESADQMANLAKKSVNEGGSLYCNLDRLVKDIKMM  456

Query  1511  KLQ  1519
              L+
Sbjct  457   SLR  459



>ref|XP_011000049.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Populus 
euphratica]
Length=486

 Score =   488 bits (1257),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 242/483 (50%), Positives = 312/483 (65%), Gaps = 12/483 (2%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             MDQ    HV+  PFP QGHV  ML LAELL  ++    TF+NS     RL   T++   +
Sbjct  1     MDQPVVPHVVFLPFPAQGHVKPMLMLAELL-SQAGFEATFINSNHIQDRLEHSTNIATMY  59

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
               +P F FR+I DGLP+DHPR+G  +  L  S    T+  FR +L +   ++    P TC
Sbjct  60    GRFPKFQFRSIPDGLPSDHPRSGSSISQLLISNRDETRTEFRNLLVNLGQKNGRWEPPTC  119

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             IIADGIM FAID+  EL IP I FRTFSA C W +F + KLIE G+ P  G+ DMDK + 
Sbjct  120   IIADGIMSFAIDIAEELTIPVITFRTFSACCTWTYFHLTKLIEEGEFPFQGDVDMDKTIT  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              + G+E  LR RDLP  CR  + +D      I  T    RA+GLILNTF+ LE S ++++
Sbjct  180   CIPGLEGTLRCRDLPGICRLKEANDPLLQFFIKETAAMPRASGLILNTFDGLEASMVSKL  239

Query  803   RKHIPNLYTIGPLHAHLR--ARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
                   +YT+GPL       A+  S+R       +  LW+EDR C+ WLD  P +SV+YV
Sbjct  240   GSFFSKIYTLGPLQGLFDTFAKSPSARTSF----NGLLWKEDRGCITWLDSHPSRSVIYV  295

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMV  1147
             SFGS+  L R+Q LEFWHG+VNSGK FLW +R +S+IG+D    +P EL   T ++G +V
Sbjct  296   SFGSLVGLFRDQLLEFWHGLVNSGKPFLWVLRSDSIIGEDGVSEVPLELKAATEERGCIV  355

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
              WAPQEEVL HPA+GGFLTHSGWNSTLESI  G+PMICWP  ADQQVNSR V  +WK G 
Sbjct  356   DWAPQEEVLAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMLADQQVNSRCVSELWKTGF  415

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKD C+R  +EK+V++LME   DE  K ++ +A +AR +V + GSSYSNL +L+ED+K 
Sbjct  416   DMKDKCERAVIEKLVRDLME--SDEIVKATDEIAGMARDSVKEGGSSYSNLQKLIEDIKS  473

Query  1508  MKL  1516
             M L
Sbjct  474   MSL  476



>gb|AGZ84549.1| glycosyltransferase KGT31 [Pueraria montana var. lobata]
Length=479

 Score =   488 bits (1255),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 252/478 (53%), Positives = 326/478 (68%), Gaps = 12/478 (3%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             + +HV++FP PV+G+VN ML+LA+LL      HVTFLN+E  H R  R+  +     +YP
Sbjct  2     AKAHVVLFPGPVKGNVNSMLKLAQLLALHD-FHVTFLNTENNHHRFHRFGHIEALSQTYP  60

Query  275   NFYFRTISDGLPADHPRTGDR-VVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIA  451
                F+TI DGLP  HPR+GD  +VDL+ S+N+  KP  RE+L S   Q+  +P VTC+I 
Sbjct  61    TLQFKTIPDGLPHHHPRSGDHALVDLYASMNSHAKPLLREILLS---QTPQKPRVTCLIG  117

Query  452   DGIMCFAIDVGN-ELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENV  628
             DG +         E+ IP I F     S FWA FC P L +S +LP+ GE DMD+++  +
Sbjct  118   DGFLAALAADVADEVGIPLIHFFAIGVSSFWALFCAPNLFQSNELPIRGEEDMDRIITTL  177

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFL-SVILATLRTTRANGLILNTFEDLEESALAQIR  805
              GMEN+LR RDLPSF R  +      L S +  + +T  A GLILNTFED++   L+QIR
Sbjct  178   PGMENLLRCRDLPSFYRGAESHMVDPLKSKVFESHQTLGARGLILNTFEDIDGPVLSQIR  237

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
               IP ++ +GPLHAHL +R  S     P  S+SS WE DR C+ WLD QPLKSV+YVSFG
Sbjct  238   LKIPQVFAVGPLHAHLNSRRVSDAKTTP--STSSFWEVDRGCLTWLDSQPLKSVIYVSFG  295

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVGWA  1156
             S+T LTR + LEFW+G+V+S K FLW +RP+ V G +N   IP EL EGT+++G MVGWA
Sbjct  296   SITTLTRERLLEFWYGLVDSKKRFLWVVRPDMVAGKENDGRIPEELEEGTKERGLMVGWA  355

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEE L H A+GGFLTHSGWNSTLES+  G+PMICWP++ADQQVNSR V  VWK G+DMK
Sbjct  356   PQEEALAHKAIGGFLTHSGWNSTLESLVAGVPMICWPYFADQQVNSRFVNEVWKLGLDMK  415

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             D CDR  VE MV +LM  RRDEF + +  MA LA K+V+  GSSYS+LD+L++ +K +
Sbjct  416   DVCDRHVVENMVNDLMVHRRDEFLRSAQAMAMLAHKSVSPSGSSYSSLDQLIQYIKSI  473



>ref|XP_008785471.1| PREDICTED: UDP-glycosyltransferase 85A4-like [Phoenix dactylifera]
Length=481

 Score =   487 bits (1254),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 248/475 (52%), Positives = 320/475 (67%), Gaps = 18/475 (4%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             +R   HVL+FPFP QG VNCML+LA+LL   + + VTFLN+   H+ L R++  H R + 
Sbjct  5     RRKEVHVLVFPFPGQGMVNCMLKLADLLSG-AGLLVTFLNTHHNHRHLSRFSGAHTRLAQ  63

Query  269   YPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREML-SSGSLQSSGRPPVTCI  445
              P F F +I DGL  +  R+     DL  S+       FR++L +     S G PPVTC+
Sbjct  64    RPKFRFASIPDGLSEEETRSVFNFFDLEESMRTRAAASFRDLLIAYRDKDSGGWPPVTCV  123

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
             IADG+M FA+DV  E+ IP I+FRT SA C WAF CVPKL+E+G++P    +D+D+ +  
Sbjct  124   IADGLMPFAVDVSEEVGIPAIIFRTISACCVWAFLCVPKLLENGEIPFPEGADLDEPVRG  183

Query  626   VEGMENVLRLRDLPSFCRTT-DLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
             V GME+ LR RDLPSFCR   D +DR    V   T    RA  LILNTFE LE SAL+ I
Sbjct  184   VPGMESFLRRRDLPSFCRQARDHTDRELQVVSSVTASANRARALILNTFESLEGSALSHI  243

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSF  982
             R + P  Y +GPL+A   AR SS  G        SLW+EDR CM WLD QP +SVVYVSF
Sbjct  244   RNNSPVTYAVGPLNA--LARTSSDSG--------SLWQEDRDCMTWLDSQPDRSVVYVSF  293

Query  983   GSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSV----IGDDNIPAELIEGTRKKGYMVG  1150
             GS+ V+TR +F+EFWHG+V+SG+ FLW +R + +     G + +PAE+ EGTR++G MVG
Sbjct  294   GSLAVVTREEFMEFWHGLVDSGQRFLWVVRSDLINRRGGGTEVLPAEVEEGTRERGCMVG  353

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL HPAVG FLTHSGWNSTLESI  G PM+CWPF+ADQQ+NSR V AVW  G+D
Sbjct  354   WAPQEEVLSHPAVGCFLTHSGWNSTLESIAAGKPMLCWPFFADQQINSRFVSAVWGIGLD  413

Query  1331  MKDTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLV  1492
             MKD C R  VEKMV+E+ME  R +E  + +  MA++A+K+V + G+S++    L+
Sbjct  414   MKDLCGRSIVEKMVREVMEGERSEELRRNAREMAEMAKKSVAEGGTSFNEFQSLI  468



>ref|XP_011014019.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Populus euphratica]
Length=496

 Score =   486 bits (1251),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 238/484 (49%), Positives = 315/484 (65%), Gaps = 12/484 (2%)
 Frame = +2

Query  80    TMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             TMDQ    HV+  PFP QGHV  ML LAELL  ++    TF+NS     RL    ++   
Sbjct  10    TMDQPVVPHVVFLPFPAQGHVKPMLMLAELL-SQAGFEATFINSNHIQHRLEHSINIATM  68

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             +  +P F FR+++DGLP+DHPR+   +V L  S    T+  FR +L +   ++    P T
Sbjct  69    YRRFPKFQFRSVTDGLPSDHPRSSSSIVQLLISARDETRTEFRNLLVNLGQKNGRWEPPT  128

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADGIM FAID+  EL IP I FRTFSA C W +F + KLIE G++P  G+ DMDK +
Sbjct  129   CIIADGIMSFAIDIAEELTIPVITFRTFSACCTWTYFHLTKLIEQGEVPFQGDVDMDKTI  188

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
               + G+E  LR RDLP  CR  + +D      I  T    RA G+ILNTF+ LE S +++
Sbjct  189   TCIPGLEGTLRCRDLPGICRLKEANDPLLQFFIKETAAMPRAYGVILNTFDGLEASMVSK  248

Query  800   IRKHIPNLYTIGPLHAHLR--ARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVY  973
             +      +YT+GPL       A+  S+R       +  LW+EDR C++WLD  P +SV+Y
Sbjct  249   LGSFFSKIYTLGPLQGLFDTFAKSPSARTSF----NGLLWKEDRGCISWLDFHPSRSVIY  304

Query  974   VSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYM  1144
             VSFGS+  L R+Q LEFWHG+VNSGK FLW +R +S++G+D    +P EL   T ++G +
Sbjct  305   VSFGSLVCLVRDQLLEFWHGLVNSGKPFLWVLRSDSILGEDGVSEVPLELKAATEERGCI  364

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             V WAPQEEVL HPA+GGFLTHSGWNSTLESI  G+PMICWP +ADQQVNSR V  +WK G
Sbjct  365   VDWAPQEEVLAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMFADQQVNSRCVSELWKIG  424

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
              DMKD C+R  +EK+V++LME   DE  K ++  A++AR +V + GSSYSNL +L+ED+K
Sbjct  425   FDMKDKCERAVIEKLVRDLME--SDEIVKSTDEFARMARDSVKEGGSSYSNLQKLIEDIK  482

Query  1505  KMKL  1516
              + L
Sbjct  483   SISL  486



>ref|XP_010666049.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=516

 Score =   486 bits (1250),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 334/503 (66%), Gaps = 31/503 (6%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHES-SIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNF  280
             H+LIFP P+QG VN ML+LAELL   + +IH TFL ++  + +L+       RF   P F
Sbjct  15    HILIFPLPMQGPVNSMLKLAELLILSADNIHATFLTTDVVYHQLIVSARAKERFDRNPRF  74

Query  281   YFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR-----------  427
              FRT SDGLP DHPR GD+ +++ +++ AV+ P  RE++SSG   +S             
Sbjct  75    SFRTFSDGLPNDHPRGGDKFLEMLDAVKAVSHPIVREIVSSGDTHTSSSETNQTLEVVLS  134

Query  428   PPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM  607
             P VTCI++DG+  FA+DVGNE+ IP   F T S SC W + C+PKL+E+G++P    SD+
Sbjct  135   PLVTCIVSDGLYNFALDVGNEVGIPVFYFETMSPSCLWVYLCLPKLVEAGEVPFTENSDL  194

Query  608   DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRT-TRANGLILNTFEDLEE  784
             D LL NV GM+  LR RDLP FCR  D +D   L  +L  ++   RA G+ILNTFEDL+ 
Sbjct  195   DALLVNVPGMDGYLRRRDLPDFCRARDATDDIMLQRVLGQVQQMQRAQGIILNTFEDLDS  254

Query  785   SALAQIRKH--IPNLYTIGPLHAHLRARV-----SSSRGELPWRSSSSLWEEDRSCMAWL  943
               L+ +R H  IP +YTIGPLH+ L+ R+     SS++  +    S+SLW+EDR+CMAWL
Sbjct  255   HLLSYMRSHCSIP-IYTIGPLHSSLKERLQANALSSNQPFVYSDHSNSLWQEDRNCMAWL  313

Query  944   DEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG-DDN-------  1099
             D+QPL+SV++ SFGS  V+T+ Q  EF HG+V+S   FLW  RP SVIG ++N       
Sbjct  314   DKQPLRSVIFCSFGSQVVITKEQLTEFLHGLVDSKTLFLWMNRPGSVIGLEENYEMLEKQ  373

Query  1100  --IPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFY  1273
               +  +L++G +K G +V W PQ EVL HPA+GGFLTH GWNS +ES+  G+PM+CWP Y
Sbjct  374   VLMHGDLLKGIKKNGCIVSWVPQVEVLSHPAIGGFLTHGGWNSVIESVVAGVPMVCWPHY  433

Query  1274  ADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVT  1453
              DQ VNSRL   VWK GVD+KD+C+R  VEK+V+++M +RRDE  + + +MA LA  +V 
Sbjct  434   VDQLVNSRLATEVWKLGVDIKDSCNRAIVEKVVRDIMCLRRDELLENATKMANLASTSVQ  493

Query  1454  QHGSSYSNLDRLVEDLKKMKLQL  1522
             + G+SY ++  L++D++ +  Q+
Sbjct  494   KGGTSYESMKNLIKDMESLTSQI  516



>ref|XP_010923184.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   484 bits (1246),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 243/482 (50%), Positives = 319/482 (66%), Gaps = 8/482 (2%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M +   +HVL+ PFP QGHV  ML+ AELL H + + VTF+N++  H+R L  +    R 
Sbjct  1     MTEGGEAHVLVSPFPAQGHVPPMLKFAELLAH-AGLRVTFVNTDNIHRRFLASSPALQRL  59

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
             +  P F FRTI DG P DHPR     +DL  S+   ++  +RE+L        G PPV+C
Sbjct  60    AGLPRFRFRTIPDGFPEDHPRPFLEFLDLEESLRTRSREHYRELLVPTDPDPDGWPPVSC  119

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD--MDKL  616
             ++ADG++  A +V  E+ IP I FRT  A   WA+ CVP LIE G +P   E +  +D+ 
Sbjct  120   VVADGMLRLASEVAAEMEIPLIFFRTSGAGAVWAYLCVPDLIEGGVIPFPAEEEDGLDET  179

Query  617   LENVEGMENVLRLRDLPSFCRTTD-LSDRGFLSVILATLRTTRANGLILNTFEDLEESAL  793
             +  V GME  LR RDLPSFCR     SDR  L V  A     R  GLILNTFE LE   L
Sbjct  180   IRGVPGMEGFLRRRDLPSFCRNAKSTSDRPLLFVTNANANVRRGRGLILNTFESLEGPVL  239

Query  794   AQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRS-SSSLWEEDRSCMAWLDEQPLKSVV  970
             + IR  IPN+Y +GPLH   RA        +P+ S S+SLW+EDRSC+ WLD QP +SVV
Sbjct  240   SHIRSAIPNIYALGPLHLLSRA-FGDCGANVPFSSNSTSLWQEDRSCLKWLDSQPQRSVV  298

Query  971   YVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD-DNIPAELIEGTRKKGYMV  1147
             Y+SFGS+TV++R++ +EFWHG+V+SGK FLW +RP+ V G  +    EL + TR++G +V
Sbjct  299   YISFGSVTVMSRDELMEFWHGLVDSGKRFLWVVRPDLVEGKIEEAMQELEKETRERGCVV  358

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GWAPQEEVL HPAVG FLTHSGWNSTLES+  G+PMICWPF+ADQQVNSRLVG VW+ G+
Sbjct  359   GWAPQEEVLAHPAVGCFLTHSGWNSTLESVAAGVPMICWPFFADQQVNSRLVGEVWRIGL  418

Query  1328  DMKDTCDRITVEKMVKELMEV-RRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             DMKD  +R  VE+MV+E+ME  R +E  + +  MA+ AR+++ + GSSY   + LVE +K
Sbjct  419   DMKDKHERSVVERMVREVMEGDRAEELRRSAGEMAEHARRSIEEGGSSYRGFENLVEHIK  478

Query  1505  KM  1510
              +
Sbjct  479   AI  480



>ref|XP_007009137.1| UDP-glucosyltransferase family 1 protein, putative [Theobroma 
cacao]
 gb|EOY17947.1| UDP-glucosyltransferase family 1 protein, putative [Theobroma 
cacao]
Length=460

 Score =   483 bits (1242),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 242/488 (50%), Positives = 323/488 (66%), Gaps = 49/488 (10%)
 Frame = +2

Query  92    RSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSY  271
             ++  HVLIFP P+QGHVN M +LAELL   +   VTFLNSE  H RL+++T++   F+ Y
Sbjct  8     KACPHVLIFPLPLQGHVNSMFKLAELLAL-TGFKVTFLNSEHNHGRLVKHTNISAHFARY  66

Query  272   PNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIA  451
             P F FRT+ DGLP DHPR+G+  ++++ ++    K   REML + +      PPV CII 
Sbjct  67    PGFEFRTVPDGLPDDHPRSGNWFLEMYYAMETKAKLSLREMLLNIN------PPVDCIIG  120

Query  452   DGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLP--------LNGESDM  607
             DG + F +DV  EL IP    RT SA CFWA++ +P +I++G++P        L G  DM
Sbjct  121   DGFLGFVLDVAKELGIPVFYCRTSSACCFWAYYSIPDIIQAGEIPIKGVFVKKLKGIEDM  180

Query  608   DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEES  787
             D+L+  V GME  LR RDLPSFCR +D+++     V+  T ++ +A+ LILNTFEDL+  
Sbjct  181   DRLITTVPGMETFLRCRDLPSFCRASDMANSTIQLVVKQTRKSPQAHALILNTFEDLDRP  240

Query  788   ALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
              L+ IR   P++YTIGP+HA L  R+  ++     + S+SLWEEDR+C++WLD+QP +SV
Sbjct  241   ILSHIRTKCPHVYTIGPIHALLNTRL-KAQCVASSQFSNSLWEEDRNCISWLDKQPKQSV  299

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD----NIPAELIEGTRKK  1135
             VYV F                             RPNSV G D    ++P EL+EGT+++
Sbjct  300   VYVKF-----------------------------RPNSVTGKDGQGEDVPVELLEGTQER  330

Query  1136  GYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVW  1315
             G +VGWAPQEEVL H AVGGFLTHSGWNSTLES+  G+PMICWP++ADQQVNSR V  VW
Sbjct  331   GCIVGWAPQEEVLNHSAVGGFLTHSGWNSTLESVVAGVPMICWPYFADQQVNSRFVSEVW  390

Query  1316  KNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
             K G+DMKD CDR  VEKMV +LM  +R+EF K +  MAKLA+++V   GSSY NLDRL+E
Sbjct  391   KLGLDMKDVCDRKAVEKMVNDLMMDKREEFVKSAAEMAKLAKESVNVGGSSYCNLDRLIE  450

Query  1496  DLKKMKLQ  1519
             D++ M L+
Sbjct  451   DIRLMSLK  458



>ref|XP_006362115.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=489

 Score =   483 bits (1244),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 235/481 (49%), Positives = 328/481 (68%), Gaps = 13/481 (3%)
 Frame = +2

Query  83    MDQRSS--SHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             MD ++S    VLIFP P+Q  +N  L+LAELLC  + + VTFLN+    QRL+  +++  
Sbjct  1     MDHQTSITPPVLIFPLPLQSTINSNLQLAELLCL-AGLRVTFLNTNHNQQRLVGNSNVES  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
             RF  YP F F T+SDGLP DHPR+ ++  D+ +S+  + +P  ++MLS+       + PV
Sbjct  60    RFKQYPGFRFLTLSDGLPDDHPRSVEQFGDILSSLQTMAEPLLKQMLSALV-----KEPV  114

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TC+I DG+  + +D+GNE+ +P I F T S SCFW +  +PKLIE+G LP  G +D+D L
Sbjct  115   TCVILDGLFYYGVDIGNEMGVPVITFDTISPSCFWIYLSLPKLIEAGVLPFKG-NDLDAL  173

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             + ++  ME +LR RDLP FC     +D+   +V     R  +A+GLILN+FEDL+   L+
Sbjct  174   VTHLPAMEGLLRRRDLPHFCLLDYKTDQNSQAVFKEIERLPKAHGLILNSFEDLDGPFLS  233

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              +R + P  Y IGPL  +L++R+++    L   SS+SLWEED + + WL+ Q   SV+YV
Sbjct  234   SVRSYFPKTYAIGPLPLNLKSRLAAKATPL-LSSSNSLWEEDHTSIKWLNAQSNGSVIYV  292

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD---DNIPAELIEGTRKKGYMV  1147
             SFGS+ V++R++ +EFWHG++NS   FLW +RPN + GD   D    EL+EG++  GY+V
Sbjct  293   SFGSLLVVSRDEMMEFWHGLMNSKVKFLWVMRPNMLKGDVSRDQFMKELVEGSKGIGYIV  352

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
              WAPQ+ VL HP+VGGFLTHSGWNSTLESI EG PMICWP Y DQ+V SRLV   WK G+
Sbjct  353   SWAPQKMVLAHPSVGGFLTHSGWNSTLESIIEGKPMICWPQYVDQRVTSRLVNEFWKIGL  412

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKD CDR  VEKMVK+LME ++DE+ K   +++KLA+ +V + G SYSNLD L+ D+K 
Sbjct  413   DMKDICDRFVVEKMVKDLMETKKDEYKKSVEKLSKLAKLSVQEGGLSYSNLDCLINDIKG  472

Query  1508  M  1510
             +
Sbjct  473   L  473



>ref|XP_003517692.2| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=505

 Score =   484 bits (1245),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 248/485 (51%), Positives = 325/485 (67%), Gaps = 12/485 (2%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             ++ + +HV IFP P QGHV+ ML+LA+LL      H+TFLN++F H RL R+ DL     
Sbjct  26    EETTDTHVAIFPCPAQGHVSTMLKLAQLLALHG-FHITFLNTDFIHHRLHRFGDLEALLQ  84

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             +YP+  F+T  DGLP  HPR+G   VDLF  IN   KP  R +L S   Q  G+P + C 
Sbjct  85    TYPSLQFKTFPDGLPHHHPRSGQSAVDLFQYINLHAKPHIRHILLS---QDPGKPKINCF  141

Query  446   IADGIM-CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             IADG+     IDV +++ IP I FRT SASCFW +FCVP L +S  LP+ G+ DMD+++ 
Sbjct  142   IADGVFGALTIDVAHQVGIPIIHFRTISASCFWTYFCVPNLFQSNQLPITGDEDMDRVIT  201

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFL-SVILATLRTTRANGLILNTFEDLEESALAQ  799
              + GMEN+ R RDLPSF R T       L S+ L T  + +A  LILNTFEDLE S L+Q
Sbjct  202   CIPGMENMFRCRDLPSFSRGTGSEIVYALNSLALETRESLQARALILNTFEDLEGSVLSQ  261

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             +R   P ++TIGPLHAHL  R  S+    P  S+S + E DR CM WLD QPLKSV+YVS
Sbjct  262   MRLQFPRVFTIGPLHAHLNTRKESNTETTP--STSCVGEVDRRCMTWLDSQPLKSVIYVS  319

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVG  1150
             FGS+  +TR + +E W+G+VNS K FLW +RP+ V   +N   +PAEL EGT+++G++VG
Sbjct  320   FGSIATMTREKLIEIWYGLVNSKKRFLWVVRPDMVGPKENGDRVPAELEEGTKERGFIVG  379

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL H A+GGFLTHSGWNSTLES+  G+PMIC P + DQ VNSR V  V K G+D
Sbjct  380   WAPQEEVLAHKAIGGFLTHSGWNSTLESLAAGVPMICCPSFGDQHVNSRFVSEVCKVGLD  439

Query  1331  MKD-TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             MKD  CDR  VE MV +LM+ R + F   +  +A LA ++V+  GSSYSNLD L++ ++ 
Sbjct  440   MKDVACDRNLVENMVNDLMDHRNEVFLNSAREVALLANRSVSSGGSSYSNLDGLIQYIRS  499

Query  1508  MKLQL  1522
             +  ++
Sbjct  500   ISQEI  504



>ref|XP_009589441.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=477

 Score =   482 bits (1241),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 235/475 (49%), Positives = 317/475 (67%), Gaps = 19/475 (4%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             SSHVL+FP P+Q  +N ML LAEL C  + + VTFLN+    + LLR+T++  RF  YP 
Sbjct  5     SSHVLLFPLPIQSPINSMLHLAELFCL-AGLQVTFLNTNHNQKLLLRHTNVESRFRQYPR  63

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADG  457
             F FRTISDGLP ++PR+  +  +L +S+ AV +P  RE+L S S      PPVTC+I DG
Sbjct  64    FRFRTISDGLPEENPRSSVQFGELISSLQAVAEPFLREILLSSSSDGVTEPPVTCVIPDG  123

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGM  637
             +  +A+D+GNE+ +P I F T S  C W + C+PKLI++ ++P               GM
Sbjct  124   LFYYAVDIGNEIGVPVIPFDTISPCCLWVYLCIPKLIQAEEIPFKA------------GM  171

Query  638   ENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTT-RANGLILNTFEDLEESALAQIRKHI  814
             + +LR RD P F R  D +   +  + L  + +  R+NGLILNTFEDL+   L+ IR H 
Sbjct  172   QGLLRRRDFP-FYRLIDYATDPYCQIALKEVESIPRSNGLILNTFEDLDGPLLSLIRSHC  230

Query  815   PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMT  994
                Y IGPLH HL+ +++  R  +   SS+SLWEED S + WLD QP++SV+YVSFGSM 
Sbjct  231   QQTYAIGPLHLHLKTKLAEKRMPIS-ASSNSLWEEDHSSIQWLDAQPIESVIYVSFGSMA  289

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVGWAPQE  1165
              L++ + LEFWHG+VNSG  FLW +R N + G+++      EL EG  ++ Y+V WAPQE
Sbjct  290   TLSKEEILEFWHGLVNSGIRFLWVMRSNLLRGEESNHQFVKELAEGCIERAYIVSWAPQE  349

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL H A+GGFLTHSGWNST+ESI +G PMICW  Y DQ+V SR VG VWK GVDMKD C
Sbjct  350   KVLAHSAIGGFLTHSGWNSTMESIVQGKPMICWAVYVDQRVTSRFVGEVWKIGVDMKDIC  409

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             DR  +EKMVK+LM   RDEF K + +++ LA+++V   GSSY+ L  LV+D+KK+
Sbjct  410   DRYIIEKMVKDLMVTNRDEFKKSAEKLSNLAKESVGDGGSSYNALQCLVDDVKKL  464



>gb|KHN04919.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   482 bits (1241),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 250/488 (51%), Positives = 327/488 (67%), Gaps = 15/488 (3%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             ++ + +HV IFP P QGHV+ ML+LA+LL      H+TFLN++F H RL R+ DL     
Sbjct  4     EETTDTHVAIFPCPAQGHVSTMLKLAQLLALHG-FHITFLNTDFIHHRLHRFGDLEALLQ  62

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             +YP   F+T  DGLP  HPR+G   VDLF SIN   KP  R +L S   Q  G+P + C 
Sbjct  63    TYPALQFKTFPDGLPHHHPRSGQSAVDLFQSINLHAKPHIRHILLS---QDPGKPKINCF  119

Query  446   IADGIM-CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             IADG+     IDV +++ IP I FRT SASCFW +FCVP L +S  LP+ G+ DMD+++ 
Sbjct  120   IADGVFGALTIDVAHQVGIPIIHFRTISASCFWTYFCVPNLFQSNQLPITGDEDMDRVIT  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFL-SVILATLRTTRANGLILNTFEDLEESALAQ  799
              + GMEN+ R RDLPSF R T       L S+ L T  + +A  LILNTFEDLE S L+Q
Sbjct  180   CIPGMENMFRCRDLPSFSRGTGSEIVYALNSLALETRESLQARALILNTFEDLEGSVLSQ  239

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             +R   P ++TIGPLHAHL  R  S+    P  S+S + E D+ CM WLD QPLKSV+YVS
Sbjct  240   MRLQFPRVFTIGPLHAHLNTRKESNTETTP--STSCVGEVDQRCMTWLDSQPLKSVIYVS  297

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKA---FLWAIRPNSVIGDDN---IPAELIEGTRKKGY  1141
             FGS+  +TR + +E W+G+VNS K    FLW +RP+ V+G +N   IPAEL EGT+++G+
Sbjct  298   FGSIATMTREKLIEIWYGLVNSKKRKNRFLWVMRPDLVVGKENGDWIPAELEEGTKERGF  357

Query  1142  MVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKN  1321
             +VGWAPQEEVL H A+GGFLTHSGWNSTLES+  G+PMIC P + DQ VNSR V  V K 
Sbjct  358   IVGWAPQEEVLAHKAIGGFLTHSGWNSTLESLAAGVPMICCPSFGDQHVNSRFVSEVCKV  417

Query  1322  GVDMKD-TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
             G+DMKD  CDR  VE MV +LM+ R + F   +  +A LA ++V+  GSSYSNLD L++ 
Sbjct  418   GLDMKDVACDRNLVENMVNDLMDHRNEVFLNSAREVALLANRSVSSGGSSYSNLDGLIQY  477

Query  1499  LKKMKLQL  1522
             ++ +  ++
Sbjct  478   IRSISQEI  485



>emb|CAN68538.1| hypothetical protein VITISV_039646 [Vitis vinifera]
Length=450

 Score =   481 bits (1238),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 255/480 (53%), Positives = 318/480 (66%), Gaps = 38/480 (8%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQ   S HVLIFPFP QGHVN ML+LAELL   + +HVTFLNSE+   RLL +TD+  R
Sbjct  1     MDQGPVSPHVLIFPFPAQGHVNSMLKLAELLS-VAGLHVTFLNSEYNQHRLLLHTDIQTR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             FS YP F F+TISDGL  DHPRTG+RV+DLF  + A  KP FRE++ S    S   PPV 
Sbjct  60    FSXYPGFRFQTISDGLTTDHPRTGERVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVN  119

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADGIM F ID+ NE+ IP I FRT SA  FWA+F   KLIESG+LPL G +DMD+L+
Sbjct  120   CIIADGIMSFTIDIANEVGIPIISFRTISACSFWAYFSALKLIESGELPLKG-NDMDQLV  178

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              ++ GME  LR RDLPS  R ++L D   L V   T +T RA+ LILNTFEDLE   L Q
Sbjct  179   TSIPGMEGFLRKRDLPSLIRVSNLDDEXLLLVTKETQQTPRAHALILNTFEDLEGPILGQ  238

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P  YTIGPLHAHL  R++S       +SS+SL +EDRSC+AWL+ QP KSV+YVS
Sbjct  239   IRNHCPKTYTIGPLHAHLETRLASE--STTSQSSNSLRQEDRSCIAWLNRQPSKSVIYVS  296

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVG  1150
             FGS+TV+TR Q +EF +G+ NSG  FLW IR +S+    G+   PAEL+EG +++ Y+ G
Sbjct  297   FGSVTVITRKQLIEFCYGLENSGSRFLWVIRTDSLAEEDGERQTPAELLEGAKERSYIRG  356

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
                         VG   T  G ++                  +QQ+NSR V  VWK G D
Sbjct  357   ------------VGS--TRRGSSAP----------------GNQQINSRFVSHVWKLGSD  386

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR+ VEKMV++LME R+DE  K +++MA  ARK V++ GSS  NL  L+E+++ M
Sbjct  387   MKDTCDRLIVEKMVRDLMEERKDELLKTADKMATRARKCVSEGGSSXCNLSSLIEEIRLM  446



>ref|XP_004235101.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   482 bits (1240),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 231/474 (49%), Positives = 321/474 (68%), Gaps = 11/474 (2%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             + HVLIFP P+Q  +N  L+LAELLC  + + V+FLN+    QRL+  +++  RF  Y  
Sbjct  7     TPHVLIFPLPLQSTINSNLQLAELLCL-AGLRVSFLNTNHNQQRLVANSNVESRFKQYTG  65

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADG  457
             F F TISDGLP D+PR+G++  D+ +S+  + +P  ++MLS        + P+TC+I DG
Sbjct  66    FQFLTISDGLPEDNPRSGEQFGDIISSLQTMAEPYLKQMLSGLV-----KEPITCVILDG  120

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGM  637
             +  + +D+GNE+ +P ++F T S SCFW +  +PKLIE+G LP  G +D+D L+ +V  M
Sbjct  121   LFYYGVDIGNEMGVPVVIFDTISPSCFWIYLSLPKLIEAGVLPFKG-NDIDALVTHVPAM  179

Query  638   ENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIP  817
             E  LR RDLP FC      D+   +V     R  +A+GLILN+FE+L+   L  IR + P
Sbjct  180   EGFLRRRDLPHFCLLDYKIDQNSQAVFKEIERIPKAHGLILNSFEELDGPFLYNIRSYFP  239

Query  818   NLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTV  997
               Y IGPL  +L+ R+++    L   SS+S+WEED + + WLD Q   SV+YVSFGS+ V
Sbjct  240   KTYAIGPLPLNLKTRLAAKATPL-LSSSNSMWEEDHTSIKWLDAQSKGSVIYVSFGSLVV  298

Query  998   LTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD---DNIPAELIEGTRKKGYMVGWAPQEE  1168
             ++R++ +EFWHG++NS   FLW +RPN + GD   D    EL+EG +  GY+V WAPQE 
Sbjct  299   VSRDEIMEFWHGLMNSKVKFLWVMRPNMLKGDASHDQFMKELVEGCKGIGYIVSWAPQEM  358

Query  1169  VLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCD  1348
             VL HP+VGGFLTHSGWNSTLESI EG PMICWP Y DQ+V SRLV   WK G+DMKD CD
Sbjct  359   VLAHPSVGGFLTHSGWNSTLESIIEGKPMICWPQYVDQRVTSRLVNEFWKIGLDMKDICD  418

Query  1349  RITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             R  VEK+VK+LME ++DE+TK   ++++LA+ +V + G SYSNLD L+ D+K +
Sbjct  419   RFVVEKLVKDLMETKKDEYTKSVEKLSELAKLSVEEGGLSYSNLDCLINDIKGL  472



>dbj|BAK55741.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=493

 Score =   482 bits (1240),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 240/483 (50%), Positives = 328/483 (68%), Gaps = 10/483 (2%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             S+ HVL+FP P+QG VNCML+LAELLC  + + VTFLN++   +RLL  TD+  RF  Y 
Sbjct  9     STPHVLLFPLPLQGPVNCMLKLAELLCF-NHLQVTFLNTDHVQRRLLSCTDVSSRFKRYA  67

Query  275   -NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG-RPPVTCII  448
              +F F T+ DGLPA    TG+++ +L +S+ AV+ P FRE++ S    S G + P+TCII
Sbjct  68    GHFRFETVPDGLPAGKTMTGEQIGELLDSMEAVSLPLFREIVRSSVHVSDGAQNPLTCII  127

Query  449   ADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENV  628
             ADG   FA+D+  E  +  + F T S    W+     +LI++GD P   + D+D  + +V
Sbjct  128   ADGAFGFAVDIAAEFGVALMYFDTISPCGLWSILSANRLIQAGDFPFK-DDDLDAPVTSV  186

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GME  LR RDLPSF R  D +D     V+    +  + +GLI N+FEDLE   L+Q++ 
Sbjct  187   PGMEGFLRRRDLPSFFRIPDQNDPIIQRVLREEQQMKKCHGLIFNSFEDLEGPILSQLKT  246

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSS-SLWEEDRSCMAWLDEQPLKSVVYVSFG  985
              +P +YTIGPLH H + R+ S +G    R+S+ SLW E++SC++WLD QP KSV+YVS G
Sbjct  247   LVPRVYTIGPLHTHKKNRLVSEKGSKNDRNSTNSLWTENKSCISWLDNQPAKSVIYVSIG  306

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG-----DDNIPAELIEGTRKKGYMVG  1150
             S+ ++ + Q LE WHG+ NS   FLW  RP S+ G     D  +P  L   T ++G +V 
Sbjct  307   SLALMGKEQLLEIWHGLANSEVRFLWVQRPGSITGLDEENDGGVPLNLCRATIERGCIVS  366

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL HPAVGGFLTHSGWNSTLESI EG+PMIC P++ADQQ+NSR VG VWK G+D
Sbjct  367   WAPQEEVLAHPAVGGFLTHSGWNSTLESIVEGVPMICLPYFADQQINSRYVGEVWKVGLD  426

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             MKDTCDR  VE MV++LME R+DEF + ++ +AKLA+ +V++ G+SY+ L+ L+ED+K M
Sbjct  427   MKDTCDRDIVEMMVRDLMEKRKDEFLEKADHVAKLAKASVSKGGASYNALNCLIEDIKLM  486

Query  1511  KLQ  1519
              L+
Sbjct  487   SLK  489



>ref|XP_011014018.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Populus euphratica]
Length=498

 Score =   481 bits (1239),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 238/486 (49%), Positives = 315/486 (65%), Gaps = 14/486 (3%)
 Frame = +2

Query  80    TMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             TMDQ    HV+  PFP QGHV  ML LAELL  ++    TF+NS     RL    ++   
Sbjct  10    TMDQPVVPHVVFLPFPAQGHVKPMLMLAELL-SQAGFEATFINSNHIQHRLEHSINIATM  68

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             +  +P F FR+++DGLP+DHPR+   +V L  S    T+  FR +L +   ++    P T
Sbjct  69    YRRFPKFQFRSVTDGLPSDHPRSSSSIVQLLISARDETRTEFRNLLVNLGQKNGRWEPPT  128

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNG--ESDMDK  613
             CIIADGIM FAID+  EL IP I FRTFSA C W +F + KLIE G++P  G  + DMDK
Sbjct  129   CIIADGIMSFAIDIAEELTIPVITFRTFSACCTWTYFHLTKLIEQGEVPFQGPGDVDMDK  188

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESAL  793
              +  + G+E  LR RDLP  CR  + +D      I  T    RA G+ILNTF+ LE S +
Sbjct  189   TITCIPGLEGTLRCRDLPGICRLKEANDPLLQFFIKETAAMPRAYGVILNTFDGLEASMV  248

Query  794   AQIRKHIPNLYTIGPLHAHLR--ARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
             +++      +YT+GPL       A+  S+R       +  LW+EDR C++WLD  P +SV
Sbjct  249   SKLGSFFSKIYTLGPLQGLFDTFAKSPSARTSF----NGLLWKEDRGCISWLDFHPSRSV  304

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI---PAELIEGTRKKG  1138
             +YVSFGS+  L R+Q LEFWHG+VNSGK FLW +R +S++G+D +   P EL   T ++G
Sbjct  305   IYVSFGSLVCLVRDQLLEFWHGLVNSGKPFLWVLRSDSILGEDGVSEVPLELKAATEERG  364

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              +V WAPQEEVL HPA+GGFLTHSGWNSTLESI  G+PMICWP +ADQQVNSR V  +WK
Sbjct  365   CIVDWAPQEEVLAHPAIGGFLTHSGWNSTLESIFAGVPMICWPMFADQQVNSRCVSELWK  424

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G DMKD C+R  +EK+V++LME   DE  K ++  A++AR +V + GSSYSNL +L+ED
Sbjct  425   IGFDMKDKCERAVIEKLVRDLME--SDEIVKSTDEFARMARDSVKEGGSSYSNLQKLIED  482

Query  1499  LKKMKL  1516
             +K + L
Sbjct  483   IKSISL  488



>ref|XP_007158359.1| hypothetical protein PHAVU_002G146200g [Phaseolus vulgaris]
 gb|ESW30353.1| hypothetical protein PHAVU_002G146200g [Phaseolus vulgaris]
Length=482

 Score =   480 bits (1236),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 237/478 (50%), Positives = 323/478 (68%), Gaps = 12/478 (3%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             + +HVLIFP PV  HV  ML+LAELL  E+ +H+TFL ++  H RL R+ D+ +   SYP
Sbjct  2     AEAHVLIFPLPVSAHVASMLKLAELLTLEN-LHITFLTTDTIHGRLTRFGDIQVLSKSYP  60

Query  275   NFYFRTISDGL-PADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIA  451
               +F+T+SD     DHP  GDR+ DL +S     KP  R++L S + Q    P ++C+I 
Sbjct  61    TLHFKTLSDSYDEGDHPGFGDRIWDLISSTTLHAKPFLRDILLSHTPQI---PKLSCVIQ  117

Query  452   DGIM-CFAIDVGNE--LRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             DGI    + DV +E  + IP I FRT SA CFWA+     L+ S +LP+ G+ DMD++++
Sbjct  118   DGIFGSLSADVASEFNVSIPIIQFRTVSACCFWAYISATNLLHSQELPIRGDEDMDRIIK  177

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
             ++ GMEN+LR RDLPSF R     +  F S +  + ++  A+ +I+N+FEDLE   L+QI
Sbjct  178   DIPGMENLLRCRDLPSFFRPDKKGNSTFESYVDRSRQSLAADAIIVNSFEDLEGPVLSQI  237

Query  803   RKHIPNLYTIGPLHAHLRAR-VSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             R H P +YT+GPLH HL  R   S++GE   +  +++++ D +CM WLD QP  SV+YVS
Sbjct  238   RHHFPKVYTVGPLHHHLNTRKAESNKGEDIPKFKNAIFQVDGTCMTWLDAQPEGSVMYVS  297

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKGYMVG  1150
             FGS T++ R   +E WHG+VNS K FLW +RP+ V G   DD IPAE+ EGT+++G++V 
Sbjct  298   FGSSTIVKREDLMEIWHGLVNSKKRFLWVMRPDIVAGKQDDDRIPAEVEEGTKERGFIVE  357

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL H A+GGFLTHSGWNSTLES+  G+PMICWP++ADQQ+NSR V  VWK G+D
Sbjct  358   WAPQEEVLEHKAIGGFLTHSGWNSTLESVVAGVPMICWPYFADQQINSRFVSEVWKVGLD  417

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             MKD CDR  VEKMV +LM  RR+EF   +  MA LA K+V+  GSSYS+    +  +K
Sbjct  418   MKDVCDRDVVEKMVNDLMVHRREEFLNSAKAMATLAHKSVSPGGSSYSSFQDFIHYIK  475



>dbj|BAK55740.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=496

 Score =   481 bits (1237),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 240/485 (49%), Positives = 328/485 (68%), Gaps = 11/485 (2%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             S+ HVL+FP P+QG VNCML+LAELLC  + + VTFLN++   +RLL  TD+  RF  Y 
Sbjct  9     STPHVLLFPLPLQGPVNCMLKLAELLCF-NHLQVTFLNTDHVQRRLLSCTDVSSRFKRYA  67

Query  275   -NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG-RPPVTCII  448
              +F F T+ DGLPA    TG+++ +L +S+ AV+ P FRE++ S    S G + P+TCII
Sbjct  68    GHFRFETVPDGLPAGKTMTGEQIGELLDSMEAVSLPLFREIVRSSVHVSDGAQNPLTCII  127

Query  449   ADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLN--GESDMDKLLE  622
             ADG   FA+D+  E  +  + F T S    W+     +LI++GD P     + D+D  + 
Sbjct  128   ADGAFGFAVDIAAEFGVALMYFDTISPCGLWSILSANRLIQAGDFPFKVYTDDDLDAPVT  187

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
             +V GME  LR RDLPSF R  D +D     V+    +  + +GLI N+FEDLE   L+Q+
Sbjct  188   SVPGMEGFLRRRDLPSFFRIPDQNDPIIQRVLREEQQMKKCHGLIFNSFEDLEGPILSQL  247

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSS-SLWEEDRSCMAWLDEQPLKSVVYVS  979
             +  +P +YTIGPLH H + R+ S +G    R+S+ SLW E++SC++WLD QP KSV+YVS
Sbjct  248   KTLVPRVYTIGPLHTHKKNRLVSEKGSKNDRNSTNSLWTENKSCISWLDNQPAKSVIYVS  307

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG-----DDNIPAELIEGTRKKGYM  1144
              GS+ ++ + Q LE WHG+ NS   FLW  RP S+ G     D  +P  L   T ++G +
Sbjct  308   IGSLALMGKEQLLEIWHGLANSEVRFLWVQRPGSITGLDEENDGGVPLNLCRATIERGCI  367

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             V WAPQEEVL HPAVGGFLTHSGWNSTLESI EG+PMIC P++ADQQ+NSR VG VWK G
Sbjct  368   VSWAPQEEVLAHPAVGGFLTHSGWNSTLESIVEGVPMICLPYFADQQINSRYVGEVWKVG  427

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +DMKDTCDR  VE MV++LME R+DEF + ++ +AKLA+ +V++ G+SY+ L+ L+ED+K
Sbjct  428   LDMKDTCDRDIVEMMVRDLMEKRKDEFLEKADHVAKLAKASVSKGGASYNALNCLIEDIK  487

Query  1505  KMKLQ  1519
              M L+
Sbjct  488   LMSLK  492



>ref|XP_009759439.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=483

 Score =   478 bits (1231),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 236/472 (50%), Positives = 324/472 (69%), Gaps = 14/472 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QG +NC L+LAEL C  S + VTFLN+    +RLLR+T++  RF  YP F 
Sbjct  12    HVLIFPLPIQGPINCKLQLAELFCL-SGLKVTFLNTIHNQERLLRHTNVQSRFEKYPGFR  70

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP +HPR+ ++  D+ +S+  V +P  REML SG+     +  VTC++ D + 
Sbjct  71    FLTIPDGLPDEHPRSFEQFGDIISSVQTVAEPFLREMLRSGA-----KELVTCVVPDALS  125

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              +  D+GNE+ +P I F T S SC W + C+PKLIESG+LP   ++D+D  + ++  +E 
Sbjct  126   YYVADIGNEMGVPVIPFDTLSPSCVWVYMCLPKLIESGELPFK-DNDLDASVTHIPALEG  184

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
             +LR RDLP FC     +D  FL+ +    R  +++GLILNTFEDL+   L+ I  + P  
Sbjct  185   LLRRRDLPPFCLMDYKTDPDFLAALKQVERIPQSHGLILNTFEDLDRPFLSCIHSYSPKT  244

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             Y IGPLH HL+A++SS        SS+SLWEED S + WLD QP+ SV+YVSFGS+ V++
Sbjct  245   YAIGPLHLHLKAKLSSKNAP----SSNSLWEEDHSSIKWLDAQPMGSVLYVSFGSVVVVS  300

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKGYMVGWAPQEEVL  1174
             + + LEF HG++NS   FLW +RPN + G   D     EL EG +  GY+V WAPQ+ VL
Sbjct  301   KEEILEFQHGLLNSKVKFLWVMRPNILKGGESDVQFMKELAEGCKGNGYIVSWAPQKMVL  360

Query  1175  VHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRI  1354
              HPA+ GFLTHSGWNSTLES+ EG PMICWP Y DQ+VNSRLV  +W+ G+DMK  CDR 
Sbjct  361   AHPAIAGFLTHSGWNSTLESVSEGKPMICWPHYVDQRVNSRLVNELWQIGLDMKGICDRS  420

Query  1355  TVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             T+E+M+K+LME++RDE  K    ++KLA+ +V + GSSY+NLD L++D+K++
Sbjct  421   TIERMIKDLMEIKRDELKKSIEELSKLAKLSVEEGGSSYNNLDCLIDDIKEL  472



>ref|XP_003613025.1| UDP-glucuronosyltransferase 1-1 [Medicago truncatula]
 gb|AES95983.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=475

 Score =   478 bits (1230),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 242/476 (51%), Positives = 324/476 (68%), Gaps = 15/476 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTD-LHLRFS  265
             ++SS HVLIFP P QGHVN ML+LAELL  ++ I++TFLN+++ H RL+++ D +     
Sbjct  7     EKSSPHVLIFPCPAQGHVNSMLKLAELLAIQN-IYITFLNTKYIHNRLIQFNDDIQALLE  65

Query  266   SYPNFYFRTISDGLPAD-HPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
              YP   F+TISD    + HP  G+R+ D+  S++   KP  ++++ S          ++C
Sbjct  66    CYPKLQFKTISDFHSEEKHPGFGERIGDVITSLSLYGKPLLKDIIVSEK--------ISC  117

Query  443   IIADGIMC-FAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             II DGI    A D+  E  I  I FRT S+ CFWA+FCVPKL+E  +LP+ G+ DMD+++
Sbjct  118   IILDGIFGDLATDLAAEFGIQLIHFRTISSCCFWAYFCVPKLLECNELPIRGDEDMDRII  177

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              N+ GMEN+LR RDLPSFCR           V L T ++ +AN  ILNTFEDLE S L+Q
Sbjct  178   TNIPGMENILRCRDLPSFCRENKKDHIRLDDVALRTKQSLKANAFILNTFEDLEASVLSQ  237

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P LYTIGPLH HL      S     + S S+ ++ DR+CMAWLD QPLKSV+YVS
Sbjct  238   IRIHFPKLYTIGPLH-HLLNTTKKSSFPSSFFSKSNFFKVDRTCMAWLDSQPLKSVIYVS  296

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRK-KGYMVGWA  1156
             FGS T + R + +E WHG++NS K FLW IRPN ++ +  + +EL EGTRK KG +VGW 
Sbjct  297   FGSTTPMKREEIIEIWHGLLNSKKQFLWVIRPN-MVQEKGLLSELEEGTRKEKGLIVGWV  355

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEEVL H A+G FLTH+GWNSTLES+  G+PMICWP++ADQQ+NSR V  VWK G+DMK
Sbjct  356   PQEEVLSHKAIGAFLTHNGWNSTLESVVCGVPMICWPYFADQQINSRFVSDVWKLGLDMK  415

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             D CDR  VE MV ++M  R++EF + +  +AKLA K+V+  GSSY+N   L++ ++
Sbjct  416   DVCDRKVVENMVNDVMVNRKEEFVRSAMDIAKLASKSVSPGGSSYNNFQDLIQYIR  471



>ref|XP_010923186.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   478 bits (1230),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 242/481 (50%), Positives = 323/481 (67%), Gaps = 21/481 (4%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             +R  +HVL+FPFP QG VNCML+LA+LL   + +HVTFLN+   H+RL +++    R + 
Sbjct  5     RRKEAHVLVFPFPGQGMVNCMLKLADLLSG-AGLHVTFLNTHHNHRRLSQFSGALSRLAQ  63

Query  269   YPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREML-SSGSLQSSGRPPVTCI  445
              P F F +I DGL  +  R+     DL  S+       FR++L +     + G PPVTC+
Sbjct  64    RPKFRFASIPDGLSEEETRSVFNFFDLEESMRTRAATSFRDLLLAYRDKDTDGWPPVTCV  123

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
             IADG+M F IDV  E+ IP I+FRT SA C WA+ C+P L+ESG++P    +D+D+ +  
Sbjct  124   IADGLMPFTIDVSEEVGIPAIMFRTISACCVWAYLCIPNLLESGEIPFPEGADLDEPVRG  183

Query  626   VEGMENVLRLRDLPSFCRTT-DLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
             V GME+ LR RDLPSFCR   D  DR    +   T  T RA  LILNT E LE SAL+ I
Sbjct  184   VAGMESFLRRRDLPSFCRQARDQMDRELQVMSSVTASTNRARALILNTLESLEGSALSHI  243

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSF  982
             RKH P  Y +GPL+A  +A  SS  G        SLW+EDR CM WL  QP +SVVYVSF
Sbjct  244   RKHSPVTYAVGPLNA--QAGTSSDSG--------SLWQEDRDCMTWLHAQPDRSVVYVSF  293

Query  983   GSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSV----IGDDN---IPAELIEGTRKKGY  1141
             GS+TV+TR +++EFWHG+V+SG+ FLW +R + +     G +    +PAE+ E TR +G 
Sbjct  294   GSLTVVTREEYMEFWHGLVDSGQRFLWVVRSDLINMRGGGTEEKPAVPAEVEEWTRDRGC  353

Query  1142  MVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKN  1321
             +VGWAPQEEVL HP+VG F+THSGWNSTLE I  G PM+CWPF+ADQQ+NSR V AVW+ 
Sbjct  354   IVGWAPQEEVLAHPSVGCFVTHSGWNSTLECIAAGKPMLCWPFFADQQINSRFVSAVWEI  413

Query  1322  GVDMKDTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
             G+DMKD C R  VEKMV+E+ME  R +E  + +  MA++A+K+V + G+SY++L RL++ 
Sbjct  414   GLDMKDLCGRSIVEKMVREVMEGERSEELRRNAREMAEMAKKSVAEGGTSYNDLQRLIQH  473

Query  1499  L  1501
             +
Sbjct  474   I  474



>ref|XP_004512576.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cicer arietinum]
Length=473

 Score =   478 bits (1229),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 238/472 (50%), Positives = 320/472 (68%), Gaps = 15/472 (3%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             ++++  HVLIFP P QGHVN ML+LAELL  ++ +++TFLN+E+ H RL+R+ D     S
Sbjct  6     EEKTCPHVLIFPCPAQGHVNSMLKLAELLALQN-MNITFLNTEYIHNRLIRFNDSIQALS  64

Query  266   -SYPNFYFRTISDGLPAD-HPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
              +YP F F+TI D    + HP  G+++ D+  S++   KP  R+M+ S        P ++
Sbjct  65    LTYPKFQFKTIPDFHDEEKHPGFGEKIGDVIMSLSLNGKPYLRDMIVSEV------PKIS  118

Query  440   CIIADGIMC-FAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             CII DG+      D+ +E  I  I FRT SA CFWA+ CVPKL+ES ++P+ G+ DMD++
Sbjct  119   CIILDGVFGDLVTDLASEFGIQLIHFRTISACCFWAYLCVPKLLESNEIPIRGDEDMDRI  178

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             + N  GMENVLR RDLPSF R     +     +++ T ++ +AN LILNTFEDLE   L+
Sbjct  179   IRNAPGMENVLRCRDLPSFFRENK-HNLSLDKLVVRTQQSFKANALILNTFEDLESPILS  237

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             QIR H P LYTIGPLH HL     ++   +    +S+L++ DR+CM WLD QPLKSV+YV
Sbjct  238   QIRLHFPKLYTIGPLHHHLNNTKKTTTTLI----NSNLFQVDRTCMTWLDSQPLKSVIYV  293

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWA  1156
             SFGS T +   + +E WHG++NS K FLW IRPN V G + +  EL E T+++G +VGW 
Sbjct  294   SFGSTTPMKSEEVIEIWHGLMNSEKRFLWVIRPNMVQGKEVLLKELEEKTKERGLIVGWV  353

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEEVL H A+G FLTHSGWNSTLES+  G+PMICWPF+ADQQ+NSR V  VWK G+DMK
Sbjct  354   PQEEVLAHKAIGAFLTHSGWNSTLESVVCGVPMICWPFFADQQINSRFVSEVWKIGLDMK  413

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLV  1492
             D CDR  VE MV +LM  R++EF K +  M+KL+ K+V+  GSSY N   L+
Sbjct  414   DVCDRKVVENMVNDLMVNRKEEFLKSAMEMSKLSCKSVSPSGSSYDNFQALI  465



>ref|XP_008359771.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
 ref|XP_008368325.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   476 bits (1224),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 248/489 (51%), Positives = 323/489 (66%), Gaps = 27/489 (6%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             +  S++HVL+ PFP QGH+  ML  A+LLCH + IHVTFL++E  H+ L +   L  RF 
Sbjct  7     ESESAAHVLLLPFPAQGHITPMLSFAQLLCH-AGIHVTFLSTEHNHRLLTQRRALSARF-  64

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREML--------SSGSLQSS  421
               P  +F +I DGLP DHPRT   + D+ +S+ +VTKP  R++L         S    ++
Sbjct  65    --PTLHFESIPDGLPPDHPRTIPPLDDIVSSLRSVTKPLLRDLLITLTKKDNESXGATTT  122

Query  422   GRPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGES  601
              RPP++C+I DGIMCFAID+  E+ IP    RT SA  FW + C+P LI+ G LP   + 
Sbjct  123   PRPPLSCVIIDGIMCFAIDMAEEVGIPVFALRTVSACSFWCYSCIPDLIQQGQLPFQ-DQ  181

Query  602   DMDKLLENVEGMENVLRLRDLPSFCR--TTDLSDRGFLSVILATLRTTRANGLILNTFED  775
             DMD  + ++ GME +LRLRDLPSFCR      S + F+  I A    TR + +ILNTF+D
Sbjct  182   DMDHPIRDIPGMEALLRLRDLPSFCRMPIDHPSFKFFMEQIEAI---TRVSAIILNTFDD  238

Query  776   LEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQP  955
             LE   L+QI    P +YT+GP HA L++RV    G+    S SSL  EDR CMAWLD Q 
Sbjct  239   LEPLILSQIATRFPKIYTLGPFHALLKSRV----GDDLSSSVSSLRHEDRRCMAWLDSQQ  294

Query  956   LKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGT  1126
               SV++VSFGS+  L+R Q LEFWHG++NSGK FLW +R + +         P EL +GT
Sbjct  295   SGSVIFVSFGSLAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLSSGQEERATPVELEDGT  354

Query  1127  RKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVG  1306
             +++GY+  W PQEEVL H AVGGF THSGWNST+E I  G+PM+CWP  ADQQVNSR VG
Sbjct  355   KERGYIAEWVPQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNSRWVG  414

Query  1307  AVWKNGVDMKDTCDRITVEKMVKELMEV--RRDEFTKCSNRMAKLARKAVTQHGSSYSNL  1480
               WK G+DMKDTCDR TVEKMV+ LME   +R++  K  +  AKLAR AV++ GSSY NL
Sbjct  415   EGWKIGLDMKDTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSSYKNL  474

Query  1481  DRLVEDLKK  1507
             ++L+EDL +
Sbjct  475   EKLIEDLNE  483



>ref|XP_006357782.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=484

 Score =   476 bits (1224),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 232/481 (48%), Positives = 321/481 (67%), Gaps = 19/481 (4%)
 Frame = +2

Query  80    TMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             T++ +   HVL+FP P+Q  +N ML+LAEL C  + + VTFLN+    Q L R+T++  R
Sbjct  6     TIEAKMCPHVLLFPLPIQSPINSMLQLAELFCL-ADLQVTFLNTNHNQQLLYRHTNVESR  64

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             F  YP F FRTISDGLP DHPR+     DL NS+ AV +P  R++L+           VT
Sbjct  65    FKQYPKFQFRTISDGLPDDHPRSFPMFEDLINSLQAVAEPFLRKILTESG--------VT  116

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             C+I DG+  +A+D+ NE+ +  I F T S  C W + C PKLI++GD+P  G +D+D L+
Sbjct  117   CVIPDGLFYYAVDICNEVGVSVISFDTISPCCLWVYLCFPKLIQTGDIPFKG-NDLDMLI  175

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTT-RANGLILNTFEDLEESALA  796
             ENV GME++LR RD P F R T+ +   +  + L  +++  R++GLILNTFEDL+   L+
Sbjct  176   ENVPGMEDLLRRRDFP-FYRLTNCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLS  234

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              IR H P  Y +GPLH  L+ R++  R      SS+SLWEED S + WLD QP++SV+YV
Sbjct  235   HIRSHCPQTYAVGPLHLQLKTRLADKR----MSSSNSLWEEDHSSIQWLDAQPIESVIYV  290

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMV  1147
             SFGS+  LT+ + LEFWHG+VNSG  FLW +R + +  ++       EL  G +++ Y+V
Sbjct  291   SFGSLATLTKEEMLEFWHGLVNSGIRFLWVMRSDLLREEEFSHQFVKELAAGCKERAYIV  350

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
              WAPQE+VL HPA+GGFLTHSGWNST+ESI E  PMICW  Y DQ+V SR VG VWK G+
Sbjct  351   SWAPQEKVLSHPAIGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGL  410

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKD CDR  +EK+VK+LM   +D+  K  ++++ LA  +V + GSSY+  + LV+D+KK
Sbjct  411   DMKDICDRDNIEKVVKDLMVTNKDKLKKSVDKLSMLAEISVGEGGSSYNAFEYLVDDIKK  470

Query  1508  M  1510
             +
Sbjct  471   L  471



>ref|XP_008388093.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   475 bits (1223),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 248/489 (51%), Positives = 323/489 (66%), Gaps = 27/489 (6%)
 Frame = +2

Query  86    DQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFS  265
             +  S++HVL+ PFP QGH+  ML  A+LLCH + IHVTFL++E  H+ L +   L  RF 
Sbjct  7     ESESAAHVLLLPFPAQGHITPMLSFAQLLCH-AGIHVTFLSTEHNHRLLTQRRALSARF-  64

Query  266   SYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREML--------SSGSLQSS  421
               P  +F +I DGLP DHPRT   + D+ +S+ +VTKP  R++L         S    ++
Sbjct  65    --PTLHFESIPDGLPPDHPRTIPPLDDIVSSLRSVTKPLLRDLLITLTKKDNESCGATTT  122

Query  422   GRPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGES  601
              RPP++C+I DGIMCFAID+  E+ IP    RT SA  FW + C+P LI+ G LP   + 
Sbjct  123   PRPPLSCVIIDGIMCFAIDMAEEVGIPVFALRTVSACSFWCYSCIPDLIQQGQLPFQ-DQ  181

Query  602   DMDKLLENVEGMENVLRLRDLPSFCR--TTDLSDRGFLSVILATLRTTRANGLILNTFED  775
             DMD  + ++ GME +LRLRDLPSFCR      S + F+  I A    TR + +ILNTF+D
Sbjct  182   DMDHPIRDIPGMEALLRLRDLPSFCRMPIDHPSFKFFMEQIEAI---TRVSAIILNTFDD  238

Query  776   LEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQP  955
             LE   L+QI    P +YT+GP HA L++RV    G+    S SSL  EDR CMAWLD Q 
Sbjct  239   LEPLILSQIATRFPKIYTLGPFHALLKSRV----GDDLSSSVSSLRHEDRRCMAWLDSQQ  294

Query  956   LKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGT  1126
               SV++VSFGS+  L+R Q LEFWHG++NSGK FLW +R + +         P EL +GT
Sbjct  295   SGSVIFVSFGSLAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLSSGQEERATPVELEDGT  354

Query  1127  RKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVG  1306
             +++GY+  W PQEEVL H AVGGF THSGWNST+E I  G+PM+CWP  ADQQVNSR VG
Sbjct  355   KERGYIAEWVPQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNSRWVG  414

Query  1307  AVWKNGVDMKDTCDRITVEKMVKELMEV--RRDEFTKCSNRMAKLARKAVTQHGSSYSNL  1480
               WK G+DMKDTCDR TVEKMV+ LME   +R++  K  +  AKLAR AV++ GSSY NL
Sbjct  415   EGWKIGLDMKDTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSSYKNL  474

Query  1481  DRLVEDLKK  1507
             ++L+EDL +
Sbjct  475   EKLIEDLNE  483



>gb|KHG01936.1| UDP-glycosyltransferase 85A1 [Gossypium arboreum]
Length=913

 Score =   489 bits (1260),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 229/448 (51%), Positives = 311/448 (69%), Gaps = 12/448 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q    HVL+FPFP+QGH+N M++LAELL   +   +TFLNS + H+RL+++ ++   F  
Sbjct  8     QPPPPHVLVFPFPLQGHINSMIKLAELLAL-AGFKLTFLNSHYNHERLVKFNNIAAHFER  66

Query  269   YPNFYFRTISDGLPADHPRTGDRVVDLFN-SINAVTKPRFREMLSSGSLQSSGRPPVTCI  445
             Y  F F+TI+DGLP DHPR+G+  +D++  ++    KP  REML + S      PPV CI
Sbjct  67    YQGFEFKTITDGLPLDHPRSGNWFLDMYEEALEMKMKPGLREMLENIS------PPVDCI  120

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
             IADG + FAIDV  EL IP I FRT S   FW ++ +P +I++G+LP+ G  DMD+LL  
Sbjct  121   IADGFLGFAIDVAKELEIPIIYFRTSSPCSFWVYYSIPDIIQAGELPIKGSEDMDRLLTT  180

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             V GME   R RDLPSFCR TD+ D      +  T ++++A+ LILNT E+L+   L+QIR
Sbjct  181   VPGMETYFRCRDLPSFCRETDIEDSIIKLYVKQTQKSSQADALILNTAEELDGPILSQIR  240

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
                P +Y IGPLHA L  R+ +  GE     S++LWE D+SC+ WLD+QP +SV+YVSFG
Sbjct  241   TKCPRVYAIGPLHAQLNTRLKAKHGESYDHFSNTLWEVDKSCIFWLDKQPNRSVIYVSFG  300

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD----NIPAELIEGTRKKGYMVGW  1153
             S+T  +R Q +E W+G++NS   FL  +RPNSVIG D    ++  EL+E ++ +GY+V W
Sbjct  301   SITSTSREQLVELWYGLLNSKTKFLLVVRPNSVIGKDGEGEDVVVELMEKSKDQGYIVNW  360

Query  1154  APQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDM  1333
             APQE VL HP VGGF TH+GWNSTLESI  G+PMICWP++ADQQVNSR+V  VWK G+DM
Sbjct  361   APQEAVLNHPTVGGFFTHNGWNSTLESIVAGVPMICWPYFADQQVNSRVVSEVWKIGLDM  420

Query  1334  KDTCDRITVEKMVKELMEVRRDEFTKCS  1417
             KD CD+  VEKMVK++M  +++EF + +
Sbjct  421   KDVCDKKIVEKMVKDVMVDQKEEFVQSA  448


 Score =   457 bits (1176),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 221/451 (49%), Positives = 309/451 (69%), Gaps = 12/451 (3%)
 Frame = +2

Query  194   VTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRTGDRVVDLFN-SINAV  370
             +TFLNS   H+RL+++T +   F  YP F  +TI+DGLP DHPR+G+  ++ +  +I   
Sbjct  465   LTFLNSHHNHERLIKFTSIVAYFKRYPGFELKTITDGLPLDHPRSGNWFLETYEEAILMK  524

Query  371   TKPRFREMLSSGSLQSSGRPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFF  550
              K  FREM+ + +      PPV C+IADG   +AIDV NEL IP I FRT S   FW ++
Sbjct  525   IKQSFREMMINSN------PPVDCVIADGFSGYAIDVANELGIPIIGFRTSSPRSFWVYY  578

Query  551   CVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATL  730
              +  +I++G+LP+ G  DMD+L+  V GME  LR RDLPSFCR  D+ D     ++  T 
Sbjct  579   SITDIIKAGELPIRGSEDMDRLITTVPGMETYLRCRDLPSFCRKPDIEDSTVQLIVKQTR  638

Query  731   RTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSL  910
             ++T+A+ LI NT ++L+E  L+QIR    N+Y IGPLHA L  R+ +  GE   + S++L
Sbjct  639   KSTQADALIFNTTDELDEPILSQIRTKCANIYPIGPLHAQLNTRLKAKHGESFDQFSNTL  698

Query  911   WEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG  1090
              EED+SC+ WLD+QP +SV+YVSFGS+T  +R+Q +E W+G++NS   FL+ +RP+SVIG
Sbjct  699   REEDKSCIPWLDKQPNRSVIYVSFGSITSTSRDQLVELWYGLLNSKTKFLFVVRPDSVIG  758

Query  1091  DD----NIPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMI  1258
              D    +   EL+E ++ +GY+V WAPQE VL H AVGGFLTHSGWNSTLESI  G+PM+
Sbjct  759   KDGEGEDFVKELMEKSKDRGYIVDWAPQEVVLNHEAVGGFLTHSGWNSTLESIVAGVPMV  818

Query  1259  CWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLA  1438
             CWP++ADQQV SR+V  VWK G+DMKD  DR  VEKMV ++M V + EF   +  MAK+ 
Sbjct  819   CWPYFADQQVTSRVVSTVWKIGLDMKDVSDRKIVEKMVNDVM-VDQKEFVNSATDMAKVI  877

Query  1439  RKAVTQHGSSYSNLDRLVEDLKKMKLQL*YI  1531
              + V+  GSS +NLDRL+ED++  +L+  ++
Sbjct  878   NQCVSIGGSSSNNLDRLIEDIRMKRLKTTFV  908



>ref|XP_010688868.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=509

 Score =   475 bits (1223),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 232/491 (47%), Positives = 324/491 (66%), Gaps = 22/491 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLC--HESSIHVTFLNSEFAHQRLLRYTDLHLRFS-SYP  274
             HV+IFP P+QG VNCML+LA+L+     ++I VTFL +EF H RLL ++    R S + P
Sbjct  16    HVVIFPLPIQGPVNCMLKLADLILTLSHATISVTFLTTEFIHSRLLLHSTAAARLSDTAP  75

Query  275   NFYFRTISDGLPAD-HPRTGDRVVDLFNSINAVTKP---RFREMLSSGSLQSSGRPPVTC  442
             +F F T+ DGL  D +PR   ++ DL  ++    +    R RE+L+ GS++   +  VTC
Sbjct  76    HFRFETVPDGLGLDENPRGSSQLADLTMTLEGQAQAKGSRLREVLAYGSVEPESKKVVTC  135

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             IIADG     +DV  EL++P + F T S    W + CVP +I + DLP  GE D+D  + 
Sbjct  136   IIADGFFGCMVDVAKELKVPLVYFETISPCGLWTYLCVPNMIRACDLPFQGEEDLDAAVT  195

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRT-TRANGLILNTFEDLEESALAQ  799
             +V GME  LR RDLPSFCR  +  +   + ++L   +T +RA G ILNTF+ LE      
Sbjct  196   SVPGMETYLRRRDLPSFCRAYN-PNSPVIQLVLKEAQTFSRAQGHILNTFDKLEGEFFTH  254

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             ++   PNLY IGPLH +L+ R+     +     S+SLW+EDRSC+ WLD QP KSV++VS
Sbjct  255   MQALCPNLYNIGPLHLNLKCRIKQESAK---SFSNSLWQEDRSCLGWLDAQPQKSVLFVS  311

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN----------IPAELIEGTR  1129
              GS+ V+T++Q +E W G++NS   FLW  R +S+I  +N          +P+E+IEG +
Sbjct  312   IGSLAVMTKDQLMEIWCGLINSKTRFLWVRRADSIIKSNNEEADQSQYSEVPSEVIEGIK  371

Query  1130  KKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGA  1309
              +G +V WAPQEEVL H A+GGFLTHSGWNSTLESI  G+PMICWPF+ DQQVNSR+V  
Sbjct  372   DRGCIVRWAPQEEVLAHKAIGGFLTHSGWNSTLESIVAGVPMICWPFFVDQQVNSRVVSE  431

Query  1310  VWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRL  1489
             VWK G+DMKD C+R+ +EKM+K+LM  R+DEF   ++ M KLA +AV + GSSY++L+RL
Sbjct  432   VWKIGLDMKDNCNRVVIEKMIKDLMGTRKDEFLARADEMGKLAAQAVVEDGSSYNSLNRL  491

Query  1490  VEDLKKMKLQL  1522
             ++D+  M+  +
Sbjct  492   IDDIMFMRFSI  502



>ref|XP_007158358.1| hypothetical protein PHAVU_002G146100g [Phaseolus vulgaris]
 gb|ESW30352.1| hypothetical protein PHAVU_002G146100g [Phaseolus vulgaris]
Length=482

 Score =   474 bits (1220),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 237/478 (50%), Positives = 319/478 (67%), Gaps = 12/478 (3%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             + +HVLIFP P+  HV  ML+LAELL  E+ +HVTFL ++  H RL R+ D+     SYP
Sbjct  2     AEAHVLIFPLPLPAHVVSMLKLAELLVLEN-LHVTFLTTDTIHGRLTRFGDIQFLSKSYP  60

Query  275   NFYFRTISDGL-PADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIA  451
               +F+TISD     DHP  GDR+ DL +S     KP  R++L S + Q    P ++C+I 
Sbjct  61    KLHFKTISDCYDEGDHPGFGDRLWDLISSTTLHAKPFLRDILLSHTPQI---PKLSCVIQ  117

Query  452   DGIM-CFAIDVGNELR--IPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             DGI    + DV +E    IP I FRT SA CFWA+     L++  +LP+ G+ DMD++++
Sbjct  118   DGIFGSLSADVASEFNVSIPIIQFRTVSACCFWAYMSATNLLQCQELPIRGDEDMDRIIK  177

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
             ++ GMEN+LR RDLPSF R     +  F S +  + ++  A+ +I+N+FEDLE   L+QI
Sbjct  178   DIPGMENLLRCRDLPSFFRPDKKGNSTFESHVDRSRQSLAADAIIVNSFEDLEGPVLSQI  237

Query  803   RKHIPNLYTIGPLHAHLRAR-VSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             R H P +YT+GPLH HL  R   S+ GE   +  +++++ DR+CM WLD QP  SV+YVS
Sbjct  238   RHHFPKVYTVGPLHCHLNTRKAESNEGEDIPKFKNAIFQVDRTCMTWLDAQPEGSVMYVS  297

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKGYMVG  1150
             FGS T++ R    E WHG+VNS   FLW +RP+ V G   DD IPAE+ EGT+++G++V 
Sbjct  298   FGSSTIVKREDLTEIWHGLVNSKNRFLWVMRPDIVAGKQDDDRIPAEVEEGTKERGFIVE  357

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQEEVL H A+GGFLTHSGWNSTLES+  G+PMICWP++ADQQ+NSR V  VWK G+D
Sbjct  358   WAPQEEVLEHKAIGGFLTHSGWNSTLESVVAGVPMICWPYFADQQINSRFVSEVWKVGLD  417

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             MKD CDR  VEKMV +LM  RR+EF   +  MA LA K+V+  GSSYS+    +  +K
Sbjct  418   MKDVCDRDVVEKMVNDLMVHRREEFLNSAKAMATLAHKSVSPGGSSYSSFQDFIHYIK  475



>gb|AFJ53008.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=487

 Score =   473 bits (1218),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 248/487 (51%), Positives = 335/487 (69%), Gaps = 27/487 (6%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESS--IHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             HVLIFPFPVQGHVN ML+LAELL   +   I +TFLNS+  H RLL+++D   RFS YP 
Sbjct  11    HVLIFPFPVQGHVNSMLKLAELLSLAAGGGIRITFLNSDCTHNRLLQFSDAESRFSVYPG  70

Query  278   FYFRTISDG-LPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIAD  454
             F F+TI D  +P +    GD+V+DL  ++ +  KP FR+MLS         PPVTC+I D
Sbjct  71    FQFKTIDDHRIPMEKLTKGDKVLDLVGAMESEMKPDFRDMLSRMD------PPVTCVIGD  124

Query  455   GIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEG  634
             G++ F  +V  EL IP I FRT S  CFW  +C+P LIE+G+LP+    DMD+ +  V G
Sbjct  125   GLLGFIREVSMELGIPVIRFRTISPCCFWVNYCLPDLIEAGELPIQ---DMDRKISKVPG  181

Query  635   MENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHI  814
             ME+ LR RDLP  CR + L D   + +I AT  +   + LILNTFEDL+ S L+QIR+H 
Sbjct  182   MESFLRSRDLPGMCRVSGLDDPTLVMLINATRESPPLSPLILNTFEDLDSSVLSQIRRHF  241

Query  815   PNLYTIGPLHAHLRARVSS----SRGELPWRSSSS--LWEEDRSCMAWLDEQPLKSVVYV  976
             P  Y IGPLH HL +R+ +    S+  +  +SSSS  LW+E+ SC+ WLD+QP  SV+YV
Sbjct  242   PQTYAIGPLHQHLESRLRTMSFGSQNNINTQSSSSNSLWKEEASCLKWLDQQPEGSVLYV  301

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD---DNIPAELIEGTRKKGY--  1141
             +FGS+TV+T ++ +EFW G+ +S   FLW +RP  +I D   + IP E++   +K+G+  
Sbjct  302   NFGSITVMTADRIVEFWEGLSSSKHRFLWVMRPG-LIPDKELEKIPQEIL--NQKEGFYK  358

Query  1142  -MVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              +VGWAPQEEVL H AVGGFLTHSGWNSTLES+  G+PMICWPF+ADQ VNSR+V  V+ 
Sbjct  359   VVVGWAPQEEVLNHAAVGGFLTHSGWNSTLESVAAGVPMICWPFFADQLVNSRVVSEVYN  418

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G+DMKD CDR  VE+MV +LM+ R+DEF   + +MA LA+ +V++ GSS  NL+ L++D
Sbjct  419   LGLDMKDVCDRKVVERMVNDLMDERKDEFQSLAAKMAALAKGSVSEGGSSCRNLEVLIQD  478

Query  1499  LKKMKLQ  1519
             ++ M ++
Sbjct  479   IRLMSVK  485



>ref|XP_006357780.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=489

 Score =   473 bits (1217),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 233/473 (49%), Positives = 313/473 (66%), Gaps = 16/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+FP P+Q  +N ML+LAEL C  + + VTFLN+    Q L R+T++  RF  YP F 
Sbjct  16    HVLLFPLPIQSPINSMLQLAELFCL-AGLQVTFLNTNHNQQLLYRHTNVESRFKQYPKFQ  74

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             FRTISDGLP DHPR+     DL  S+ AV +P  RE+L   +      PPVTC+I DG+ 
Sbjct  75    FRTISDGLPKDHPRSSLLFGDLITSLQAVAEPFLREILLGVT-----EPPVTCVIPDGLF  129

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              +A+D+ NE+ +  I F T S  C W + C PKLI+SGD+P  G +D+D L+ENV GME+
Sbjct  130   YYAVDICNEVGVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKG-NDLDVLIENVPGMED  188

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTT-RANGLILNTFEDLEESALAQIRKHIPN  820
             +LR RD P F R T+ +   +  + L  +++  R++GLILNTFEDL+   L+ IR H P 
Sbjct  189   LLRRRDFP-FYRLTNCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLSLIRSHCPQ  247

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
              Y +GPLH  L+ R++         SS+SLWEED S + WLD  P +SV+YVSFGS+  L
Sbjct  248   TYAVGPLHLQLKTRLADKT----MSSSNSLWEEDHSSIQWLDAHPTESVIYVSFGSLATL  303

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQEEV  1171
             T+ + LEFWHG+VNSG  FLW +R + +  ++       EL +G  ++ Y+V WAPQE+V
Sbjct  304   TKKEILEFWHGLVNSGIRFLWVMRSDLLREEEFSHQFVKELTDGCEERAYIVSWAPQEKV  363

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPA+GGFLTHSGWNST+ESI E  PMICW  Y DQ+V SR VG VWK G+DMKD CDR
Sbjct  364   LSHPAIGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDR  423

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
               +EK VKELM   +D+  K  ++++ LA  +V + GSSY+  + LV D+KK+
Sbjct  424   YIIEKAVKELMVTNKDKLKKSVDKLSMLAEISVGEGGSSYNAFEYLVNDIKKL  476



>ref|XP_010316061.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   471 bits (1211),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 229/473 (48%), Positives = 317/473 (67%), Gaps = 19/473 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+FP P+Q  +N ML+LAEL C  + + VTFLN+    Q L R+T++  RF  YP F 
Sbjct  12    HVLLFPLPIQSPINSMLQLAELFCL-AGLQVTFLNTNHNQQLLYRHTNVESRFRQYPKFR  70

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             FRTISDGLP DHPR+     DL NS+ AV +P  RE+++           VTC+I DG+ 
Sbjct  71    FRTISDGLPDDHPRSFPMFEDLINSLQAVAEPSLREIVTESG--------VTCVIPDGLF  122

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              +A+D+ NE+ +  I F T S  C W + C PKLI++GD+P  G +D+D L+ENV GME+
Sbjct  123   YYAVDICNEVGVSVISFDTISPCCLWVYLCFPKLIQTGDIPFKG-NDLDMLIENVPGMED  181

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTT-RANGLILNTFEDLEESALAQIRKHIPN  820
             +LR RD P F R TD +   +  + L  +++  R++GLILNTFEDL+   L+ IR H P 
Sbjct  182   LLRRRDFP-FYRLTDCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLSNIRSHCPQ  240

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
              Y +GPLH  L+ R++         SS+SLWEED S + WLD QP++SV+YVSFGS+  L
Sbjct  241   TYAVGPLHLQLKTRLADKT----MSSSNSLWEEDHSSIQWLDAQPIESVIYVSFGSLATL  296

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQEEV  1171
             T+ + LEFWHG+VNSG  FLW +R + +  ++    +  EL +G +++ Y+V WAPQE+V
Sbjct  297   TKEEMLEFWHGLVNSGIRFLWVMRSDLLREEEFSHQLVKELADGCKERAYIVSWAPQEKV  356

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPA+GGFLTHSGWNST+ESI E  PMICW  Y DQ+V SR V  VWK G+DMKD CDR
Sbjct  357   LSHPAIGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVSEVWKIGLDMKDICDR  416

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
               +EK+VK+LM   +++  K  ++++ LA  +V + GSSY+  + LV+D+KK+
Sbjct  417   DNIEKVVKDLMVTNKEKLKKSVDKLSMLAEISVGEGGSSYNAFEYLVDDIKKL  469



>ref|XP_008785470.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=489

 Score =   470 bits (1210),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/487 (49%), Positives = 316/487 (65%), Gaps = 13/487 (3%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M +   +HVL+ PFP QGHV  ML+LAE+L H + +HVTF+N++  H+R L  +    R 
Sbjct  1     MTEVGEAHVLVSPFPAQGHVPPMLKLAEILSH-AGLHVTFVNTDNIHRRFLASSPALQRL  59

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
             +  P F FRTI DGLP DHPR   + +DL  S+   ++  +RE+L        G PPVTC
Sbjct  60    AGLPRFRFRTIPDGLPEDHPRPFLQFLDLEESLRTRSREHYRELLVPTGKDPDGWPPVTC  119

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPL------NGESD  604
              +ADGI+  A +V  E+ IP I  RT  A   WA+ C+P LI+ G++P         E  
Sbjct  120   AVADGILRLASEVAAEMEIPVIFVRTSGACAVWAYLCIPDLIKGGEIPFPEEEEEKEEDG  179

Query  605   MDKLLENVEGMENVLRLRDLPSFCRTTD-LSDRGFLSVILATLRTTRANGLILNTFEDLE  781
             +D+ +  V GME  LR RDLPSFCR     SDR    V  A     R  GLILNTFE LE
Sbjct  180   LDETIRGVPGMEGFLRRRDLPSFCRNAKSTSDRSLQFVTNANANVRRGRGLILNTFEALE  239

Query  782   ESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRS-SSSLWEEDRSCMAWLDEQPL  958
                L+ IR  IP  Y +GPLH   R        + P  S S+SLW+EDRSC+ WLD QP 
Sbjct  240   GPVLSHIRSAIPISYALGPLHLLSRT-FDDCGADAPLSSNSASLWQEDRSCLKWLDSQPQ  298

Query  959   KSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG--DDNIPAELIEGTRK  1132
             +SVVY+SFGS+T+++R++ +EFWHG+V+SGK FLW +RP+   G  ++ I  +L + T++
Sbjct  299   RSVVYISFGSVTMMSRDELMEFWHGLVDSGKRFLWVVRPDLAEGKIEEAIQEDLEKETKE  358

Query  1133  KGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAV  1312
             +G +VGWAPQEEVL HPAV  FLTHSGWNSTLES+  G+PMICWPF+ADQ VNSR VG V
Sbjct  359   RGCLVGWAPQEEVLAHPAVACFLTHSGWNSTLESVAAGVPMICWPFFADQPVNSRFVGDV  418

Query  1313  WKNGVDMKDTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRL  1489
             W+ GVDMKD   R  VE+MV+E+ME  R +E  + +  MA+LAR++V + GSSY + + L
Sbjct  419   WRFGVDMKDKRGRSVVERMVREVMEGERAEELRRSAGEMAELARRSVGEGGSSYRDFENL  478

Query  1490  VEDLKKM  1510
             V+D+K M
Sbjct  479   VKDIKAM  485



>ref|XP_004231996.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Solanum lycopersicum]
Length=477

 Score =   464 bits (1195),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 230/473 (49%), Positives = 313/473 (66%), Gaps = 19/473 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+FP P+Q  +N ML+LAEL C  + + VTFLN+    Q L R+TD+  RF  YP F 
Sbjct  4     HVLLFPLPIQSPINSMLQLAELFCL-AGLQVTFLNTNHNQQLLYRHTDVESRFRQYPKFQ  62

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             FRTISDGLP DHPR+     DL  S+ AV +P  RE+++           VTC+I DG+ 
Sbjct  63    FRTISDGLPDDHPRSSLLFGDLITSLQAVAEPFLREIVTESG--------VTCVIPDGLF  114

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              +A+D+ NEL +  I F T S  C W + C PKLI+SGD+P  G +D+D L+ENV GME+
Sbjct  115   YYAVDICNELGVSVISFDTISPCCLWVYLCFPKLIQSGDIPFKG-NDLDVLIENVPGMED  173

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTT-RANGLILNTFEDLEESALAQIRKHIPN  820
             +LR RD P F R T+ +   +  + L  +++  R++GLILNTFEDL+   L+ IR H P 
Sbjct  174   LLRRRDFP-FYRLTNCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLSNIRTHCPQ  232

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
              Y +GPL   L+ R++         SS+SL EED S + WLD QP++SV+YVSFGS+  L
Sbjct  233   TYAVGPLQLQLKTRLADKS----MSSSNSLREEDGSSIQWLDAQPVESVIYVSFGSLATL  288

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQEEV  1171
             T+ + LEFWHG+VNSG  FLW +R + +  ++       EL +G +++ Y+V WAPQE+V
Sbjct  289   TKEEMLEFWHGLVNSGIRFLWVMRSDLLREEEFSHQFVKELADGCKERAYIVSWAPQEKV  348

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPA+GGFLTHSGWNST+ESI E  PMICW  Y DQ+V SR VG VWK G+DMKD CDR
Sbjct  349   LSHPAIGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDR  408

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
               +EK VK+LM   +D+  K  ++++ LA+ +V + GSSY+  + LV D+KK+
Sbjct  409   YIIEKAVKDLMVTNKDKLKKSVDKLSMLAKISVGEGGSSYNAFESLVIDIKKL  461



>ref|XP_003613026.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES95984.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   464 bits (1193),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 233/474 (49%), Positives = 314/474 (66%), Gaps = 19/474 (4%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRL--LRYTDLHLRFSSY  271
             + HVLIFP P QGHVN ML+LAELL  ++ +H+TFLN+E+ H RL  L   D+      Y
Sbjct  3     TPHVLIFPCPAQGHVNTMLKLAELLLIQN-LHITFLNTEYIHNRLISLNIDDVKSISQCY  61

Query  272   PNFYFRTISDGLPAD-HPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCII  448
             P   F+TISD    + HP  G+ +VD+ +SIN   KP  R+++ S          ++CII
Sbjct  62    PKLQFKTISDFQNKEKHPGFGENIVDVISSINMYGKPSLRDIIVSEK--------ISCII  113

Query  449   ADGIMC-FAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
              DG     A D+  E  I  I FRT +AS  W +FC+PKL++  ++P+ G+ DMD+++ N
Sbjct  114   LDGGFGDLATDLAAEFGIQLIHFRTVAASTVWIYFCMPKLLDCNEIPIRGDEDMDRIIRN  173

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             V GMEN++R RDLP F  +  +       V+  T  + + N +ILNTFEDLE   L+QIR
Sbjct  174   VPGMENIIRCRDLPRFGTSNKMDHIILDKVLQLTQASLKGNAVILNTFEDLESPILSQIR  233

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
              H P LYTIGPLH HL     ++        +S+ ++ DR+CM WL+ QPLKSVVYVSFG
Sbjct  234   LHFPKLYTIGPLHHHLNTMKKTTSSSF----NSNFFKVDRTCMTWLESQPLKSVVYVSFG  289

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRK-KGYMVGWAPQ  1162
             S T +TR + LEFWHG++NS KAFLW IRPN ++ +  +  EL EGT K KG +V WAPQ
Sbjct  290   STTTMTREEILEFWHGLLNSKKAFLWVIRPN-MVQEKRLIKELEEGTSKEKGLIVEWAPQ  348

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             EEVL H A+G FLTHSGWNSTLES+  G+PMICWP+++DQ +NSR V  VWK G+DMKD 
Sbjct  349   EEVLSHKAIGAFLTHSGWNSTLESVVCGVPMICWPYFSDQPLNSRFVSEVWKLGLDMKDV  408

Query  1343  CDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             CDR  VE MV ++M  +++EF+K + +MA LA K+V   GSSY+NL  L++ ++
Sbjct  409   CDRNVVENMVNDIMVNKKEEFSKSATKMADLASKSVNPDGSSYNNLQDLIQYIR  462



>ref|XP_006429244.1| hypothetical protein CICLE_v10013877mg [Citrus clementina]
 gb|ESR42484.1| hypothetical protein CICLE_v10013877mg [Citrus clementina]
Length=477

 Score =   464 bits (1193),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 233/484 (48%), Positives = 315/484 (65%), Gaps = 13/484 (3%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M+Q    HV++ P+P  GH+  ML LAEL  H +   VTF+N+E  H RLL   D+   +
Sbjct  1     MEQTRVPHVVLLPYPAYGHIKPMLTLAELFSH-AGFRVTFVNTEQYHDRLLGNNDVTGFY  59

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
               +PNF F +I DGLP D+PR G  + D F S   V+K  F ++L S  L        TC
Sbjct  60    KRFPNFRFTSIPDGLPPDNPRFGIYIKDWFCSDKPVSKLAFLQLLMSPGLLP------TC  113

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             II+D IM F IDV  EL IP I FR +SA C W+ F   KL E G+LP+  E + DK ++
Sbjct  114   IISDSIMSFTIDVAEELNIPIITFRPYSAHCSWSDFHFSKLAEEGELPVTNE-NFDKPVK  172

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              + G+EN  R RDLPS CR     D    + I  T  TTRA+ L++NTF ++E   ++++
Sbjct  173   CIPGLENFFRNRDLPSICRDGGPDDPILQTFIRDTSATTRASALVINTFNEIEGPIISKL  232

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGEL--PWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
                +  +YT+GPLHA L++R+     E   P  ++  L +EDRSCM WLD QP +SV+YV
Sbjct  233   GSRLTKIYTVGPLHALLKSRIQEDSAESSPPESNNCVLSKEDRSCMTWLDSQPSRSVLYV  292

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI---PAELIEGTRKKGYMV  1147
             SFGS   L R Q LEFWHG+VNSGK FLW IR + + G+  +   P EL +GT+++G +V
Sbjct  293   SFGSFIKLGREQILEFWHGMVNSGKRFLWVIRSDLIDGEPGVGPVPVELDQGTKERGCIV  352

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
              WAPQEEVL H A+GGFLTHSGWNSTLES+  G+PMICWP   DQQVNSR V  +WK G+
Sbjct  353   SWAPQEEVLAHQAIGGFLTHSGWNSTLESLVAGVPMICWPQIGDQQVNSRCVSEIWKIGL  412

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKDTCDR T+E + ++LM+ +RD+  + + ++AK+AR AV + GSSY NL++L+ED++ 
Sbjct  413   DMKDTCDRSTIENLARDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLEKLIEDIRS  472

Query  1508  MKLQ  1519
             M  +
Sbjct  473   MAFK  476



>gb|KHN04913.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=457

 Score =   462 bits (1189),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 240/476 (50%), Positives = 318/476 (67%), Gaps = 33/476 (7%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             + +HVLIFP P+ GH+  ML+LAELL  ++ IHVTF++ E +                YP
Sbjct  2     AEAHVLIFPLPLPGHLGSMLKLAELLALDN-IHVTFVD-ELS--------------ECYP  45

Query  275   NFYFRTISDGL--PADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCII  448
               +F+TI D      +HP  GDRV D   S     KP  R++L S    S G P V+CII
Sbjct  46    TLHFKTIPDCYDEEGEHPGFGDRVGDFITSTAQHAKPFLRDILLSQ--HSPGIPKVSCII  103

Query  449   ADGIM-CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
              DGI    + D   ELRIP I FRT S+ CFWA+FCVPKL++  +LP+ GE DMD+++ N
Sbjct  104   QDGIFGALSSDFAAELRIPLIHFRTVSSCCFWAYFCVPKLLDCKELPIKGEEDMDRIIRN  163

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLS-VILATLRTTRANGLILNTFEDLEESALAQI  802
             + GMEN+LR RDLPSFCR    ++  FL   +  T ++  A+ L+LNTFEDLE S L+Q+
Sbjct  164   MPGMENLLRCRDLPSFCRPN--TEGNFLEWAVFRTRQSLAADALMLNTFEDLEGSVLSQM  221

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRG--ELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              +H P LYTIGP+H HL+ R + S    ++P    +SL++ DRSCMAWL+ QP  SV+YV
Sbjct  222   GQHFPKLYTIGPIHHHLKIRKAESNKAKDIP-TFKNSLFQVDRSCMAWLEAQPQGSVIYV  280

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWA  1156
             SFGS T++ R   +E WHG+VNS K FLW +RP+ ++  D IPAE+ EGTR++G +VGWA
Sbjct  281   SFGSSTIVKREDLMEIWHGLVNSKKRFLWVMRPD-IVAADRIPAEVEEGTRERGLIVGWA  339

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQE+VL H A+GGFLT      TL+S+  G+PMICWP++ADQQ+NSR V  VWK G+DMK
Sbjct  340   PQEDVLAHKAIGGFLT-----PTLDSVVAGVPMICWPYFADQQINSRFVSEVWKLGLDMK  394

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             D CDR  VEKMV +LM  R++EF K +  MA LA K+VT  GSSYS+ D L++ +K
Sbjct  395   DVCDRHVVEKMVNDLMVHRKEEFLKSAQEMAMLAHKSVTPGGSSYSSFDDLIQYIK  450



>ref|XP_003613028.1| Cis-zeatin O-glucosyltransferase [Medicago truncatula]
 gb|AES95986.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=474

 Score =   462 bits (1190),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 240/476 (50%), Positives = 319/476 (67%), Gaps = 16/476 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTD-LHLRFS  265
             ++S  HVLIFP P QGHVN ML+LAELL  ++ I++TFLN+++ H RL+++ D +     
Sbjct  7     KKSLPHVLIFPCPAQGHVNPMLKLAELLAIQN-IYITFLNTKYIHNRLIQFNDDIQALLE  65

Query  266   SYPNFYFRTISDGLPAD-HPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
              YP   F+TISD    + HP  G++V D+  S++   KP  ++++ S          ++C
Sbjct  66    CYPKLQFKTISDFHSEEKHPGFGEKVGDVILSLSLYGKPLLKDIIVSEK--------ISC  117

Query  443   IIADGIMC-FAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             II DGI    A D+  E  I  I FRT SA CFWA+  VPKL+E  +LP+ G+ DMD+++
Sbjct  118   IILDGIFGDLATDLAAEFGIQLIHFRTISACCFWAYLSVPKLLECNELPIKGDEDMDRII  177

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
              NV GMEN+LR RDLPSF R  D SD       L T ++ + N LILNTFE+LE  AL+Q
Sbjct  178   RNVPGMENLLRCRDLPSF-RKMDDSDTILDKAALLTQQSLKGNALILNTFENLESPALSQ  236

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P LYTIGPLH HL     +S       S S+ +E DR+CM WL+ QPLKSVVYVS
Sbjct  237   IRLHAPKLYTIGPLHHHLNTTKKTSSSSSS-SSKSNFFEVDRTCMTWLESQPLKSVVYVS  295

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRK-KGYMVGWA  1156
             FGS+T +   + +E WHG++NS K FLW IRPN ++ +  +  EL EGT K KG +VGW 
Sbjct  296   FGSITPMKGEEIIEIWHGLLNSKKPFLWVIRPN-MVQEKGLLKELEEGTTKEKGMIVGWV  354

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEEVL H A+G FLTHSGWNSTLES+  G+PMICWP++ADQQ+NSR V  VWK G+DMK
Sbjct  355   PQEEVLSHKAIGAFLTHSGWNSTLESVVCGVPMICWPYFADQQINSRFVSDVWKLGLDMK  414

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             D CDR  VE MV ++M  R++EF + +  +AKLA K+V+  GSSY+N   L++ ++
Sbjct  415   DVCDRKVVENMVNDVMVNRKEEFVRSAMDIAKLASKSVSPGGSSYNNFQDLIQYIR  470



>gb|AIE12478.1| UGT5 [Panax ginseng]
Length=477

 Score =   462 bits (1190),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 223/480 (46%), Positives = 319/480 (66%), Gaps = 6/480 (1%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M+   + HVL+ PFP  GH+  ML L +LLC ++ + VT LN++  H  +L   D    +
Sbjct  1     MENPQAPHVLMLPFPAVGHIKPMLMLGKLLC-QAGLSVTLLNTDQNHNNILNPIDQSSFY  59

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
             S YP F F++++ GLP +H RTG  V +L   I +    +F+E L     +     PVTC
Sbjct  60    SRYPGFQFKSLAVGLPPEHLRTGPVVAELLYWITSACSTKFKEYLMVEENEKGQPEPVTC  119

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             IIADGIM F ID+  E  IP I FRT++++  W +F + +L+++G++P+  + DMD+ + 
Sbjct  120   IIADGIMSFTIDIAEEFHIPVITFRTYNSTSTWVYFHLHQLLQNGEIPVQRDEDMDQQIT  179

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
             ++ G+E +LR RDLP FC+  D +D      +  T +  RA+ LILNTFE+LE   ++ +
Sbjct  180   SIPGLETILRRRDLPPFCKL-DSTDHLLQFYMGQTSKMKRASALILNTFEELEGPIVSHL  238

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSF  982
                 P +YTIGPLH  L++ ++ +       S +S+  +DR+C+ WLD QP KSVVYVSF
Sbjct  239   HSIFPTVYTIGPLHGLLQSHINHNAPPSD-SSETSVRPQDRTCIRWLDSQPSKSVVYVSF  297

Query  983   GSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI---PAELIEGTRKKGYMVGW  1153
             GS+ VLT++Q LEFWHG+VNSG  FLW IRP  V+ ++N+   P+EL   T ++G +VGW
Sbjct  298   GSVVVLTQDQLLEFWHGLVNSGSPFLWVIRPGLVLAENNVAETPSELTIATNERGCIVGW  357

Query  1154  APQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDM  1333
              PQEEVL H AVGGFL+HSGWNSTLESI  G+PMICWP  ADQ +NSR VG +W+ G+DM
Sbjct  358   GPQEEVLAHRAVGGFLSHSGWNSTLESIWAGMPMICWPQIADQWINSRCVGEMWRTGLDM  417

Query  1334  KDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMK  1513
             KDTCDR TVEKMV+ LME + +E  K +   + +AR +V + GSSY ++ +L+ED+K ++
Sbjct  418   KDTCDRSTVEKMVRGLMEDKNEEIRKSTAIYSSMARNSVAKGGSSYHSMSKLIEDIKSIQ  477



>gb|AFJ53010.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=459

 Score =   462 bits (1188),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 234/484 (48%), Positives = 323/484 (67%), Gaps = 42/484 (9%)
 Frame = +2

Query  92    RSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSY  271
             R   HVLIFP+P+QGHV  ML LAELLC  S+I VTF NS+   +RLL++T +  RF+ Y
Sbjct  6     RPPPHVLIFPYPLQGHVTSMLNLAELLCL-SNIRVTFFNSDHIQRRLLQFTSVQSRFAKY  64

Query  272   PN-FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCII  448
             P  F+F+TISDGLP+DH R+G  V+DLF S++ +T+P F+E+L S       +PP+ C+I
Sbjct  65    PYLFHFQTISDGLPSDHSRSGKDVLDLFLSMSTITRPLFKELLLSN------QPPIDCVI  118

Query  449   ADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLN---GESDMDKLL  619
             +DG + F ++V +E+ IP + FRT  ASCFW +FC+P +IE+G+LP+     E DM++++
Sbjct  119   SDGGLEFTVEVADEVGIPLVYFRTIGASCFWIYFCIPDMIEAGELPIRVEVEEEDMERVI  178

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
               V G E VLR RDLPS CR  DLSD    +++L T ++ +   LILNTFEDLE     +
Sbjct  179   TKVPGAEGVLRCRDLPSLCRVGDLSDPFLQAIVLTTRKSPKVYALILNTFEDLE----VE  234

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             I+   P                +SSR  +  R      EEDRSCM WLD QP KSV+Y +
Sbjct  235   IKAFQPQ---------------NSSRIIIVVR------EEDRSCMKWLDLQPPKSVLYAN  273

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKG-YMV  1147
             FGS+TV+   + +E WHG++NS + FLW IR  ++   +N    P EL++G  K   +MV
Sbjct  274   FGSITVMKPEELVEIWHGLINSKQKFLWVIRQGTITSIENTSEFPEELVKGGSKGDEFMV  333

Query  1148  --GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKN  1321
               GW  Q+EVL H ++GGFLTHSGWNSTLE+I  G+PMIC P++ADQQVNSR    VWK 
Sbjct  334   LSGWVAQKEVLDHGSIGGFLTHSGWNSTLETIVAGVPMICLPYFADQQVNSRFTSEVWKL  393

Query  1322  GVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
             G+DMKD+C R  VE+MV ELM  R++EF +C+ +MA+LAR +V+  G S  NL+ L+E++
Sbjct  394   GLDMKDSCKRGVVERMVNELMVERKEEFGRCAAKMAELARMSVSTGGCSSRNLEDLIEEI  453

Query  1502  KKMK  1513
             + M+
Sbjct  454   RSMR  457



>emb|CBI36709.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   461 bits (1187),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 244/478 (51%), Positives = 310/478 (65%), Gaps = 64/478 (13%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             M+ RS S HVLIFP PVQGHVN ML+LAELL   + + +TFLNS++ H RLLRYT++  R
Sbjct  23    MEHRSVSPHVLIFPLPVQGHVNPMLKLAELLSL-AGLRITFLNSDYNHHRLLRYTNILDR  81

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             ++ YP F F+TISDGLP D PRTG  + D+ + I A TKP FREM+ S    S    PVT
Sbjct  82    YTRYPGFRFQTISDGLPLDRPRTGAGLRDMMDGIKATTKPLFREMVISWCRSSD---PVT  138

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             CIIADG+M FAIDV NE+ +P I  RT S  CF A+F   +LIE+G++P   + DMD+L+
Sbjct  139   CIIADGLMSFAIDVANEVGVPIISCRTVSPCCFLAYFSFAELIEAGEVPFK-DDDMDRLV  197

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
               V GME  LR RDLPSFCRT D +DRG   +I  T +T RA+ LILNTFEDL+   L+Q
Sbjct  198   TRVPGMEGFLRRRDLPSFCRTRDANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQ  257

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             IR H P +YTIGPLHAHL++R++S      +  S+S W EDRSC+AWLD QP KSV+YVS
Sbjct  258   IRNHCPKIYTIGPLHAHLKSRLASETTTSQF--SNSFWVEDRSCLAWLDRQPSKSVIYVS  315

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI-GDDNIPAELIEGTRKKGYMVGWA  1156
             FGS+TV+T+ Q +EFWHG+VNSG  FLW IRP+S+   D + P              GW 
Sbjct  316   FGSITVITKEQMMEFWHGLVNSGSRFLWVIRPDSLTEKDGDAPG------------CGWV  363

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             P                                           NSR V  VWK G+DMK
Sbjct  364   P-------------------------------------------NSRFVSHVWKMGMDMK  380

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             DTCDR+T+EKMV+++ME RR EFTK  + MAKLAR+++++ G+SY N DRL+ED++ M
Sbjct  381   DTCDRVTIEKMVRDVMEGRRAEFTKSVDAMAKLARRSLSEGGTSYCNFDRLIEDIRLM  438



>gb|AFK79038.1| glycosyltransferase UGT6 [Bupleurum chinense]
Length=489

 Score =   462 bits (1190),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 245/477 (51%), Positives = 320/477 (67%), Gaps = 7/477 (1%)
 Frame = +2

Query  101   SHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNF  280
             +HVLIFP P+QG VNCML+LAELL   +++HVTFLN+      L+++T +  RF+ YP+F
Sbjct  11    AHVLIFPLPLQGPVNCMLKLAELL-ALNNLHVTFLNTTHIQNSLIKHTHVESRFTKYPDF  69

Query  281   YFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGI  460
              F TI DGL  DHPRTGD+ +D+ + I  V KP FREMLSSG L S    PV+ +IADG 
Sbjct  70    RFETIPDGLSEDHPRTGDKFLDITHGIEKVMKPLFREMLSSGKLSSKSSKPVSLVIADGF  129

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
               F + +  E  IP + F T S    W FF +P LI+ G++P   E D DK +  + G E
Sbjct  130   YNFGVGIAKEAGIPLVYFDTISPCAVWTFFSLPTLIKLGEVPFT-EEDYDKKVTCIPGTE  188

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
               LR RDLPSF RT+DLSD     ++       ++ G+ILNT E ++   ++Q+  +  N
Sbjct  189   KYLRPRDLPSFFRTSDLSDPIVHLILQEIEAIPKSQGIILNTSEHIDGQIISQLSTYCSN  248

Query  821   LYTIGPLHA-HLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTV  997
             +YTIGPLHA H    +S  +      SS+SLWEED SCM WLD QP KSV+YVS GS+ V
Sbjct  249   VYTIGPLHALHKSIMLSKDKASPQANSSNSLWEEDNSCMTWLDAQPRKSVIYVSIGSLAV  308

Query  998   LTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVGWAPQEE  1168
             ++  Q +E  HGIVNSGK FLW  RP S+ G D    I  EL + T ++G +V W  QEE
Sbjct  309   MSIAQLMELRHGIVNSGKRFLWVQRPGSLSGKDEDYAISTELSDATTERGCIVSWVFQEE  368

Query  1169  VLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCD  1348
             VL HPA+G FLTHSGWNSTLE I EG+PM+CWP++ DQQVNSR V  VW  G+D+KD CD
Sbjct  369   VLAHPAIGLFLTHSGWNSTLEGIIEGVPMLCWPYFVDQQVNSRFVQEVWSVGIDIKDKCD  428

Query  1349  RITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVT-QHGSSYSNLDRLVEDLKKMKL  1516
             R+T+EK V+E+ME R+DEF K ++ MAKLAR++V  Q GSS+ N +RLV D++ M+L
Sbjct  429   RVTIEKAVREIMEERKDEFEKSASMMAKLARQSVCDQGGSSHHNFNRLVNDIRLMRL  485



>ref|XP_006423294.1| hypothetical protein CICLE_v10030404mg [Citrus clementina]
 ref|XP_006469143.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Citrus sinensis]
 gb|ESR36534.1| hypothetical protein CICLE_v10030404mg [Citrus clementina]
Length=477

 Score =   462 bits (1189),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 236/484 (49%), Positives = 319/484 (66%), Gaps = 13/484 (3%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M+Q    HV++ PFP  GH+  ML LA+L  H +   +TF+N+E  H RL   TD+   +
Sbjct  1     MEQTRVPHVVLLPFPAYGHIKPMLSLAKLFSH-AGFRITFVNTEQYHDRLFGNTDVTAFY  59

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
               +PNF   +I DGLP D+PR G  + D F S   V+K  FR++L      + GR P TC
Sbjct  60    KHFPNFLCTSIPDGLPPDNPRFGIYIKDWFCSNKPVSKLAFRQLL-----MTPGRLP-TC  113

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             II+D IM FAIDV  EL IP I FR +SA C W+ F   KL E G+LP+  E + DK + 
Sbjct  114   IISDSIMSFAIDVAEELNIPIITFRPYSAYCSWSDFHFSKLAEEGELPVTDE-NFDKSVT  172

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              +  +EN+ R RDLPS CR     D    + I  T  TTR + L++NTF ++E   ++++
Sbjct  173   CIPELENIFRNRDLPSICRHGGPDDPILQTFIRDTSATTRTSALVINTFNEIEGPIMSKL  232

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGEL-PWRSSSS-LWEEDRSCMAWLDEQPLKSVVYV  976
                +  +YTIGPLHA L++R+     E  P  S++  L +EDRSCM WL  QP +SV+YV
Sbjct  233   GSRLTKIYTIGPLHALLKSRIQEDSVESSPLESNNCVLSKEDRSCMTWLGSQPSRSVLYV  292

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI---PAELIEGTRKKGYMV  1147
             SFGS   L+ +Q LEFWHGIVNSGK FLW IR + + G+  +   PAEL +GT+++G +V
Sbjct  293   SFGSFIKLSGDQILEFWHGIVNSGKGFLWVIRSDLIDGESGVGPVPAELDQGTKERGCIV  352

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
              WAPQEEVL H A+GGFLTHSGWNSTLES+  G+PMICWP   DQQVNSR V  +WK G 
Sbjct  353   SWAPQEEVLAHQAIGGFLTHSGWNSTLESMVAGVPMICWPQVGDQQVNSRCVSEIWKIGF  412

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKDTCDR T+EK+V++LM+ +RD+  + + ++AK+AR AV + GSSY NL++L+ED++ 
Sbjct  413   DMKDTCDRSTIEKLVRDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLEKLIEDIRL  472

Query  1508  MKLQ  1519
             M  +
Sbjct  473   MAFK  476



>ref|XP_007026849.1| UDP-glucosyl transferase 85A3, putative [Theobroma cacao]
 gb|EOY07351.1| UDP-glucosyl transferase 85A3, putative [Theobroma cacao]
Length=468

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 243/473 (51%), Positives = 321/473 (68%), Gaps = 16/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+ PFP QGH+  ML LAELLC ++ + VTFLN+  +H+RL    DL  RF   P  +
Sbjct  5     HVLVLPFPAQGHIKPMLCLAELLC-QAGLRVTFLNTHHSHRRLNNLQDLSTRF---PTLH  60

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F ++SDGLP DHPR     + L +SI  VTKP  R++L+S SL++   PPV+CIIADGI+
Sbjct  61    FESVSDGLPEDHPRNLVHFMHLVHSIKNVTKPLLRDLLTSLSLKTD-IPPVSCIIADGIL  119

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              FAIDV  EL+I  I+FRT S+ C W++ CVPKLI+ G+L  + +SDM + + +V  M+ 
Sbjct  120   SFAIDVAEELQIKVIIFRTISSCCLWSYLCVPKLIQQGELQFS-DSDMGQKVSSVPEMKG  178

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
              LRL D P       L D  F   +  T   TRA+ +I NTF+ LE   L+Q+   +P +
Sbjct  179   SLRLHDRPYSFGLKQLEDPNFQFFVSETQAMTRASAVIFNTFDSLEAPVLSQMIPLLPKV  238

Query  824   YTIGPLHAHLRARVSSSRGELPWRSS--SSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTV  997
             YTIGPLHA  +AR+    G+L   SS   +L E D +C+ WLD QPL+SVVYVSFGS  V
Sbjct  239   YTIGPLHALRKARL----GDLSQHSSFNGNLREADHNCITWLDSQPLRSVVYVSFGSHVV  294

Query  998   LTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN----IPAELIEGTRKKGYMVGWAPQE  1165
             LT  + LEFWHG+VNSGK FLW +RP+ + G+ +    I  E   GT++KG +V WAPQE
Sbjct  295   LTSEELLEFWHGLVNSGKRFLWVLRPDIIAGEKDHNQIIAREPDLGTKEKGLLVDWAPQE  354

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             EVL HP+VGGFLTH GWNSTLES+  G+PM+CWP   DQ VNS  V  VWK G+D+KD C
Sbjct  355   EVLAHPSVGGFLTHCGWNSTLESMVAGVPMLCWPKLPDQLVNSSCVSEVWKIGLDLKDMC  414

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             DR TVEKMV+ LME RR+E  +  + ++KLAR++V+  GSS SNL+ L+++L+
Sbjct  415   DRSTVEKMVRALMEDRREEVMRSVDGISKLARESVSHGGSSSSNLEMLIQELE  467



>ref|XP_009346996.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=485

 Score =   460 bits (1184),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/494 (47%), Positives = 319/494 (65%), Gaps = 32/494 (6%)
 Frame = +2

Query  80    TMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             T    S++HVL+ PFP QGH+  ML  A+LL H + IHVTFLN+E  H+ L +   L  R
Sbjct  3     TERSESAAHVLLLPFPAQGHITPMLSFAQLLGH-AGIHVTFLNTEHNHRLLTQRHALSAR  61

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREML---------SSGSL  412
             F   P  +F ++ DGLP D PR+   ++D+ +S+ +VTKP  R++L         S GS 
Sbjct  62    F---PTLHFESLPDGLPPDCPRSIPHIIDMVSSLKSVTKPLLRDLLITLTKKDEESYGS-  117

Query  413   QSSGRPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLN  592
              S+ RPP++C+I D IMCFAIDV  ++ +P +     S   +W++ C+P LI+ G +P  
Sbjct  118   TSTRRPPLSCVIMDEIMCFAIDVAEKVGVPAMAITVISGCGYWSYSCIPNLIQQGHVPFT  177

Query  593   GESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFE  772
              E DMDK   ++ GME +LR RDLP FCR +   D     + +  ++ TRA+ LI+NTF+
Sbjct  178   DE-DMDKQSSDIPGMEGLLRRRDLPGFCRFS--IDHPVTKIFMEVIKATRASALIINTFD  234

Query  773   DLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQ  952
              LE S L+ I    P +Y IGP+HA +++RV          SS+SL +EDR CMAWLD +
Sbjct  235   GLEASILSHIATLFPQVYAIGPVHALVKSRVGDGLS-----SSASLRQEDRRCMAWLDSK  289

Query  953   PLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN--------IPA  1108
             P+ SV+YVSFGS+  LT +Q  EFWHG+V+ GK FLW +R + + G+          IP 
Sbjct  290   PVGSVIYVSFGSLVELTHDQLFEFWHGLVSCGKQFLWVVRSDMISGEQGEHVIPTELIPT  349

Query  1109  ELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQV  1288
             EL  GT+++G +V WAPQEEVL H AVGGFLT  GWNS LE I  G+PM+CWP  A+Q V
Sbjct  350   ELKMGTKERGLIVEWAPQEEVLAHKAVGGFLTQCGWNSILEGIWAGVPMLCWPRLAEQLV  409

Query  1289  NSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEV--RRDEFTKCSNRMAKLARKAVTQHG  1462
              SR +G VW+ G+DMKDTC+R  VEKM++ LME    R++  +   R +KLAR AVT+ G
Sbjct  410   TSRWIGEVWRIGIDMKDTCERSMVEKMIRRLMEEGDEREQILRSVERFSKLARGAVTEGG  469

Query  1463  SSYSNLDRLVEDLK  1504
             SSY+NLD+L++DL+
Sbjct  470   SSYNNLDKLIQDLR  483



>ref|XP_006481394.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Citrus sinensis]
Length=469

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 232/476 (49%), Positives = 311/476 (65%), Gaps = 13/476 (3%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M+Q    HV++FP+P  GH+  ML LAEL  H +   VTF+N+E  H RLL   D+   +
Sbjct  1     MEQTRVPHVVLFPYPAYGHIKPMLTLAELFSH-AGFRVTFVNTEQYHDRLLGNNDVTGFY  59

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
               +PNF F +I DGLP D+PR G  + D F S   V+K  F ++L S  L        TC
Sbjct  60    KRFPNFRFTSIPDGLPPDNPRFGIYIKDWFCSDKPVSKLAFLQLLMSPGLLP------TC  113

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             II+D IM F IDV  EL IP I FR +SA C W+ F   KL E G+LP+  E + DK ++
Sbjct  114   IISDSIMSFTIDVAEELNIPIITFRPYSAHCSWSDFHFSKLAEEGELPVTNE-NFDKPVK  172

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              + G+EN  R RDLPS CR     D    + I  T  TTR + L++NTF ++E   ++++
Sbjct  173   CIPGLENFFRNRDLPSICRDGGPDDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKL  232

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGEL--PWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
                +  +YT+GPLHA L++R+     E   P  ++  L +EDRSCM WLD QP +SV+YV
Sbjct  233   GSRLTKIYTVGPLHALLKSRIQEDSAESSPPESNNCVLSKEDRSCMTWLDSQPSRSVLYV  292

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI---PAELIEGTRKKGYMV  1147
             SFGS   L R Q LEFWHG+VNSGK FLW IR + + G+  +   P EL +GT+++G +V
Sbjct  293   SFGSFIKLGREQILEFWHGMVNSGKRFLWVIRSDLIDGEPGVGPVPVELEQGTKERGCIV  352

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
              WAPQEEVL H A+GGFLTHSGWNSTLES+  G+PMICWP   DQQVNSR V  +WK G+
Sbjct  353   SWAPQEEVLAHQAIGGFLTHSGWNSTLESLVAGVPMICWPQIGDQQVNSRCVSEIWKIGL  412

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
             DMKDTCDR T+E +V++LM+ +RD+  + + ++AK+AR AV + GSSY NLD+L++
Sbjct  413   DMKDTCDRSTIENLVRDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLDKLIK  468



>dbj|BAB86920.1| glucosyltransferase-2 [Vigna angularis]
Length=485

 Score =   459 bits (1181),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 239/473 (51%), Positives = 312/473 (66%), Gaps = 13/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+ P P+QG+VN M++LA         H++            R     L F++ P   
Sbjct  13    HVLLLPGPMQGNVNSMMKLAPSSSASLPHHLSHHRFHPPPPPPFRRH--PLSFTNLPQPR  70

Query  284   FRTISDGLPADHPRTG-DRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGI  460
              +     LP DHPR+  + + DL++S+N+  KP  R+++ S   Q++ +P +TC+I DG 
Sbjct  71    DQDHLRCLPDDHPRSDRNALADLYSSMNSHAKPLIRDIILS---QTAAKPKITCLIGDGF  127

Query  461   MC-FAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGM  637
                   DV +E+ IP I FR  SASCFWA FC P L ES +LP+ GE DMD+++  + GM
Sbjct  128   FGGLTADVADEVGIPVIHFRAISASCFWALFCAPNLFESNELPIRGEEDMDRIIATLPGM  187

Query  638   ENVLRLRDLPSFCRTTDLSDRGFL-SVILATLRTTRANGLILNTFEDLEESALAQIRKHI  814
             EN+LR RDLP F R T+ +    L S +    +T RA G+ILNTFEDL+   L Q+R   
Sbjct  188   ENILRCRDLPGFFRGTETNLVDPLKSTVFDCHQTLRARGVILNTFEDLDGPLLTQMRLKF  247

Query  815   PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMT  994
               ++ +G LHAHL  R  S     P  S+SS WEEDRSC+ WLD QPLKSV+YVSFGS+T
Sbjct  248   LRVFAVGSLHAHLNYRRVSDAKTTP--STSSFWEEDRSCLTWLDSQPLKSVLYVSFGSIT  305

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVGWAPQE  1165
              +TR + +EFW+G+VNS K FLW IRP+ V G DN   + AEL EGT+++G++VGWAPQE
Sbjct  306   TVTRERLMEFWYGLVNSKKRFLWVIRPDMVAGADNDERVAAELEEGTKERGFIVGWAPQE  365

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             EVL H A+GGFLTHSGWNSTLES+  G+PMICWP +ADQQ+NSR V  VWK G+DMKD C
Sbjct  366   EVLAHKAIGGFLTHSGWNSTLESLVAGVPMICWPCFADQQINSRFVSEVWKLGLDMKDLC  425

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             DR  VEKMV +LM  RR+EF K +  MA LA K+V+  GSSYS+L  LVE +K
Sbjct  426   DRDVVEKMVNDLMVHRREEFLKSAQAMATLADKSVSPGGSSYSSLHDLVEFIK  478



>gb|KDO43669.1| hypothetical protein CISIN_1g011792mg [Citrus sinensis]
Length=477

 Score =   459 bits (1180),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 234/484 (48%), Positives = 318/484 (66%), Gaps = 13/484 (3%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M+Q    HV++ PFP  GH+  ML LA+L  H +   +TF+N++  H RL   TD+   +
Sbjct  1     MEQTRVPHVVLLPFPAYGHIKPMLSLAKLFSH-AGFRITFVNTDQYHDRLFGNTDVTAFY  59

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
               +PNF   +I DGLP D+PR G    D F S   V+K  FR++L      + GR P TC
Sbjct  60    KHFPNFLCTSIPDGLPPDNPRFGIYTKDWFCSNKPVSKLAFRQLL-----MTPGRLP-TC  113

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             II+D IM FAIDV  EL IP I FR +SA C W+ F   KL E G+LP+  E + DK + 
Sbjct  114   IISDSIMSFAIDVAEELNIPIITFRPYSAYCSWSDFHFSKLAEEGELPVTDE-NFDKPVT  172

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              +  +EN+ R RDLPS CR     D    + I  T  TTR + L++NTF ++E   ++++
Sbjct  173   CIPELENIFRNRDLPSICRHGGPDDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKL  232

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGEL-PWRSSSS-LWEEDRSCMAWLDEQPLKSVVYV  976
                +  +YT+GPLHA L++R+     E  P  S++  L +EDRSCM WL  QP +SV+YV
Sbjct  233   GSRLTKIYTVGPLHALLKSRIQEDSVESSPLESNNCVLSKEDRSCMTWLGSQPSRSVLYV  292

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI---PAELIEGTRKKGYMV  1147
             SFGS   L+ +Q LEFWHGIVNSGK FLW IR + + G+  +   PAEL +GT+++G +V
Sbjct  293   SFGSFIKLSGDQILEFWHGIVNSGKGFLWVIRSDLIDGESGVGPVPAELDQGTKERGCIV  352

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
              WAPQEEVL H A+GGFLTHSGWNSTLES+  G+PMICWP   DQQVNSR V  +WK G 
Sbjct  353   SWAPQEEVLAHQAIGGFLTHSGWNSTLESMVAGVPMICWPQVGDQQVNSRCVSEIWKIGF  412

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             DMKDTCDR T+EK+V++LM+ +RD+  + + ++AK+AR AV + GSSY NL++L+ED++ 
Sbjct  413   DMKDTCDRSTIEKLVRDLMDNKRDKIMESTVQIAKMARDAVKEGGSSYRNLEKLIEDIRL  472

Query  1508  MKLQ  1519
             M  +
Sbjct  473   MAFK  476



>ref|XP_008388092.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   456 bits (1174),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 241/493 (49%), Positives = 317/493 (64%), Gaps = 27/493 (5%)
 Frame = +2

Query  74    TPTMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLH  253
             T   +  S++HVL+ PFP QGH+  ML LA+LLCH + IHVTFL++E  H+ L +   L 
Sbjct  3     TEMEESESAAHVLLLPFPAQGHITPMLSLAQLLCH-AGIHVTFLSTEXNHRXLTQRRALS  61

Query  254   LRFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR--  427
              RF   P  +F +I D LP D P     + D+ +S+ +VTKP  R++L + + +      
Sbjct  62    ARF---PTLHFESIPDALPPDQPPAIHSLHDISSSLRSVTKPLLRDLLITLAKKDDESYR  118

Query  428   ------PPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPL  589
                   PP++C+I DGIMCFAIDV  E+ IP +  RT SA  FW + C+P LI+ G LP 
Sbjct  119   STTIRCPPLSCVIIDGIMCFAIDVAEEVGIPVLALRTVSACSFWCYSCIPDLIQQGQLPF  178

Query  590   NGESDMDKLLENVEGMENVLRLRDLPSFCR--TTDLSDRGFLSVILATLRTTRANGLILN  763
               + DMD  + ++ GME +LR RDLPSFCR      S + F+  I A    TR + +I N
Sbjct  179   Q-DQDMDHPIRDIPGMEALLRXRDLPSFCRMPIDHPSFKFFMEQIEAI---TRVSAIIXN  234

Query  764   TFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWL  943
             TF+DL    L QI      +YT+GP HA L++RV    G+    S SSL  EDR CMAWL
Sbjct  235   TFDDLXPXILXQIATRFXKIYTLGPXHALLKSRV----GDDLSSSVSSLRHEDRRCMAWL  290

Query  944   DEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAEL  1114
             D Q   SV++VSFGS+  L+R Q LEFWHG++NSGK FLW +R + +     +   P EL
Sbjct  291   DSQQSGSVIFVSFGSLAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLXSGQEEXATPVEL  350

Query  1115  IEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNS  1294
              +GT+++GY+  W PQEEVL H AVGGF THSGWNST+E I  G+PM+CWP  ADQQVNS
Sbjct  351   EDGTKERGYIAEWVPQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNS  410

Query  1295  RLVGAVWKNGVDMKDTCDRITVEKMVKELMEV--RRDEFTKCSNRMAKLARKAVTQHGSS  1468
             R VG  WK G+DMKDTCDR TVEKMV+ LME   +R++  K  +  AKLAR AV++ GSS
Sbjct  411   RWVGEGWKIGLDMKDTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSS  470

Query  1469  YSNLDRLVEDLKK  1507
             Y NL++L+EDL +
Sbjct  471   YKNLEKLIEDLNE  483



>ref|XP_010923185.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   454 bits (1169),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 237/473 (50%), Positives = 310/473 (66%), Gaps = 8/473 (2%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFPFP QGHV  ML+LAEL    + + +TF+N+E  H+RLL  +      +  P F 
Sbjct  9     HVLIFPFPAQGHVPTMLKLAELFLL-AGLRITFINTERIHRRLLLNSPTLPPLARLPRFR  67

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             FRTI DGLP D  R    + +L  SI   ++  +R++L+         P VTC++ADG +
Sbjct  68    FRTIPDGLPEDDRRASVPLQELEESIRTRSREPYRDLLAPAGRDPDEWPSVTCVVADGSL  127

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
               + +V  E+ IP I FRT SA  FWA++ +P LI+ G++P   E+D D+ +  V GME+
Sbjct  128   PLSWEVAEEVGIPVIFFRTSSACAFWAYYRIPDLIKGGEIPFPEEADWDEKVRGVPGMES  187

Query  644   VLRLRDLPSFCRTTDL-SDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
              LR RDLPSFCR     SDRG  SV  AT  T RA  LILNTFE LE   L+ IR  IP 
Sbjct  188   FLRRRDLPSFCRNAKTTSDRGLQSVDNATASTRRARALILNTFESLEGPVLSHIRSAIPI  247

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
              Y +GPLH  L  +   + G     +S  L +EDRSCM WLD QP +SVVYVSFGS+ V+
Sbjct  248   TYALGPLH--LLVKTFENGGSFVTINSVRLSQEDRSCMTWLDSQPPRSVVYVSFGSVAVM  305

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD--DNIPAELIEGTRKKGYMVGWAPQEEVL  1174
             +R + +EFWHG+V+SG+ FLW +R + V G   + +PAE  EGTR++G +VGWAPQEEVL
Sbjct  306   SREELMEFWHGLVDSGERFLWVLRSDLVEGKTGEAVPAE-AEGTRERGCIVGWAPQEEVL  364

Query  1175  VHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRI  1354
              HPAVG FLTHSGWNSTLES+  G+PMICWP +ADQQ+NSR V  VW+ G DMKD C+R 
Sbjct  365   SHPAVGCFLTHSGWNSTLESVSAGVPMICWPCFADQQINSRFVSDVWRIGADMKDKCERS  424

Query  1355  TVEKMVKELMEVRRDEFTKCSN-RMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
              VEKMV+++M   R E  + S   MA+LAR++V + GSSY +   LVE ++ +
Sbjct  425   IVEKMVRDVMVRERAERLRTSAMEMAELARRSVAKGGSSYRDYWSLVEHIRAI  477



>ref|XP_002530397.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF31967.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=479

 Score =   454 bits (1168),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 238/478 (50%), Positives = 321/478 (67%), Gaps = 17/478 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P QGHVN ML+LAELL   + + +TFLN E+ H+ L R +D+  RF  YP F 
Sbjct  12    HVLIFPAPGQGHVNSMLKLAELL-ALAGLKITFLNFEYIHENLFRCSDVQARFDKYPGFQ  70

Query  284   FRTISDGLPADH--PRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADG  457
             F+TI +  P       T D + +L  ++   +KP F+++L   ++ +    P+ CII D 
Sbjct  71    FKTIPNCWPEGRRIGNTSDTLRELLEAMKMQSKPIFKKILVECNITA----PINCIIGDM  126

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGM  637
             +M F  DV +E+ IP I F T SA     F  +P ++ + +LP+ G+ DMD+L+  V GM
Sbjct  127   LMGFVYDVASEVGIPAIQFHTISACSVLTFLSIPDVLAAQELPVKGKEDMDRLITKVPGM  186

Query  638   ENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIP  817
             EN LR RDLP FC+  + SD   L +I   +R ++A  LILNTFE+L++  LAQIR H P
Sbjct  187   ENFLRRRDLPDFCQ--EASDPSLL-IITKEMRESQA--LILNTFEELDKEILAQIRTHYP  241

Query  818   NLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTV  997
               YTIGPLH  L++R++S + +  + +S+S+ E DRSC+ WLD+QP +SV++VSFGS T+
Sbjct  242   KTYTIGPLHMLLKSRLTSIKKQELYTTSNSIVEVDRSCINWLDKQPKRSVLFVSFGSTTL  301

Query  998   LTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDD--NIPAELIEGTRKKGYMVGWAPQ  1162
             +TR+Q +EFWHGIVNS   FLW +RP S+    GDD      E   G ++ GY+V WAPQ
Sbjct  302   MTRDQMMEFWHGIVNSKIRFLWVLRPQSITAKDGDDLERFLDEFEVGPKESGYIVRWAPQ  361

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             EEVL H A GGFLTHSGWNSTLESI  G+PMICWP+Y DQQVNSR V AVWK G+DMKD 
Sbjct  362   EEVLGHKATGGFLTHSGWNSTLESIAAGVPMICWPYYGDQQVNSRFVSAVWKVGLDMKDV  421

Query  1343  CDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
             CDR  VEKMV +LM  R++EF   S RMA+ A+ +V   GSS+ NL+ L++D++ M +
Sbjct  422   CDREIVEKMVIDLMVNRKEEFVGSSTRMAEAAKNSVKDGGSSFCNLESLIKDIRLMSM  479



>ref|XP_010674282.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   454 bits (1169),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 233/526 (44%), Positives = 321/526 (61%), Gaps = 62/526 (12%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             SSH+LIFP P+QGH+  ML LAEL C  +++ VTFLN+   H+ L ++TD+  RF+ YP+
Sbjct  8     SSHILIFPLPLQGHITPMLHLAELFCL-ANLKVTFLNTNKNHKLLTQHTDIQARFARYPS  66

Query  278   FYFRTISDGLPADHPRT-------------------------------------------  328
             F F TI D    D P+                                            
Sbjct  67    FRFETIPDSPSKDQPQAQAQAQAQAQEQEQKRAQKQAQAQAQEQEQKQAQEQAQAQALAL  126

Query  329   -------GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIMCFAIDVGN  487
                     D +  L  ++    +P  RE+L         R  +TC I DG + FA ++ +
Sbjct  127   AVKRSNLKDALEALHEALAPSAEPLLRELLFGT------RDKITCFIIDGWLRFAYEIAS  180

Query  488   ELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLP  667
             E  +P I FR  SA C WA+FC+P +IE+G++P     +MD+L++NV GM++ LR RDLP
Sbjct  181   EAEVPVIAFRCPSACCIWAYFCIPHIIEAGEVPFKDNEEMDQLVKNVPGMDSFLRCRDLP  240

Query  668   SFCRTTDLSDRGFLS--VILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPL  841
             SFCR  D+S    L    +    RT  A+  ILNTFEDLE   L+QIR     +Y+IGPL
Sbjct  241   SFCREQDMSSCCELQEYFVGEIQRTKYAHSFILNTFEDLEGPILSQIRSQCSTVYSIGPL  300

Query  842   HAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLE  1021
             HAHL+ R+      L   SSSSLWE D+SC++WLD++P KSV+YVS GS T LT++Q  E
Sbjct  301   HAHLKYRLGKGETPLSNNSSSSLWEVDKSCISWLDQKPDKSVIYVSLGSTTTLTKDQLTE  360

Query  1022  FWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKGYMVGWAPQEEVLVHPAVG  1192
              W G+V S + FLW + PN +I    D   P +L+EGT K+G +V W+PQ+EVL H A+G
Sbjct  361   LWTGLVQSKRYFLWVVSPNVIIEGGLDSPTPNDLLEGTEKRGCIVKWSPQDEVLTHRAIG  420

Query  1193  GFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMV  1372
             GFLTHSGWNSTLESI  G+PM+CWP +ADQQ+NSR    VW+ G+DMKDTCDR  VEKM+
Sbjct  421   GFLTHSGWNSTLESIVAGVPMLCWPHFADQQLNSRFASEVWRIGLDMKDTCDRTIVEKMI  480

Query  1373  KELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
              +LM+ ++DE  + + R+++ A+K++++ GSSYSNL+RL+ED+  M
Sbjct  481   NDLMDGKKDELQRSAKRVSQEAKKSISEGGSSYSNLNRLIEDIIAM  526



>ref|XP_008353149.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   452 bits (1164),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 240/493 (49%), Positives = 315/493 (64%), Gaps = 27/493 (5%)
 Frame = +2

Query  74    TPTMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLH  253
             T   +  S++HVL+ PFP QGH+  ML LA+LLCH + IHVTFL++E  H+ L +   L 
Sbjct  3     TEMEESESAAHVLLLPFPAQGHITPMLSLAQLLCH-AGIHVTFLSTEHNHRLLTQRRALS  61

Query  254   LRFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR--  427
              RF   P  +F +I D LP D P     + D+ +S+ +VTKP  R++L + + +      
Sbjct  62    ARF---PTLHFESIPDALPPDQPPAIHSLHDISSSLRSVTKPLLRDLLITLAKKDDESYR  118

Query  428   ------PPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPL  589
                   PP++C+I DGIMCFAID   E+ IP    RT SA  FW + C+P LI+ G LP 
Sbjct  119   STTIRCPPLSCVIIDGIMCFAIDXAEEVGIPVXALRTVSACSFWCYSCIPDLIQQGQLPF  178

Query  590   NGESDMDKLLENVEGMENVLRLRDLPSFCR--TTDLSDRGFLSVILATLRTTRANGLILN  763
               + DMD  + ++ GME +LR RDLPSFCR      S + F+  I A    TR + +I N
Sbjct  179   Q-DQDMDHPIRDIPGMEALLRXRDLPSFCRMPIDHPSFKFFMEQIEAI---TRVSAIIXN  234

Query  764   TFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWL  943
             TF+DL    L QI      +YT+GP HA L++RV    G+    S SSL  EDR CMAWL
Sbjct  235   TFDDLXPXILXQIATRFXKIYTLGPXHALLKSRV----GDDLSSSVSSLRHEDRRCMAWL  290

Query  944   DEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAEL  1114
             D Q   SV++VSFGS+  L+R Q LEFWHG++NSGK FLW +R + +     +   P EL
Sbjct  291   DSQQSGSVIFVSFGSLAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLXSGQEEXATPVEL  350

Query  1115  IEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNS  1294
              +GT+++GY+  W PQEEVL H AVGGF THSGWNST+E I  G+PM+CWP  ADQQVNS
Sbjct  351   EDGTKERGYIAEWVPQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCWPQLADQQVNS  410

Query  1295  RLVGAVWKNGVDMKDTCDRITVEKMVKELMEV--RRDEFTKCSNRMAKLARKAVTQHGSS  1468
             R VG  WK G+DMKDTCDR TVEKMV+ LME   +R++  K  +  AKLAR AV++ GSS
Sbjct  411   RWVGEGWKIGLDMKDTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLARHAVSEDGSS  470

Query  1469  YSNLDRLVEDLKK  1507
             Y NL++L+EDL +
Sbjct  471   YKNLEKLIEDLNE  483



>ref|XP_010316060.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Solanum lycopersicum]
Length=469

 Score =   452 bits (1162),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 226/473 (48%), Positives = 306/473 (65%), Gaps = 27/473 (6%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+FP P+Q  +N ML+LAEL C  + + VTFLN+    Q L R+TD+  RF  YP F 
Sbjct  4     HVLLFPLPIQSPINSMLQLAELFCL-AGLQVTFLNTNHNQQLLYRHTDVESRFRQYPKFQ  62

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             FRTISDGLP DHPR+     DL  S+ AV +P  RE+++           VTC+I DG+ 
Sbjct  63    FRTISDGLPDDHPRSSLLFGDLITSLQAVAEPFLREIVTESG--------VTCVIPDGLF  114

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              +A+D+ NEL +  I F T S  C W + C PKLI+SGD+P           ENV GME+
Sbjct  115   YYAVDICNELGVSVISFDTISPCCLWVYLCFPKLIQSGDIPFK---------ENVPGMED  165

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTT-RANGLILNTFEDLEESALAQIRKHIPN  820
             +LR RD P F R T+ +   +  + L  +++  R++GLILNTFEDL+   L+ IR H P 
Sbjct  166   LLRRRDFP-FYRLTNCATDLYCQLALKEIQSIPRSHGLILNTFEDLDGPLLSNIRTHCPQ  224

Query  821   LYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVL  1000
              Y +GPL   L+ R++         SS+SL EED S + WLD QP++SV+YVSFGS+  L
Sbjct  225   TYAVGPLQLQLKTRLADKS----MSSSNSLREEDGSSIQWLDAQPVESVIYVSFGSLATL  280

Query  1001  TRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD---NIPAELIEGTRKKGYMVGWAPQEEV  1171
             T+ + LEFWHG+VNSG  FLW +R + +  ++       EL +G +++ Y+V WAPQE+V
Sbjct  281   TKEEMLEFWHGLVNSGIRFLWVMRSDLLREEEFSHQFVKELADGCKERAYIVSWAPQEKV  340

Query  1172  LVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDR  1351
             L HPA+GGFLTHSGWNST+ESI E  PMICW  Y DQ+V SR VG VWK G+DMKD CDR
Sbjct  341   LSHPAIGGFLTHSGWNSTMESIVERKPMICWAVYVDQRVTSRFVGEVWKIGLDMKDICDR  400

Query  1352  ITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
               +EK VK+LM   +D+  K  ++++ LA+ +V + GSSY+  + LV D+KK+
Sbjct  401   YIIEKAVKDLMVTNKDKLKKSVDKLSMLAKISVGEGGSSYNAFESLVIDIKKL  453



>gb|KDO38335.1| hypothetical protein CISIN_1g044936mg [Citrus sinensis]
Length=455

 Score =   450 bits (1158),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 229/462 (50%), Positives = 304/462 (66%), Gaps = 13/462 (3%)
 Frame = +2

Query  149   MLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRT  328
             ML LAEL  H +   VTF+N+E  H RLL  TD+   +  +PNF F +I DGLP D+PR 
Sbjct  1     MLTLAELFSH-AGFRVTFVNTEQYHDRLLGNTDVTGFYKRFPNFRFTSIPDGLPPDNPRF  59

Query  329   GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIMCFAIDVGNELRIPTI  508
             G  + D F S   V+K  FR +L      + GR P TCII+D IM F IDV  EL IP I
Sbjct  60    GIYIKDWFCSDKPVSKLAFRRLL-----MTPGRLP-TCIISDSIMSFTIDVAEELNIPII  113

Query  509   LFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTD  688
              FR +SA C W+ F   KL E G+LP+  E D DK +  + G+EN+ R RDLPS CR   
Sbjct  114   TFRPYSAHCSWSDFHFSKLAEEGELPVTNE-DFDKPVTCIPGLENIFRNRDLPSICRDGG  172

Query  689   LSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVS  868
               D    + I  T  TTR + L++NTF ++E   ++++   +  +YT+GPLHA L++R+ 
Sbjct  173   PDDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKLGSRLTKIYTVGPLHALLKSRIQ  232

Query  869   SSRGEL--PWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVN  1042
                 E   P  ++  L +EDRSCM WLD QP  +V+YVSFGS   L R Q LEFWHG+VN
Sbjct  233   EDSAESSPPESNNCVLSKEDRSCMTWLDSQPSGTVLYVSFGSFIKLGREQILEFWHGMVN  292

Query  1043  SGKAFLWAIRPNSVIGDDNI---PAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSG  1213
             SGK FLW IR + + G+  +   P EL +GT+++G +V WAPQEEVL H A+GGFLTHSG
Sbjct  293   SGKRFLWVIRSDLIDGEPGVGPVPVELDQGTKERGCIVSWAPQEEVLAHQAIGGFLTHSG  352

Query  1214  WNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVR  1393
             WNSTLES+  G+PMICWP   DQQVNSR V  +WK G+DMKDTCDR T+E +V++LM+ +
Sbjct  353   WNSTLESMVAGVPMICWPQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTIENLVRDLMDNK  412

Query  1394  RDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
             RDE  + + ++AK+AR AV + GSSY NL++L+ED++ M  +
Sbjct  413   RDEIMESTVKIAKMARDAVKEGGSSYRNLEKLIEDIRSMAFK  454



>ref|XP_008370121.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score =   447 bits (1150),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 236/490 (48%), Positives = 311/490 (63%), Gaps = 26/490 (5%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q+ +SHV++ P P QGH   ML LA+LLCH + IHVTFL ++ +H    +   L  RF  
Sbjct  4     QQQNSHVVLLPLPSQGHFTPMLSLAQLLCH-AGIHVTFLITKHSHSLFTQRDALSARF--  60

Query  269   YPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS-------GSLQSSGR  427
              P  +F +I DGLP DH R    + ++  S+ +  KP  RE+L S        S   S R
Sbjct  61    -PTLHFESIPDGLPPDHGRKFSALHEVGASLRSTIKPFLRELLISLTKKDDETSNDGSTR  119

Query  428   ---PPVTCIIADGI-MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNG  595
                PP+ C++ DGI MCFAIDV  E+ IP    RT SA  FW + C+P LI+ G LP   
Sbjct  120   RRLPPLRCMVIDGIFMCFAIDVAEEVGIPIFALRTTSACSFWCYTCIPDLIQQGQLPFQD  179

Query  596   ESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFED  775
             E DMD+ + ++ GME++LR RDLPSFC+   +    F   +      TR + LILNTF+D
Sbjct  180   E-DMDQPIRDIPGMESLLRRRDLPSFCKMP-IDHPTFKFFVEEFEAITRVSALILNTFDD  237

Query  776   LEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQP  955
             LE   L+ I    P +YT+GP HA L++R+ +        S+SSL  +DR CM WLD Q 
Sbjct  238   LESPILSHIATRFPKIYTLGPFHALLKSRIGNDLSS----SASSLRHQDRRCMTWLDSQQ  293

Query  956   LKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIE---GT  1126
             L+SV++VSFGS+  LTR Q LEFWHG+++SGK FLW IR + +  +    A  ++   GT
Sbjct  294   LRSVIFVSFGSLVKLTRVQLLEFWHGLIDSGKPFLWVIRSDMLWNEQEAHATSVKLEVGT  353

Query  1127  RKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVG  1306
             ++KG++  W PQEEVL H A+GGFLTHSGWNST+E I  G+PM+CWP  ADQ VNSR VG
Sbjct  354   KEKGFIAEWVPQEEVLAHKAIGGFLTHSGWNSTIEGIWAGVPMLCWPQIADQPVNSRWVG  413

Query  1307  AVWKNGVDMKDTCDRITVEKMVKELMEV--RRDEFTKCSNRMAKLARKAVTQHGSSYSNL  1480
               WK G+DMKDTCDR TVEKMV+ LME   R  +  K  +  AKLAR AV + GSSY NL
Sbjct  414   EGWKIGLDMKDTCDRSTVEKMVRALMEEGDRSAQIFKSVDTFAKLARHAVNEDGSSYKNL  473

Query  1481  DRLVEDLKKM  1510
             ++L+ED+KK+
Sbjct  474   EKLIEDVKKL  483



>ref|XP_006361975.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Solanum tuberosum]
Length=470

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 228/472 (48%), Positives = 300/472 (64%), Gaps = 69/472 (15%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+IFPFP QGHVN ML+LA+LL   S+  +TFL +   H  LL +TD+  RF S   F 
Sbjct  6     HVIIFPFPAQGHVNSMLKLAQLLSL-SNFDITFLVTLDTHDHLLNHTDVISRFGS--GFL  62

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
              + +  G+  D   T D +  L++S+N + KP  RE ++          PVTC+IADG++
Sbjct  63    LQALPHGISMDVMNTRDGISMLYDSLNKIAKPFLREFITYS--------PVTCLIADGLL  114

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
               A DV  E+ +P I FRT SAS FW++FC+P LI+ G+LPL                  
Sbjct  115   SLAGDVAKEINLPIIYFRTASASSFWSYFCMPDLIQVGELPL------------------  156

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
                                             +A GLILNTFEDLE   L+QIR   PN+
Sbjct  157   --------------------------------KARGLILNTFEDLEGPILSQIRTVCPNV  184

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             YTIG +HAHL+A++++        SS+SLW+ED S M+WLD QP KSV+YVSFGS+  LT
Sbjct  185   YTIGAVHAHLKAKLATKS-----TSSNSLWQEDESWMSWLDTQPPKSVIYVSFGSVAGLT  239

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELIEGTRKKGYMVGWAPQEEVL  1174
             + + LEFW+G+VNS + FLW +RP+ +IG    D IP EL +GT+ +GYM  W PQE+VL
Sbjct  240   KEELLEFWYGLVNSEQKFLWVMRPDLIIGREKKDEIPVELEQGTKARGYMADWVPQEKVL  299

Query  1175  VHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRI  1354
              H A+GGFLTHSGWNSTLESI EG+PMICWP +ADQQVNSR VG VWK G+D+KDTCDR 
Sbjct  300   AHRAIGGFLTHSGWNSTLESIVEGVPMICWPRFADQQVNSRFVGEVWKMGLDIKDTCDRD  359

Query  1355  TVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
              + K +++LME R  EF++ +  MA LA+KAV + GSSY NLDRL++D++ M
Sbjct  360   IIAKSIRDLMEKRNGEFSQRTEHMASLAKKAVNEGGSSYINLDRLIQDIRSM  411



>dbj|BAB86930.1| glucosyltransferase-12 [Vigna angularis]
Length=463

 Score =   444 bits (1143),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 227/447 (51%), Positives = 298/447 (67%), Gaps = 11/447 (2%)
 Frame = +2

Query  194   VTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLP-ADHPRTGDRVVDLFNSINAV  370
             VTF+N+   H RL RY D+    +SYP  +F TI+D     +H  +GD   D+  S    
Sbjct  15    VTFINTHSIHNRLTRYGDIQSLSASYPTLHFNTIADCYSHGNHTGSGDTSGDIILSTALH  74

Query  371   TKPRFREMLSSGSLQSSGRPPVTCIIADGIM-CFAIDVGNEL--RIPTILFRTFSASCFW  541
              KP  R +L +   QS   P VTCII DGI+   + D+ +EL  RI  I FRT S  CFW
Sbjct  75    AKPLLRNILLA---QSPEIPKVTCIIQDGILGSLSNDLASELGIRITIIHFRTSSPCCFW  131

Query  542   AFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVIL  721
              +F +P L ++ +LP+ G+ DMD+++ N+ GMEN+LR RDLPSFCR     +     V  
Sbjct  132   PYFWLPNLFKTNELPIRGDEDMDRIITNMPGMENLLRCRDLPSFCRPGAKGNMSIDWVSF  191

Query  722   ATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRS-  898
              T ++  A+ LILNTFE+L+   L+QIR H P +YT+GPLH HL  R + + G     S 
Sbjct  192   QTQQSLAADALILNTFEELDRLVLSQIRLHFPKVYTLGPLHHHLNVRKAETNGANDAPSF  251

Query  899   SSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPN  1078
              SS +E DRSCMAWLD Q   SV+YVSFG+ T++TR + +EFWHG+V+S K FLW +RP+
Sbjct  252   RSSFFEVDRSCMAWLDAQAQGSVLYVSFGTSTIVTREELMEFWHGLVDSKKRFLWVMRPD  311

Query  1079  SVIG---DDNIPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGL  1249
              V+G   DD IP E+ EGT+++G MV WAPQEEVL H A+GGFLTHSGWNSTLES+  G+
Sbjct  312   LVVGRENDDRIPEEVEEGTKERGLMVEWAPQEEVLAHKAIGGFLTHSGWNSTLESLVAGV  371

Query  1250  PMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMA  1429
             PMICWP++ADQQVNSR V  VWK G+DMKD CDR  VEKMV +LM  RRDEF K +  MA
Sbjct  372   PMICWPYFADQQVNSRFVSEVWKVGLDMKDVCDRDVVEKMVNDLMVHRRDEFLKSAQAMA  431

Query  1430  KLARKAVTQHGSSYSNLDRLVEDLKKM  1510
              LA ++V+  GSS+S++  L+  +K +
Sbjct  432   MLAHQSVSPGGSSHSSMQDLIHYIKSV  458



>gb|KDO38337.1| hypothetical protein CISIN_1g011531mg [Citrus sinensis]
Length=483

 Score =   443 bits (1140),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 229/480 (48%), Positives = 314/480 (65%), Gaps = 12/480 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV++ P+P+QGH+  M+ LAELL   ++  VTF+N++  H  LLR TD+    + +PNF 
Sbjct  9     HVVLLPYPLQGHIKPMMSLAELL-GSANFQVTFVNTDHNHDLLLRNTDITSFCNRFPNFQ  67

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             FR+I  GLPA+  R+G    D+F+++ AV+KP FR++L S   ++  R   TC+IADGI+
Sbjct  68    FRSIPSGLPANVIRSGLTAKDVFDAMKAVSKPAFRDLLISLREETEQRQSPTCVIADGIL  127

Query  464   CF-AIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             CF  +DV  EL+IP +  RT +AS  W +F +PKL+E G +P   E +M+K +  + G E
Sbjct  128   CFLTLDVSEELQIPLLALRTHNASYSWIYFLLPKLVEDGHIPFPDE-NMEKPVAGIPGFE  186

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILA-TLRTTRANGLILNTFEDLEESALAQIRKHIP  817
             N LR RDLP  CR     D   L   +  T   TRA+ LILNTFE +E   ++ +  H  
Sbjct  187   NFLRNRDLPGTCRVKTSDDDYLLQFFIGETFAMTRASALILNTFE-IEAPVVSLLGSHFT  245

Query  818   NLYTIGPLHAHLRARVSSSRGELPWRSSSSLWE-EDRSCMAWLDEQPLKSVVYVSFGSMT  994
              +YTIGPLH   ++R+       P  SSS + + ED SCM WL+ QP KSV+YVSFGS+ 
Sbjct  246   KIYTIGPLHELRKSRMKDINS--PSVSSSGILQTEDTSCMTWLNSQPPKSVLYVSFGSLV  303

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKG-YMVGWAPQ  1162
              LTR Q  E WHG+VN G+ FL  +RP+ ++G+      P    EGT ++  ++V WAPQ
Sbjct  304   GLTREQMSELWHGLVNRGQRFLLVVRPDLILGEPGAAETPLAQNEGTEERNRFIVSWAPQ  363

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             EEVL HPAVGGFLTH GWNSTLE I  G+PMICWP ++DQ VNSR V  VWK G DMKDT
Sbjct  364   EEVLAHPAVGGFLTHGGWNSTLEGIAAGVPMICWPQFSDQLVNSRCVSEVWKIGFDMKDT  423

Query  1343  CDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQL  1522
             CD   +EK+V++LME +R+E    ++R+A +AR AV + GSSY NLD L+ED++ M  ++
Sbjct  424   CDGSIIEKLVRDLMENKREEIMGSTDRVATMARDAVNEGGSSYRNLDGLIEDIRLMARKI  483



>ref|XP_004302685.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Fragaria vesca 
subsp. vesca]
Length=465

 Score =   440 bits (1132),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 235/472 (50%), Positives = 305/472 (65%), Gaps = 25/472 (5%)
 Frame = +2

Query  149   MLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRT  328
             ML LA+LLCH + IHVTF+N+E  H+ L +   L  RF   P   FR+I DGLP+DHPR+
Sbjct  1     MLTLAQLLCH-AGIHVTFVNTEHNHRHLTQRESLSARF---PTLRFRSIFDGLPSDHPRS  56

Query  329   -GDRVVDLFNSINAVTKPRFREMLSS---------GSLQSSGRPPVTCIIADGIMCFAID  478
                  +D+  S+ + T P   ++L S         G+      PP++C+I DG+MCFAID
Sbjct  57    ISPYFLDIVTSLRSTTAPLLHQLLVSLASKTNDDIGAAAGDQLPPLSCVITDGLMCFAID  116

Query  479   VGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLR  658
                E+ +P I  RT SA   W + C+PKLIE  +LP  G+ DMDK +  V G E +LR R
Sbjct  117   AAEEVGLPVIAVRTSSACSVWCYLCLPKLIEEAELPF-GDEDMDKTVSGVPGKECLLRRR  175

Query  659   DLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGP  838
             DL S CR   +    F   +   +  TRA+GLILNTFEDLE S L+ I      +Y IGP
Sbjct  176   DLLSICRMP-VDHPVFKFFMEEHIAITRASGLILNTFEDLESSVLSHIASKFSKIYPIGP  234

Query  839   LHAHLRARVSS-SRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQF  1015
             LHA L++RV            ++SL  EDRSCM WLD Q   SV++VS+GS+  LTR Q 
Sbjct  235   LHALLKSRVDDHDLSSSSTAMAASLHREDRSCMTWLDSQRPGSVIFVSYGSLVKLTRVQL  294

Query  1016  LEFWHGIVNSGKAFLWAIRPNSVIGDDN------IPAELIEGTRKKGYMVGWAPQEEVLV  1177
             LEFWHG+VNSG  FLW +R + V+ D+        P EL  GT+++G++V WAPQEEVL 
Sbjct  295   LEFWHGLVNSGSHFLWVMRSD-VLSDEGEHMRHVTPTELEMGTKERGFIVDWAPQEEVLA  353

Query  1178  HPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRIT  1357
             H AVGGFLTHSGWNSTLE+I  G+PM+CWP  ADQQVNSR VG VWK G+DMKD CDR T
Sbjct  354   HDAVGGFLTHSGWNSTLEAIWAGVPMLCWPQVADQQVNSRWVGEVWKIGIDMKDMCDRTT  413

Query  1358  VEKMVKELM-EVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             VEKM+K LM    R+ FT+  +R +KLAR +V++ GSSY NL++L++DL+ +
Sbjct  414   VEKMIKALMGGEEREVFTRSVDRFSKLARASVSESGSSYHNLEKLIQDLRNL  465



>ref|XP_006429243.1| hypothetical protein CICLE_v10011602mg [Citrus clementina]
 gb|ESR42483.1| hypothetical protein CICLE_v10011602mg [Citrus clementina]
Length=486

 Score =   440 bits (1132),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 230/480 (48%), Positives = 313/480 (65%), Gaps = 12/480 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV++ P+P+QGH+  M+ LAELL   ++  VTF+N+   H  LLR TD+    + +PNF 
Sbjct  12    HVVLLPYPLQGHIKPMMSLAELLG-SANFQVTFVNTNHNHDLLLRNTDITSFCNRFPNFQ  70

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             FR+I  GLPA+  R+G    D+F+++ A++KP FR++L S   ++  R   TC+IADGI+
Sbjct  71    FRSIPSGLPANVIRSGLTAKDVFDAMKAMSKPAFRDLLISLGEETEQRQRPTCVIADGIL  130

Query  464   CF-AIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGME  640
             CF  +DV  EL+IP +  RT +AS  W +F +PKLIE G +P   E +MDK +  + G E
Sbjct  131   CFLTLDVSEELQIPLLALRTHNASYSWIYFHLPKLIEDGHIPFLDE-NMDKPVAGIPGFE  189

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILA-TLRTTRANGLILNTFEDLEESALAQIRKHIP  817
             N LR RDLP  CR     D   L   +  T   TRA+ LILNTFE +E   ++ +  H  
Sbjct  190   NFLRNRDLPGTCRVKTSDDDYLLQFFIGETFAMTRASALILNTFE-IEAPVVSLLGSHFT  248

Query  818   NLYTIGPLHAHLRARVSSSRGELPWRSSSS-LWEEDRSCMAWLDEQPLKSVVYVSFGSMT  994
              +YTIGPLH   ++R+       P  SSS  L +ED SCM WL+ QP KSV+YVSFGS+ 
Sbjct  249   KIYTIGPLHKLRKSRMKDINS--PSVSSSGILQKEDTSCMTWLNSQPPKSVLYVSFGSLV  306

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKG-YMVGWAPQ  1162
              LTR Q  E WHG+VNSG+ FL  +RP+ ++G+      P    +GT ++  ++V WAPQ
Sbjct  307   GLTREQMSELWHGLVNSGQRFLLVVRPDLILGEPGAGATPLAQNKGTEERNRFIVSWAPQ  366

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             EEVL HPAVGGFLTH GWNSTLE I  G+PMICWP ++DQ VNSR V  VWK G DMKDT
Sbjct  367   EEVLAHPAVGGFLTHGGWNSTLEGIVAGVPMICWPQFSDQFVNSRCVSEVWKIGFDMKDT  426

Query  1343  CDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQL  1522
             CD   +EK+V++LME +R+E    ++R+A +A  AV + GSSY NLD L+ED++ M  ++
Sbjct  427   CDGSIIEKLVRDLMENKREEIMGSTDRVATMAHDAVNEGGSSYRNLDGLIEDIRLMARKI  486



>gb|KDO58004.1| hypothetical protein CISIN_1g037999mg [Citrus sinensis]
Length=447

 Score =   436 bits (1122),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 223/454 (49%), Positives = 297/454 (65%), Gaps = 13/454 (3%)
 Frame = +2

Query  149   MLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRT  328
             ML LAEL  H +   VTF+N+E  H RLL   D+   +  +PNF F +I DGLP D+PR 
Sbjct  1     MLTLAELFSH-AGFRVTFVNTEQYHDRLLGNNDVTGFYKRFPNFRFTSIPDGLPPDNPRF  59

Query  329   GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIMCFAIDVGNELRIPTI  508
             G  + D F S   V+K  F ++L S  L        TCII+D IM F IDV  EL IP I
Sbjct  60    GIYIKDWFCSDKPVSKLAFLQLLMSPGLLP------TCIISDSIMSFTIDVAEELNIPII  113

Query  509   LFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTD  688
              FR +SA C W+ F   KL E G+LP+  E + DK ++ + G+EN  R RDLPS CR   
Sbjct  114   TFRPYSAHCSWSDFHFSKLAEEGELPVTNE-NFDKPVKCIPGLENFFRNRDLPSICRDGG  172

Query  689   LSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVS  868
               D    + I  T  TTR + L++NTF ++E   ++++   +  +YT+GPLHA L++R+ 
Sbjct  173   PDDPILQTFIRDTSATTRTSALVINTFNEIEGPIISKLGSRLTKIYTVGPLHALLKSRIQ  232

Query  869   SSRGEL--PWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVN  1042
                 E   P  ++  L +EDRSCM WLD QP +SV+YVSFGS   L R Q LEFWHG+VN
Sbjct  233   EDSAESSPPESNNCVLSKEDRSCMTWLDSQPSRSVLYVSFGSFIKLGREQILEFWHGMVN  292

Query  1043  SGKAFLWAIRPNSVIGDDNI---PAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSG  1213
             SGK FLW IR + + G+  +   P EL +GT+++G +V WAPQEEVL H A+GGFLTHSG
Sbjct  293   SGKRFLWVIRSDLIDGEPGVGPVPVELEQGTKERGCIVSWAPQEEVLAHQAIGGFLTHSG  352

Query  1214  WNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVR  1393
             WNSTLES+  G+PMICWP   DQQVNSR V  +WK G+DMKDTCDR T+E +V++LM+ +
Sbjct  353   WNSTLESLVAGVPMICWPQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTIENLVRDLMDNK  412

Query  1394  RDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
             RD+  + + ++AK+AR AV + GSSY NLD+L++
Sbjct  413   RDKIMESTVQIAKMARDAVKEGGSSYRNLDKLIK  446



>gb|KHG08953.1| hypothetical protein F383_15475 [Gossypium arboreum]
Length=484

 Score =   437 bits (1123),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 232/480 (48%), Positives = 308/480 (64%), Gaps = 15/480 (3%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             + HVLI P P QGH+  ML+LAELL + +S  +TFLN+E+ H   L   D+H     +P 
Sbjct  8     APHVLILPIPAQGHLRPMLKLAELLSN-ASFQITFLNTEYFHHTFLSSIDIHAFSRRFPK  66

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQS-SGRPPVTCIIAD  454
             F F TI DGLP D PR G  +     S+    KP   E+L S  L+S SGRPP TCIIAD
Sbjct  67    FQFVTIPDGLPPDSPRPGKGIAHYLISLTDAAKPAVVEVLVS--LRSKSGRPP-TCIIAD  123

Query  455   GIMC-FAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVE  631
             GIM   A+  G E  IP + FRT+SA C W +F +  L+E G+LPL  + DMDKL+  + 
Sbjct  124   GIMSSAAVAAGEEFGIPVLAFRTYSACCTWTYFNLSNLVEGGELPL-PDKDMDKLVTCIP  182

Query  632   GMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTR-ANGLILNTFEDLEESALAQIRK  808
             G+ENVLR RDLPSFCR     D       +A     R A+ LILNTFE LE   ++++  
Sbjct  183   GLENVLRHRDLPSFCRLEKADDHLLYDFFIAQASAMRRASALILNTFEQLETPFISKLAS  242

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
                 +YTIGPLH        ++       + S  W+E++ C+ WLD  P KSVV+VSFGS
Sbjct  243   IFSKIYTIGPLHCLSNVDDPTALAS----TKSIFWQEEKGCLTWLDSHPSKSVVFVSFGS  298

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVGWAP  1159
             +   T +Q LEFWHG+VNSGK FLW IR N++IG+D+   I  +L + T+ KG +V WAP
Sbjct  299   VVTFTLDQMLEFWHGLVNSGKPFLWVIRSNAIIGEDDPRKILEDLKDNTKGKGSIVSWAP  358

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             QEEVL HPAVG FLTHSGWNSTLESI  G+PMICWP + DQ VNSR V  VW+ G DMKD
Sbjct  359   QEEVLAHPAVGAFLTHSGWNSTLESIYAGVPMICWPLFVDQYVNSRCVSYVWRVGFDMKD  418

Query  1340  TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
             +C R  +EKMV++++E++ +E  K    ++K A+++V + G SY NLD++++D+  + L+
Sbjct  419   SCHRSIIEKMVRDVIEMKNEEIMKSMEEISKQAQESVKESGPSYCNLDKMIQDIMSVNLE  478



>dbj|BAB86929.1| glucosyltransferase-11 [Vigna angularis]
Length=462

 Score =   436 bits (1120),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 220/456 (48%), Positives = 305/456 (67%), Gaps = 12/456 (3%)
 Frame = +2

Query  152   LRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGL-PADHPRT  328
             L+LAELL  ++ + VTFL +   H RL R+ ++ +   SYP  +F+T SD     +HP  
Sbjct  1     LKLAELLVLQN-LRVTFLTTNTIHSRLARFGEIQVLSESYPTLHFKTFSDCYDEGNHPGF  59

Query  329   GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM-CFAIDVGNELRI--  499
             GDR+ DL +S+    KP  R++L S + Q    P ++C+I DGI    +  V +EL I  
Sbjct  60    GDRIWDLISSVTLHAKPFLRDILLSHTPQI---PKLSCVIQDGIFGSLSSGVASELNISI  116

Query  500   PTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCR  679
             P I FRT S+ CFWA+    KL++  +LP+ G+ DMD++++N+ GMEN+LR RDLPSF R
Sbjct  117   PIIHFRTVSSCCFWAYMSATKLLQCQELPIRGDDDMDRIIKNLPGMENLLRCRDLPSFFR  176

Query  680   TTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRA  859
                  +  F S    + ++  A+ +ILN+FEDLE   L+QIR +   +YT+GPLH HL  
Sbjct  177   PNQEGNSTFESYADRSRQSLAADAVILNSFEDLEGPVLSQIRHNFSKVYTVGPLHHHLNM  236

Query  860   R-VSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGI  1036
             R   S++G+   R  +S+++ DRSCM WLD QP  SV+YVSFGS T++ +   +E WHG+
Sbjct  237   RKAESNKGKEIPRFKNSIFQVDRSCMTWLDAQPDGSVMYVSFGSSTIMNKEDLMEIWHGL  296

Query  1037  VNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTH  1207
             VNS K FLW   P+ V G  N   +P E+ EGT+++G++V WAPQEEVL H A+GGFLTH
Sbjct  297   VNSKKRFLWVKLPDIVAGKHNEEHVPTEVKEGTKERGFIVEWAPQEEVLTHKAIGGFLTH  356

Query  1208  SGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELME  1387
             SGWNSTLES+  G+PMICWP++ADQQ+NSR V  VWK G+DMKD CDR  VEKMV ++M 
Sbjct  357   SGWNSTLESLVAGVPMICWPYFADQQINSRFVSEVWKVGLDMKDVCDRDVVEKMVNDVMV  416

Query  1388  VRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
              RR+EF K +  MA LA ++V+  GSSY++L  L+E
Sbjct  417   HRREEFLKSAQTMAMLAHQSVSPGGSSYTSLHDLIE  452



>ref|XP_007026847.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07349.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
Length=496

 Score =   435 bits (1119),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 232/485 (48%), Positives = 306/485 (63%), Gaps = 20/485 (4%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q    HV++ PFP  GH+  +L LAELL H +S  VTFLN +  H RLL   D+      
Sbjct  5     QPRVPHVVLLPFPSLGHIKPLLSLAELLSH-ASFQVTFLNPQQIHDRLLLSMDMPAFHRR  63

Query  269   YPNFYFRTISDGL--PADHPRTG-DRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             +P F F ++ D +   +D PR G   + D   S+ +V KP   E+L S + +   R P T
Sbjct  64    HPEFEFLSMPDPVRRSSDRPRPGLFSLHDNILSLGSVIKPALGELLISFNRERGRRQPAT  123

Query  440   CIIADGIMCF-AIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLN-GESDMDK  613
             CIIADG++    IDV  +  IP    RT SA C WA+F  PKL+E GD+P    + DMDK
Sbjct  124   CIIADGLLSSPVIDVAEQFEIPFFALRTSSACCIWAYFNPPKLVEEGDVPFQVADEDMDK  183

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVIL-ATLRTTRANGLILNTFEDLEESA  790
             L+  + G+ENV+R RDLP   R    +D      I   TL   RA+GLILNTF++LE   
Sbjct  184   LVTCIPGLENVVRRRDLPGIFRIERANDPALEYFINDQTLVLPRASGLILNTFDELEAPV  243

Query  791   LAQIRKHIPNLYTIGPLHA----HLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPL  958
             +A++  H   +YT+GPLH+     ++  +S + GE      + LW+ED SCM WLD Q  
Sbjct  244   IAKLGSHFTKVYTVGPLHSLSTVRMKDLISVASGE------NILWKEDTSCMTWLDSQLS  297

Query  959   KSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTR  1129
             KSV++VSFGS+   TR+Q  E WHG+VN GK FLWAIR +S+IG+D    I  +L + T 
Sbjct  298   KSVIFVSFGSVISFTRDQMFELWHGLVNCGKPFLWAIRQDSIIGEDGPSLILGKLKDMTG  357

Query  1130  KKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGA  1309
              KG +V WAPQE VL HPA+GGF THSGWNSTLESI  G+PMICWP   DQQ+NSR V  
Sbjct  358   DKGLLVSWAPQELVLTHPAIGGFFTHSGWNSTLESIFAGVPMICWPAIGDQQMNSRFVSD  417

Query  1310  VWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRL  1489
             VWK G DMKD+CDR  +EKMV++LME +R+E  K  N + KLA +AV + GSS+ NLD+L
Sbjct  418   VWKIGFDMKDSCDRSLIEKMVRDLMEDKREEIMKSVNEIKKLAHEAVKEGGSSFCNLDKL  477

Query  1490  VEDLK  1504
             ++D++
Sbjct  478   IDDIR  482



>ref|XP_007026848.1| UDP-glucosyl transferase 85A3, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY07350.1| UDP-glucosyl transferase 85A3, putative isoform 2, partial [Theobroma 
cacao]
Length=478

 Score =   434 bits (1117),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 233/482 (48%), Positives = 304/482 (63%), Gaps = 20/482 (4%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             Q    HV++ PFP  GH+  +L LAELL H +S  VTFLN +  H RLL   D+      
Sbjct  5     QPRVPHVVLLPFPSLGHIKPLLSLAELLSH-ASFQVTFLNPQQIHDRLLLSMDMPAFHRR  63

Query  269   YPNFYFRTISDGL--PADHPRTG-DRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             +P F F ++ D +   +D PR G   + D   S+ +V KP   E+L S + +   R P T
Sbjct  64    HPEFEFLSMPDPVRRSSDRPRPGLFSLHDNILSLGSVIKPALGELLISFNRERGRRQPAT  123

Query  440   CIIADGIMCF-AIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             CIIADG++    IDV  +  IP    RT SA C WA+F  PKL+E GD+P   E DMDKL
Sbjct  124   CIIADGLLSSPVIDVAEQFEIPFFALRTSSACCIWAYFNPPKLVEEGDVPFQDE-DMDKL  182

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVIL-ATLRTTRANGLILNTFEDLEESAL  793
             +  + G+ENV+R RDLP   R    +D      I   TL   RA+GLILNTF++LE   +
Sbjct  183   VTCIPGLENVVRRRDLPGIFRIERANDPALEYFINDQTLVLPRASGLILNTFDELEAPVI  242

Query  794   AQIRKHIPNLYTIGPLHA----HLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLK  961
             A++  H   +YT+GPLH+     ++  +S + GE      + LW+ED SCM WLD Q  K
Sbjct  243   AKLGSHFTKVYTVGPLHSLSTVRMKDLISVASGE------NILWKEDTSCMTWLDSQLSK  296

Query  962   SVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRK  1132
             SV++VSFGS+   TR+Q  E WHG+VN GK FLWAIR +S+IG+D    I  +L + T  
Sbjct  297   SVIFVSFGSVISFTRDQMFELWHGLVNCGKPFLWAIRQDSIIGEDGPSLILGKLKDMTGD  356

Query  1133  KGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAV  1312
             KG +V WAPQE VL HPA+GGF THSGWNSTLESI  G+PMICWP   DQQ+NSR V  V
Sbjct  357   KGLLVSWAPQELVLTHPAIGGFFTHSGWNSTLESIFAGVPMICWPAIGDQQMNSRFVSDV  416

Query  1313  WKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLV  1492
             WK G DMKD+CDR  +EKMV++LME +R+E  K  N + KLA +AV + GSS+ NLD+L+
Sbjct  417   WKIGFDMKDSCDRSLIEKMVRDLMEDKREEIMKSVNEIKKLAHEAVKEGGSSFCNLDKLI  476

Query  1493  ED  1498
             +D
Sbjct  477   DD  478



>gb|EPS60746.1| hypothetical protein M569_14056, partial [Genlisea aurea]
Length=455

 Score =   432 bits (1112),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 229/455 (50%), Positives = 304/455 (67%), Gaps = 23/455 (5%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+FP P+QGHVN ML+L+ELLC  + IHVT L S+F+  RL R++D+  RFS Y  F 
Sbjct  4     HVLVFPLPLQGHVNSMLKLSELLCL-AGIHVTLLLSKFSSSRLRRHSDVESRFSRYSGFR  62

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG--RPPVTCIIADG  457
                  DGLP D+PR G+  +DL +SI  V +   R++L +    S G  R  V+  + DG
Sbjct  63    IAVFDDGLPEDNPRVGESTIDLLSSILRVGETELRKVLEATDSLSDGGARRRVSFFVIDG  122

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD----------M  607
             ++ FA+ V  EL IP + FRT SA  FW +FC  +LI +G+LPL GE +          +
Sbjct  123   VLSFAMPVAEELGIPVVYFRTISACSFWCYFCSSELIAAGELPLRGEDEGKYEYWRNPNL  182

Query  608   DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEES  787
             D  + ++ GME +LR RDLPSF R TD +D     +   T +T  + GLILNTFEDLE  
Sbjct  183   DLPVTSIPGMEAILRRRDLPSFLRVTDPNDSVLQIMAAETRKTALSAGLILNTFEDLEGP  242

Query  788   ALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
              + +IRK IPN+++IGPLH HL++ +     +    +SSS   EDR+ + WL+ QP KSV
Sbjct  243   IMDEIRKRIPNVFSIGPLHTHLKSHLDP---QSSSLASSSFLREDRTSIDWLNSQPPKSV  299

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN------IPAELIEGTR  1129
             +YVSFGS+T LT  + LEFW+G+VNSG  FLW +RP+S+ G DN      IP EL EGT+
Sbjct  300   IYVSFGSLTQLTEEEHLEFWYGLVNSGHMFLWVMRPDSIAGSDNRHRNAAIPKELEEGTK  359

Query  1130  KKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGA  1309
             ++GY+V W PQ EVL HP+VG F TH GWNSTLESIC G+PMICWP++ADQQ NSR V  
Sbjct  360   QRGYLVEWVPQMEVLAHPSVGAFFTHGGWNSTLESICAGVPMICWPYFADQQTNSRFVSH  419

Query  1310  VWKNGVDMKDTCDRITVEKMVKELM-EVRRDEFTK  1411
              WK G DMKD+CDR+ VE+MV+E+M + RRDE ++
Sbjct  420   EWKVGFDMKDSCDRVVVEEMVREVMGDRRRDELSE  454



>ref|XP_007026845.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07347.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
Length=488

 Score =   433 bits (1113),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 232/478 (49%), Positives = 297/478 (62%), Gaps = 18/478 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+  P P  GH+  ML+LAELL    S  VTF+N++  H RLL  TDL  R   YP F 
Sbjct  10    HVVFLPIPGLGHIKPMLKLAELLSR-PSFQVTFINTQRIHDRLLS-TDLLAR---YPEFQ  64

Query  284   FRTISDGLPADHPRTGDRVV-DLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGI  460
             F TI D +P D PR+G     D   +   V KP  R++  S   +     P TCII DGI
Sbjct  65    FLTIPDVVPRDRPRSGTMSPGDFLLAAGPVIKPALRQLFISLCKKKGRWQPATCIIEDGI  124

Query  461   MCFA-IDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGM  637
             +  + IDV  E ++P   FRT SA C W +F V KL+E GD+P+  + DMDK +  + G+
Sbjct  125   LSSSVIDVAEEFQVPVFAFRTSSACCIWTYFHVRKLVEEGDVPVVQDKDMDKPVTCIPGL  184

Query  638   ENVLRLRDLPSFCRTTDLSDRGFLSVIL-ATLRTTRANGLILNTFEDLEESALAQIRKHI  814
             ENV+R RDLP   R     D G    I   TL   RA  +I+NTF+ LE + ++++    
Sbjct  185   ENVVRRRDLPGIFRIERADDPGLEFFINDQTLVMPRAFAIIINTFDGLEATMISKLASVF  244

Query  815   PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMT  994
               +YT+GPLH    AR           S+S LW+EDR CM WLD QP +SVV+VSFGS  
Sbjct  245   TKMYTVGPLHGLSNARAKEETTSA--SSNSILWKEDRGCMFWLDSQPSRSVVFVSFGSFV  302

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRK------KGYMVGWA  1156
              LTR++ LEF HG+VNSG  FLW IRP+S+ G+  +   LI G  K      KG MV WA
Sbjct  303   GLTRDKMLEFGHGLVNSGYPFLWVIRPDSITGE--VDPSLILGELKAMIEDNKGLMVSWA  360

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQEEVL HPA+G FLTHSGWNSTLES+  G+PMICWP   DQQ+NSR V  VWK G+DMK
Sbjct  361   PQEEVLAHPAIGVFLTHSGWNSTLESVYAGVPMICWPAIGDQQINSRFVSDVWKIGLDMK  420

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             DTCDR T+EKMV+ LME +R+E  K  N + KLA + + + GSS+SNL++L++D+  M
Sbjct  421   DTCDRSTIEKMVRSLMEDKREEIMKSVNEIKKLAHETIKEGGSSFSNLEKLIDDIWSM  478



>emb|CBI36705.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   426 bits (1094),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 226/455 (50%), Positives = 290/455 (64%), Gaps = 63/455 (14%)
 Frame = +2

Query  149   MLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRT  328
             ML+LAELL   + + +TFLNS++ H RLLRYT++  R++ YP F F+TISDGLP D P T
Sbjct  1     MLKLAELLSL-AGLRITFLNSDYNHHRLLRYTNILDRYTRYPGFRFQTISDGLPLDRPWT  59

Query  329   GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIMCFAIDVGNELRIPTI  508
             G  + D+ + I A TKP FREM+ S    S    PVTCIIADG+M FAIDV NE+ +P I
Sbjct  60    GAGLRDMMDGIKATTKPLFREMVISWCQSSD---PVTCIIADGLMSFAIDVANEVGVPII  116

Query  509   LFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTD  688
               RT S  CF A+F   +LIE+G++P   + DMD+L+  V GME  LR RDLPSFCRT D
Sbjct  117   SCRTVSPCCFLAYFSFAELIEAGEVPFK-DDDMDRLVTRVPGMEGFLRRRDLPSFCRTRD  175

Query  689   LSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVS  868
              +DRG   +I  T +T RA+ LILNTFEDL+   L+QIR H P +YTIGPLHAHL++R++
Sbjct  176   ANDRGIQFIITETQQTPRAHALILNTFEDLDGPILSQIRNHCPKIYTIGPLHAHLKSRLA  235

Query  869   SSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSG  1048
             S      +  S+S WEEDRSC+AWLD QP KS +YVSFGS+TV+T+ Q +EFWHG+VNSG
Sbjct  236   SETTTSQF--SNSFWEEDRSCLAWLDRQPSKSFIYVSFGSITVITKEQMMEFWHGLVNSG  293

Query  1049  KAFLWAIRPNSVI-GDDNIPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNST  1225
               FLW IRP+S+   D + P              GW P                      
Sbjct  294   SRFLWVIRPDSLTEKDGDAPG------------CGWVP----------------------  319

Query  1226  LESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEF  1405
                                  NSR V  VWK G+DMKDTCDR+TVEKMV+++ME RR EF
Sbjct  320   ---------------------NSRFVSHVWKIGMDMKDTCDRVTVEKMVRDVMEERRAEF  358

Query  1406  TKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             TK  + MAKLAR ++++ G+SY N +RL+ED++ M
Sbjct  359   TKSVDAMAKLARSSLSEGGTSYCNFNRLIEDIRLM  393



>ref|XP_007207618.1| hypothetical protein PRUPE_ppa019804mg [Prunus persica]
 gb|EMJ08817.1| hypothetical protein PRUPE_ppa019804mg [Prunus persica]
Length=474

 Score =   424 bits (1090),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 215/477 (45%), Positives = 297/477 (62%), Gaps = 15/477 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+IFPFP+QGH+  +L LAELLCH + +HVT++N+   HQRL     L + F   P  +
Sbjct  7     HVVIFPFPLQGHMKPLLCLAELLCH-AGLHVTYVNTHHNHQRLANRQALSIHF---PTLH  62

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR----PPVTCIIA  451
             F +ISDGLP D PRT +    L  ++    +P FRE+L + S ++       PP +CI+ 
Sbjct  63    FESISDGLPEDDPRTLNS--QLLIALKTSIRPHFRELLKTISFKAESNDALVPPPSCIMT  120

Query  452   DGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVE  631
             DG++ FA DVG EL +P + F        W   C+PKLIE+G LP   + DM+  +  V 
Sbjct  121   DGLVTFAFDVGEELGLPILSFNVPCPRYLWTCLCLPKLIENGQLPFQ-DDDMNVEITGVP  179

Query  632   GMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKH  811
             GME +L  +DLP FCR            I  T    RA+ LIL+T  +L+   ++ +   
Sbjct  180   GMEGLLHRQDLPGFCRVKQADHPSLQFAINETQTLKRASALILDTVYELDAPCISHMALM  239

Query  812   IPNLYTIGPLHAHLRARVSS-SRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              P +YT+GPLHA L +++   SRG     S  SLW+ D +CM WLD QP KSV+YVSFG+
Sbjct  240   FPKIYTLGPLHALLNSQIGDMSRG---LASHGSLWKSDLNCMTWLDSQPSKSVIYVSFGT  296

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQEE  1168
             +  LTR Q +EFW+G+VNSG  FLW +R +   GD  IPAEL  GT+++G +V W  QEE
Sbjct  297   LVHLTRAQVIEFWYGLVNSGHPFLWVMRSDITSGDHQIPAELENGTKERGCIVDWVSQEE  356

Query  1169  VLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCD  1348
             VL H +VGGFLTHSGWNSTLESI  GLPMICWP   D  + SR V   WK G+ + + CD
Sbjct  357   VLAHKSVGGFLTHSGWNSTLESIVAGLPMICWPKLGDHYIISRTVCRQWKIGLQLNENCD  416

Query  1349  RITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
             R  +E MV+ LM  +R+E     + ++KLAR +V + GSS++NL++L+E ++ ++ Q
Sbjct  417   RSNIESMVQTLMGSKREEIQSSMDAISKLARDSVAEGGSSHNNLEQLIEYIRNLQHQ  473



>ref|XP_010676681.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=503

 Score =   424 bits (1091),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 230/475 (48%), Positives = 305/475 (64%), Gaps = 27/475 (6%)
 Frame = +2

Query  131   QGHVNCMLRLAELLCHESS-IHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGL  307
             QG +NC L+LA LL   S  +++TFLN+EF HQRLL   DL  RF   P+  F   SDG+
Sbjct  40    QGPINCFLKLAHLLSLSSDHLNITFLNAEFVHQRLL---DLPSRF---PHVKFLKFSDGI  93

Query  308   PADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIMCFAIDVGN  487
               D PRT  +   +   + A    R  E + S +       P TC+I+DG+     +  N
Sbjct  94    SGDEPRTPAKFPAMVGFLQAEISRRLPEFMESPA-------PATCLISDGVFTSVGERAN  146

Query  488   ELRIPTILFRTFSASCFWA-FFCVPKLIESGDLPLNGESDMDKLLENVEGMENV-LRLRD  661
             EL IP + F T S  C WA  F VPKL++ G+LP     D+D+ + ++ G  +  LR  D
Sbjct  147   ELGIPVVYFSTLSPCCVWASCFLVPKLVDYGELPFKKGMDLDEPVSDIPGAADTSLRWCD  206

Query  662   LPSFCRTTDLSDRGFLSVILATLRT-TRANGLILNTFEDLEESALAQIRKHIPNLYTIGP  838
             LP  CRT D++D  ++ ++L   R    A G ILNTF+DLEE  L+++R   PNLYTIGP
Sbjct  207   LPGICRTHDMTD-PYVQLVLKEFRELPNAQGHILNTFDDLEEPLLSELRLLCPNLYTIGP  265

Query  839   LHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFL  1018
             +H H R R      +    +S+SLW+EDRSC+AWLD QP  SV+YVSFGS+  LT +Q  
Sbjct  266   IHLHSRTRQQLESEQR--ITSNSLWQEDRSCIAWLDAQPSGSVIYVSFGSVVPLTMDQLT  323

Query  1019  EFWHGIVNSGKAFLWAIRPNSVIGDD-------NIPAELIEGTRKKGYMVGWAPQEEVLV  1177
             EFW+G+VNSG  FLW  R   V+  +        +P E++EGTR +G++V WAPQEEVL 
Sbjct  324   EFWYGLVNSGTRFLWVRRSGMVVEMEESEEISLQVPTEILEGTRNRGFIVKWAPQEEVLA  383

Query  1178  HPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRIT  1357
             H AVGGFLTHSGWNSTLESI EGLPM+CWP   DQ V SR VG VWK G+DMKD CDR  
Sbjct  384   HRAVGGFLTHSGWNSTLESIVEGLPMLCWPNGIDQLVISRFVGDVWKIGIDMKDICDRGV  443

Query  1358  VEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQL  1522
             +E MV +LM+ R+DEF++ +NR++KLA +AV + GSS+  L RL+ED+K M+L++
Sbjct  444   IEHMVIDLMKGRKDEFSRRANRLSKLAGEAVREGGSSWRALHRLIEDIKFMRLEV  498



>gb|AFJ53007.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=480

 Score =   422 bits (1086),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 224/482 (46%), Positives = 298/482 (62%), Gaps = 28/482 (6%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR--FSSYPN  277
             HV+  PFP QGH+  M  LA+LL H +   +T +N+   H  L R  D        S+P+
Sbjct  13    HVVFLPFPAQGHIKPMFTLAKLLSHVAKFRITLVNTHHNHALLQRSLDTAAADFGDSFPD  72

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAV--TKPRFREMLSSGSLQSSGRPPVTCIIA  451
             F+F ++ D +   H      + ++   + A+  +KP F  ++    L S+     TCII 
Sbjct  73    FHFASLPDVVA--HQDGQSNLANIAQLLPAIRNSKPDFHRLMLD--LPSAA----TCIIV  124

Query  452   DGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVE  631
             DG+M + I+V  E+ IP I FRTFSA   W +F + KL E G +P+ G +DMD+L+ ++ 
Sbjct  125   DGVMSYGIEVAEEIGIPAITFRTFSAVGLWVYFNLDKLTEDGSIPIPGNADMDELITSIP  184

Query  632   GMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKH  811
             G+E VLRLRDLPS CR    S +     I  T    RA+GLILNTF++LE S ++++   
Sbjct  185   GLEGVLRLRDLPSMCRPGP-SSQVLKFFIDETKSMKRASGLILNTFDELEGSIISKLSST  243

Query  812   I-PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
             I P  Y +GPLH  L   V          S   LW ED+ CM WL+  P KSVVYVSFGS
Sbjct  244   IFPKTYPVGPLHGLLNNVVKEHH------SDGGLWREDKGCMTWLESHPSKSVVYVSFGS  297

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN------IPAELIEGTRKKGYMVG  1150
             +   T  QF+EFWHG+VN+GK FLW IRP+SV G+D       I + L E    K  +V 
Sbjct  298   LVAFTEAQFMEFWHGLVNTGKPFLWVIRPDSVSGEDGSIQSGRIISGLKEAHGNKCCVVD  357

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQ EVL H AVGGFLTHSGWNSTLE+I EG+PMICWP ++DQQVNSR V  +W  G+D
Sbjct  358   WAPQLEVLAHEAVGGFLTHSGWNSTLEAILEGVPMICWPRFSDQQVNSRAVSDIWNVGLD  417

Query  1331  MKDTCDRITVEKMVKELME--VRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             MKDTCDR TVEKMV+ELM+   +RDE  K +  +A+LAR ++ + GSSY NL++L+ D+ 
Sbjct  418   MKDTCDRWTVEKMVRELMDDSCKRDEIVKSTAEIARLARDSIKEGGSSYCNLEKLIADVG  477

Query  1505  KM  1510
              M
Sbjct  478   AM  479



>ref|XP_007207791.1| hypothetical protein PRUPE_ppa025605mg [Prunus persica]
 gb|EMJ08990.1| hypothetical protein PRUPE_ppa025605mg [Prunus persica]
Length=483

 Score =   422 bits (1084),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 215/478 (45%), Positives = 295/478 (62%), Gaps = 17/478 (4%)
 Frame = +2

Query  101   SHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNF  280
             S V+IFPFP+QGH+  +L LAELLCH +  HVTF+N+   H+RL     L   F   P  
Sbjct  6     SLVVIFPFPLQGHIKPLLCLAELLCH-AGFHVTFVNTHHNHKRLANPEALSTHF---PTL  61

Query  281   YFRTISDGLPADHPRT--GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR----PPVTC  442
             +F +ISDGLP DHPR   G+ ++ L  SI    +P FRE+L + S+++       PP+ C
Sbjct  62    HFESISDGLPDDHPRALNGELLIALKTSI----RPHFRELLETISIKAESNDAPAPPLNC  117

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             II DG++ FA D+  EL IP + +    A   W   C+P LIE G LP   + DM   + 
Sbjct  118   IITDGLVTFAFDLAEELEIPVLSYNVPCARYLWTCLCLPDLIEQGQLPFP-DDDMSVEIT  176

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              V GM+  L  +DLPSFCR    +       I  T    RA+ LIL+T  +L+ S L+ +
Sbjct  177   GVSGMDGPLHRQDLPSFCRVKQANHPALQFAINWTQAQRRASALILDTVYELDASCLSHM  236

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSF  982
                 P +YT+GPLHA L A++ +    L   S   LW+ D +CM WLD QP +SV+YVSF
Sbjct  237   ALMFPKIYTLGPLHALLNAQIGNVSKSL--ASHGGLWKSDPNCMTWLDSQPSRSVIYVSF  294

Query  983   GSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQ  1162
             G++  LTR Q +EFW+G+VNSG  F+W IR + + G   IPAEL  GT+++GY+V W  Q
Sbjct  295   GTLVNLTRAQMIEFWYGLVNSGHPFMWVIRSDIIYGAHQIPAELEIGTKERGYIVDWVSQ  354

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             EEVL H AVGGFLTHSGWNSTLESI  GLPMICWP   D  + SR V   WK G+ + + 
Sbjct  355   EEVLAHKAVGGFLTHSGWNSTLESIVAGLPMICWPNLGDHYIISRTVSQKWKIGLQLNEI  414

Query  1343  CDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
             CDR  +E M++ LM  +R+E     + ++KLAR +V + GSS++NL++L+E ++   +
Sbjct  415   CDRCNIETMIQTLMGPKREEIQSSIDTISKLARDSVVKGGSSHNNLEQLIEYIRSFSM  472



>ref|XP_004305167.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   420 bits (1080),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 216/478 (45%), Positives = 294/478 (62%), Gaps = 14/478 (3%)
 Frame = +2

Query  89    QRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSS  268
             ++S SHV+IFPFP+QGH+  +L LAELLCH + +HVTF+N+   H RL     L  RF  
Sbjct  2     EKSQSHVVIFPFPLQGHIKPLLCLAELLCH-AGLHVTFVNTRHNHNRLANLPALSARF--  58

Query  269   YPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG--RPPVTC  442
              P   F +ISDGLP +HPRT     +L  ++    KP F+E+L S  L+++G   P  TC
Sbjct  59    -PTLNFESISDGLPLEHPRTLGS--ELLIALKTSIKPHFKELLQS-PLKANGVALPAPTC  114

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             II DG++ FA DV  EL +P   +        W   C+P LIE G LP   + DM+  + 
Sbjct  115   IITDGLVTFAFDVAEELGLPIFSYNVPCTRYMWTCLCLPNLIEQGQLPFP-DDDMNVEIT  173

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              V GME +LR  DLP FCR    +  G    I  T    RA+ LIL+T  +L+   L+ +
Sbjct  174   GVPGMEGLLRRVDLPGFCRVKQSNHPGLQFAIHETQTQKRASTLILDTIYELDAPCLSHM  233

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSF  982
                 P +YT+GPLH+ L +++      L   S   LW+ D +CM WLD QP KSV+YVSF
Sbjct  234   ANMFPKIYTLGPLHSLLHSQIGDVSRSL--ASHGGLWKGDPNCMTWLDSQPTKSVLYVSF  291

Query  983   GSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPN--SVIGDDNIPAELIEGTRKKGYMVGWA  1156
             G++  LT  Q +EFW+G++NSG  FLW IR +  S +G D IP EL  GT+++GY+V W 
Sbjct  292   GTLVTLTGTQIIEFWYGLINSGHPFLWVIRSDITSGLGGDPIPMELEIGTKERGYIVNWV  351

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
              QEEVL H +VGGFLTHSGWNSTLESI  G+PMICWP   D  + SR V   WK G+ +K
Sbjct  352   SQEEVLAHKSVGGFLTHSGWNSTLESIVAGIPMICWPNLGDHYIISRTVSEKWKIGLQLK  411

Query  1337  DTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             + CDR  +E M++ LME +R E     + ++K+AR +V + GSS  NL+ L++D++ M
Sbjct  412   ENCDRKEIETMIRMLMEFKRGEIQSSMDVISKVARDSVVKGGSSNHNLEMLIQDIRNM  469



>emb|CAN67315.1| hypothetical protein VITISV_036458 [Vitis vinifera]
Length=479

 Score =   420 bits (1080),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 257/386 (67%), Gaps = 27/386 (7%)
 Frame = +2

Query  302   GLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIMCFAIDV  481
             GLP        RV+DLF  + A  KP FRE++ S    S   PPV CIIADG+M F ID+
Sbjct  66    GLPRTIHVPVKRVMDLFEGLKATAKPIFRELVISRGQGSDTLPPVNCIIADGMMSFTIDI  125

Query  482   GNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRD  661
              NE+ IP I FRT SA  FWA+F   KLIESG+L L G +DMD+L+ ++ GME  LR RD
Sbjct  126   ANEVGIPIISFRTISACSFWAYFSALKLIESGELXLKG-NDMDQLVTSIPGMEGFLRKRD  184

Query  662   LPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPL  841
             LPS  R ++L +   L V   T +T RA+ LILNTFEDLE   L QIR H P  YTIGPL
Sbjct  185   LPSLIRVSNLDBEXLLLVXKETQQTPRAHALILNTFEDLEGPILGQIRNHCPKTYTIGPL  244

Query  842   HAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLE  1021
             HAHL  R++S                           P KSV+YVSFGS+TV+TR Q +E
Sbjct  245   HAHLXTRLASE-----------------------STNPSKSVIYVSFGSLTVITRKQLIE  281

Query  1022  FWHGIVNSGKAFLWAIRPNSVI---GDDNIPAELIEGTRKKGYMVGWAPQEEVLVHPAVG  1192
             F +G+VNSG  FLW IR +S+    G+   PAEL+EG +++ Y+V WAPQEEVL HPAVG
Sbjct  282   FCYGLVNSGXRFLWVIRTDSLAEEDGERQTPAELLEGAKERSYIVEWAPQEEVLAHPAVG  341

Query  1193  GFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMV  1372
             GFLTHSGWNSTLESIC G+PMICWP++ADQQ+NSR    VWK G DMKDTCDR+ VEKMV
Sbjct  342   GFLTHSGWNSTLESICAGVPMICWPYFADQQINSRFASHVWKLGSDMKDTCDRLIVEKMV  401

Query  1373  KELMEVRRDEFTKCSNRMAKLARKAV  1450
             ++LME RRDE  K ++ MA  ARK +
Sbjct  402   RDLMEXRRDELLKTADMMATRARKCL  427



>ref|XP_010044032.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW86038.1| hypothetical protein EUGRSUZ_B02744 [Eucalyptus grandis]
Length=473

 Score =   419 bits (1078),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 230/482 (48%), Positives = 300/482 (62%), Gaps = 19/482 (4%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M++    HVL+ PFP QGH+  ML LA+LL   + + VTFLN+   H+R+L         
Sbjct  1     MEEPREPHVLVLPFPAQGHIKPMLCLAKLL-AAAGLRVTFLNTHHNHRRILPRG---PSS  56

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
                      +ISDGLP DHPR+ +R+ +L  SI    K   RE L S     S  PPVTC
Sbjct  57    PPSSLLRLESISDGLPDDHPRSLERIEELLLSIKTAMKAALREFLVS----KSAEPPVTC  112

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             +IADGIM   IDV  EL +P I FRTFSA C W +FC+P  I  G LP   + D+DK   
Sbjct  113   VIADGIMSIGIDVAEELSVPAISFRTFSACCLWTYFCIPTFIHEGKLPFP-DDDLDKEFH  171

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              + G E +LR RDLPS CR+  ++   +   +  T+  TRA  LILNTF+ LE   L+ +
Sbjct  172   GLLGAEGLLRRRDLPSICRSA-IAINLYRYFMDETIAMTRACALILNTFDALEAPMLSHL  230

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSS--SLWEEDRSCMAWLDEQPLKSVVYV  976
                  ++YTIGPLHA     V S  G    RS S  SL  EDRSCM WL+ Q  +SVVYV
Sbjct  231   ATIFTDIYTIGPLHA---LAVKSHVGHFSGRSESVGSLQMEDRSCMVWLNSQASRSVVYV  287

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRK----KGYM  1144
             SFGS+  +T +Q +EFWHG+VN G+ FLW +R ++++G++   A  +    K    +  +
Sbjct  288   SFGSLVKITVDQLMEFWHGLVNCGRPFLWVLREDAILGENEEKARSLLSELKVVSERRRV  347

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             V WAPQEEVL H AVGGFLTHSGWNSTLE I  G+PMICWP  ADQQ+NSR V  VWK G
Sbjct  348   VDWAPQEEVLAHAAVGGFLTHSGWNSTLEGIVAGIPMICWPRIADQQINSRWVSEVWKIG  407

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +DMKDTCDR TVE MV+ LM+ +++E  K   R++ L+  +V   GSS  NL+RLV++++
Sbjct  408   LDMKDTCDRSTVETMVRLLMDDKKEEIMKSMARISALSSDSVGPEGSSSKNLERLVKNIR  467

Query  1505  KM  1510
             K+
Sbjct  468   KI  469



>ref|XP_007207170.1| hypothetical protein PRUPE_ppa022102mg [Prunus persica]
 gb|EMJ08369.1| hypothetical protein PRUPE_ppa022102mg [Prunus persica]
Length=474

 Score =   419 bits (1078),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 213/477 (45%), Positives = 295/477 (62%), Gaps = 15/477 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+IFPFP+QGH+  +L LAELLCH + +HVT++N+   HQRL     L   F   P  +
Sbjct  7     HVVIFPFPLQGHMKPLLCLAELLCH-AGLHVTYVNTHHNHQRLANRQALSTHF---PTLH  62

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR----PPVTCIIA  451
             F +ISDGLP D PRT +    L  ++    +P FRE+L + SL++       PP +CI+ 
Sbjct  63    FESISDGLPEDDPRTLNS--QLLIALKTSIRPHFRELLKTISLKAESNDALVPPPSCIMT  120

Query  452   DGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVE  631
             DG++ FA DV  EL +P + F        W   C+PKLIE+G LP   + DM+  +  V 
Sbjct  121   DGLVTFAFDVAEELGLPILSFNVPCPRYLWTCLCLPKLIENGQLPFQ-DDDMNVEITGVP  179

Query  632   GMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKH  811
             GME +L  +DLP FCR            I  T    RA+ LIL+T  +L+   ++ +   
Sbjct  180   GMEGLLHRQDLPGFCRVKQADHPSLQFAINETQTLKRASALILDTVYELDTPCISHMALM  239

Query  812   IPNLYTIGPLHAHLRARVSS-SRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              P +YT+GPLHA L +++   SRG     S  SLW+ D +CM WLD QP KSV+YVSFG+
Sbjct  240   FPKIYTLGPLHALLNSQIGDMSRG---LASHGSLWKSDLNCMTWLDSQPSKSVIYVSFGT  296

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQEE  1168
             +  LTR Q +EFW+G++NSG  FLW +R +   GD  IP EL  GT+++G +V W  QEE
Sbjct  297   LVHLTRAQVIEFWYGLINSGHPFLWVMRSDITSGDHQIPPELENGTKERGCIVDWVSQEE  356

Query  1169  VLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCD  1348
             VL H +VGGFLTHSGWNSTLESI  GLPMICWP   D  + SR V   WK G+ + + CD
Sbjct  357   VLAHKSVGGFLTHSGWNSTLESIVAGLPMICWPNLGDHYIISRTVCRQWKIGLQLNENCD  416

Query  1349  RITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
             R  +E MV+ LM  +R+E     + ++KLAR +V + GSS++NL++L+E ++ ++ Q
Sbjct  417   RSNIESMVQTLMGSKREEIQSSMDAISKLARDSVAEGGSSHNNLEQLIEYIRNLQHQ  473



>dbj|BAM63146.1| uncharacterized glucosyltransferase 2 [Ipomoea nil]
Length=464

 Score =   419 bits (1076),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 216/472 (46%), Positives = 294/472 (62%), Gaps = 28/472 (6%)
 Frame = +2

Query  149   MLRLAELLCHESSIHVTFLNSEFAHQRLLRYT---DLHLRFSSYP-NFYFRTISDGLPAD  316
             ML+LAELLC  + +HVTFLN++  HQRLLR     D+  RF  YP +F F  ISDG P D
Sbjct  1     MLKLAELLCL-AGVHVTFLNTKHNHQRLLRSAANGDVESRFDRYPGSFRFEVISDGFPED  59

Query  317   HPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPP-----VTCIIADGIMCFAIDV  481
             HPR+ +  +D+ NS+  V +P  RE+L         RPP     VTC + + +  +  ++
Sbjct  60    HPRSVEDFLDVVNSLQTVAEPHLREVLL--------RPPESGRKVTCAVVEAVFSYVFEI  111

Query  482   GNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGE--SDMDKLLENVEGMENVLRL  655
             G E+ +P   F T S  C   + C+PKL + G LPL  +   D++ +++ V GME VL++
Sbjct  112   GKEVGVPVFAFETISPCCLGVYLCIPKLFQDGKLPLIKDLGEDLETVVDVVAGMEGVLKV  171

Query  656   RDLPSFCRTTDLSDRGFLSVILATLRTTR--ANGLILNTFEDLEESALAQIRKHIP-NLY  826
             RDLP FCRT          + +A + +    A+GLILN+FE+LE   L  IR H P N Y
Sbjct  172   RDLPEFCRTEGPRAEKSRKLAMAEIHSLSKLAHGLILNSFEELEGPILPHIRTHFPGNTY  231

Query  827   TIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTR  1006
              IGP+  HL+ R++  R      SS+S W ED +C+ WLDEQP +SV+YVSFGS+  LT 
Sbjct  232   MIGPVQQHLKTRLAE-REITQSPSSNSFWREDNTCIQWLDEQPDESVIYVSFGSLNTLTM  290

Query  1007  NQFLEFWHGIVNSGKAFLWAIRPNSVI----GDDNIPAELIEGTRKKGYMVGWAPQEEVL  1174
              Q +E WHG+V S   FLW +RP+ V      D N+  EL +G  + G +V WAPQEEVL
Sbjct  291   AQLMEVWHGLVASAVRFLWVLRPDIVKDNLSSDQNLVTELRKGCSENGQIVSWAPQEEVL  350

Query  1175  VHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRI  1354
              H A+GGF THSGWNSTLESI  G PMIC     DQ +  R+V  VWK GVDM+D CDR+
Sbjct  351   AHRAIGGFWTHSGWNSTLESIIAGKPMICSAQIVDQLITRRVVSEVWKIGVDMEDKCDRL  410

Query  1355  TVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             ++EKMVKE+M  R  E  K + + +KLAR++V   GSSY+NLD L+ +++++
Sbjct  411   SIEKMVKEVMGSRGQELKKSAQKFSKLARESVNNGGSSYTNLDHLINEIRRL  462



>ref|XP_008242286.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=474

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/475 (44%), Positives = 293/475 (62%), Gaps = 13/475 (3%)
 Frame = +2

Query  101   SHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNF  280
             SHV+IFPFP+QGH+  +L LAELLCH + +HVTF+N+   H+ L     L   F   P  
Sbjct  6     SHVVIFPFPLQGHIKPLLCLAELLCH-AGLHVTFVNTHPNHKHLANPEALSTHF---PTL  61

Query  281   YFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR----PPVTCII  448
             +F +ISDGLP DHPR  +   +L  ++    +P FRE+L + SL++       PP+ CII
Sbjct  62    HFESISDGLPDDHPRALNG--ELLMALKTSIRPHFRELLETISLKAESNDASVPPLNCII  119

Query  449   ADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENV  628
              DG++ FA D+  EL IP + +    A   W   C+P LIE G LP   + DM   +  V
Sbjct  120   TDGLVTFAFDLAEELEIPILSYNVPCARYLWTCLCLPDLIEQGQLPF-PDDDMSVEITGV  178

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GM+  L  +DLPSFCR            I  T    R++ LIL+T  +L+ S L+ +  
Sbjct  179   SGMDGPLHRQDLPSFCRVKQTDHPALQFAITWTQAQRRSSALILDTVYELDASCLSHMAL  238

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
               P +YT+GPLHA L A++ +    L   S   LW+ D +CM WLD QP +SV+YVSFG+
Sbjct  239   MFPKIYTLGPLHALLNAQIGNVSKSL--ASHGGLWKSDPNCMTWLDFQPSRSVIYVSFGT  296

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQEE  1168
             +  LTR Q +EFW+G+VNS   F+W IR + +     IPAEL  GT+++GY+V W  QEE
Sbjct  297   LVNLTRAQIIEFWYGLVNSRHPFMWVIRSDIIYRAHQIPAELEIGTKERGYIVDWVSQEE  356

Query  1169  VLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCD  1348
             VL H AVGGFLTHSGWNSTLESI  GLPMICWP   D  + SR V   WK G+ +K+ CD
Sbjct  357   VLAHKAVGGFLTHSGWNSTLESIVAGLPMICWPNLGDHYIISRTVSQKWKIGLQLKENCD  416

Query  1349  RITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMK  1513
             R  +E M++ LM  +R+E     + ++KLAR +V + GSS++NL++L+E ++ ++
Sbjct  417   RCNIETMIQTLMGPKREEIQSSMDTISKLARDSVVKGGSSHNNLEQLIEHIRSLQ  471



>emb|CDP14405.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/342 (56%), Positives = 254/342 (74%), Gaps = 15/342 (4%)
 Frame = +2

Query  491   LRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGE----------SDMDKLLENVEGME  640
             + IP I FRT  A  FWA FC+  +I++G++PL G+           +MD ++ +V GME
Sbjct  1     MGIPFIYFRTVGACSFWANFCIQDVIDAGEIPLKGKDEDKVSYRNKKEMDLMVTSVAGME  60

Query  641   NVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPN  820
               LR RDLP+F R  D+++ G  ++   T R+ +A  L+LN+FEDLE   L QIRKH+P 
Sbjct  61    GYLRRRDLPAFFRVADVNNPGLQTIKSETRRSVKARALLLNSFEDLEGPILDQIRKHMPI  120

Query  821   LYTIGPLHAHLRARVSSSRG--ELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMT  994
             L++IGPLHAHL+ R+++S+   E     S S WEEDRSC+ WL+ QP KSV+YVSFGS+T
Sbjct  121   LFSIGPLHAHLKVRIAASKSTTEKSMGHSGSFWEEDRSCIEWLNSQPDKSVIYVSFGSVT  180

Query  995   VLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI---PAELIEGTRKKGYMVGWAPQE  1165
             ++TR++ LEFW+G+VNSG+ FLW +RP+SVIG D +   P E+ EGT+ +GY+VGWAPQE
Sbjct  181   IMTRDELLEFWYGLVNSGQMFLWVMRPDSVIGKDGVSHLPVEIEEGTKARGYIVGWAPQE  240

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             EVL HPA GGFLTH GWNSTLESI  G+PMICWP++ADQ +NSR V  VWK G+DMKDTC
Sbjct  241   EVLAHPATGGFLTHCGWNSTLESINAGIPMICWPYFADQTINSRFVDEVWKLGLDMKDTC  300

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSY  1471
             DR+TVE MV++LMEVR+DEF K +  MA LA+KAV++ GSSY
Sbjct  301   DRVTVEIMVRDLMEVRKDEFLKKAEHMANLAKKAVSEGGSSY  342



>ref|XP_007206751.1| hypothetical protein PRUPE_ppa025141mg [Prunus persica]
 gb|EMJ07950.1| hypothetical protein PRUPE_ppa025141mg [Prunus persica]
Length=482

 Score =   417 bits (1073),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 212/476 (45%), Positives = 294/476 (62%), Gaps = 15/476 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+IFPFP+QGH+  +L LAELLCH + +HVT++N+   HQRL     L   F   P  +
Sbjct  7     HVIIFPFPLQGHMKPLLCLAELLCH-AGLHVTYVNTHHNHQRLANRQALSTHF---PTLH  62

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR----PPVTCIIA  451
             F +ISDGLP D PRT +    L  ++    +P FRE+L + SL++       PP +CI+ 
Sbjct  63    FESISDGLPEDDPRTLNS--QLLIALKTSIRPHFRELLKTISLKAESNDTLVPPPSCIMT  120

Query  452   DGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVE  631
             DG++ FA DV  EL +P + F        W   C+PKLIE+G LP   + DM+  +  V 
Sbjct  121   DGLVTFAFDVAEELGLPILSFNVPCPRYLWTCLCLPKLIENGQLPFQ-DDDMNVEITGVP  179

Query  632   GMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKH  811
             GME +L  +DLP FCR            I  T    RA+ LIL+T  +L+   ++ +   
Sbjct  180   GMEGLLHRQDLPGFCRVKQADHPSLQFAINETQTLKRASALILDTVYELDAPCISHMALM  239

Query  812   IPNLYTIGPLHAHLRARVSS-SRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              P +YT+GPLHA L +++   SRG     S  SLW+ D +CM WLD QP KS++YVSFG+
Sbjct  240   FPKIYTLGPLHALLNSQIGDMSRG---LASHGSLWKSDLNCMTWLDSQPSKSIIYVSFGT  296

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQEE  1168
             +  LTR Q +EFW+G+VNSG  FLW +R +   GD  IPAEL  GT+++G +V W  QEE
Sbjct  297   LVHLTRAQVIEFWYGLVNSGHPFLWVMRSDITSGDHQIPAELENGTKERGCIVDWVSQEE  356

Query  1169  VLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCD  1348
             VL H +VGGFLTHSGWNSTLESI  GLPMICWP   D  + S  V   WK G+ + + CD
Sbjct  357   VLAHKSVGGFLTHSGWNSTLESIVAGLPMICWPKLGDHYIISSTVCRQWKIGLQLNENCD  416

Query  1349  RITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKL  1516
             R  +E MV+ LM  +R+E     + ++KL+R +V + GSS++NL++L+E ++  +L
Sbjct  417   RSNIESMVQTLMGSKREEIQSSMDAISKLSRDSVAEGGSSHNNLEQLIEYIRNFRL  472



>ref|XP_010674285.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=536

 Score =   412 bits (1060),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/398 (50%), Positives = 272/398 (68%), Gaps = 11/398 (3%)
 Frame = +2

Query  332   DRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIMCFAIDVGNELRIPTIL  511
             D +  L  ++    +P  RE+L         R  +TC I DG + FA ++ NE  +P I 
Sbjct  142   DALEALHEALAPSAEPLLRELLFGT------RDKITCFIIDGWLRFAYEIANEAEVPVIA  195

Query  512   FRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTDL  691
             FR  SA C WA+FC+P++IE+G++P     +MD+L++NV GM++ LR RDLPSFCR  D+
Sbjct  196   FRCPSACCIWAYFCIPQIIEAGEVPFKDNEEMDQLVKNVAGMDSFLRCRDLPSFCRGQDM  255

Query  692   SDRGFLSVILA--TLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARV  865
             S    L    A    RT  A+  ILNTFEDLE   L+QIR     +Y+IGPLHAHL+ R+
Sbjct  256   SSCCELQEYFAGEIQRTKHAHSFILNTFEDLEGPILSQIRSQCSTVYSIGPLHAHLKYRL  315

Query  866   SSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNS  1045
                   L   SSSSLWE D+SC++WLD++P KSV+Y+S GS T LT+NQ  E W G+V S
Sbjct  316   GKGETPLSNNSSSSLWEVDKSCISWLDQKPDKSVIYISLGSTTTLTKNQLTELWTGVVQS  375

Query  1046  GKAFLWAIRPNSVIG---DDNIPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGW  1216
              + FLW +RPN +I    D  IP +L+EGT K+G +V WAPQ+EVL H A+GGFLTHSGW
Sbjct  376   KRYFLWVVRPNVIIEGGLDSPIPNDLLEGTDKRGCIVKWAPQDEVLTHRAIGGFLTHSGW  435

Query  1217  NSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRR  1396
             NSTLESI  G+PM+CWP +ADQQ+NSR    VW+ G+DMKDTCDR  VEKM+ +LM+ ++
Sbjct  436   NSTLESIVAGVPMLCWPHFADQQLNSRFASEVWRIGLDMKDTCDRTIVEKMINDLMDGKK  495

Query  1397  DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             DE  + + R+++ A+K++++ GSSYSNL+RL+ED+  M
Sbjct  496   DELQRSAKRVSQEAKKSISEGGSSYSNLNRLIEDIIAM  533


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +2

Query  98   SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
            S H+LIFP P+QGH+  ML LAEL C  +++ VTFLN+   H+ L ++T++H RF+ YP+
Sbjct  8    SPHILIFPLPLQGHITPMLHLAELFCL-ANLKVTFLNTNKNHKLLTQHTNIHARFARYPS  66

Query  278  FYFRTISD  301
            F F TI D
Sbjct  67   FRFETIPD  74



>emb|CBI31566.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 217/504 (43%), Positives = 305/504 (61%), Gaps = 54/504 (11%)
 Frame = +2

Query  83    MDQRS-SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             MDQRS S HVLI P P+QG+VN ML+LAELLC  + I VTFLN  + H  LL Y+++  R
Sbjct  1     MDQRSVSPHVLILPSPLQGNVNSMLKLAELLC-LAGIQVTFLNCHYPHHCLLSYSNVQAR  59

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSG-RPPV  436
             FS YP F F TISDGLP +HPRT ++ +D+ + +   T P F EM+ S    +S  RPP+
Sbjct  60    FSRYPGFRFETISDGLPMEHPRTAEQFLDIVDGVKTTTAPLFMEMMISWCRSTSDTRPPL  119

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TCI+AD +M FA DV NE+ +P ++F   SA  FWA+F  P+LIE+G++P+ G+ DMD+L
Sbjct  120   TCIMADQLMSFATDVANEVGLPIVIFCAISACSFWAYFSFPQLIEAGEVPITGD-DMDRL  178

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             + +V GME  LR RDLPS  R  D++  G   ++    +  RA+ L++NTF+DLE   L+
Sbjct  179   VVSVPGMEGFLRRRDLPSSGRVNDVAYPGLQHLMKIFRQAQRAHALVINTFDDLEGPVLS  238

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
             QIR H P  Y +GPLHAHL+++++S       +SS+S  EED+SC+ WLD QP KSV+YV
Sbjct  239   QIRDHYPRTYAVGPLHAHLKSKLASETSTS--QSSNSFREEDKSCILWLDRQPPKSVIYV  296

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIP-----------------  1105
             SFGS+ ++T+++  EFWHG+VNSG  FLW IRP++++    +                  
Sbjct  297   SFGSLAIITKDELREFWHGLVNSGSRFLWVIRPDALVVPPTVTWAYQLLNIWLCSSKQLV  356

Query  1106  --AELIEGT------------------------RKKGYMVGWAPQEEVLVHPAVGGFLTH  1207
                 L+ GT                        +   +  G+  +++V        +L+ 
Sbjct  357   WRPPLLSGTACSSKLKIEMILMKTLKHLGEVEYKDAPHTKGYCLKKKVKHFSEAHAWLSL  416

Query  1208  SGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELME  1387
               + STL+ I  G+PMICWP +ADQQ+NSR +  VWK G+DMKDTCDRI +EKM    ME
Sbjct  417   KKFLSTLKGITAGVPMICWPRFADQQINSRFMSHVWKLGIDMKDTCDRIMIEKMHLISME  476

Query  1388  VRRDEFTKCSNRMAKLARKAVTQH  1459
             +     +K     AK  R ++ Q 
Sbjct  477   ISLSSTSK-----AKPPRVSMKQQ  495



>gb|EPS61663.1| hypothetical protein M569_13131, partial [Genlisea aurea]
Length=464

 Score =   407 bits (1045),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 220/450 (49%), Positives = 291/450 (65%), Gaps = 17/450 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVLIFP P+QG VN ML+L+ELLC  + IHVTFL S F++  L R++D+  RFS Y  F 
Sbjct  17    HVLIFPLPLQGPVNAMLKLSELLCL-AGIHVTFLLSNFSYALLRRHSDIESRFSRYSGFR  75

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREML-SSGSLQ-SSGRPPVTCIIADG  457
                I DGLP D PR G   +DL +SI  V +   R++L ++ SL+  S R  V+ II DG
Sbjct  76    IAGIDDGLPEDRPRVGVGSIDLLSSILRVGETELRKVLEATDSLRDGSARRRVSFIIIDG  135

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD----------M  607
             I+ F + V  EL IP + FRT SA  FWA FC  ++I +G+LPL GE +          +
Sbjct  136   ILNFVLPVAEELGIPVVHFRTISACSFWASFCSKEVIAAGELPLRGEEEGKYEYWRNPNL  195

Query  608   DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEES  787
             D  + ++ GME +LR RDLPSF R TD +D     +   T +   + GLILNTFEDLE  
Sbjct  196   DLPVTSIPGMEAILRRRDLPSFFRVTDPNDSELQMLATDTRKAALSAGLILNTFEDLEGP  255

Query  788   ALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSV  967
              + +IRK IPN+Y+IGPLH HL++ +      +   SSSS   EDR+ + WL+ QP KSV
Sbjct  256   IIDEIRKRIPNVYSIGPLHTHLKSHLDPRSSSV--ASSSSFLREDRTSIDWLNSQPPKSV  313

Query  968   VYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN--IPAELIEGTRKKGY  1141
             +YVSFGS+T LT  + LEF +G+VNSG  FLW +RP+S+ G D   IP EL +GTR++GY
Sbjct  314   IYVSFGSLTQLTEEEHLEFLNGLVNSGHRFLWVVRPDSIAGSDKVAIPEELEQGTRERGY  373

Query  1142  MVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKN  1321
             +V WAPQ EVL HP+VG F TH GWNSTLESIC G+PMICWP++ DQ  NSR V   WK 
Sbjct  374   VVEWAPQMEVLAHPSVGAFFTHGGWNSTLESICAGVPMICWPYFIDQPTNSRFVSHEWKV  433

Query  1322  GVDMKDTCDRITVEKMVKELMEVRRDEFTK  1411
             G+D+      +  E + + + + RRDE ++
Sbjct  434   GLDVNSCDRVVVEEMVREVMEDRRRDELSE  463



>emb|CDP05613.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   403 bits (1035),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 214/416 (51%), Positives = 272/416 (65%), Gaps = 32/416 (8%)
 Frame = +2

Query  341   VDLFNSINAVTKPRFREMLSSGSLQSSG--RPPVTCIIADGIMCFAIDVGNELRIPTILF  514
             +DL  S+ +V KP  +E LS   +  SG  RPP T IIADGI+  A+DV  E+ +P I F
Sbjct  1     MDLHTSLQSVMKPFLKEFLSKDPVGGSGKNRPPFTSIIADGILSVALDVAEEIGLPVIYF  60

Query  515   RTFSASCFWAFFCVPKLIESGDLPLN------GESDMDKLLENVEGMENVLRLRDLPSFC  676
             RT SA  FW +FC P L E+G+ P +        +DMD  + +V+GME VLR RDL SF 
Sbjct  61    RTTSAGFFWPYFCTPLLTEAGEFPFSFTILYSERNDMDLPIAHVKGMEGVLRHRDLTSFY  120

Query  677   RTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLR  856
             R  DL+   F  ++   L+T RA GLILNTFEDLE   L+ +R   PNLYTIGPL+AHL+
Sbjct  121   RANDLNSPRFKLLLNENLQTPRAKGLILNTFEDLERPILSHVRIQCPNLYTIGPLYAHLK  180

Query  857   ARVSSS----RGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEF  1024
              R+       RG         L EED SC+ WLD QP KSV+YVSFGS+T++TR + LEF
Sbjct  181   TRLQLQLVLERGR-----GFDLCEEDTSCIKWLDNQPPKSVLYVSFGSITIITREKLLEF  235

Query  1025  WHGIVNSGKAFLWAIRPNSV---IGDDNIPAE---------LIEG-TRKKGYMVGW--AP  1159
             WHGIVNS   FLW IR +S+   +GDD +  +         LI   +  +GY VG+  AP
Sbjct  236   WHGIVNSRVRFLWVIRSDSIRVRLGDDGLETDKQYKYLGKKLINNYSSDRGYRVGYFLAP  295

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             QEEVL  PA+  FLTHSGWNSTLES+ EG PMICWP++ DQ  NSR VG +WK G+D+KD
Sbjct  296   QEEVLARPAIDRFLTHSGWNSTLESMVEGKPMICWPYFGDQHPNSRFVGELWKLGLDIKD  355

Query  1340  TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             TCDR  VEKM+K LM  R+DEF + +N MAKLARK++ + GSS+ N  RL++D+ K
Sbjct  356   TCDRKIVEKMIKGLMVERKDEFLQRANEMAKLARKSIEEGGSSFCNFLRLIDDIVK  411



>ref|XP_003520949.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Glycine max]
Length=477

 Score =   403 bits (1036),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 211/490 (43%), Positives = 305/490 (62%), Gaps = 25/490 (5%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M+   +SH+L  PFP +GH+  M  LA+LL H S   +TF+N+   H RLL++TDL    
Sbjct  1     MEHSDTSHILAIPFPAEGHIKPMFNLAKLLSHRSH-RITFVNTHHNHNRLLQFTDLPSFH  59

Query  263   SSYPNFYFRTISDGLPADHPRTGDRV----VDLFNSINAVTKPRFREMLSSGSLQSSG--  424
             + +P+F+F +I+DG+P+D+PR G  +    + +  S  ++    FRE+ S   L+ +G  
Sbjct  60    TQFPDFHFASITDGIPSDNPRKGALINYLPMLITPSARSLVAKEFRELFSR-LLEKNGDQ  118

Query  425   -RPPVTCIIADGIM-CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGE  598
              + P +CII DG+M    + V  E RIP I FRT+SA+C W    + KL + G   L   
Sbjct  119   WQQP-SCIIVDGLMSTIVMGVAQEFRIPVIAFRTYSATCTWVTIFMSKLAKEGAQQLRSN  177

Query  599   SDMDKLLE---NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTF  769
              D + L     N+ G+EN+LR  DLP    T D        +   TL  T+A+ +ILNTF
Sbjct  178   QDAENLKSASANIPGLENLLRNCDLPPDSGTRDF-------IFEETLAMTQASAIILNTF  230

Query  770   EDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDE  949
             E LE S + ++    P +Y+IGPLH   +  ++++    P +    L +EDRSC+ WLD 
Sbjct  231   EQLEPSIITKLATIFPKVYSIGPLHTLCKTMITTNSTSSPHKDGR-LRKEDRSCITWLDH  289

Query  950   QPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTR  1129
             Q  KSV+YVSFG++  L+  Q +EFWHG+VNS K FLW I+   +I   N+P EL  GT+
Sbjct  290   QKAKSVLYVSFGTVVNLSYEQLMEFWHGLVNSLKPFLWVIQKELII-QKNVPIELEIGTK  348

Query  1130  KKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGA  1309
             ++G++V WAPQEEVL +PAVGGFLTH GWNSTLESI EG+PM+CWP   DQ VNSR V  
Sbjct  349   ERGFLVNWAPQEEVLANPAVGGFLTHCGWNSTLESIAEGVPMLCWPSITDQTVNSRCVSE  408

Query  1310  VWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRL  1489
              WK G++M  +CDR  VE MV+++ME   ++  + +N +AK A   + ++GSSY NL+ L
Sbjct  409   QWKIGLNMNGSCDRFVVENMVRDIME--NEDLMRSANDVAKKALHGIKENGSSYHNLENL  466

Query  1490  VEDLKKMKLQ  1519
             ++D+  MK++
Sbjct  467   IKDISLMKVR  476



>ref|XP_007026846.1| UDP-glucosyl transferase 85A3, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07348.1| UDP-glucosyl transferase 85A3, putative isoform 2 [Theobroma 
cacao]
Length=448

 Score =   400 bits (1027),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 213/437 (49%), Positives = 273/437 (62%), Gaps = 17/437 (4%)
 Frame = +2

Query  221   HQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRTGDRVV-DLFNSINAVTKPRFREML  397
             H RLL  TDL  R   YP F F TI D +P D PR+G     D   +   V KP  R++ 
Sbjct  6     HDRLLS-TDLLAR---YPEFQFLTIPDVVPRDRPRSGTMSPGDFLLAAGPVIKPALRQLF  61

Query  398   SSGSLQSSGRPPVTCIIADGIMCFA-IDVGNELRIPTILFRTFSASCFWAFFCVPKLIES  574
              S   +     P TCII DGI+  + IDV  E ++P   FRT SA C W +F V KL+E 
Sbjct  62    ISLCKKKGRWQPATCIIEDGILSSSVIDVAEEFQVPVFAFRTSSACCIWTYFHVRKLVEE  121

Query  575   GDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVIL-ATLRTTRANG  751
             GD+P+  + DMDK +  + G+ENV+R RDLP   R     D G    I   TL   RA  
Sbjct  122   GDVPVVQDKDMDKPVTCIPGLENVVRRRDLPGIFRIERADDPGLEFFINDQTLVMPRAFA  181

Query  752   LILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSC  931
             +I+NTF+ LE + ++++      +YT+GPLH    AR           S+S LW+EDR C
Sbjct  182   IIINTFDGLEATMISKLASVFTKMYTVGPLHGLSNARAKEETTSA--SSNSILWKEDRGC  239

Query  932   MAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAE  1111
             M WLD QP +SVV+VSFGS   LTR++ LEF HG+VNSG  FLW IRP+S+ G+  +   
Sbjct  240   MFWLDSQPSRSVVFVSFGSFVGLTRDKMLEFGHGLVNSGYPFLWVIRPDSITGE--VDPS  297

Query  1112  LIEGTRK------KGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFY  1273
             LI G  K      KG MV WAPQEEVL HPA+G FLTHSGWNSTLES+  G+PMICWP  
Sbjct  298   LILGELKAMIEDNKGLMVSWAPQEEVLAHPAIGVFLTHSGWNSTLESVYAGVPMICWPAI  357

Query  1274  ADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVT  1453
              DQQ+NSR V  VWK G+DMKDTCDR T+EKMV+ LME +R+E  K  N + KLA + + 
Sbjct  358   GDQQINSRFVSDVWKIGLDMKDTCDRSTIEKMVRSLMEDKREEIMKSVNEIKKLAHETIK  417

Query  1454  QHGSSYSNLDRLVEDLK  1504
             + GSS+SNL++L++D++
Sbjct  418   EGGSSFSNLEKLIDDIR  434



>ref|XP_009594030.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=380

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/371 (50%), Positives = 258/371 (70%), Gaps = 7/371 (2%)
 Frame = +2

Query  410   LQSSGRPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPL  589
             L+S  + PVTC+I D +  + +D+GNE+ +P I F T S SC W + C+ KLIESG+LP 
Sbjct  2     LRSGAKEPVTCVIPDALSYYVVDIGNEMGVPVIPFDTISPSCVWVYLCLSKLIESGELPF  61

Query  590   NGESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTF  769
               ++D+D  + ++  ME +LR RDLP FC     +D  FL+ +    R  +++GLILNTF
Sbjct  62    K-DNDLDASVTHIPAMEGLLRRRDLPHFCLMDYKTDPNFLAALKQIERIPQSHGLILNTF  120

Query  770   EDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRG-ELPWRSSSSLWEEDRSCMAWLD  946
             EDL+ S L+ IR + P  Y IGP+H HL+A+++S     LP+  S+SLWEED S + WLD
Sbjct  121   EDLDRSFLSCIRSYSPKTYAIGPVHLHLKAKLASKNTPSLPF--SNSLWEEDHSSIKWLD  178

Query  947   EQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPAELI  1117
              QP+ SV+YVSFGS  VL++ + LEF HG++NS   FLW +RPN + G   D     EL 
Sbjct  179   AQPMGSVIYVSFGSAVVLSKKEILEFRHGLLNSKVKFLWVMRPNILKGGKSDVQFMKELA  238

Query  1118  EGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSR  1297
             EG +  GY+V WAPQ+ VL HP++ GFLTHSGWNSTLES+ EG PMICWP Y DQ+V SR
Sbjct  239   EGCKGNGYVVSWAPQKMVLAHPSISGFLTHSGWNSTLESVIEGKPMICWPQYVDQRVTSR  298

Query  1298  LVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSN  1477
             LV  +W+ G+DMKD CDR T+E+ +K+LME +RDEF K    ++KLA+ ++ + GSSY+N
Sbjct  299   LVNELWQIGLDMKDMCDRSTIERTIKDLMETKRDEFKKSIEELSKLAKLSIGEGGSSYNN  358

Query  1478  LDRLVEDLKKM  1510
             LD L+ D+K++
Sbjct  359   LDCLIHDIKEL  369



>ref|XP_008242262.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=456

 Score =   397 bits (1021),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 203/462 (44%), Positives = 283/462 (61%), Gaps = 15/462 (3%)
 Frame = +2

Query  149   MLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRT  328
             +L LAELLCH + +H T++N    HQRL     L   F   P  +F +ISDGLP D PRT
Sbjct  4     LLCLAELLCH-AGLHATYVNPPPTHQRLANRQALSTHF---PTLHFESISDGLPEDDPRT  59

Query  329   GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR----PPVTCIIADGIMCFAIDVGNELR  496
              +    L  ++    +P FRE+L + SL++       PP +CI+ DG++ FA DV  EL 
Sbjct  60    LNS--QLLIALKTSIRPHFRELLKTISLKAESNDALVPPPSCIVTDGLVTFAFDVAEELG  117

Query  497   IPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFC  676
             +P + +        W   C+PKLIE+G LP   + DM+  +  V GME +LR +DLP FC
Sbjct  118   LPILSYNVPCPRYLWTCLCLPKLIENGQLPFQ-DDDMNVEITGVPGMEGLLRRQDLPGFC  176

Query  677   RTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLR  856
             R            I  T    R++ LIL+T  +L+   ++ +    P +YT+GPLHA L 
Sbjct  177   RVKQADHPSLQFAINETQTLKRSSALILDTVYELDAPCISHMALTFPKIYTLGPLHALLN  236

Query  857   ARVSS-SRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHG  1033
             +++   SRG     S  SLW+ D +CM WLD QP KSV+YVSFG++  LT  Q +EFW+G
Sbjct  237   SQIGDMSRG---LASHGSLWKSDLNCMTWLDSQPSKSVIYVSFGTLVHLTHAQVIEFWYG  293

Query  1034  IVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSG  1213
             +VNSG  FLW +R +   GD  IPAEL +GT+++GY+V W  QEEVL H +VGGFLTHSG
Sbjct  294   LVNSGHPFLWVMRSDITSGDHQIPAELEKGTKERGYIVDWVSQEEVLAHKSVGGFLTHSG  353

Query  1214  WNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVR  1393
             WNSTLESI  GLPMICWP   D  + SR V   WK G+ + + CDR  +E MV+ LM  +
Sbjct  354   WNSTLESIVAGLPMICWPNLGDHYIISRTVCRQWKIGLQLNENCDRSNIESMVQTLMGPK  413

Query  1394  RDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
             R+E     + ++KLAR +V + GSS++NL++L+E ++ ++ Q
Sbjct  414   REEIQSSMDAISKLARDSVAEGGSSHNNLEQLIEYIRNLQHQ  455



>ref|XP_003522179.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Glycine max]
 gb|KHN15665.1| UDP-glycosyltransferase 85A7 [Glycine soja]
Length=482

 Score =   397 bits (1020),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 205/490 (42%), Positives = 303/490 (62%), Gaps = 16/490 (3%)
 Frame = +2

Query  83    MDQRSSS--HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             M++ SS+  H+L   FP +GH+  M  L +LL  +    +TF+N+   H RLL++TDL  
Sbjct  1     MEEHSSAAPHILALTFPAEGHIKPMFNLTKLLSQKGH-RITFVNTRHNHNRLLQFTDLPS  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
               + +PNF F T++DG+P  HP   D  V +  +  +     FRE+LSS   +     P 
Sbjct  60    FHTQFPNFNFATVNDGVPDGHP-PNDFSVMVSPASRSKVALEFRELLSSLVEKRCLWGPP  118

Query  437   TCIIADGIM-CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDK  613
             +C+I DG+M   A+D   E  IP + FRT+SA+C W    + K+I    + +    D+DK
Sbjct  119   SCMIVDGMMSTIAMDAAEEFGIPVLTFRTYSATCTWVTIHISKVIREEAVDMQDPEDIDK  178

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESAL  793
             +L ++ G+EN+LR RDLPS  R    S+ G    I  TL  TRA+GLILNTF+ LE   +
Sbjct  179   VLSSIPGLENLLRDRDLPSVFRLKPGSN-GLEFYIKETLAMTRASGLILNTFDQLEAPII  237

Query  794   AQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVY  973
               +    P +YTIGPLH  ++ +++++       SS  L +ED+ C+ WL+ Q  KSV+Y
Sbjct  238   TMLSTIFPKVYTIGPLHTLIKTQITNNSS-----SSLHLRKEDKICITWLNHQKEKSVLY  292

Query  974   VSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPN-----SVIGDDNIPAELIEGTRKKG  1138
             VSFG++  L+  Q LEFWHG+VNS K FLW +R +      ++ + N+P EL  GT+++G
Sbjct  293   VSFGTVVKLSHEQLLEFWHGLVNSMKPFLWVMRRDLINREGIMENINVPIELELGTKERG  352

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              +V WAPQEEVL HP+VGGFLTH GWNS LE I EG+PM+CWP  ADQ VN+R V   W 
Sbjct  353   LLVDWAPQEEVLAHPSVGGFLTHCGWNSILECIVEGVPMLCWPLMADQTVNNRCVSEQWG  412

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G+D+  T DR+ +E MVK ++E + +   +  + +AK AR ++ + GSSY N+++++ED
Sbjct  413   IGIDIDGTYDRLVIENMVKNVLENQIEGLKRSVDEIAKKARDSIKETGSSYHNIEKMIED  472

Query  1499  LKKMKLQL*Y  1528
             +  MK++  Y
Sbjct  473   IMSMKIRKKY  482



>ref|XP_006379614.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
 gb|ERP57411.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
Length=365

 Score =   392 bits (1008),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 238/314 (76%), Gaps = 5/314 (2%)
 Frame = +2

Query  593   GESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFE  772
             G  DMD+L+  V GME  LR RDLPSFCR +D++    L V+  T ++ RA  LILNTFE
Sbjct  50    GNEDMDRLITKVPGMETFLRCRDLPSFCRVSDMTHPNLLLVMNETRQSPRAKALILNTFE  109

Query  773   DLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQ  952
             DLE   ++QIR H P +Y+IGPLH HL+A++S+ + E   +SS+SL E DRSCM WLD Q
Sbjct  110   DLEGPLMSQIRTHCPEIYSIGPLHEHLQAKLSA-KNEKSCQSSNSLREIDRSCMTWLDNQ  168

Query  953   PLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD----NIPAELIE  1120
             P KSV+YVSFGS TV+TR+Q LEFW+G+V+S K FLW IRP+S+   D     IP E+ E
Sbjct  169   PEKSVLYVSFGSFTVMTRHQLLEFWYGLVSSKKRFLWVIRPDSIATKDGEFEKIPVEVEE  228

Query  1121  GTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRL  1300
             GT+++G++ GW PQEEVL H A+ GFLTHSGWNSTLESI  G+PMICWP++ADQQVNSR 
Sbjct  229   GTKERGFIAGWVPQEEVLAHKAIAGFLTHSGWNSTLESIVAGVPMICWPYFADQQVNSRF  288

Query  1301  VGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNL  1480
             VG VWK G+DMKD CDR  VEKMV +LM  RR+EF + + RMA+L+RK+V + GSSY NL
Sbjct  289   VGEVWKLGLDMKDQCDREIVEKMVNDLMVERREEFVRSATRMAELSRKSVREGGSSYCNL  348

Query  1481  DRLVEDLKKMKLQL  1522
             +RL+ED++ M +++
Sbjct  349   NRLIEDIRTMSVRV  362



>ref|XP_004957723.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Setaria italica]
Length=483

 Score =   394 bits (1013),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 217/487 (45%), Positives = 293/487 (60%), Gaps = 33/487 (7%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             ++HVL+FP PVQGH+N ML  A  L  ++  HVTFL+++   +R+ R   +    +S P 
Sbjct  3     AAHVLVFPVPVQGHINAMLPFAAALL-DAGAHVTFLHTDHNLRRVGRAASV----ASSPR  57

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFR----EMLSSGSLQSSGR------  427
               F +I DGLP D  R+   + +L  S+  V   R+R     +LS+GS   +G       
Sbjct  58    LRFLSIPDGLPDDSRRSVGDLGELDRSLREVGSVRYRALFASLLSAGSPNRAGADDEHRF  117

Query  428   PPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM  607
             PP+TC++ADG+M +AID+  EL +P + FRT SA  F AF   P L E GDLP     D+
Sbjct  118   PPLTCVVADGLMPWAIDIAEELGVPALAFRTSSACSFLAFMSAPGLFELGDLPFPAGGDL  177

Query  608   DKLLENVEGMENVLRLRDLPSFCR---TTDLSDRGFLSVILATLRTTRANGLILNTFEDL  778
             D+ +  V GME+ LR RDLPS  R    TD  D     V  A+    +A  L+LNT   L
Sbjct  178   DEPVRGVPGMESFLRRRDLPSSFRRRGDTDDVDPSLHVVAKASAHCGKARALVLNTAASL  237

Query  779   EESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPL  958
             E SALA I   + +L++IGPLHA   A  +S           SLW ED  C+AWLD Q  
Sbjct  238   ERSALAHIAPRMRDLFSIGPLHAMSPALAASC----------SLWREDDGCLAWLDGQAD  287

Query  959   KSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSV-IGDDNI--PAELIEGTR  1129
             +SVVYVS GS TV++R QF EF  GI  +G  FLW +RP+ V    D +   A +     
Sbjct  288   RSVVYVSLGSFTVISREQFKEFLSGIAATGYPFLWVLRPDMVWASQDGVLHEAAMAAAGD  347

Query  1130  KKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGA  1309
              K  +V WAPQ +VL H AVG FLTH+GWNSTLE++ EG+PM+CWPF+ADQ VNSR VGA
Sbjct  348   GKARIVAWAPQRDVLRHRAVGCFLTHAGWNSTLEAVVEGVPMVCWPFFADQHVNSRFVGA  407

Query  1310  VWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRL  1489
             VW+NG+DMKD C+R  VE+ V+E ME   DE  + +  +A+L ++ V   GSS + L+RL
Sbjct  408   VWRNGLDMKDVCERGVVERTVREAME--SDEIRRAAQALAQLVKRDVAAGGSSATELERL  465

Query  1490  VEDLKKM  1510
             V  ++++
Sbjct  466   VGFIREL  472



>ref|XP_006361974.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=378

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 197/400 (49%), Positives = 267/400 (67%), Gaps = 30/400 (8%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+IFPFP QGHVN ML+LA+LL   S+  VTFL +   H R++ + D+  RF S   F+
Sbjct  6     HVIIFPFPAQGHVNSMLKLAQLLSL-SNFDVTFLVTVDTHDRVVNHIDVLSRFGSV--FH  62

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
              + +  G+  D   T D +  L+ S+N + KP  RE + + S        VTC+I DGI+
Sbjct  63    LQALPHGISMDGVNTRDGISMLYYSLNTIAKPFLREFIPNSS--------VTCLIVDGIL  114

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
               A DV  E+ +P I FRT SAS FW++FC+P+LI++G+LPL  E+  D  L  V+GME+
Sbjct  115   SMAADVAEEINLPIIYFRTVSASSFWSYFCIPELIQAGELPLK-ENAKDLTLTKVKGMED  173

Query  644   VLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRKHIPNL  823
              LR RDLPSFC+ +DL++  F  V+  T +T RA GLILNTFEDLE           P+ 
Sbjct  174   FLRGRDLPSFCQASDLTNPDFRIVMTETRQTPRAQGLILNTFEDLER----------PHT  223

Query  824   YTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLT  1003
             ++   +HAHL+A++++        SS++LW+ED  CM+WLD QP KS++YVSFGS+  LT
Sbjct  224   FSNSNVHAHLKAKLATKS-----TSSNNLWQEDERCMSWLDTQPPKSMIYVSFGSVAGLT  278

Query  1004  RNQFLEFWHGIVNSGKAFLWAIRPNSVIGD---DNIPAELIEGTRKKGYMVGWAPQEEVL  1174
             + + LEFW+G+VNS + FLW +RP+ +IG    D I  EL +GT+ +GYM  W PQE+VL
Sbjct  279   KEELLEFWYGLVNSEQKFLWVMRPDLIIGQERKDEISVELEQGTKARGYMADWVPQEKVL  338

Query  1175  VHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNS  1294
              H  +GGFLTHSGWNSTLESI EG+ MICWP +ADQQVNS
Sbjct  339   AHREIGGFLTHSGWNSTLESIVEGVSMICWPRFADQQVNS  378



>ref|XP_007133898.1| hypothetical protein PHAVU_010G001300g [Phaseolus vulgaris]
 gb|ESW05892.1| hypothetical protein PHAVU_010G001300g [Phaseolus vulgaris]
Length=484

 Score =   390 bits (1003),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 209/486 (43%), Positives = 298/486 (61%), Gaps = 15/486 (3%)
 Frame = +2

Query  83    MDQRSSS--HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             M++RS++  H+L  PFP +GH+  M  L +LLCH+    +TF+N++  H RLL++TDL  
Sbjct  1     MEERSTAPLHLLALPFPAEGHIKPMFYLTKLLCHKGH-RITFVNTQHIHNRLLQHTDLPS  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
               + +P+F F  ++DG+P D       V+   +S + V +  FREML           P 
Sbjct  60    FHADFPDFRFTFVADGVPHDLAPNDFSVIVSPSSRSRVAE-EFREMLRGLVENPPPWGPP  118

Query  437   TCIIADGIM-CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDK  613
             +CIIADG+M   A+D   EL +P I FRT+SA+  W    V K++E G + +    D+ K
Sbjct  119   SCIIADGMMSTIAMDAAQELGVPVIAFRTYSATATWVTIHVSKVLEEGVMDMQNPEDVHK  178

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESAL  793
             ++ ++ G+EN+LR  DLP+  +    S  G    +  TL  TRA+ LILNTF++LE   +
Sbjct  179   VVSSIPGLENLLRDCDLPNVFKMKRGSS-GLDFFMKETLTMTRASALILNTFDELEAPTI  237

Query  794   AQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVY  973
               +    P +YTIGPLH HL+ +V+ +        S ++  +DRSC+ WLD Q  KSV+Y
Sbjct  238   TNLTTVFPRVYTIGPLHTHLKNQVTQNPS-----LSLNVRTQDRSCITWLDHQRAKSVLY  292

Query  974   VSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD----DNIPAELIEGTRKKGY  1141
             VSFG++  L+  Q LEFWHG+VNS K FLW +R + + G     DN+  EL  GTR++G 
Sbjct  293   VSFGTVVKLSEEQLLEFWHGLVNSLKPFLWVVRKDLMNGKGGFGDNVAEELELGTRERGL  352

Query  1142  MVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKN  1321
             +V WAPQE VL HPAVGGFLTH GWNSTLE I EG+PM+CWPF  DQ VN R V   W  
Sbjct  353   LVEWAPQEGVLAHPAVGGFLTHCGWNSTLECIGEGVPMLCWPFMVDQTVNGRCVSEQWGI  412

Query  1322  GVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
             GV +    DR+ +EKMVK+++E R +      + +AK AR +V Q GSS  N++ +++D+
Sbjct  413   GVGIDGNFDRLVIEKMVKDVLENRIEGLRNSVDEIAKHARDSVKQTGSSSRNIESMIKDM  472

Query  1502  KKMKLQ  1519
               MK Q
Sbjct  473   MTMKEQ  478



>dbj|BAC57706.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
Length=485

 Score =   389 bits (1000),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 207/472 (44%), Positives = 281/472 (60%), Gaps = 26/472 (6%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             ++HVL+FP PV GH+ CML  A  L   + +HVTFL+S+   +R    +   LR+ S P 
Sbjct  9     AAHVLMFPCPVHGHITCMLHFATGLL-AAGLHVTFLHSDHNLRRAAAASSPRLRYVSIP-  66

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSL--QSSGRPPVTCIIA  451
                    DGLP +HPR   R+V+L  S+       +R +L+S  L   + G PPVTC++A
Sbjct  67    -------DGLPVEHPRDVGRIVELMESLKTKASVAYRSLLASLLLGDATGGFPPVTCVVA  119

Query  452   DGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVE  631
             DGIM FA+DV  EL IP + FRT SA  F A+  +P+L+E G+LP     D+D+ +  V 
Sbjct  120   DGIMSFAVDVAEELGIPALAFRTDSACSFLAYLSLPRLLELGELPFKDGDDLDEPVRGVP  179

Query  632   GMENVLRLRDLPSFCR-TTDLSDRGFLSVILA-TLRTTRANGLILNTFEDLEESALAQIR  805
             GME+ LR RDLPS CR  +D  +   L ++   T  +  A  L+LNT   +E +ALA I 
Sbjct  180   GMESFLRRRDLPSQCRDCSDPDNDPLLQIVYGFTAHSGNARALVLNTAASMERAALAHIA  239

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
              H+ +++ IGPLHA +     ++ G        SLW ED  C+AWLD Q   SVVYVS G
Sbjct  240   PHMRDVFAIGPLHA-MSPTAPAAGG--------SLWREDDGCLAWLDGQADGSVVYVSLG  290

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGT--RKKGYMVGWAP  1159
             S+TV++  QF EF HG+V +G  FLW +RP+ V    +           + K  +V WAP
Sbjct  291   SLTVISLEQFTEFLHGLVAAGYPFLWVLRPDMVGASQSAALREAVAAAGKSKARVVEWAP  350

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             Q  VL H AVG FLTH+GWNSTLE+  EG+PM+CWPF+ DQQ+NSR VG VW+ G+DMKD
Sbjct  351   QRGVLRHRAVGCFLTHAGWNSTLEAAVEGVPMVCWPFFTDQQINSRFVGGVWRTGLDMKD  410

Query  1340  TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
              CD   V +MV+E ME    +    +  +A+  R+ V   GSS +   RLVE
Sbjct  411   VCDAAVVARMVREAME--SGQIRASAQALAREVRRDVADGGSSTAEFKRLVE  460



>ref|NP_001059664.1| Os07g0486700 [Oryza sativa Japonica Group]
 dbj|BAF21578.1| Os07g0486700 [Oryza sativa Japonica Group]
Length=492

 Score =   389 bits (999),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 207/472 (44%), Positives = 281/472 (60%), Gaps = 26/472 (6%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPN  277
             ++HVL+FP PV GH+ CML  A  L   + +HVTFL+S+   +R    +   LR+ S P 
Sbjct  9     AAHVLMFPCPVHGHITCMLHFATGLL-AAGLHVTFLHSDHNLRRAAAASSPRLRYVSIP-  66

Query  278   FYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSL--QSSGRPPVTCIIA  451
                    DGLP +HPR   R+V+L  S+       +R +L+S  L   + G PPVTC++A
Sbjct  67    -------DGLPVEHPRDVGRIVELMESLKTKASVAYRSLLASLLLGDATGGFPPVTCVVA  119

Query  452   DGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVE  631
             DGIM FA+DV  EL IP + FRT SA  F A+  +P+L+E G+LP     D+D+ +  V 
Sbjct  120   DGIMSFAVDVAEELGIPALAFRTDSACSFLAYLSLPRLLELGELPFKDGDDLDEPVRGVP  179

Query  632   GMENVLRLRDLPSFCR-TTDLSDRGFLSVILA-TLRTTRANGLILNTFEDLEESALAQIR  805
             GME+ LR RDLPS CR  +D  +   L ++   T  +  A  L+LNT   +E +ALA I 
Sbjct  180   GMESFLRRRDLPSQCRDCSDPDNDPLLQIVYGFTAHSGNARALVLNTAASMERAALAHIA  239

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
              H+ +++ IGPLHA +     ++ G        SLW ED  C+AWLD Q   SVVYVS G
Sbjct  240   PHMRDVFAIGPLHA-MSPTAPAAGG--------SLWREDDGCLAWLDGQADGSVVYVSLG  290

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGT--RKKGYMVGWAP  1159
             S+TV++  QF EF HG+V +G  FLW +RP+ V    +           + K  +V WAP
Sbjct  291   SLTVISLEQFTEFLHGLVAAGYPFLWVLRPDMVGASQSAALREAVAAAGKSKARVVEWAP  350

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             Q  VL H AVG FLTH+GWNSTLE+  EG+PM+CWPF+ DQQ+NSR VG VW+ G+DMKD
Sbjct  351   QRGVLRHRAVGCFLTHAGWNSTLEAAVEGVPMVCWPFFTDQQINSRFVGGVWRTGLDMKD  410

Query  1340  TCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
              CD   V +MV+E ME    +    +  +A+  R+ V   GSS +   RLVE
Sbjct  411   VCDAAVVARMVREAME--SGQIRASAQALAREVRRDVADGGSSTAEFKRLVE  460



>ref|XP_007026850.1| UDP-glucosyl transferase 85A4-like protein isoform 1 [Theobroma 
cacao]
 gb|EOY07352.1| UDP-glucosyl transferase 85A4-like protein isoform 1 [Theobroma 
cacao]
Length=490

 Score =   387 bits (993),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 214/484 (44%), Positives = 293/484 (61%), Gaps = 21/484 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+ FPFP  GH+  M RLAELL H ++  VTFLN++  H  LL  +D+    S YPNF 
Sbjct  10    HVVFFPFPAHGHIKPMFRLAELLSH-ANFQVTFLNTQRNHDLLLLSSDIPAFRSRYPNFQ  68

Query  284   FRTISDGLPAD---HPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIAD  454
               +  D +P     H R+    VDL  S  A  KP   E+L     + +GR P TCIIAD
Sbjct  69    LLSYPDKVPLGLDPHRRSEQGFVDLLLSTKAAAKPALSELLE----KKTGRRPPTCIIAD  124

Query  455   -GIMCF-AIDVGNEL-RIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
               IMC  A+DV  E   IP   F+T  A   W  F + KLIE G++PL G  DMDK + +
Sbjct  125   WAIMCSSAMDVAKEFGNIPVFAFQTACAHYMWMDFHLLKLIEEGEVPLRGYKDMDKPVTS  184

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGF-LSVILATLRTTRANGLILNTFEDLEESALAQI  802
             + G+   +R RDL  F R   +  +   +S    +   ++A G+I NTF+ LE   ++++
Sbjct  185   ISGLGMSVRRRDLSGFARFDTVCKQVIEISTNYGSSAVSQAYGVIHNTFDKLEAPVISKL  244

Query  803   RKHIP-NLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
                +P  +YTIGPLH  L          L    + ++ +ED +C+ WLD QP  SV++VS
Sbjct  245   SSFLPFKIYTIGPLHCLLNNYCIKDSNPL-HSINVTICKEDTNCITWLDSQPSGSVIFVS  303

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPA----ELIEGTRKKG  1138
             FGS+  L+R+Q LE   G++NS + FLW I PN ++G   DD+ P     EL   +++KG
Sbjct  304   FGSLVSLSRSQILEIGQGLLNSCRPFLWVILPNPIVGQQEDDSTPGQILMELENMSKEKG  363

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              +V WAPQE+VL HPA+GGFLTHSGWNST+ESI   +PMICWP  ADQ VNSR V  +W+
Sbjct  364   LIVSWAPQEKVLAHPAIGGFLTHSGWNSTMESIYARVPMICWPTEADQLVNSRCVSELWR  423

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G DMKDTCDR TVEK+V +LME +RDE  K  +++ + A ++V + GSSY NL RL+ D
Sbjct  424   IGFDMKDTCDRSTVEKLVNDLMEDKRDEIMKSMDKITRQAEESVQEGGSSYCNLQRLITD  483

Query  1499  LKKM  1510
             ++ +
Sbjct  484   IRSL  487



>ref|XP_008346926.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Malus domestica]
Length=476

 Score =   386 bits (991),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 203/489 (42%), Positives = 297/489 (61%), Gaps = 29/489 (6%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M+Q+   HV+IFP P+QGH+  +L LAELLCH S  HVTF+N+   HQ   R+ +     
Sbjct  1     MEQQP--HVVIFPLPLQGHIKPLLCLAELLCH-SGFHVTFVNT---HQNYKRFGNSEAIS  54

Query  263   SSYPNFYFRTISDGLPADHPR--TGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR---  427
             + +P  +F +ISDGLP +HPR  +   +++L +SI    KP FRE+L +  L++  +   
Sbjct  55    THFPTLHFESISDGLPEEHPRAISSTLLIELKSSI----KPPFRELLKTIILRADDKDHV  110

Query  428   -----PPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLN  592
                  PP+TCII DG +  A D+  EL IP I          W    +PKL+E G +P  
Sbjct  111   IGCWVPPLTCIITDGTLAGAFDIAQELGIPIIAHNVPYPGYLWTVLSIPKLVEQGQIPFK  170

Query  593   GESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRT-TRANGLILNTF  769
              + DM+  +  V GME  LR RDLP FC+    +D   L  I    +T  RA+ LIL++ 
Sbjct  171   -DDDMNVEIMGVPGMEGYLRRRDLPGFCKVKQ-ADHPALQYISNEYKTLKRASALILDSV  228

Query  770   EDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDE  949
              +L+   L+ + +  P +YT+GP+HA L ++V     EL   + ++     + CM WLD 
Sbjct  229   YELDAPILSHMAQVFPKIYTLGPIHALLNSQVGDISRELNSHTKTA-----QKCMTWLDN  283

Query  950   QPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDD-NIPAELIEGT  1126
              P +SV+YVSFGS+  LT  Q +EFW+G+V SG+ F+W IR +     D ++PAEL  GT
Sbjct  284   HPSRSVIYVSFGSLVKLTHEQVIEFWYGLVKSGQPFIWVIRSDITSRQDLDVPAELETGT  343

Query  1127  RKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVG  1306
             +++G++V WAPQEEVL H AVGGFLTHSGWNSTLE I  G+PMIC+P   D  + SR V 
Sbjct  344   KERGFIVEWAPQEEVLAHIAVGGFLTHSGWNSTLEGIVAGVPMICFPILGDHMIVSRTVC  403

Query  1307  AVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDR  1486
               WK G+ + + CDR  +E ++K+LM  +++   K  +  +KLAR +V + GSS+ NL+ 
Sbjct  404   LKWKIGLPLSENCDRSEIETVIKDLMGYKKEGIQKSMDSTSKLARDSVKKGGSSHCNLEL  463

Query  1487  LVEDLKKMK  1513
             L++ ++ M+
Sbjct  464   LIQQIRDMQ  472



>ref|XP_007219664.1| hypothetical protein PRUPE_ppa023956mg [Prunus persica]
 gb|EMJ20863.1| hypothetical protein PRUPE_ppa023956mg [Prunus persica]
Length=394

 Score =   382 bits (982),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 280/454 (62%), Gaps = 73/454 (16%)
 Frame = +2

Query  83    MDQRSSS-HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             +DQRSS  HVLIFP P+Q HV   L  AELLC  ++ H+TFLNS F H RLLR+ D+   
Sbjct  3     LDQRSSGPHVLIFPLPLQSHVTTTLNFAELLCL-ANFHITFLNSHFVHNRLLRHIDIQSH  61

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
             F + P+F    +S   P    R GD     F SI                    G   + 
Sbjct  62    F-AIPDF----VSTASPT---RNGD-----FCSI--------------------GLGLLA  88

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLL  619
             C++ADGIM FA D+  E+ + +I FRT SASC+W++F +PKLIE+ +LP   ES+MD L+
Sbjct  89    CVVADGIMNFATDIAKEIGLMSISFRTISASCYWSYFGIPKLIEASELPFK-ESEMDILI  147

Query  620   ENVEGMENVLRLRDLPSFCRTTDL-SDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
              +V GME++L  RDLP FCRT+++ +D+    VI  +    RA+ LI+NTFE+LE  AL 
Sbjct  148   TSVPGMEDILLRRDLPGFCRTSNVAADKTLQFVIRQSQGNVRADSLIVNTFEELEAPALY  207

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              IR HIPN Y IG LH HL +R++S +G  P  +S+SLWEEDRSCMAWLD QP KSV++V
Sbjct  208   HIRDHIPNTYAIGSLHTHLSSRLASIKGTAP-IASNSLWEEDRSCMAWLDAQPPKSVLHV  266

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD---DNIPAELIEGTRKKGYMV  1147
             SFGS+TV+TR++ +E W+G+V     FLW +RP+SV+GD      P EL+ GTR++GYMV
Sbjct  267   SFGSITVMTRDELMEIWYGLV----WFLWVMRPDSVVGDGGEGQAPEELLAGTRERGYMV  322

Query  1148  GWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGV  1327
             GWAP EEVL H A+GGF T                              RLV  VWK G 
Sbjct  323   GWAPPEEVLKHQAIGGFWT----------------------------ECRLVSEVWKLGF  354

Query  1328  DMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMA  1429
             DMKD CDR+ +EKM+++LM  R+ EF K +  MA
Sbjct  355   DMKDRCDRVILEKMIRDLMGERKVEFMKSATEMA  388



>ref|XP_003563101.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=495

 Score =   385 bits (988),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 207/498 (42%), Positives = 294/498 (59%), Gaps = 41/498 (8%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRL-----LRYTDLHLR  259
             +++HVL+FP P QGH+NCML+    L   + +HVTFL+S+   +RL         +    
Sbjct  2     AAAHVLVFPCPAQGHINCMLQFTAGLL-AAGLHVTFLHSDHNLRRLRHANNNNNNESTAA  60

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRP---  430
              +S P   F ++ DGLP DHPR+   +V+   S+ A T   +R +LSS  L++   P   
Sbjct  61    ANSSPRLRFMSVPDGLPDDHPRSAGNLVEFMESMFAKTSVAYRALLSS--LRAPAPPLDA  118

Query  431   --------PVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLP  586
                     PVTC++ADG++ FAI V  EL +P + FRT SA  F A+  VP L+  G++P
Sbjct  119   NDDGLLFPPVTCVVADGMLPFAITVSEELGVPALAFRTASACSFLAYLSVPDLVALGEVP  178

Query  587   LNGESDMDKLLENVEGMENVLRLRDLPSFCR-------TTDLSDRGFLSVILATLRTTRA  745
             +   +D+D  +  V GME  LRLRDLPSFCR       T D  D     ++ +  ++  A
Sbjct  179   VPESADLDAPVRGVPGMEAFLRLRDLPSFCRGRSDPAGTADGLDPMLRILVDSVPQSRNA  238

Query  746   NGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDR  925
                ILNT   LE  AL+ I  H+ +L+ +GPLHA  +A            +  +LW ED 
Sbjct  239   RAFILNTSASLERDALSHIAPHMRDLFAVGPLHAMFQAP----------GAGGALWREDD  288

Query  926   SCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIP  1105
             +CM WLD Q   +VVYVS GS+ V++  QF EF  G+VN+G  FLW +RP+ V    N  
Sbjct  289   ACMRWLDAQADGTVVYVSLGSLAVISLEQFTEFLSGLVNAGHPFLWVLRPDMVDASQN--  346

Query  1106  AELIEGTRK-KGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQ  1282
             A L +  ++ KG +V WAPQ +VL H AVG FLTH+GWNSTLE + EG+P +CWPF+ADQ
Sbjct  347   AVLQDAVKQSKGCVVEWAPQRDVLRHRAVGCFLTHAGWNSTLECVVEGVPTVCWPFFADQ  406

Query  1283  QVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHG  1462
             Q NSR +GAVW  G+DMKD C+R  VE+MV+E +E    E  + +  +A+  R+ + + G
Sbjct  407   QTNSRFMGAVWGTGLDMKDVCERAVVERMVREAVE--SGELRRSAQELAREVRRDIAEGG  464

Query  1463  SSYSNLDRLVEDLKKMKL  1516
             SS +   RLVE + ++ +
Sbjct  465   SSATEFRRLVEFIIELSV  482



>ref|XP_008450117.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Cucumis melo]
Length=472

 Score =   382 bits (982),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 213/493 (43%), Positives = 304/493 (62%), Gaps = 37/493 (8%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M    S HVL+FPFP +GH+   L LA LLC+ + + VTFL+++  HQ+L   T  HL  
Sbjct  1     MGLSPSDHVLLFPFPAKGHIKPFLCLAHLLCN-AGLRVTFLSTDHHHQKLHNLT--HLAT  57

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVD--LFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
             +   + +F++ISDGLP DHPR    V+D  L  S+  VTKP FRE+L S     +G  P+
Sbjct  58    AQISSLHFQSISDGLPPDHPRN---VLDGQLSKSMPLVTKPLFRELLLS---YKNGTSPI  111

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TC+I D I  F +DV  EL IP   F TFSA   + +F +PKL+E G +P   E + ++ 
Sbjct  112   TCVITDLIFRFPMDVAQELGIPVFCFSTFSARFLFLYFSIPKLLEDGQIPYP-EGNSNQA  170

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             L  + G E + R +DLP +     +++   ++ +  TL TT+++GLILNTF++LE   + 
Sbjct  171   LHGIPGGEGLFRCKDLPGYWSVEAVANYNPMNFVNQTLATTKSHGLILNTFDELEAPFIT  230

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              + K    +YTIGP+H+ L+  V         ++    W+ED SC+AWLD QP +SV++V
Sbjct  231   NLSKIYKKVYTIGPIHSLLKKSV---------QTQYEFWKEDHSCLAWLDSQPPRSVMFV  281

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD----DNIPAEL----IEGTRK  1132
             SFGS+  L  +Q  EFW+G+VNSGKAFL  +R +++  +    D    EL    I  T+ 
Sbjct  282   SFGSIVKLKSSQLKEFWNGLVNSGKAFLLVLRSDALTEETGEEDEKQKELVIKEIMETKD  341

Query  1133  KG--YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVG  1306
             +G   +V WAPQE+VL H A+GGFLTHSGWNSTLES+  G+PM+CWP   DQ  N+  + 
Sbjct  342   EGRWVIVNWAPQEKVLRHEAIGGFLTHSGWNSTLESVAVGVPMVCWPQIGDQPSNATWLS  401

Query  1307  AVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKA---VTQHGSSYSN  1477
              VWK GV+M+D+ DR TVE  V+ +ME    E  K  N + +LA++A   V++ G+S  N
Sbjct  402   KVWKIGVEMEDSHDRCTVESRVRSIME---HEDKKMENAIVELAKRADDRVSKEGTSCRN  458

Query  1478  LDRLVEDLKKMKL  1516
             L RL+ED+K  KL
Sbjct  459   LQRLIEDIKGFKL  471



>ref|XP_007026851.1| UDP-Glycosyltransferase superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY07353.1| UDP-Glycosyltransferase superfamily protein isoform 2 [Theobroma 
cacao]
Length=489

 Score =   381 bits (978),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 213/484 (44%), Positives = 293/484 (61%), Gaps = 22/484 (5%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+ FPFP  GH+  M RLAELL H ++  VTFLN++  H  LL  +D+    S YPNF 
Sbjct  10    HVVFFPFPAHGHIKPMFRLAELLSH-ANFQVTFLNTQRNHDLLLLSSDIPAFRSRYPNFQ  68

Query  284   FRTISDGLPAD---HPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIAD  454
               +  D +P     H R+    VDL  S  A  KP   E+L     + +GR P TCIIAD
Sbjct  69    LLSYPDKVPLGLDPHRRSEQGFVDLLLSTKAAAKPALSELLE----KKTGRRPPTCIIAD  124

Query  455   -GIMCF-AIDVGNEL-RIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
               IMC  A+DV  E   IP   F+T  A   W  F + KLIE G++PL  + DMDK + +
Sbjct  125   WAIMCSSAMDVAKEFGNIPVFAFQTACAHYMWMDFHLLKLIEEGEVPLR-DKDMDKPVTS  183

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGF-LSVILATLRTTRANGLILNTFEDLEESALAQI  802
             + G+   +R RDL  F R   +  +   +S    +   ++A G+I NTF+ LE   ++++
Sbjct  184   ISGLGMSVRRRDLSGFARFDTVCKQVIEISTNYGSSAVSQAYGVIHNTFDKLEAPVISKL  243

Query  803   RKHIP-NLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
                +P  +YTIGPLH  L          L    + ++ +ED +C+ WLD QP  SV++VS
Sbjct  244   SSFLPFKIYTIGPLHCLLNNYCIKDSNPL-HSINVTICKEDTNCITWLDSQPSGSVIFVS  302

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG---DDNIPA----ELIEGTRKKG  1138
             FGS+  L+R+Q LE   G++NS + FLW I PN ++G   DD+ P     EL   +++KG
Sbjct  303   FGSLVSLSRSQILEIGQGLLNSCRPFLWVILPNPIVGQQEDDSTPGQILMELENMSKEKG  362

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              +V WAPQE+VL HPA+GGFLTHSGWNST+ESI   +PMICWP  ADQ VNSR V  +W+
Sbjct  363   LIVSWAPQEKVLAHPAIGGFLTHSGWNSTMESIYARVPMICWPTEADQLVNSRCVSELWR  422

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G DMKDTCDR TVEK+V +LME +RDE  K  +++ + A ++V + GSSY NL RL+ D
Sbjct  423   IGFDMKDTCDRSTVEKLVNDLMEDKRDEIMKSMDKITRQAEESVQEGGSSYCNLQRLITD  482

Query  1499  LKKM  1510
             ++ +
Sbjct  483   IRSL  486



>gb|KGN54319.1| hypothetical protein Csa_4G303180 [Cucumis sativus]
Length=471

 Score =   380 bits (975),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 206/493 (42%), Positives = 306/493 (62%), Gaps = 38/493 (8%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M    + HVL+FPFP +GH+     LA LLC+ + + VTFL++E  HQ+L   T L    
Sbjct  1     MGLSPTDHVLLFPFPAKGHIKPFFCLAHLLCN-AGLRVTFLSTEHHHQKLHNLTHLA---  56

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVD--LFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
             +  P+ +F++ISDGL  DHPR    ++D  LF S+  VTKP FR++L S      G  P+
Sbjct  57    AQIPSLHFQSISDGLSLDHPRN---LLDGQLFKSMPQVTKPLFRQLLLS---YKDGTSPI  110

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKL  616
             TC+I D I+ F +DV  EL IP   F TFSA   + +F +PKL+E G +P   E + +++
Sbjct  111   TCVITDLILRFPMDVAQELDIPVFCFSTFSARFLFLYFSIPKLLEDGQIPY-PEGNSNQV  169

Query  617   LENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
             L  + G E +LR +DLP +     +++   ++ +  T+ T++++GLILNTF++LE   + 
Sbjct  170   LHGIPGAEGLLRCKDLPGYWSVEAVANYNPMNFVNQTIATSKSHGLILNTFDELEVPFIT  229

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              + K    +YTIGP+H+ L+  V         ++    W+ED SC+AWLD QP +SV++V
Sbjct  230   NLSKIYKKVYTIGPIHSLLKKSV---------QTQYEFWKEDHSCLAWLDSQPPRSVMFV  280

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD----DNIPAEL----IEGTRK  1132
             SFGS+  L  +Q  EFW+G+V+SGKAFL  +R ++++ +    D    EL    I  T++
Sbjct  281   SFGSIVKLKSSQLKEFWNGLVDSGKAFLLVLRSDALVEETGEEDEKQKELVIKEIMETKE  340

Query  1133  KG--YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVG  1306
             +G   +V WAPQE+VL H A+GGFLTHSGWNSTLES+  G+PM+ WP   DQ  N+  + 
Sbjct  341   EGRWVIVNWAPQEKVLEHKAIGGFLTHSGWNSTLESVAVGVPMVSWPQIGDQPSNATWLS  400

Query  1307  AVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKA---VTQHGSSYSN  1477
              VWK GV+M+D+ DR TVE  V+ +ME    E  K  N + +LA++    V++ G+SY N
Sbjct  401   KVWKIGVEMEDSYDRSTVESKVRSIME---HEDKKMENAIVELAKRVDDRVSKEGTSYQN  457

Query  1478  LDRLVEDLKKMKL  1516
             L RL+ED++  KL
Sbjct  458   LQRLIEDIEGFKL  470



>ref|XP_008372493.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=473

 Score =   379 bits (973),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 211/476 (44%), Positives = 285/476 (60%), Gaps = 17/476 (4%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             +  H +  PFP QGH+N M +LA+LL H    H+TF+N+E  H+RL+     +      P
Sbjct  4     TKPHAVFIPFPAQGHINPMQQLAKLL-HYKGFHITFVNTEVTHKRLINSLGAN-SLDGLP  61

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIAD  454
              F F TI DGLPA HPR    V  L  S N      FRE+L   +  S   PPVTCIIAD
Sbjct  62    TFRFETIPDGLPATHPR---DVPSLCVSTNKTGLGPFRELLKKLN-SSPNSPPVTCIIAD  117

Query  455   GIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD-----MDKLL  619
             G+M F +D  +EL IP +LF T SA  F A+    +LIE G  PL  ES      +D ++
Sbjct  118   GVMTFTLDAAHELGIPEVLFWTTSACGFLAYAQYHRLIEEGLTPLKDESHFXNGYLDTVV  177

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
             + + GM+++ RL+D+PSF RTTD +D     ++  T RT +A+ ++LNTFE  E+ AL  
Sbjct  178   DWLPGMKDI-RLKDIPSFIRTTDPNDVMLEFMVGETERTKKASAVVLNTFESFEKEALDA  236

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             I    P  Y++GPL+  L +++ +   EL    +SSLW ED+ C+ WLD +   SVVYV+
Sbjct  237   ISSLFPPTYSVGPLNL-LFSQIPADN-ELK-AIASSLWTEDKECLDWLDTKEPNSVVYVN  293

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWA  1156
             FGS TV+T  Q +EF  G+ NS K FLW IRP  V GD  + P E +E T  +G +  W 
Sbjct  294   FGSTTVMTNEQLVEFSWGLANSNKTFLWIIRPGLVAGDSAVVPPEFLEETXGRGKLASWC  353

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQE+VL HPA+GGFLTHSGWNSTLES+C G+PMICWPF+A+QQ N R     W  G++++
Sbjct  354   PQEQVLTHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRYACKHWGIGIEIE  413

Query  1337  DTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
             D   R  +E +V+ LME     E  K +    K   KA +  GSS  +LD L+  +
Sbjct  414   DEVKRDYIEGLVRRLMEGEEGKEMRKNALGWKKKIEKATSPKGSSVLDLDNLINQV  469



>dbj|BAJ98857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score =   378 bits (971),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 204/479 (43%), Positives = 292/479 (61%), Gaps = 27/479 (6%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             + +HVL+FP+P+QGH+N ML  A  L  ++ +HVTF+++E  H             ++ P
Sbjct  2     APAHVLVFPWPLQGHINSMLHFAAGLL-DAGLHVTFVHTE--HNLRRAQR---AEAAATP  55

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSS--GRPPVTCII  448
                F ++ DGL  DHPR+   + DL  S+       +R +L+S    ++  G P ++C++
Sbjct  56    RLRFVSLPDGLSVDHPRSVGDLKDLAKSLMTTGPAAYRALLASALSPAAIGGFPALSCVV  115

Query  449   ADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENV  628
             ADG++ FAIDV  EL +P + FRT SA  F A+  VPKL+E G++P+   +D+D  + +V
Sbjct  116   ADGLLPFAIDVAEELGVPALAFRTSSACSFLAYLSVPKLVELGEVPIPVGADLDGPVCSV  175

Query  629   EGMENVLRLRDLPSFCR----TTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
              GME+ LR RDLPS CR    T D+ D     ++  T  +  A  LI NT   LE SALA
Sbjct  176   PGMEDFLRRRDLPSSCRRRPETQDV-DPLLQLLVSYTAHSCNARALIFNTAASLERSALA  234

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              I  H+ +++ IGPLHA     +S++        ++SLW ED  CMAWLD Q  +SVVYV
Sbjct  235   HIAPHMRDVFAIGPLHA-----ISAAPAP-----ATSLWREDDGCMAWLDGQADRSVVYV  284

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGY--MVG  1150
             S GS+ V++  QF EF  G+VNSG  FLW +RP+ +    +   +   G   KG   +VG
Sbjct  285   SLGSLAVISLEQFTEFLSGLVNSGYTFLWVLRPDMIGASQSAVLQEAVGAAGKGKARVVG  344

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             WAPQ +VL H AVG FLTH+GWNSTLE I EG+P++CWPF+ DQQ+NSR VGAVW  G+D
Sbjct  345   WAPQRDVLRHRAVGCFLTHAGWNSTLEGIAEGVPLVCWPFFLDQQINSRFVGAVWGAGLD  404

Query  1331  MKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKK  1507
             MKD CDR  VE MV++ ME   ++    +  +++  R+ V + GSS +   RL+  +K+
Sbjct  405   MKDVCDRAVVEGMVRQAME--SEQLRMSAQTLSQEVRRDVAEGGSSATEFQRLLAFIKE  461



>ref|XP_004305165.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Fragaria vesca 
subsp. vesca]
Length=503

 Score =   379 bits (974),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 196/448 (44%), Positives = 270/448 (60%), Gaps = 13/448 (3%)
 Frame = +2

Query  179   ESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNS  358
             +S +HVTF+N+   H RL     L  RF   P   F +ISDGLP +HPRT     +L  +
Sbjct  59    KSGLHVTFVNTRHNHNRLANLPALSARF---PTLNFESISDGLPLEHPRTLGS--ELLMA  113

Query  359   INAVTKPRFREMLSSGSLQSSG--RPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSAS  532
             +    KP F+E+L S  L+++G   P  TCII DG++ FA DV  EL +P + +      
Sbjct  114   LKTSIKPHFKELLQS-PLKANGVALPAPTCIITDGLVTFAFDVAEELGLPILGYNVPCTR  172

Query  533   CFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLS  712
               W   C+P LIE G LP   + DM+  +  V GME +LR  DLP FCR    +  G   
Sbjct  173   YMWTCLCLPNLIEQGQLPFP-DDDMNVEITGVPGMEGLLRRVDLPGFCRVKQSNHPGLQF  231

Query  713   VILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPW  892
              I  T    RA+ LIL+T  +L+   L+ +    P +YT+GPLH+ L +++      L  
Sbjct  232   AIRETQTQKRASALILDTIYELDAPCLSHMANMFPKIYTLGPLHSLLHSQIGDVSRSLA-  290

Query  893   RSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIR  1072
              S   LW++D +CM WLD Q  KSV+YVSFG++  LTR Q +EFW+G++ SG  FLW IR
Sbjct  291   -SYGGLWKDDPNCMTWLDSQATKSVLYVSFGTLVTLTRTQIMEFWYGLIYSGHPFLWVIR  349

Query  1073  PN--SVIGDDNIPAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEG  1246
              +  S +G D IP EL  GT+++GY+V W  QEEVL H +VGGFLTHSGWNSTLESI  G
Sbjct  350   SDITSDLGGDPIPMELEIGTKERGYIVNWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAG  409

Query  1247  LPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRM  1426
             +PMICWP   D  + SR V   WK G+ +K+ CDR  +E M++ LME +R E     + +
Sbjct  410   IPMICWPNLGDHYIISRTVSEKWKIGLQLKENCDRKEIETMIRMLMEFKRGEIQSSMDVI  469

Query  1427  AKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             +K+AR +V + GSS  NL+ L++D++ M
Sbjct  470   SKVARDSVVKGGSSNHNLEMLIQDIRNM  497



>gb|EAZ03912.1| hypothetical protein OsI_26045 [Oryza sativa Indica Group]
Length=490

 Score =   378 bits (971),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/483 (42%), Positives = 284/483 (59%), Gaps = 34/483 (7%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             + +HVL+FP+P+QGH+N ML LA  L   + +HVTFL++++    L R         + P
Sbjct  6     APAHVLVFPWPIQGHLNVMLHLAVALA-GAGVHVTFLHTDY---NLRRLGAAAAAAVASP  61

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGS-------LQSSGRPP  433
                F +++DGLP DHPRT   + ++  S++   +  +R +L+S S             PP
Sbjct  62    WLRFMSVTDGLPDDHPRTVANLGEISRSLHTAGRAAYRALLASSSQLVPADAAGGGAFPP  121

Query  434   VTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDK  613
             VT ++AD ++ FAIDV  EL +P + FRT SA  F A+  VP+L+E G+LP     D+D+
Sbjct  122   VTTVVADALLPFAIDVAEELGVPALAFRTASACSFLAYMSVPRLVELGELPFPPGGDLDE  181

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVIL-----ATLRTTRANGLILNTFEDL  778
              +  V GME  LR RDLPS CR    ++    + +L     A +  ++A  LILNT   L
Sbjct  182   PVRGVPGMEGFLRRRDLPSPCRHHGANNNDDAAALLGRLVDAAVHCSKARALILNTAASL  241

Query  779   EESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPL  958
             E  ALA I   + +++ +GPLHA   A  +++          SLW  D  CMAWLD Q  
Sbjct  242   EAPALAHIAPRMRDVFAVGPLHAMSPAPAAAT----------SLWRADDGCMAWLDCQAD  291

Query  959   KSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTR---  1129
             +SVVYVS GS+TV++  QF EF  G+V +G  FLW +RP+ V       A+L E      
Sbjct  292   RSVVYVSLGSLTVISPEQFTEFLSGLVAAGNPFLWVLRPDMVTARRRH-ADLQESVTAAA  350

Query  1130  --KKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLV  1303
                K  +VGWAPQ +VL H AVG FLTH+GWNSTLE+  EG+P +CWPF+ DQQ+NSRLV
Sbjct  351   GDSKARVVGWAPQRDVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFVDQQINSRLV  410

Query  1304  GAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLD  1483
             GAVW+ G+DMKD CD   V +MV+E ME    E    +  +A+  R+ V + GSS   L 
Sbjct  411   GAVWRTGLDMKDVCDAAVVARMVREAME--SGEIRASAQSVARQLRRDVAEGGSSAMELK  468

Query  1484  RLV  1492
             RLV
Sbjct  469   RLV  471



>ref|XP_007133982.1| hypothetical protein PHAVU_010G009000g [Phaseolus vulgaris]
 gb|ESW05976.1| hypothetical protein PHAVU_010G009000g [Phaseolus vulgaris]
Length=484

 Score =   377 bits (969),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 206/489 (42%), Positives = 300/489 (61%), Gaps = 21/489 (4%)
 Frame = +2

Query  83    MDQRSSS--HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHL  256
             M++RS++  H+L  PFP +GH+  M  L +LLCH+    +TF+N++  H RLL++TDL  
Sbjct  1     MEKRSTAPPHLLALPFPAEGHIKPMFYLTKLLCHKGH-RITFVNTQHIHNRLLQHTDLPS  59

Query  257   RFSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPV  436
               S +P+F F  ++DG+P D     D  V +  +  +     F EML       S   P 
Sbjct  60    FNSDFPDFRFTFVADGVPHDLA-PDDFSVTISPTSRSRVAEEFGEMLRGLVENPSEWGPP  118

Query  437   TCIIADGIM-CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDK  613
             +CIIADGIM   A+D   E+ +P I FRT+SA+  W    V K++  G + +    D+ K
Sbjct  119   SCIIADGIMSTIAMDAAQEVGVPVIAFRTYSATATWVTIHVIKVLHEGLMDMQDPEDVHK  178

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSV--ILATLRT-TRANGLILNTFEDLEE  784
             ++ ++ G+EN+LR  DLPS  +      RG L++   +   +T TRA+GLILNTF++LE 
Sbjct  179   VVSSIPGLENLLRDCDLPSVYKL----KRGSLALEFFMKEYQTMTRASGLILNTFDELEA  234

Query  785   SALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKS  964
               + ++    P +YTIGPLH HL+ +V+ +        S ++  +DRSC+ WLD Q  KS
Sbjct  235   PTITKLTTVFPRVYTIGPLHTHLKNQVTQNPS-----LSLNVRTQDRSCITWLDHQRAKS  289

Query  965   VVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGD----DNIPAELIEGTRK  1132
             V+YVSFG++  L+  Q LEFWHG+VNS K FLW IR   + G     +N+  EL  GT++
Sbjct  290   VLYVSFGTVVKLSEEQLLEFWHGLVNSLKPFLWVIRKELMDGKAGFGNNVAKELELGTKE  349

Query  1133  KGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAV  1312
             +G +V WAPQEEVL  PAVGGFLTH GWNSTLE I EG+PM+C  F  DQ +NSR V   
Sbjct  350   RGLLVEWAPQEEVLAQPAVGGFLTHCGWNSTLECIGEGVPMLCVLFMVDQTINSRCVSEQ  409

Query  1313  WKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLV  1492
             W  GV +    DR+ +EKMVK+++E R +     ++++AK AR ++ Q GSS  N++ ++
Sbjct  410   WGIGVGIDGIFDRLIIEKMVKDVLENRIEGLRNSADQIAKQARDSIKQTGSSSRNIESMI  469

Query  1493  EDLKKMKLQ  1519
             +D+  MK Q
Sbjct  470   KDILSMKEQ  478



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   377 bits (969),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/473 (42%), Positives = 287/473 (61%), Gaps = 14/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  PFP QGH+N ML+LA+LL H    H+TF+N+EF H+RLL+    +      P+F 
Sbjct  11    HAVCIPFPAQGHINPMLKLAKLL-HYKGFHITFVNTEFNHKRLLKSRGPN-SLDGLPSFR  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP         +  L  S    + P FR++LS  +  S+G PPV+CI++DG+M
Sbjct  69    FETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLN-SSTGCPPVSCIVSDGVM  127

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLENV  628
              F +D  +EL IP +LF T SA  F A+    +LIE G  PL   + +     +  ++ +
Sbjct  128   SFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDANYLTNGYLETQIDWI  187

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GM  + RL+D+PSF RTTD  D     ++  T RT +A+ ++LNTF DLE  AL  +  
Sbjct  188   PGMRGI-RLKDIPSFIRTTDPDDLMLDFLVHETERTRKASAVVLNTFHDLEHEALDALST  246

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              +P +Y+IGPLH  +    + S  +      S+LW E+  C+ WLD +   SVVYV+FGS
Sbjct  247   LLPPIYSIGPLHLQINQIPADSELK---EIRSNLWTEEPECLEWLDSKEPNSVVYVNFGS  303

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQE  1165
             +TV+T  Q +EF  G+ NS + F W IRP+ V GD  + P E +E T+++  +  W PQE
Sbjct  304   ITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQE  363

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL HPAVGGFLTHSGWNST+ES+C G+PMICWPF+A+QQ N R     W  G+++K   
Sbjct  364   QVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDV  423

Query  1346  DRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
              R  VE +V++LME     +  K +    KLA++A + +GSS+  LD+++  +
Sbjct  424   KRNYVEGLVRKLMEGEEGKDMRKKALEWKKLAKEATSPNGSSFVPLDKMINQV  476



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   375 bits (964),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 199/473 (42%), Positives = 288/473 (61%), Gaps = 14/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  PFP QGH+N ML+LA+LL H    H+TF+N+EF H+RLL+    +      P+F 
Sbjct  11    HAVCIPFPAQGHINPMLKLAKLL-HYKGFHITFVNTEFNHKRLLKSRGPN-SLDGLPSFR  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP         +  L  S    + P FR++LS  +  S+G PPV+CI++DG+M
Sbjct  69    FETIPDGLPLTDANATQDIPSLCESTRKHSLPYFRDLLSKLN-SSTGCPPVSCIVSDGVM  127

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLENV  628
              F +D  +EL IP +LF T SA  F A+    +LIE+G  PL   S +     +  ++ +
Sbjct  128   SFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIENGLTPLKDASYLTNGYLETQIDWI  187

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GM  + RL+D+PSF RTTD  D     ++  T RT +A+ ++LNTF DLE  AL  +  
Sbjct  188   PGMRGI-RLKDIPSFIRTTDRDDLMLDFLVHETERTRKASAVVLNTFHDLEHEALDALST  246

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              +P +Y+IGPLH  +    + S  +      S+LW E+  C+ WLD +   SVVYV+FGS
Sbjct  247   LLPPIYSIGPLHLQINQIPADSELK---EIRSNLWTEEPECLEWLDSKEPNSVVYVNFGS  303

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQE  1165
             +TV+T  Q +EF  G+ NS + F W IRP+ V GD  + P E +E T+++  +  W PQE
Sbjct  304   ITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQE  363

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL HPAVGGFLTHSGWNST+ES+C G+PMICWPF+A+QQ N R     W  G+++++  
Sbjct  364   QVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIGMEIENDV  423

Query  1346  DRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
              R  VE +V++LME     +  K +    KLA +A + +GSS+  LD+++  +
Sbjct  424   KRNYVEGLVRKLMEGEEGKDMRKKALEWKKLAMEATSPNGSSFVALDKMINQV  476



>gb|ACD03242.1| UDP-glycosyltransferase UGT709A10 [Avena strigosa]
Length=470

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 206/475 (43%), Positives = 277/475 (58%), Gaps = 22/475 (5%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+FP+P+QGH+NCM  LA  L  ++ +HVTFL++   H  L R         S P   
Sbjct  11    HVLVFPWPLQGHINCMHHLATALL-DAGLHVTFLHT---HHNLRRLATKPAPAPSQPRLR  66

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
               +I DGLP DHPR+   + DL +S+       +R +L + S    G PPVTC+IADG+M
Sbjct  67    LLSIPDGLPEDHPRSVAHLNDLMDSMRTTGSAAYRALLLASSSNKDGHPPVTCVIADGVM  126

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMEN  643
              FA+DV  E+ +P I FRT SA  F  +  V +L+E G+ P       D+ +  V GME 
Sbjct  127   AFAVDVAEEVGVPAIAFRTASACSFLTYLSVRRLVELGEFPFPS----DQPVSGVPGMEG  182

Query  644   VLRLRDLPSFCR-----TTDLS-DRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
              LR RDLP   R     T D   D   L++   T+ +  A  LILNT   +E  ALAQI 
Sbjct  183   FLRRRDLPRAPRPAGSATDDCGVDPMLLNMGECTVHSGEARALILNTSASMEGPALAQIA  242

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
              H+ +++++GPLH      V++  G      ++SLW ED  CMAWLD Q  +SVVYVS G
Sbjct  243   PHMRDVFSVGPLH------VAAGTGTKSTAPTASLWREDDGCMAWLDGQQDRSVVYVSLG  296

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQE  1165
             S+TV++  Q  EF  G+  +G AFLW +RP+ V G     A +     +K  +V WAPQ 
Sbjct  297   SLTVISEEQLAEFLSGLAATGYAFLWVLRPDMVAGGTTSLAAVKTLVGEKARVVHWAPQR  356

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL HPAVG FLTH+GWNSTLE+  EG+PM+CW F+ DQ +NSR V  VW+ GVD+KD C
Sbjct  357   DVLRHPAVGCFLTHAGWNSTLEAAYEGVPMVCWTFFGDQLINSRFVDTVWQTGVDIKDVC  416

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKM  1510
             DR  VEK V+E ME    +    +  MA+  R  V   GSS S + RLV  ++ +
Sbjct  417   DRAVVEKAVREAME--SAQIRAAAQAMARQLRLDVADGGSSSSEIKRLVAFIRDL  469



>ref|XP_004299647.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   375 bits (963),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 201/481 (42%), Positives = 294/481 (61%), Gaps = 17/481 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  PFP QGH+N ML+LA+LL H    H+TF+N+E+ H+RLL+    +      P+F 
Sbjct  9     HAVCIPFPAQGHINPMLKLAKLL-HHKGFHITFVNTEYNHKRLLKSRGPN-SLDGLPSFT  66

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP         ++ L  S      P FR++LS  +  SS  PPV+CI++DG+M
Sbjct  67    FETIPDGLPPTDANATQDILSLCVSTRTKCLPHFRDLLSKLN-SSSNIPPVSCIVSDGVM  125

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGES-----DMDKLLENV  628
              F ++   EL IP +LF T SA  F  +     LI+ G +PL   S      ++  ++ +
Sbjct  126   SFTVEAAQELGIPEVLFWTTSACGFMGYMQYQNLIDEGLIPLKDASCLTNGYLETEIDWL  185

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GM  + RLRDLP+F RTTD  D    ++++ T R  RA+ +ILNT +DLE   L  ++ 
Sbjct  186   PGMRGI-RLRDLPAFIRTTDPEDGMMKTMLIETERAKRASAIILNTIDDLEHEVLDALKN  244

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              +P +Y+IGPLH  L  +V S   +L     S+LW+++  C+ WLD +   SVVYV+FGS
Sbjct  245   LLPPIYSIGPLHLQLD-QVQSEGTDLK-SIQSNLWKDEPECLEWLDSRAPNSVVYVNFGS  302

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQE  1165
             +TV+T  Q +EF  G+ NS K FLW IRP+ V G+  + P E +E T+++  +  W PQE
Sbjct  303   ITVMTSEQLIEFAWGLANSSKTFLWVIRPDLVGGESAVVPPEFVEETKERSLLTTWCPQE  362

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL HPA+GGFLTHSGWNSTLES+C G+PM+CWPF+A+QQ N R     W  G++++   
Sbjct  363   QVLNHPAIGGFLTHSGWNSTLESVCAGVPMLCWPFFAEQQTNCRYCCKEWGIGMEIEGDV  422

Query  1346  DRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVT-QHGSSYSNLDRLVEDL---KKM  1510
              R  +E++V +LME     E  K +    KLA++A T  +G S+ +LD++V ++   KK+
Sbjct  423   HRSNIEELVTKLMEGEEGKEMRKKAMEWKKLAKEAATGPNGLSFLDLDKMVNEVLLSKKL  482

Query  1511  K  1513
             K
Sbjct  483   K  483



>gb|EMT06489.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=461

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 206/476 (43%), Positives = 284/476 (60%), Gaps = 32/476 (7%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             + +HVL+FP+P+QGH+NCML L   L  ++   VTFL++E    RL R        +  P
Sbjct  3     APAHVLVFPWPLQGHINCMLHLTAALL-DAGFRVTFLHTEHNLSRLARA-------ALPP  54

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQS-SGRPPVTCIIA  451
                  ++ DGLP DHPR+   + +L  S+       +R +L S  L+S S  PP+TC+IA
Sbjct  55    GLRLLSVPDGLPDDHPRSVRSLKELTESMFTTGSAAYRALLLS--LRSDSDAPPLTCVIA  112

Query  452   DGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVE  631
             DGIM FA+D+  EL +P + FRT SA  + A+  VP L+E G++P       D  +  V 
Sbjct  113   DGIMPFAVDIAEELGVPALAFRTASACSYLAYLSVPTLVELGEVPFPA----DDPVRGVP  168

Query  632   GMENVLRLRDLP-SFCRTTDLS-DRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             GME  LR RDLP    R+ D + D   L++        +A  LILNT   +E  ALA+I 
Sbjct  169   GMEGFLRRRDLPRGVGRSEDGAFDPMLLAIAEGIAHAGKARALILNTAASMEGPALARIA  228

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
              H+ +L+ IGPLHA   A             ++SLW ED SCMAWLD    +SVVYVS G
Sbjct  229   PHMRDLFAIGPLHAEHDA-------------AASLWSEDDSCMAWLDGHGDRSVVYVSLG  275

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTRKKGYMVGWAPQE  1165
             S+ V++  QF EF  G+V +G AFLW +RP+ V    ++  E ++    K  +V WAPQ 
Sbjct  276   SLAVISHEQFTEFLAGLVATGYAFLWVLRPDMVKTTGSVLREAVKEAGSKARVVEWAPQR  335

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
              VL H AVG FLTH GWNSTLE+  EG+PM+CWPF+ADQQ+NSR VGAVW+ G+DMKD C
Sbjct  336   GVLRHRAVGCFLTHGGWNSTLEAAAEGVPMVCWPFFADQQINSRFVGAVWRTGLDMKDLC  395

Query  1346  DRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMK  1513
             +R  V+  V+E ME    E    ++ MA+  +  V   GSS S+L+RLV  +++++
Sbjct  396   NRAIVQGKVREAME--SGELRGRAHAMAQQLKLDVAVGGSSSSDLERLVGFIRELR  449



>gb|EAZ03904.1| hypothetical protein OsI_26038 [Oryza sativa Indica Group]
Length=498

 Score =   375 bits (963),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 206/484 (43%), Positives = 278/484 (57%), Gaps = 29/484 (6%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+FPFP QGH+NCM+  A  L   + +HVTFL+S+ + +RL          S  P   
Sbjct  9     HVLVFPFPAQGHINCMMHFATGLLG-AGLHVTFLHSDRSLRRLGGAAAALAAGS--PRLR  65

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREML-----SSGSLQSSGR--PPVTC  442
             F +I DGLP DH R    +++   SI       +R +L      +G   S+G   PPVTC
Sbjct  66    FLSIPDGLPDDHARAAGDLLEHMESIRTKGSVAYRRVLLASLVRAGDDGSTGVQFPPVTC  125

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             ++ADGIM  AID+  E+ +P + FRT SA  F A+  +P+L E G+LP     D+D+ + 
Sbjct  126   VVADGIMPLAIDIAEEIGVPALGFRTVSACSFLAYLSIPRLFELGELPFPAGGDLDEPVR  185

Query  623   NVEGMENVLRLRDLPSFCRT----TDLSDRGFLSVILATLRTTRANGLILNTFEDLEESA  790
              V GME  LR RDLPSFCR        +D    +V   T  + +A  L+LNT   +E  A
Sbjct  186   GVPGMETFLRRRDLPSFCRGGGGGESQNDPMLQTVNEVTAHSRKARALVLNTSASMEGPA  245

Query  791   LAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVV  970
             LA I  H+ +++ IGPLH    A  ++           SLW  D  CMAWLD QP +SVV
Sbjct  246   LAHIAPHMRDVFAIGPLHTMFPAPAAAG----------SLWRADDGCMAWLDGQPDRSVV  295

Query  971   YVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTR--KKGYM  1144
             YVS GS TV++  QF EF HG+V +G AFLW +RP+ V    +             +  +
Sbjct  296   YVSLGSFTVISLEQFTEFLHGLVAAGHAFLWVLRPDMVGASQSAALREAAAAAGDSRARV  355

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             V WAPQ +VL H AVG FLTH+GWNSTLE+  EG+P +CWPF+ADQQ+NSR VG VW+ G
Sbjct  356   VEWAPQLDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQINSRFVGGVWRTG  415

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQH-GSSYSNLDRLVEDL  1501
             +DMKD CD   VE+MV+E ME    E    +  +A+  R+ +    GSS +   RLV  +
Sbjct  416   LDMKDVCDAAVVERMVREAME--SAEIRASAQALARQLRRDIADDGGSSAAEFQRLVGFI  473

Query  1502  KKMK  1513
             K++ 
Sbjct  474   KELS  477



>ref|NP_001175206.1| Os07g0489950 [Oryza sativa Japonica Group]
 dbj|BAC80059.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
 dbj|BAH93934.1| Os07g0489950 [Oryza sativa Japonica Group]
Length=490

 Score =   375 bits (963),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 203/483 (42%), Positives = 282/483 (58%), Gaps = 34/483 (7%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             + +HVL+FP+P+QGH+N ML LA  L   + +HVTFL++++    L R         + P
Sbjct  6     APAHVLVFPWPIQGHLNVMLHLAVALA-GAGVHVTFLHTDY---NLRRLGAAAAAAVASP  61

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGS-------LQSSGRPP  433
                F +++DGLP DHPRT   + ++  S++   +  +R +L+S S             PP
Sbjct  62    WLRFMSVTDGLPDDHPRTVANLGEISRSLHTAGRAAYRALLASSSQLVPADAAGGGAFPP  121

Query  434   VTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDK  613
             VT ++AD ++ FAIDV  EL +P + FRT SA  F A+  VP+L+E G+LP     D+D+
Sbjct  122   VTTVVADALLPFAIDVAEELGVPALAFRTASACSFLAYMSVPRLVELGELPFPPGGDLDE  181

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVIL-----ATLRTTRANGLILNTFEDL  778
              +  V GME  LR RDLPS CR    ++    + +L     A +  ++A  LILNT   L
Sbjct  182   PVRGVPGMEGFLRRRDLPSPCRHHGANNNDDAAALLGRLADAAVHCSKARALILNTAASL  241

Query  779   EESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPL  958
             E  ALA I   + +++ +GPLHA   A  +++          SLW  D  CMAWLD Q  
Sbjct  242   EAPALAHIAPRMRDVFAVGPLHAMSPAPAAAT----------SLWRADDGCMAWLDCQAD  291

Query  959   KSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGTR---  1129
             +SVVYVS GS+TV++  QF EF  G+V +G  FLW +RP+ V       A+L E      
Sbjct  292   RSVVYVSLGSLTVISPEQFTEFLSGLVAAGNPFLWVLRPDMVTARRRH-ADLQESVTAAA  350

Query  1130  --KKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLV  1303
                K  +VGWAPQ +VL H AVG FLTH+GWNSTLE+  EG+P +CWPF+ DQQ+NSR V
Sbjct  351   GDSKARVVGWAPQRDVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFTDQQINSRFV  410

Query  1304  GAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLD  1483
             G VW+ G+DMKD CD   V +MV+E ME    E    +  +A+  R+ V + GSS   L 
Sbjct  411   GGVWRTGLDMKDVCDAAVVARMVREAME--SGEIRASAQSVARQLRRDVAEGGSSAMELK  468

Query  1484  RLV  1492
             RLV
Sbjct  469   RLV  471



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   374 bits (961),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 201/473 (42%), Positives = 283/473 (60%), Gaps = 14/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  PFP QGH+N ML LA+LL H    H+TF+N+EF H+RLL+    +      P+F 
Sbjct  11    HAVCIPFPAQGHINPMLELAKLL-HYKGFHITFVNTEFNHKRLLKSRGPN-SLDGLPSFR  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP         +  L  S    + P FR++LS  +  S+G PPV+CI++DG+M
Sbjct  69    FETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLN-SSTGCPPVSCIVSDGVM  127

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLENV  628
              F +D  +EL IP +LF T SA  F A+    +LIE G  PL   S +     +  ++ +
Sbjct  128   SFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTNGYLETEIDWI  187

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GM  + RL+D+PSF RTTD  D     V+  T RT +A+ +ILNTF D E   L  +  
Sbjct  188   PGMRGI-RLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVILNTFHDFEHEVLDALST  246

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              +P +Y+IGPLH  +    + S  +      S+LW E+  C+ WLD +   SVVYV+FGS
Sbjct  247   LLPPIYSIGPLHVQINQIPADSELK---EIRSNLWTEEPECLEWLDSKEPNSVVYVNFGS  303

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQE  1165
             +TV+T  Q +EF  G+ NS + F W IRP+ V GD  + P E +E T+++  +  W PQE
Sbjct  304   ITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEDTKERSLLANWCPQE  363

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL HPAVGGFLTHSGWNST+ES+C G+PMICWPF+A+QQ N R     W  G++++   
Sbjct  364   QVLKHPAVGGFLTHSGWNSTIESVCSGVPMICWPFFAEQQTNCRYSEKEWGIGMEIESDV  423

Query  1346  DRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
              R  VE +V++LME     E  K +    KLA +A + +GSS+  LD++V  +
Sbjct  424   KRNYVEGLVRKLMEGDEGKEMRKKALEWKKLATEATSPNGSSFLCLDKMVNQV  476



>ref|XP_008386104.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=473

 Score =   374 bits (959),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 207/476 (43%), Positives = 285/476 (60%), Gaps = 17/476 (4%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             +  H +  PFP QGH+N M +LA+LL H    H+TF+N+E  H+RL+     +      P
Sbjct  4     TKPHAVFIPFPAQGHINPMQQLAKLL-HYKGFHITFVNTEVTHKRLINSLGAN-SLDGLP  61

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIAD  454
              F F TI DGLPA HPR    V  L  S N      FRE++   +  S   PPVTCIIAD
Sbjct  62    TFRFETIPDGLPASHPR---DVPSLCVSTNKTGLAPFRELVKKLN-SSPNSPPVTCIIAD  117

Query  455   GIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD-----MDKLL  619
             G+M F +D  +EL IP +LF T SA  F A+    +LIE G  PL  ES      +D ++
Sbjct  118   GVMTFTLDAAHELGIPEVLFWTTSACGFLAYAQYHRLIEEGLTPLKDESHFTNGYLDTMV  177

Query  620   ENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQ  799
             + + GM+++ RL+D+PSF RTTD +D     ++  T RT +A+ ++LNTF+ LE+ AL  
Sbjct  178   DWLPGMKDI-RLKDMPSFIRTTDPNDVMLEFMVGETERTKKASAVVLNTFKSLEQEALDA  236

Query  800   IRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVS  979
             I    P  Y++GPL+  L +++     EL    +SSLW ED +C+ WLD +   SVVYV+
Sbjct  237   ISSLFPPTYSVGPLNL-LFSQIPEDN-ELK-AIASSLWTEDTACLDWLDTKEPNSVVYVN  293

Query  980   FGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWA  1156
             FGS TV+T  Q +EF  G+ NS K FLW IRP  V GD  + P   +E T  +G +  W 
Sbjct  294   FGSTTVMTNEQLVEFSWGLANSNKTFLWIIRPGLVAGDTAVVPPLFLEETEGRGKLASWC  353

Query  1157  PQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMK  1336
             PQE+VL HPA+GGFLTHSGWNSTLES+C G+PMICWPF+A+QQ N R     W  G++++
Sbjct  354   PQEQVLTHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRYACEHWGIGIEIE  413

Query  1337  DTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
             D   R  +E +V+ LME +   E  K +    K   +  ++ GSS  +LD L+  +
Sbjct  414   DEVKRDYIEGLVRRLMEGKEGKEMRKNALGWKKKIEEVTSRKGSSVLDLDNLINQV  469



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   375 bits (962),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 199/482 (41%), Positives = 295/482 (61%), Gaps = 18/482 (4%)
 Frame = +2

Query  80    TMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             ++  R+  H +  P+P QGHVN ML++A+LL H    H+TF+N+E+ H+RLL+    +  
Sbjct  3     SLTARNKPHAVCLPYPAQGHVNPMLKVAKLL-HFKGFHITFVNTEYNHKRLLKSRGPN-A  60

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVT  439
                 P+F F TI DGLP         +  L +S +      FR++L+   L SSG PPVT
Sbjct  61    LDGVPDFRFETIPDGLPPPDIDATQDIPALCDSTSKNCLAPFRQLLAK--LNSSGVPPVT  118

Query  440   CIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM----  607
             CI++DG+M F +    EL IP +LF T SA  F  +   P+LIE G  PL  E+ +    
Sbjct  119   CIVSDGVMSFTLKAAEELGIPEVLFWTTSACGFLGYMHYPRLIERGFTPLKDETYLTNGY  178

Query  608   -DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEE  784
              D +++ + GM+N+ R+RDLPSF RTTD +D     + + + R  +A+ +I+NTF++ E 
Sbjct  179   LDTVIDWIPGMKNI-RIRDLPSFVRTTDRNDIMLNFLAVESERAAKASAVIVNTFDEFEH  237

Query  785   SALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRS-SSSLWEEDRSCMAWLDEQPLK  961
               +  +   +P +YTIGPL   L     +   + P  S  S+LW+E+  C+ WL+ +  K
Sbjct  238   DVVKALSSMLPRIYTIGPLQLLL-----NQIPQTPLESIGSNLWKEEPECLQWLNSKEPK  292

Query  962   SVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKG  1138
             SVVYV+FGS+TV+T  Q +EF  G+ NS   FLW IRP+ V GD +I P E +E T ++G
Sbjct  293   SVVYVNFGSITVMTAQQLVEFAWGLANSKHTFLWIIRPDLVRGDSSILPPEFLEETEERG  352

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              M  W PQE+VL HPA+ GFLTHSGWNST+ESI  G+PMI WPF+A+QQ N R     W 
Sbjct  353   LMASWCPQEQVLNHPAIAGFLTHSGWNSTVESIGYGVPMISWPFFAEQQTNCRFACTEWG  412

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKC-SNRMAKLARKAVTQHGSSYSNLDRLVE  1495
              G+++ +   R  VE++V+ELME  + +  +  +    K A +A + +GSS+ NL++L++
Sbjct  413   VGMEIDNNVKREEVERLVRELMEGEKGKGMRNKAMEWKKKAEQAASPNGSSFLNLEKLIK  472

Query  1496  DL  1501
             D+
Sbjct  473   DV  474



>ref|NP_001059665.1| Os07g0487100 [Oryza sativa Japonica Group]
 dbj|BAC57710.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
 dbj|BAC84366.1| putative UDP-glucose glucosyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF21579.1| Os07g0487100 [Oryza sativa Japonica Group]
Length=486

 Score =   373 bits (957),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 206/485 (42%), Positives = 283/485 (58%), Gaps = 28/485 (6%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+FP P QGH+NCM+  A  L   + +HVTFL+++ + +RL          S  P   
Sbjct  9     HVLVFPAPGQGHINCMMHFATGLVG-AGLHVTFLHTDHSLRRLGGAAAAGGADS--PRLR  65

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS------GSLQSSGRPPVTCI  445
             F +I DGLP DHPR    +V+L  S+       +R +L+S          S G PPVTC+
Sbjct  66    FMSIPDGLPDDHPRAVGDIVELLESLRTNGSVPYRSLLASLVRAGDDGASSGGFPPVTCV  125

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPL-NGESDMDKLLE  622
             +ADG M FA DV  E+ +P+++FRT SA    A+  V +L E G++ L   + D+D+ + 
Sbjct  126   VADGSMPFAADVAEEIGVPSLVFRTASACSVLAYLSVDRLFELGEVVLFPADGDLDEPVR  185

Query  623   NVEGMENVLRLRDLPSFCR--TTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
              V GME+ LR RDLP   R  T D +D     +I  T  +  A  ++LNT   +E  ALA
Sbjct  186   GVPGMESFLRRRDLPGNFRNCTEDQNDPIVQMLIEVTAHSRGARAVVLNTAASMEGPALA  245

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              +   + +++ IGPLHA            +P  ++ SLW  D  C+AWLD QP +SVVYV
Sbjct  246   HVAPRMRDVFAIGPLHAMF---------PVP-AAAGSLWRADDGCVAWLDGQPDRSVVYV  295

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPA--ELIEGTRK--KGYM  1144
             S GS  V++  QF EF HG+V +G  FLW +RP+ V    +  A  E +    K  K  +
Sbjct  296   SLGSFAVISLEQFTEFLHGLVAAGYPFLWVLRPDMVGASQSAGALREAVAAAEKNNKARV  355

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             VGWAPQ +VL H AVG FLTH+GWNSTLE+  EG+P +CWPF+ADQQ+NSR VGAVW  G
Sbjct  356   VGWAPQRDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQINSRFVGAVWGTG  415

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +DMKD CD   VE+MV+E ME    E    +  +A+  R+ V   GSS +  +RLV  +K
Sbjct  416   LDMKDVCDAAVVERMVREAME--SGEIRASAQALAREVRQDVADGGSSAAEFERLVGFIK  473

Query  1505  KMKLQ  1519
             ++  Q
Sbjct  474   ELSNQ  478



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score =   372 bits (956),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/470 (43%), Positives = 280/470 (60%), Gaps = 15/470 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+  P+P QGH+N ML+LA+LL  +   HVTF+N+E+ H+RLL+        +  P+F 
Sbjct  12    HVVCIPYPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKSRGPD-SLNGLPSFR  70

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP         +  L  S      P F+++LS  +  SS  PPVTCI++DG M
Sbjct  71    FETIPDGLPETDVDVTQDIPSLCISTRKTCLPHFKKLLSKLNDVSSDVPPVTCIVSDGCM  130

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD-----MDKLLENV  628
              F +D   EL IP +LF T SA  F  +    +LIE G +PL   SD     ++  +E +
Sbjct  131   SFTLDAAIELNIPEVLFWTTSACGFMGYVQYRELIEKGIIPLKDSSDITNGYLETTIEWL  190

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GM+N+ RL+DLPSF RTTD +D+    +     R  +A+ +ILNTF+ LE   L     
Sbjct  191   PGMKNI-RLKDLPSFLRTTDPNDKMLDFLTGECQRALKASAIILNTFDALEHDVLEAFSS  249

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              +P +Y+IGPLH  ++     +   L     S+LW+ED  C+ WLD +   SVVYV+FGS
Sbjct  250   ILPPVYSIGPLHLLIKDVTDKNLNSL----GSNLWKEDSECLKWLDTKEPNSVVYVNFGS  305

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQE  1165
             + V+T  Q +EF  G+ NS K FLW IRP+ V G   + P E +  T  +G +  W PQE
Sbjct  306   IAVMTSEQMVEFAWGLANSNKTFLWVIRPDLVAGKHAVLPEEFVAATNDRGRLSSWTPQE  365

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL HPA+GGFLTHSGWNSTLESIC G+PMICWPF+A+QQ N R     W  G++++D  
Sbjct  366   DVLTHPAIGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRYCCEEWGIGLEIEDA-  424

Query  1346  DRITVEKMVKELMEVRRDEFTKCSN-RMAKLAR-KAVTQHGSSYSNLDRL  1489
              R  VE +V+ELM+  + +  K +  +  KLA   AV   GSS+ NL+ +
Sbjct  425   KRDRVESLVRELMDGEKGKLMKENALKWKKLAHDSAVGPKGSSFVNLENM  474



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   372 bits (956),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 197/473 (42%), Positives = 286/473 (60%), Gaps = 14/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  PFP QGH+N ML+LA+LL H    ++TF+N+EF H+RLL+    +      P+F 
Sbjct  11    HAVCIPFPAQGHINPMLKLAKLL-HYKGFYITFVNTEFNHKRLLKSRGPN-SLDGLPSFR  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP         +  L  S    + P FR++LS  +  S+G PPV+CI++DG+M
Sbjct  69    FETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLN-SSTGCPPVSCIVSDGVM  127

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLENV  628
              F +D  +EL IP +LF T SA    A+    +LIE G  PL   S +     +  ++ +
Sbjct  128   SFTLDAAHELGIPEVLFWTTSACGLLAYVHYHRLIEKGLTPLKDASYLTNGYLETEIDWI  187

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GM  + RL+D+PSF RTTD  D     V+  T RT +A+ ++LNTF DLE  AL  +  
Sbjct  188   PGMRGI-RLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVLLNTFHDLEHEALDALST  246

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              +P +Y+IGPLH  +    + S  +      S+LW E+  C+ WLD +   SVVYV+FGS
Sbjct  247   LLPPIYSIGPLHLQINQIPADSELK---EIRSNLWTEEPECLEWLDSKEPNSVVYVNFGS  303

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQE  1165
             +TV+T  Q +EF  G+ +S + F W IRP+ V GD  + P E +E T+++  +  W PQE
Sbjct  304   ITVMTAEQLIEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQE  363

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL HPAVGGFLTHSGWNST+ES+C G+PMICWPF+A+QQ N R     W  G+++K   
Sbjct  364   QVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDV  423

Query  1346  DRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
              R  +E +V++LME     +  K +    KLA++A + +GSS+  LD+++  +
Sbjct  424   KRNYIEGLVRKLMEGEEGKDMRKKALEWKKLAKEATSPNGSSFVPLDKMINQV  476



>sp|F8WKW1.1|UGT2_GARJA RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Genipin glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 2; Short=GjUGT2; AltName: Full=UDP-glycosyltransferase 
85A24 [Gardenia jasminoides]
 dbj|BAK55737.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=481

 Score =   372 bits (954),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 203/475 (43%), Positives = 284/475 (60%), Gaps = 16/475 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  P+P QGH+N ML+LA++L H    H+TF+N+EF H+RLL+        +  P+F 
Sbjct  11    HAVCIPYPAQGHINPMLKLAKIL-HHKGFHITFVNTEFNHKRLLKSRGPD-ALNGLPDFQ  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR-PPVTCIIADGI  460
             F+TI DGLP         +  L  S        FR +L+  +  SS + PPV+CI++DG+
Sbjct  69    FKTIPDGLPPSDVDATQDIPSLCESTTTRCLDPFRNLLAELNGPSSSQVPPVSCIVSDGV  128

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLEN  625
             M F ++   EL +P ILF T SA  F  +    KLIE G  PL   S +     ++ L+ 
Sbjct  129   MSFTLEAAAELGVPEILFWTTSACGFLGYMHYAKLIEKGLTPLKDASYLSNGYLEQSLDW  188

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             + GM+++ RL+DLPSF RTT+  D     V+  T R  +A+ +ILNTF++LE+  +  + 
Sbjct  189   IPGMKDI-RLKDLPSFLRTTNPDDYMVKFVLQETERAKKASAIILNTFQELEDDVINALS  247

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
               +P +YTIGPL   L+  V   R  +     S+LW+E+  C+ WLD +   SVVYV+FG
Sbjct  248   AILPPIYTIGPLQ-FLQKEVKDERLSV---LGSNLWKEEPECLDWLDSKDPNSVVYVNFG  303

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQ  1162
             S+TV+T  Q +EF  G+ NS + FLW IRP+ V GD  I P E +E T+ +G +  W PQ
Sbjct  304   SITVMTPGQLVEFAWGLANSKQTFLWIIRPDLVSGDSAILPPEFLEETKDRGLLASWCPQ  363

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             E+VL HPA+GGFLTHSGWNSTLESIC G+PMICWPF+A+QQ N       W NG+++ + 
Sbjct  364   EQVLSHPAIGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWYNGLEIDNN  423

Query  1343  CDRITVEKMVKELM--EVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
               R  VE +V ELM  E   D   K      K    A +  GSSYSNL+++V+ L
Sbjct  424   VKRDEVESLVTELMVGEKGMDMKKKALEWKNKAEEAAKSSGGSSYSNLEKVVQVL  478



>gb|EAZ39840.1| hypothetical protein OsJ_24281 [Oryza sativa Japonica Group]
Length=486

 Score =   371 bits (953),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 205/485 (42%), Positives = 283/485 (58%), Gaps = 28/485 (6%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HVL+FP P QGH+NCM+  A  L   + +HVTFL+++ + +RL          +  P   
Sbjct  9     HVLVFPAPGQGHINCMMHFATGLVG-AGLHVTFLHTDHSLRRL--GCAAAAGGADSPRLR  65

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS------GSLQSSGRPPVTCI  445
             F +I DGLP DHPR    +V+L  S+       +R +L+S          S G PPVTC+
Sbjct  66    FMSIPDGLPDDHPRAVGDIVELLESLRTNGSVPYRSLLASLVRAGDDGASSGGFPPVTCV  125

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPL-NGESDMDKLLE  622
             +ADG M FA DV  E+ +P+++FRT SA    A+  V +L E G++ L   + D+D+ + 
Sbjct  126   VADGSMPFAADVAEEIGVPSLVFRTASACSVLAYLSVDRLFELGEVVLFPADGDLDEPVR  185

Query  623   NVEGMENVLRLRDLPSFCR--TTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALA  796
              V GME+ LR RDLP   R  T D +D     +I  T  +  A  ++LNT   +E  ALA
Sbjct  186   GVPGMESFLRRRDLPGNFRNCTEDQNDPIVQMLIEVTAHSRGARAVVLNTAASMEGPALA  245

Query  797   QIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYV  976
              +   + +++ IGPLHA            +P  ++ SLW  D  C+AWLD QP +SVVYV
Sbjct  246   HVAPRMRDVFAIGPLHAMF---------PVP-AAAGSLWRADDGCVAWLDGQPDRSVVYV  295

Query  977   SFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPA--ELIEGTRK--KGYM  1144
             S GS  V++  QF EF HG+V +G  FLW +RP+ V    +  A  E +    K  K  +
Sbjct  296   SLGSFAVISLEQFTEFLHGLVAAGYPFLWVLRPDMVGASQSAGALREAVAAAEKNNKARV  355

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             VGWAPQ +VL H AVG FLTH+GWNSTLE+  EG+P +CWPF+ADQQ+NSR VGAVW  G
Sbjct  356   VGWAPQRDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQINSRFVGAVWGTG  415

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +DMKD CD   VE+MV+E ME    E    +  +A+  R+ V   GSS +  +RLV  +K
Sbjct  416   LDMKDVCDAAVVERMVREAME--SGEIRASAQALAREVRQDVADGGSSAAEFERLVGFIK  473

Query  1505  KMKLQ  1519
             ++  Q
Sbjct  474   ELSNQ  478



>ref|XP_008467017.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
Length=304

 Score =   364 bits (935),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 225/307 (73%), Gaps = 8/307 (3%)
 Frame = +2

Query  605   MDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEE  784
             MD+++ N+ GMEN+LR RDLP FCR TD +D      I  T R+ + + LILN+FEDLEE
Sbjct  1     MDRMITNLPGMENLLRCRDLPGFCRVTDTNDSVLQFNIKQTQRSNQFHALILNSFEDLEE  60

Query  785   SALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKS  964
               L++IR   PNLY IGPLH+ LR ++S     L     ++LWE DR+C+AWLD QP  S
Sbjct  61    PILSKIRTLWPNLYAIGPLHSLLRTKLSRETEAL-----NNLWEVDRTCLAWLDNQPPGS  115

Query  965   VVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN---IPAELIEGTRKK  1135
             V+YVSFGS+TV+     +EFWHG+VNSG+ FLW IRP+ V G +    IPAEL EGT+++
Sbjct  116   VIYVSFGSITVMGNEGLMEFWHGLVNSGRNFLWVIRPDLVSGKNGEIEIPAELEEGTKQR  175

Query  1136  GYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVW  1315
             GY+VGWAPQE+VL H AVGGFLTHSGWNSTLESI  G PM+CWP+ ADQQVNSR V  VW
Sbjct  176   GYVVGWAPQEKVLSHEAVGGFLTHSGWNSTLESIVAGKPMVCWPYTADQQVNSRFVSNVW  235

Query  1316  KNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVE  1495
             K GVDMKD CDR  V KMV E+M  R++EF + ++ MA LAR++V+  GSSY++ DRLV 
Sbjct  236   KLGVDMKDLCDRDIVAKMVNEIMVNRKEEFMRTASEMANLARRSVSPGGSSYADFDRLVN  295

Query  1496  DLKKMKL  1516
             +++ + L
Sbjct  296   EIRLLSL  302



>emb|CBI31568.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   365 bits (937),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 190/356 (53%), Positives = 235/356 (66%), Gaps = 38/356 (11%)
 Frame = +2

Query  392   MLSSGSLQSSGRPPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIE  571
             M+S G   S  RPPV+CIIADG+M F ID+ NE+ IP I FRT SA  FWA+F   KLIE
Sbjct  1     MISRGQ-GSDTRPPVSCIIADGMMSFTIDIANEVGIPIISFRTVSACSFWAYFSALKLIE  59

Query  572   SGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANG  751
             SG+LPL G +DMD+L+ ++ GME  LR RDLPS  R ++L D G L V   T +T RA+ 
Sbjct  60    SGELPLKG-NDMDQLVTSIPGMEGFLRKRDLPSLLRVSNLDDEGLLLVTKETQQTPRAHA  118

Query  752   LILNTFEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSC  931
             LILNTFEDLE   L QIR H P  YTIGPLHAHL+ R++S       +SS+S  +EDRSC
Sbjct  119   LILNTFEDLEGPILGQIRNHCPKTYTIGPLHAHLKTRLASE--STTSQSSNSFRQEDRSC  176

Query  932   MAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVI---GDDNI  1102
             +AWLD QP KSV+YVSFGSM V++R Q +EF +G+VNS   FLW IR +S+    G+   
Sbjct  177   IAWLDHQPSKSVIYVSFGSMVVISRKQLIEFCYGLVNSSSRFLWVIRTDSLAEEDGEHQT  236

Query  1103  PAELIEGTRKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQ  1282
             PAEL+EG +++ Y+V WAPQEEVL HPAVGGFLTHS                        
Sbjct  237   PAELMEGAKERSYIVEWAPQEEVLAHPAVGGFLTHS------------------------  272

Query  1283  QVNSRLVGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAV  1450
                    G VWK G DMKDTCDR+ VEKMV++LME R+DE  + ++ MA  ARK +
Sbjct  273   -------GHVWKLGSDMKDTCDRLIVEKMVRDLMEERKDELLETADMMATRARKCL  321



>emb|CDP01076.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   370 bits (949),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/484 (42%), Positives = 285/484 (59%), Gaps = 18/484 (4%)
 Frame = +2

Query  80    TMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             +M      H +  P+P QGH+N ML+LA+LL H    H+TF+N+EF H+RLL+       
Sbjct  3     SMSLPEKPHAVCIPYPAQGHINPMLKLAKLL-HHKGFHITFVNTEFNHKRLLKSRGPD-A  60

Query  260   FSSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS-GSLQSSGRPPV  436
              +  P+F F+ I DGLP         V  L  S        FR++L+      SS  PPV
Sbjct  61    LNGLPDFQFKAIPDGLPPSDVDATQDVPSLCESTTTHCLGPFRDLLAELNDTSSSQVPPV  120

Query  437   TCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGES-----  601
             +CI++DG+M F ++   EL +P ILF T SA  F  +    KLIE G  PL   S     
Sbjct  121   SCIVSDGVMSFTLEAAAELGVPEILFWTPSACGFLGYMHYAKLIEKGLTPLKDASCLSNG  180

Query  602   DMDKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLE  781
              +++ ++ + GM+++ RLRDLPSF RTT+  D     V+  T R+ +A  +ILNTFE+LE
Sbjct  181   YLEQAIDWIPGMKDI-RLRDLPSFLRTTNPDDYMIKFVLQETERSKKALAIILNTFEELE  239

Query  782   ESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLK  961
             +  +  +   +P +Y IGPL   L   V   R  +     S+LW+E+  C+ WLD +   
Sbjct  240   DDVINALSAILPPIYAIGPLQ-FLEKEVKDERLSV---LGSNLWKEEPECLEWLDSKDPN  295

Query  962   SVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKG  1138
             SVVYV+FGS+TV+T +Q +EF  G+VNS + FLW IRP+ V GD  I P E +E  + +G
Sbjct  296   SVVYVNFGSITVMTADQLVEFAWGLVNSKQTFLWIIRPDLVSGDSAILPPEFLEEIKDRG  355

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              +  W PQE+VL HPA+GGFLTHSGWNSTLESIC G+PMICWPF+A+QQ N       W 
Sbjct  356   LLASWCPQEQVLSHPAIGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWG  415

Query  1319  NGVDMKDTCDRITVEKMVKELMEVR---RDEFTKCSNRMAKLARKAVTQHGSSYSNLDRL  1489
             NG+++ +   R  VE +V ELM VR   +D   K      K    A +  GSSY+NL+++
Sbjct  416   NGLEIDNNVKREGVESLVTELM-VRGKGKDMKKKALEWKNKAEEAAKSSGGSSYANLEKV  474

Query  1490  VEDL  1501
             V+ L
Sbjct  475   VQVL  478



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   370 bits (949),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/473 (42%), Positives = 281/473 (59%), Gaps = 14/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  PFP QGH+N ML+LA+LL H    H+TF+N+EF H+RLL+    +     +P+F 
Sbjct  11    HAVCIPFPAQGHINPMLKLAKLL-HYKGFHITFVNTEFNHKRLLKSRGPN-SLDGFPSFR  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP         +  L +S      P FR++LS  +  S   PPV+C+++DG M
Sbjct  69    FETIPDGLPPTDANATQDIPSLCDSTRKRGLPYFRDLLSKLN-SSPDCPPVSCVVSDGAM  127

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLENV  628
              F +D   EL +P +LF T SA  F A+    +LIE G  PL   S +     +  ++ +
Sbjct  128   GFTLDAAQELGLPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTNGYLETEIDWI  187

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GM  + RL+D+PSF RTTD  D     V+  T RT +A+ +I NTF D E   L  +  
Sbjct  188   PGMRGI-RLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVIFNTFHDFEHEVLNALST  246

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              +P +Y+IGPLH  +    + S  +      S+LW E+  C+ WLD +   SVVYV+FGS
Sbjct  247   LLPPIYSIGPLHLQINQIPADSELK---EIRSNLWTEEPECLEWLDSKEPNSVVYVNFGS  303

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQE  1165
             +TV+T  Q +EF  G+ NS + F W IRP+ V GD  + P E +E T+++  +  W PQE
Sbjct  304   ITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQE  363

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL HPAVGGFLTHSGWNST+ES+C G+PMICWPF+A+QQ N R     W  G++++   
Sbjct  364   QVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWAIGMEIESDV  423

Query  1346  DRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
              R  VE +V++LME     E  K +    KLA +A++ +GSS+  LD++V  +
Sbjct  424   KRNYVEGLVRKLMEGDEGKEMRKKALEWKKLATEAISPNGSSFVGLDKMVNQV  476



>ref|XP_002302305.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
 gb|EEE81578.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
Length=483

 Score =   369 bits (948),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 194/471 (41%), Positives = 283/471 (60%), Gaps = 15/471 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  P+P QGH+N ML+LA+LL H    H+TF+N+E+ H+R+LR   L+      P+F 
Sbjct  11    HAVCIPYPAQGHINPMLKLAKLL-HHKGFHITFVNTEYNHKRILRSRGLN-SLDGLPSFQ  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS-GSLQSSGRPPVTCIIADGI  460
             F+ I DGLP         +  L  S +      F++++++     SS  PPVTCI++DG+
Sbjct  69    FKAIPDGLPPTSNDVTQDIPSLCESTSKTCMVPFKDLITNLNDTSSSNVPPVTCIVSDGV  128

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLEN  625
             M F ++   EL IP +LF T SA  F A+    +LIE G  PL  ES +     D +++ 
Sbjct  129   MSFTLEAAQELGIPEVLFWTTSACGFLAYAHCRQLIEKGLTPLKDESYLSNGYLDSVIDW  188

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             + GM+ + RLRD+PSF RTTD  D     +   + R  +A+ ++LNT++ LE   L  + 
Sbjct  189   IPGMKGI-RLRDIPSFVRTTDPEDFMLKFIKAESERAKKASAIVLNTYDALEHEGLVSLA  247

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
               +P +Y+IGPLH  L  +V+ S  +L     S+LW E+  C+ WLD +   SVVYV+FG
Sbjct  248   SMLPPVYSIGPLHLLLN-QVTDSDLKL---IGSNLWIEESGCLEWLDSKEPNSVVYVNFG  303

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN-IPAELIEGTRKKGYMVGWAPQ  1162
             S+TV+T +Q  EF  G+ NS + FLW IRP+ V GD   +P E +  T+++G    W  Q
Sbjct  304   SITVMTSDQLTEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFASWCSQ  363

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             E+VL HP++GGFLTH+GWNST+ESIC G+PMICWPF+A+QQ N R     W  G+++   
Sbjct  364   EQVLSHPSIGGFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGMEINSD  423

Query  1343  CDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLV  1492
               R  VE +V+ELM   +  E  K +    K+A +A+T  GSS  NLD ++
Sbjct  424   VKRGEVESLVRELMGGEKGSEMKKKTREWKKMAEEAITSTGSSCMNLDDMI  474



>ref|XP_002263158.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=475

 Score =   368 bits (945),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 208/475 (44%), Positives = 279/475 (59%), Gaps = 18/475 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+  PFP QGH+  ML+LA+LL H    H+TF+N+EF H+RLLR    H      P F 
Sbjct  6     HVVCIPFPAQGHIKPMLKLAKLL-HYRGFHITFVNTEFNHKRLLRSRGPH-ALDGMPGFC  63

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS-GSLQSSGRPPVTCIIADGI  460
             F +I DGLP         +  L  S        F+++++      SS  PPVTCI++DG 
Sbjct  64    FESIPDGLPPVDADATQHIPSLCESTPKSCLIPFQQLIAKLNDAPSSNVPPVTCIVSDGS  123

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLEN  625
             MCF +    EL IP +LF T SA  F A+     LI+   +PL   S +     + +++ 
Sbjct  124   MCFTLKASEELGIPNVLFWTTSACGFMAYKQFRPLIDGVLVPLKDLSYLTNGYLETIIDW  183

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRT-TRANGLILNTFEDLEESALAQI  802
             V GM+N +RLRD PSF RT D SD   L  I+ T  + ++A+GLILNTF  LE   L  +
Sbjct  184   VPGMKN-MRLRDFPSFIRTRDPSDHFMLDFIIDTTDSASKASGLILNTFHALEHDVLNPL  242

Query  803   RKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSF  982
                 P + T+GPL   L      +  E      S+LW E+  C+ WL+ +   SVVYV+F
Sbjct  243   SSMFPTICTVGPLPLLLNQIPDDNSIE------SNLWREETECLQWLNSKQPNSVVYVNF  296

Query  983   GSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAP  1159
             GS+TV+T  Q +EF  G+ NS K FLW IRP+ V+GD  I P E +  T ++G M GW P
Sbjct  297   GSITVMTPEQLVEFAWGLANSHKPFLWIIRPDLVVGDSVILPPEFVNETIQRGLMAGWCP  356

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             QE+VL HP+VGGFLTHSGWNST+ESIC G+PMICWPF+A+QQ N R     W  G+++ +
Sbjct  357   QEKVLNHPSVGGFLTHSGWNSTIESICAGVPMICWPFFAEQQTNCRYACTEWGVGMEIDN  416

Query  1340  TCDRITVEKMVKELMEVRRDE-FTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
               +R  VEK+VKELME  + +   K +      A +A    GSSY NLD+LV+ L
Sbjct  417   NVERDEVEKLVKELMEGEKGKSMKKAAMEWRTKAEEATAPCGSSYLNLDKLVDIL  471



>dbj|BAO51842.1| UDP-glycosyltransferase 85A32 [Ipomoea batatas]
Length=485

 Score =   368 bits (945),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 200/472 (42%), Positives = 285/472 (60%), Gaps = 16/472 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  P+P QGH+N ML+LA++L H    H+TF+N+EF H+RL R T         P+F 
Sbjct  12    HAVCIPYPAQGHINPMLKLAKIL-HHKGFHITFVNTEFNHRRLER-TRGPESLRGLPSFR  69

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS-GSLQSSGRPPVTCIIADGI  460
             F TI DGLP         +  L  S +A     F+++L+       S  PPV+CI++DG+
Sbjct  70    FETIPDGLPVSDADVTQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIVSDGV  129

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLEN  625
             M F +D   EL IP +LF T SA  F  +    +L++ G  PL  ES +     +  L+ 
Sbjct  130   MSFTVDAAEELGIPEVLFWTTSACGFLGYMHFTQLLDKGYTPLKDESYLTNGYLETELDW  189

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             V+GM+ + RLRD+PSF RTT+  +     ++  T R  RA+ +ILNTF+ LE  AL  ++
Sbjct  190   VKGMKGI-RLRDIPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALEHEALMALQ  248

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
               +P +Y +GPL   L+ +V  S        +S+LW+ED SC+ WLD +   SVVYV++G
Sbjct  249   SMLPPVYAVGPLQ-FLQTQVKDSNVR---ALASNLWKEDTSCLEWLDTKEPNSVVYVNYG  304

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQ  1162
             S+TV+T +Q LEF  G+ NS K FLW +RP+ V G+  I P E +E T+ +G +  W  Q
Sbjct  305   SITVMTPDQLLEFAWGLANSKKPFLWIVRPDLVTGEAAIIPPEFLEETKDRGMLSSWCSQ  364

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             E+VL HPA+GGFLTH+GWNSTLESIC G+PM+CWPF+A+QQ N     + W  G ++   
Sbjct  365   EQVLNHPAIGGFLTHNGWNSTLESICSGVPMLCWPFFAEQQTNCHYACSKWGIGKEIDSN  424

Query  1343  CDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQH-GSSYSNLDRLV  1492
               R  VEK+V+ELME  +  E  K +    KLA +A T   GSS+ N+D+L+
Sbjct  425   VKRDEVEKLVRELMEGEKGGEMKKKAMEWKKLAEEAATSSIGSSHINIDKLI  476



>gb|KHN15666.1| UDP-glycosyltransferase 85A7 [Glycine soja]
Length=459

 Score =   367 bits (942),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 200/468 (43%), Positives = 291/468 (62%), Gaps = 21/468 (4%)
 Frame = +2

Query  149   MLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFYFRTISDGLPADHPRT  328
             M  LA+LL  +    +TF+N+   H RL+++TDL    + +P F+F +I+DG+P + P+ 
Sbjct  1     MFNLAKLLSLKGH-KITFVNTHHNHNRLIQFTDLPSFHTQFPGFHFASITDGVPDNLPQN  59

Query  329   GDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR--PPVTC-IIADGIM-CFAIDVGNELR  496
                 +    S + V    FR +LS   ++   +  PP +C IIADG+M   ++DV  E  
Sbjct  60    EFEHMISPTSRSEVAG-EFRGLLSRLVVEKPRQWDPPPSCVIIADGLMSTVSMDVAKEFG  118

Query  497   IPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLENVEGMENVLRLRDLPSFC  676
             +P I FRT+SA+  W    V K+++ G + L    DMDK+L ++ G+EN+LR  DLPS  
Sbjct  119   VPLIAFRTYSATATWVSIHVSKIVQEGVMDLQNPEDMDKVLRSIPGLENLLRECDLPSIL  178

Query  677   RTTDLSDRGFLSV---ILATLRTTRANGLILNTFEDLEESALAQIRKHIPNLYTIGPLHA  847
             +       G L +   I  TL  T+A+GLI+NTF+ LE S + ++    P +YTIGPLH 
Sbjct  179   KLKP----GSLYIDFYIKETLTMTQASGLIVNTFDQLEASIITKLTTIFPKVYTIGPLHT  234

Query  848   HLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGSMTVLTRNQFLEFW  1027
               + +  ++       SS  L +ED+SC+ WLD+Q  +SV+YVSFG++  ++  Q +E W
Sbjct  235   LTKTQFITNNSS----SSLHLRKEDKSCITWLDQQKARSVLYVSFGTLAKVSHEQLVEIW  290

Query  1028  HGIVNSGKAFLWAIRPNSVIGD----DNIPAELIEGTRKKGYMVGWAPQEEVLVHPAVGG  1195
             HG+V S K FLW IR   +IG+     N+P EL   T+++G MV WAPQEEVL HP+VGG
Sbjct  291   HGLVGSLKPFLWVIRQGLIIGEGGLGHNVPMELELKTKERGLMVNWAPQEEVLAHPSVGG  350

Query  1196  FLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTCDRITVEKMVK  1375
             F THSGWNSTLE I EG+PM+CWP  ADQ VNSR V   W  G+DM   CDR+ VEKMVK
Sbjct  351   FFTHSGWNSTLECITEGVPMLCWPLIADQTVNSRCVSEQWGIGLDMNGICDRLIVEKMVK  410

Query  1376  ELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLKKMKLQ  1519
              LME + +  T  +N +A+ A  +V ++GSS+ N++ L++D+  MK++
Sbjct  411   NLMENQIERLTSSTNEIAEKAHDSVNENGSSFHNIENLIKDIGTMKVR  458



>ref|XP_003576916.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=493

 Score =   368 bits (945),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 216/498 (43%), Positives = 293/498 (59%), Gaps = 40/498 (8%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             + +HVL+FP+P+QGH+NCML  A  L   + +HVTFL++E    R+    D     ++ P
Sbjct  2     APAHVLVFPWPLQGHINCMLHFAAGLVG-AGLHVTFLHTEHNLARV----DPLASAAATP  56

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSS-----GRPPVT  439
                F ++ DGLPA HPRT   V DL   +       +R +L+S   Q S     G PPV+
Sbjct  57    RLRFVSVPDGLPAGHPRT---VRDLKEPLLTTVPAAYRALLASLQQQPSTTADAGFPPVS  113

Query  440   CIIADGIMCFAIDVGNE-LRIPTILFRTFSASCFWAFFCVPKLIESGD-LPLNGESDMDK  613
             C++ADG++ FAID+  E   +P + FRT SA    A+  VP+L+E G+ +P+  ++D+D+
Sbjct  114   CVVADGLLPFAIDIPEEEFGVPALAFRTVSACSILAYLSVPRLVELGEAIPIPLDADLDE  173

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRG--FLSVILATLRTTR--ANGLILNTFEDLE  781
             L+  V GME  LR RDLPS CR    +      L +I+     +R  A  LILNT   LE
Sbjct  174   LVLGVPGMEGFLRRRDLPSPCRVNAETQEADPLLDMIVDFTAHSRDKARALILNTAASLE  233

Query  782   ESALAQIRKHI-PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPL  958
               +LA I + +  +++ IGPLH H  A VSSS       +S S+W ED  C+ WLD Q  
Sbjct  234   GESLAHIAEQMRGDVFAIGPLHLHAAANVSSSSSSPAPVASGSMWREDGGCIEWLDAQGD  293

Query  959   KSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGT----  1126
             +SVVYVS GS+TV++  QF EF  G+V +G AFLW +RP+ V    N  A L E      
Sbjct  294   RSVVYVSLGSLTVISLEQFTEFLSGLVGAGHAFLWVLRPDMVTATQN--ALLREAVDAAA  351

Query  1127  ------RKKGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQV  1288
                       ++V WAPQ  VL H AVG FLTH+GWNST+E   EG+PM+CWPF+ADQQ+
Sbjct  352   ALHGNAAPAAFVVDWAPQRAVLRHRAVGCFLTHAGWNSTVECAAEGVPMVCWPFFADQQI  411

Query  1289  NSRLVGAVWKNGVDMKDTCDRITVEKMVKELME---VRRDEFTKCSNRMAKLARKAVTQH  1459
             NSR VGAVW  G+DMKD CDR  VE MV+E ME   +RR         +A+  R+ V + 
Sbjct  412   NSRFVGAVWGTGLDMKDVCDRAVVEAMVREAMESAGIRRSAVA-----LAERVRRDVEEG  466

Query  1460  GSSYSNLDRLVEDLKKMK  1513
             GSS    DRLV  +K++ 
Sbjct  467   GSSAVEFDRLVGFIKELA  484



>ref|XP_011016634.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Populus euphratica]
Length=483

 Score =   368 bits (944),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 196/471 (42%), Positives = 282/471 (60%), Gaps = 15/471 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  P+P QGH+N ML+LA+LL H    H+TF+N+E+ H+R+LR    +      P+F 
Sbjct  11    HAVCIPYPAQGHINPMLKLAKLL-HHRGFHITFVNTEYNHKRILRSRGPN-SLDGLPSFQ  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS-GSLQSSGRPPVTCIIADGI  460
             F+ I DGLP         +  L  S +      F+ ++++     SS  PPVTCI++DG+
Sbjct  69    FKAIPDGLPPTSNDVTQDIPSLCESTSKTCLVPFKNLITNLNDTSSSNVPPVTCIVSDGV  128

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLEN  625
             M F ++   EL IP +LF T SA  F A+    +LIE G  PL  ES +     D +++ 
Sbjct  129   MSFTLEAAQELGIPEVLFWTTSACGFLAYAHYHQLIEKGLTPLKDESYLSNGYLDSVIDW  188

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             + GM+ + RLRD+PSF RTTD  D     V   T R  +A+ ++LNT++ LE   L  + 
Sbjct  189   IPGMKGI-RLRDIPSFVRTTDPEDFMLKFVKAETERAKKASAIVLNTYDALEHEGLVSLA  247

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
               +P +Y+IGPLH  L  +V+ S  +L     S+LW E+  C+ WLD +   SVVYV+FG
Sbjct  248   SMLPPVYSIGPLHLLLN-QVTDSDLKL---IGSNLWIEESGCLEWLDSKEPNSVVYVNFG  303

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN-IPAELIEGTRKKGYMVGWAPQ  1162
             S+TV+T +Q  EF  G+ NS + FLW IRP+ V GD   +P E +  T+++G    W  Q
Sbjct  304   SITVMTSDQLTEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFSSWCSQ  363

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             E+VL HP++GGFLTHSGWNST+ESIC G+PMICWPF+A+QQ N R     W  G+++   
Sbjct  364   EQVLSHPSIGGFLTHSGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGMEINSD  423

Query  1343  CDRITVEKMVKELMEVRRD-EFTKCSNRMAKLARKAVTQHGSSYSNLDRLV  1492
               R  VE +V+ELM   +  E  K +  + K+A +A+T  GSS  NLD ++
Sbjct  424   VKRGEVESLVRELMGGDKGREMKKKTRELKKMAEEAITSTGSSCMNLDDMI  474



>ref|XP_003560193.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=478

 Score =   367 bits (943),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 201/484 (42%), Positives = 288/484 (60%), Gaps = 33/484 (7%)
 Frame = +2

Query  101   SHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNF  280
             +HVL+FP+P+QGH+N ML  A  L   + +HVTF+++E  H   LR  D     ++ P  
Sbjct  5     AHVLVFPWPLQGHINSMLHFAAALV-GAGLHVTFVHTE--HN--LRRVD---PAAASPRL  56

Query  281   YFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS---------GSLQSSGRPP  433
              F ++ DGLP DHPR+   + D+  S+       +R +L+S               G PP
Sbjct  57    RFTSVPDGLPDDHPRSVGDLKDVAKSLMTTGPAVYRALLASLLPASTHADADADGRGFPP  116

Query  434   VTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDK  613
             V+C++ADG++ FAID+  EL +P + FRT SA    A+F + +L+E G++P    +D+D+
Sbjct  117   VSCVVADGLLPFAIDIAEELGVPALAFRTASACSVLAYFSMARLMELGEVPFPVGADLDE  176

Query  614   LLENVEGMENVLRLRDLPSFCR---TTDLSDRGFLSVILATLRTTRANGLILNTFEDLEE  784
              +  V GME+ LR RDLPS CR    T   D     ++  TL + +A  LI NT   LE 
Sbjct  177   PVRGVPGMEDFLRRRDLPSSCRRHADTHEVDPLLQLLVKFTLHSCKARALIFNTAASLEG  236

Query  785   SALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKS  964
             +A+A I  H+ +++ IGPLHA   A  + +         +SLW ED  C+AWLD    +S
Sbjct  237   AAVAHIAPHMRDVFAIGPLHAMSVAAPAPA---------ASLWREDDGCVAWLDGHADRS  287

Query  965   VVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDN-IPAELIEGTR-KKG  1138
             VVYVS GS+ V++  QF EF  G+VN+G AFLW +RP  V    + +  E +E     K 
Sbjct  288   VVYVSLGSLAVISLEQFTEFLSGLVNAGYAFLWVLRPGMVGASQSAVLQEAVEAAGLGKA  347

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              +V WAPQ +VL H AVG FLT++GWNSTLE++ E +PM+CWPF+ADQQ+NSR VGAVW 
Sbjct  348   RVVDWAPQRDVLRHRAVGCFLTNTGWNSTLEAVVEAVPMVCWPFFADQQINSRFVGAVWG  407

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVED  1498
              G+DMKD C+R  +E MV+E ME         +  +A+  R+ + Q GSS    +RLV  
Sbjct  408   TGLDMKDVCERAVMEGMVREAME--SGGLRMSAQALAQEVRRDIAQGGSSALEFERLVGF  465

Query  1499  LKKM  1510
             +K++
Sbjct  466   IKEL  469



>gb|ACF88457.1| unknown [Zea mays]
 tpg|DAA40852.1| TPA: cytokinin-O-glucosyltransferase 2 [Zea mays]
Length=480

 Score =   367 bits (942),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 196/483 (41%), Positives = 284/483 (59%), Gaps = 21/483 (4%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M   +++HVL+FP P QGH+N  L  +  L   + +HVTFL+++   +RL   T      
Sbjct  1     MAAAAAAHVLVFPAPAQGHLNSFLHFSTGLL-RAGLHVTFLHTDHNLRRL--GTAAAEAT  57

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
              + P   F ++ DGLP D PRT D + +L  S+       +R +L+S      G PPVTC
Sbjct  58    VASPRLRFLSVPDGLPDDDPRTVDGLPELMESLRTKASASYRALLASLRAGGGGFPPVTC  117

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             ++ADGIM F +DV  EL +P I FRT SA    A+  VPKLI  G+LP     D+D  + 
Sbjct  118   VVADGIMPFVVDVAEELGVPAISFRTVSACAVLAYLSVPKLIALGELPFPEGGDLDAPIR  177

Query  623   NVEGMENVLRLRDLP-SFCRTTDLSDRGFLSVILATLRTT--RANGLILNTFEDLEESAL  793
              V GME+ LR RDLP  F + T   +   ++ ++A    +  +A  LI+NT   LE S+L
Sbjct  178   GVPGMESFLRRRDLPIQFRQLTSTYEEPLVAAVVAATVHSCCKARALIVNTTTSLERSSL  237

Query  794   AQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLD-EQPLKSVV  970
               + + + +++ +GPLHA   A   +S          SLW  D  CMAWLD +Q  ++VV
Sbjct  238   GHLTQEMRDVFAVGPLHAMSPAPAVAS----------SLWRPDDGCMAWLDNQQAERAVV  287

Query  971   YVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGT--RKKGYM  1144
             Y+S GS+ V++  QF EF HG+V +G  FLW +RP+ ++   +       G   + +  +
Sbjct  288   YISLGSLAVISHEQFTEFLHGLVATGYPFLWVLRPDMLVASQDAALREAIGAVGKDRACV  347

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             V W PQ +VL H AVG FLTHSGWNST+E I EG+PM+CWPF+ADQQ+NSR VGAVW+NG
Sbjct  348   VPWVPQRDVLRHRAVGCFLTHSGWNSTIEGIVEGVPMVCWPFFADQQINSRFVGAVWRNG  407

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +DMKD CDR+ VE  V+E ME   +E  + ++ +A+  ++ V   G+S     RL+  + 
Sbjct  408   LDMKDVCDRVVVESTVREAME--SEEIRRSAHALAEQVKRDVADDGASALEFKRLISFIT  465

Query  1505  KMK  1513
             ++ 
Sbjct  466   ELS  468



>ref|NP_001148991.1| cytokinin-O-glucosyltransferase 2 [Zea mays]
 gb|ACG33743.1| cytokinin-O-glucosyltransferase 2 [Zea mays]
Length=480

 Score =   367 bits (941),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 196/482 (41%), Positives = 283/482 (59%), Gaps = 21/482 (4%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M   +++HVL+FP P QGH+N  L  +  L   + +HVTFL+++   +RL   T      
Sbjct  1     MAAAAAAHVLVFPAPAQGHLNSFLHFSTGLL-RAGLHVTFLHTDHNLRRL--GTAAAEAT  57

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
              + P   F ++ DGLP D PRT D + +L  S+       +R +L+S      G PPVTC
Sbjct  58    VASPRLRFLSVPDGLPDDDPRTVDGLPELMESLRTKASASYRALLASLRAGGGGFPPVTC  117

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLE  622
             ++ADGIM F +DV  EL +P I FRT SA    A+  VPKLI  G+LP     D+D  + 
Sbjct  118   VVADGIMPFVVDVAEELGVPAISFRTVSACAVLAYLSVPKLIALGELPFPKGGDLDAPIR  177

Query  623   NVEGMENVLRLRDLP-SFCRTTDLSDRGFLSVILATLRTT--RANGLILNTFEDLEESAL  793
              V GME+ LR RDLP  F + T   +   ++ ++A    +  +A  LI+NT   LE S+L
Sbjct  178   GVPGMESFLRRRDLPIQFRQLTSTYEEPLVAAVVAATVHSCCKARALIVNTTTSLERSSL  237

Query  794   AQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLD-EQPLKSVV  970
               + + + +++ +GPLHA   A   +S          SLW  D  CMAWLD +Q  ++VV
Sbjct  238   GHLTQEMRDVFAVGPLHAMSPAPAVAS----------SLWRPDDGCMAWLDNQQAERAVV  287

Query  971   YVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNIPAELIEGT--RKKGYM  1144
             Y+S GS+ V++  QF EF HG+V +G  FLW +RP+ ++   +       G   + +  +
Sbjct  288   YISLGSLAVISHEQFTEFLHGLVATGYPFLWVLRPDMLVASQDAALREAIGAVGKDRACV  347

Query  1145  VGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNG  1324
             V W PQ +VL H AVG FLTHSGWNST+E I EG+PM+CWPF+ADQQ+NSR VGAVW+NG
Sbjct  348   VXWVPQRDVLRHRAVGCFLTHSGWNSTMEGIVEGVPMVCWPFFADQQINSRFVGAVWRNG  407

Query  1325  VDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDLK  1504
             +DMKD CDR+ VE  V+E ME   +E  +  + +A+  ++ V   G+S     RL+  + 
Sbjct  408   LDMKDVCDRVVVESTVREAME--SEEIRRSVHALAEQVKRDVADDGASALEFKRLISFIT  465

Query  1505  KM  1510
             ++
Sbjct  466   EL  467



>gb|EEC82058.1| hypothetical protein OsI_26044 [Oryza sativa Indica Group]
Length=480

 Score =   366 bits (940),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 204/487 (42%), Positives = 281/487 (58%), Gaps = 25/487 (5%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             +++HVL+FP P+QGH+N ML LA  L   + +HVTFL+++   +RL          S   
Sbjct  4     AAAHVLVFPMPLQGHINVMLHLATALAAAAGVHVTFLHTDHNLRRLGNAAAATTAGSPR-  62

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS---GSLQSSGRPPVTCI  445
                F ++ DGLP DHPR+   V  + +S+    +  +R +L S   GS  + G PPVT +
Sbjct  63    RLRFLSVPDGLPDDHPRSASDVPVMVDSLLGAGQAAYRALLGSLLVGSGGAGGFPPVTSV  122

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
             +AD ++ FAIDV  EL +P + FRT SAS   A+  VP+L E G+LP     D+D+ +  
Sbjct  123   VADALLTFAIDVAEELGVPALAFRTASASSLLAYMSVPRLFELGELPFPPGGDLDEPVRG  182

Query  626   VEGMENVLRLRDLPSFCR----TTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESAL  793
             V GME  LR RDLPS  R      D+  +  + V L T  + +A  +ILNT   LE  AL
Sbjct  183   VPGMEGFLRRRDLPSTFRRHGNDHDVHPKLQMLVDLTT-GSCKARAVILNTAASLEAPAL  241

Query  794   AQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVY  973
             A I   + +++ +GPLHA   A  +++          SLW ED  CMAWLD Q  +SVVY
Sbjct  242   AHIAPRVRDVFAVGPLHAMSPAPAAAT----------SLWREDDGCMAWLDGQADRSVVY  291

Query  974   VSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG----DDNIPAELIEGTRKKGY  1141
             VS GS+TV++  QF EF  G+V +G  FLW +RP+ V       D   A        K  
Sbjct  292   VSLGSLTVISPEQFTEFLSGLVAAGHPFLWVLRPDMVTARLQHADLQEAVAAAAGHSKAR  351

Query  1142  MVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKN  1321
             +V WAPQ +VL H AVG FLTH+GWNSTLE+  EG+P +CWPF+ DQQ+NSR VG VW  
Sbjct  352   VVRWAPQRDVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFVDQQINSRFVGGVWGT  411

Query  1322  GVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
             G+DMKD CD   V +MV+E ME    E    +  +A+  R+ V   GSS +   RLV  L
Sbjct  412   GLDMKDACDAAVVARMVREAME--SGEIRATAQALAEKVRRDVADGGSSATEFKRLVGFL  469

Query  1502  KKMKLQL  1522
             +++  ++
Sbjct  470   QELATRI  476



>ref|NP_001059671.1| Os07g0490100 [Oryza sativa Japonica Group]
 dbj|BAC80066.1| putative glucosyltransferase-2 [Oryza sativa Japonica Group]
 dbj|BAF21585.1| Os07g0490100 [Oryza sativa Japonica Group]
 dbj|BAG97501.1| unnamed protein product [Oryza sativa Japonica Group]
Length=480

 Score =   366 bits (940),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 204/487 (42%), Positives = 280/487 (57%), Gaps = 25/487 (5%)
 Frame = +2

Query  95    SSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYP  274
             +++HVL+FP P+QGH+N ML LA  L   + +HVTFL+++    RL          S   
Sbjct  4     AAAHVLVFPMPLQGHINVMLHLATALAAAAGVHVTFLHTDHNLHRLGNAAAATTAGSPR-  62

Query  275   NFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS---GSLQSSGRPPVTCI  445
                F ++ DGLP DHPR+   V  + +S+    +  +R +L S   GS  + G PPVT +
Sbjct  63    RLRFLSVPDGLPDDHPRSASDVPVMVDSLLGAGQAAYRALLGSLLVGSGGAGGFPPVTSV  122

Query  446   IADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDMDKLLEN  625
             +AD ++ FAIDV  EL +P + FRT SAS   A+  VP+L E G+LP     D+D+ +  
Sbjct  123   VADALLTFAIDVAEELGVPALAFRTASASSLLAYMSVPRLFELGELPFPPGGDLDEPVRG  182

Query  626   VEGMENVLRLRDLPSFCR----TTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESAL  793
             V GME  LR RDLPS  R      D+  +  + V L T  + +A  +ILNT   LE  AL
Sbjct  183   VPGMEGFLRRRDLPSTFRRHGNDHDVHPKLQMLVDLTT-GSCKARAVILNTAASLEAPAL  241

Query  794   AQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVY  973
             A I   + +++ +GPLHA   A  +++          SLW ED  CMAWLD Q  +SVVY
Sbjct  242   AHIAPRVRDVFAVGPLHAMSPAPAAAT----------SLWREDDGCMAWLDGQADRSVVY  291

Query  974   VSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIG----DDNIPAELIEGTRKKGY  1141
             VS GS+TV++  QF EF  G+V +G  FLW +RP+ V       D   A        K  
Sbjct  292   VSLGSLTVISPEQFTEFLSGLVAAGHPFLWVLRPDMVTARLQHADLQEAVAAAAGHSKAR  351

Query  1142  MVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKN  1321
             +V WAPQ +VL H AVG FLTH+GWNSTLE+  EG+P +CWPF+ DQQ+NSR VG VW  
Sbjct  352   VVRWAPQRDVLRHRAVGCFLTHAGWNSTLEAAVEGVPTVCWPFFVDQQINSRFVGGVWGT  411

Query  1322  GVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
             G+DMKD CD   V +MV+E ME    E    +  +A+  R+ V   GSS +   RLV  L
Sbjct  412   GLDMKDACDAAVVARMVREAME--SGEIRATAQALAEKVRRDVADGGSSATEFKRLVGFL  469

Query  1502  KKMKLQL  1522
             +++  ++
Sbjct  470   QELATRI  476



>ref|XP_010040274.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   366 bits (940),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 200/484 (41%), Positives = 283/484 (58%), Gaps = 17/484 (4%)
 Frame = +2

Query  80    TMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             ++D     H L  P+P QGH+N ML LA+LL H    HVTF+N+E+ H RLLR       
Sbjct  3     SIDMIQKPHALCIPYPAQGHINPMLNLAKLL-HHRGFHVTFVNTEYNHSRLLRSRGPS-S  60

Query  260   FSSYPNFYFRTISDGLP-ADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQS--SGRP  430
                 P+F FRTI DGLP +D       +  L  S +    P FR++L   + +S  SG P
Sbjct  61    LDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSGSP  120

Query  431   PVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-  607
             PV+C+++DG+M F +D    + +P +LF T SA  F  +     LI+ G  PL   S + 
Sbjct  121   PVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLKDASYLT  180

Query  608   ----DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFED  775
                 D +++ + GM N+ RLRDLPSF +TTD  D     V+  T R  RA+ ++ NTF+ 
Sbjct  181   NAYLDTIIDWIPGMRNI-RLRDLPSFIQTTDPDDLMIHFVLRETERAKRASAIVFNTFDR  239

Query  776   LEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQP  955
             LE   L  ++   P++ T+GPLH             +     S+LW+ED  C+ WLD +P
Sbjct  240   LEHEVLDALKAMFPSICTLGPLHLLTEQLPDDDTKSI----GSNLWKEDLGCLEWLDSKP  295

Query  956   LKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRK  1132
               SVVYV+FGS+TV++  Q +EF  G+ NS + FLW IRP+ V+GD  I P+E    TR+
Sbjct  296   PGSVVYVNFGSITVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRE  355

Query  1133  KGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAV  1312
             +  +  W PQE VL HPAVGGFLTHSGWNST+ESI  G+P++CWPF+A+QQ N R     
Sbjct  356   RSLLASWCPQERVLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEE  415

Query  1313  WKNGVDMKDTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRL  1489
             W  G+++     R  VE+ V+ELME  R  E  + +    ++AR+A+   GSSY NLD +
Sbjct  416   WGIGMEIDGDVKRDKVERQVRELMEGERGKEMKRKAMEWQQMAREAMRPSGSSYLNLDEV  475

Query  1490  VEDL  1501
             ++ +
Sbjct  476   MDKV  479



>gb|KDP41399.1| hypothetical protein JCGZ_15806 [Jatropha curcas]
Length=487

 Score =   365 bits (937),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 201/473 (42%), Positives = 279/473 (59%), Gaps = 17/473 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  P+P QGH+N ML+LA+LL H    H+TF+++E+ H+RLLR           P+F 
Sbjct  11    HAVCIPYPAQGHINPMLKLAKLL-HHKGFHITFVHTEYNHKRLLRSRGSD-SVIGLPSFQ  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSS-GSLQSSGRPPVTCIIADGI  460
             FRTI DGLP         +  L  S +      F+ +LS      SS  PPV+CI++DG+
Sbjct  69    FRTIPDGLPPTDSDVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSSNVPPVSCIVSDGV  128

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLEN  625
             M F +D   EL IP +LF T SA  F  +    +LIE G  PL  ES +     D +++ 
Sbjct  129   MSFTVDAAQELCIPLVLFWTTSACGFMGYVQYRQLIERGLSPLKDESYLTNGYLDTVIDW  188

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             + GM+N+ RLRD+PSF RTTD  D     V+  T R  +A  +ILNTF+ LE   LA + 
Sbjct  189   IPGMKNI-RLRDIPSFIRTTDPKDGMIDFVLSETARLQKATAVILNTFDLLEHDVLAALS  247

Query  806   KHI-PNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSF  982
               + P +Y+IG L   L      +   +     S+LW+ED  C+ WLD +   SVVYV+F
Sbjct  248   SSLLPPVYSIGSLQLLLNNIKDENLKSI----ESNLWKEDADCLQWLDSKEPNSVVYVNF  303

Query  983   GSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAP  1159
             GS+TV+T  Q +EF  G+ NS K FLW IRP+ V GD  + P E +  T+++G +  W P
Sbjct  304   GSITVMTNKQLIEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLASWCP  363

Query  1160  QEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKD  1339
             QE+VL H ++GGFLTHSGWNSTLE IC G+PMICWPF+A+QQ N R     W  G+++  
Sbjct  364   QEQVLSHSSIGGFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGMEINS  423

Query  1340  TCDRITVEKMVKELM-EVRRDEFTKCSNRMAKLARKAVT-QHGSSYSNLDRLV  1492
                R  VE +V+ELM  V+  E  K +    K+A +A+T  +GSS+ NLD+ +
Sbjct  424   DVKRDEVEILVRELMVGVKGQEMKKKAMEWKKMAEEAITCPNGSSFQNLDKFI  476



>ref|XP_004136284.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 ref|XP_004167272.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 gb|KGN60220.1| hypothetical protein Csa_3G889760 [Cucumis sativus]
Length=486

 Score =   365 bits (937),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 199/476 (42%), Positives = 281/476 (59%), Gaps = 14/476 (3%)
 Frame = +2

Query  92    RSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSY  271
             +   H +  P+P QGH+N ML+LA+LL H    H+TF+N++F H+RLL+           
Sbjct  8     QQQPHAVCIPYPAQGHINPMLKLAKLL-HSFGFHITFVNTDFNHRRLLKSRG-PTALDGI  65

Query  272   PNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIA  451
              +F F +I DGLP         +  L  S   +    F+E++S  +   +  P V+CI++
Sbjct  66    SSFQFESIPDGLPPTDVDATQDIPSLCQSTRRLCLQPFKELVSKLNCDPN-VPQVSCIVS  124

Query  452   DGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLP------LNGESDMDK  613
             DG+M F +D   EL +P +LF T SA  F A+    +L+E G  P      L+ E  +D 
Sbjct  125   DGVMSFTVDAAEELGVPVVLFWTTSACGFLAYLHYQQLVERGYTPFKDESYLSNEQYLDT  184

Query  614   LLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESAL  793
              ++ + GM++V RLRD+P+F RTTD  D     +I  T R  RAN ++LNT   LE+ AL
Sbjct  185   KIDWIPGMKDV-RLRDIPTFIRTTDPEDGMIDFIISETKRAKRANAIVLNTVASLEQEAL  243

Query  794   AQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVY  973
               +   +P +++IGPL   L+   S     L +  S+ LW+ED SC+ WLD++   SVVY
Sbjct  244   NAMSSLLPPVFSIGPLQLLLQQVASHDSDHLKFLGSN-LWKEDTSCLQWLDQKSPNSVVY  302

Query  974   VSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVG  1150
             V+FGS+TV+T++Q  EF  G+ NSG+ FLW IRP+ V GD  + P E I+ T+++G +  
Sbjct  303   VNFGSITVMTKDQLKEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDVTKERGMLTN  362

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQEEVL HPA+GGFLTH+GWNST ESI  G+PMICWPF+A+QQ N R     W  G++
Sbjct  363   WCPQEEVLQHPAIGGFLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWGIGME  422

Query  1331  MKDTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQH-GSSYSNLDRLV  1492
             +     R  +EK VKELME  +  E    +    KL   A T H GSS  NL+ LV
Sbjct  423   VDSDVKREEIEKQVKELMEGEKGKEMRNRAEEWKKLVGDAATPHSGSSSRNLNDLV  478



>ref|XP_003560194.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=479

 Score =   364 bits (935),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 208/493 (42%), Positives = 282/493 (57%), Gaps = 40/493 (8%)
 Frame = +2

Query  98    SSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSE--FAHQRLLRYTDLHLRFSSY  271
             ++HVL+FP+P+QGH+N ML  A  L   + +HVTFL++E               LRF S 
Sbjct  2     AAHVLVFPWPLQGHINSMLPFAVALAG-AGVHVTFLHTEPNLRRAAATASPAARLRFMSV  60

Query  272   PNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR--------  427
             P        DGLP DHPR+   + +L  S+N      +R +L S  L ++G         
Sbjct  61    P--------DGLPDDHPRSVGDLTELAMSLNTTGAAAYRALLDS-MLSAAGSHAADAGAA  111

Query  428   ----PPVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNG  595
                 P V+C++ D  + F +DV  EL +P + F T SA    A+  +P+L E G++P++ 
Sbjct  112   VGVFPAVSCVVGDVFLPFTVDVAEELGVPALAFHTASACSVLAYLSLPRLTELGEVPVSV  171

Query  596   ESDMDKLLENVEGMENVLRLRDLPSFCR---TTDLSDRGFLSVILATLRTTRANGLILNT  766
               D+D  +  V GME  LR RDLPS CR    T   D     +     R++ A  LI+NT
Sbjct  172   GVDLDAPVRGVPGMEGFLRRRDLPSTCRRRPDTHGIDPALHILAGHAARSSGARALIINT  231

Query  767   FEDLEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLD  946
                LE  ALA+I   + +L+ IGPLHA   A   +S         +SLW ED  CM WLD
Sbjct  232   AVSLEAPALARIAPRMRDLFAIGPLHAMSSAAAPAS---------TSLWPEDEGCMEWLD  282

Query  947   EQPLKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSV-IGDDNIPAELIEG  1123
              Q  KSVVYVS GS+ V++  QF EF HG+VN+G AFLWA+RP++V      +  E +E 
Sbjct  283   GQADKSVVYVSLGSLAVISLEQFTEFLHGLVNAGYAFLWALRPDTVGASQSTVLQEAVEA  342

Query  1124  TRK-KGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRL  1300
                 K  +V WAPQ +VL H AVG FLTH+GWNSTLE I EG+P++CWPF+ DQQ NSR 
Sbjct  343   AANGKARVVDWAPQRDVLRHRAVGCFLTHAGWNSTLEGIVEGVPLVCWPFFGDQQTNSRF  402

Query  1301  VGAVWKNGVDMKDTCDRITVEKMVKELMEVRRDEFTKCSNRMAKLARKAVTQHGSSYSNL  1480
             VGAVW  G+DMKD C+R  VE MV+E ME    E  + +  +AK  R+ V + GSS S  
Sbjct  403   VGAVWGTGLDMKDVCERAVVEGMVREAME--SGELRRSAQALAKEVRRDVAEGGSSASEF  460

Query  1481  DRLVEDLKKMKLQ  1519
              RLV  +K++ ++
Sbjct  461   RRLVGFIKELNVK  473



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   363 bits (933),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 280/473 (59%), Gaps = 14/473 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  PFP QGH+N +L+LA+LL H    H+TF+N+EF H+RLL+    +     +P+F 
Sbjct  11    HAVCIPFPAQGHINPLLKLAKLL-HYKGFHITFVNTEFNHKRLLKSRGPN-SLDGFPSFR  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP         +  L +S    + P FR++LS  +  S   PPV+C+++DG M
Sbjct  69    FETIPDGLPPTDANATQDIPSLCDSTRKRSLPYFRDLLSKLN-SSPDCPPVSCVVSDGAM  127

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLENV  628
              F +D   E  +P +LF T SA  F A+    + IE G  PL   S +     +  ++ +
Sbjct  128   GFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLKDASYLTNGYLETEIDWI  187

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
              GM  + RL+D+PSF RTTD  D     V+  T RT +A+ +I NTF D E   L  +  
Sbjct  188   PGMRGI-RLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVIFNTFHDFEHEVLDALST  246

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
              +P +Y+IGPLH  +    + S  +      S+LW E+  C+ WLD +   SVVYV+FGS
Sbjct  247   LLPPIYSIGPLHLQINQIPADSELK---EIRSNLWTEEPECLEWLDSKEPNSVVYVNFGS  303

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQE  1165
             +TV+T  Q +EF  G+ +S + F W IRP+ V GD  + P E +E T+++  +  W PQE
Sbjct  304   ITVMTAEQLIEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQE  363

Query  1166  EVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDTC  1345
             +VL HPAVGGFLTHSGWNST+ES+C G+PMICWPF+A+QQ N R     W  G+++K   
Sbjct  364   QVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDV  423

Query  1346  DRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
              R  +E +V++LME     +  K +    KLA++A + +GSS+  LD+++  +
Sbjct  424   KRNYIEGLVRKLMEGEEGKDMRKKALEWKKLAKEATSPNGSSFVPLDKMINQV  476



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   364 bits (934),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 197/474 (42%), Positives = 281/474 (59%), Gaps = 16/474 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  PFP QGH++ ML+LA+LL H    H+TF+N+EF H+RLL+    +     +P+F 
Sbjct  11    HAVCIPFPAQGHIDPMLKLAKLL-HYKGFHITFVNTEFNHKRLLKSRGPN-SLDGFPSFR  68

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGR-PPVTCIIADGI  460
             F TI DGLP         +  L +S    + P FRE+LS   L SS   PPV+C+++DG 
Sbjct  69    FETIPDGLPPTDAIATQDIPSLCDSTRKHSLPYFRELLSK--LNSSPDCPPVSCVVSDGA  126

Query  461   MCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----DKLLEN  625
             M F +D   E  +P +LF T SA  F A+    + IE G  PL   S +     +  ++ 
Sbjct  127   MGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLKDASYLTNGYLETEIDW  186

Query  626   VEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIR  805
             + GM  + RL+D+PSF RTTD  D     ++  T RT +A+ +ILNTF D E   L  + 
Sbjct  187   IPGMRGI-RLKDIPSFIRTTDPDDIMLDFLVHETERTRKASAVILNTFHDFEHEVLDALS  245

Query  806   KHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFG  985
               +P +Y+IGPLH  +    + S  +      S+LW E+  C+ WLD +   SVVYV+FG
Sbjct  246   TLLPPIYSIGPLHLQINQIPADSELK---EIRSNLWTEEPECLEWLDSKEPNSVVYVNFG  302

Query  986   SMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVGWAPQ  1162
             S+TV+T  Q +EF  G+ NS + F W IRP+ V GD  + P E +E T+++  +  W PQ
Sbjct  303   SITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQ  362

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             E+VL H AVGGFLTHSGWNSTLES+C G+PMICWPF+A+QQ NSR     W  G++++  
Sbjct  363   EQVLSHSAVGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNSRYSEKEWGIGMEIERD  422

Query  1343  CDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
               R  +E +V++LME     E  K +    KLA +A + +GSS+  LD++V  +
Sbjct  423   VKRNYIEGLVRKLMEGDEGKEMRKKALEWKKLATEATSPNGSSFVGLDKMVNQV  476



>ref|XP_004299648.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Fragaria vesca 
subsp. vesca]
Length=488

 Score =   363 bits (933),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 203/483 (42%), Positives = 284/483 (59%), Gaps = 17/483 (4%)
 Frame = +2

Query  83    MDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRF  262
             M + +  H +  P+P QGH+N ML+LA+LL H    HVTF+NSE+ H+RLL     +   
Sbjct  7     MVETNKPHAVCIPYPAQGHINPMLKLAKLL-HHKGFHVTFVNSEYNHRRLLNSRGPN-AL  64

Query  263   SSYPNFYFRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTC  442
                P+F F+TI DGLP         +  L  S      P FR++L   + + +  PPV+C
Sbjct  65    DGLPSFQFKTIPDGLPPTDTNATQDIPSLCESTRKYCLPHFRKLLEEVNSEENS-PPVSC  123

Query  443   IIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-----  607
             +++DG+M F +D   EL +P +LF T SA  F A+     LIE G  PL   S +     
Sbjct  124   VVSDGVMSFTLDAAEELGVPEVLFWTTSACGFMAYVHYKHLIEKGYTPLKDASYLTNGYL  183

Query  608   DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTR-ANGLILNTFEDLEE  784
             D +++ + GM+ + RL+D+P+F RTTD +      V+  T R  + A+ +ILNTF+DLE 
Sbjct  184   DTVIDWIPGMKGI-RLKDIPTFIRTTDTNALMVDFVLHETERAAKKASAIILNTFDDLEH  242

Query  785   SALAQIRKHIP-NLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLK  961
               L      +P  +Y+IGPL   L      S  +      S+LW+E+  C+ WLD +   
Sbjct  243   DVLEAFAALLPPAVYSIGPLSLQLNQIPPGSELQ---TLKSNLWKEESECLEWLDSKDPD  299

Query  962   SVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKG  1138
             SVVYV+FGS+TV+T  Q +EF  G+ NS K FLW IRP+ V G   + PAE +E TR++ 
Sbjct  300   SVVYVNFGSITVMTETQLIEFAWGLANSKKTFLWVIRPDLVGGSSAVVPAEFVEETRERS  359

Query  1139  YMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWK  1318
              +  W PQEEVL HPAVGGFLTHSGWNSTLESIC G+PMICWPF+A+QQ N R     W 
Sbjct  360   MLATWCPQEEVLRHPAVGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRFCCKEWG  419

Query  1319  NGVDMKDTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVT-QHGSSYSNLDRLV  1492
              G++++    R  VE +V++LME     E  K +    +LA +A T   GSS+ NLD++V
Sbjct  420   IGMEIEGDPKRDYVEGLVRKLMEGEEGKEMKKKALEWKRLAMEAATGPKGSSFVNLDKMV  479

Query  1493  EDL  1501
               +
Sbjct  480   NQV  482



>ref|XP_010273031.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   363 bits (932),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 200/478 (42%), Positives = 274/478 (57%), Gaps = 21/478 (4%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             HV+  P+P QGH+N ML+LA+LL H    HVTF+N+E+ H+RL++           P F 
Sbjct  11    HVVCIPYPAQGHINPMLKLAKLL-HYKGFHVTFVNTEYNHRRLVKSRGPD-SVKGLPGFR  68

Query  284   FRTISDGLP-ADHPRTGDRVVDLFNSINAVTKPRFREMLSS-GSLQSSGRPPVTCIIADG  457
             F TI DGLP +D       +  L +S        FR +LS      SS  PPV+CI++DG
Sbjct  69    FETIPDGLPHSDDIEATQHIPSLCDSTRKTCLSPFRNLLSKLNDSSSSDTPPVSCIVSDG  128

Query  458   IMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNG-----ESDMDKLLE  622
             +M F +    E  IP +LF T SA  F ++   P LI  G  PL          +D  ++
Sbjct  129   VMSFTLTAAQECGIPEVLFWTTSACGFMSYVHYPHLIHRGLTPLKDINYLTNGYLDTTID  188

Query  623   NVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQI  802
              + G+   +RLRDLPSF RTTD  D     V     R  +A  +ILNTF+ LE   L  +
Sbjct  189   WIPGLVKDIRLRDLPSFLRTTDPDDIMLDFVKGEVQRAKKAEAIILNTFDALEHDVLNVL  248

Query  803   RKHIPNLYTIGPL---HAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVY  973
                 P +Y+IGPL   H  +      S G       S+LW+E   C+ WLD Q   SVVY
Sbjct  249   SFMFPRVYSIGPLQLLHNQIPENGLKSIG-------SNLWQEQPGCLDWLDSQKPNSVVY  301

Query  974   VSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRKKGYMVG  1150
             V+FGS+TV+T  Q +EF  G+ NS   FLW IRP+ V+GD  + P + I  TR++G +  
Sbjct  302   VNFGSITVMTPEQLVEFAWGLANSNXTFLWVIRPDLVVGDSALLPPKFITDTRERGLLAS  361

Query  1151  WAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVD  1330
             W PQE+VL HP++G FLTH+GWNST+ESIC G+PMICWPF+A+QQ N R V   W  G++
Sbjct  362   WCPQEQVLNHPSIGAFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYVCTEWGMGME  421

Query  1331  MKDTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
             +     R  VE +VK++ME  +  E  K +    K A +A  Q GSSYSNLD++++++
Sbjct  422   IDSNVKRDEVESLVKQIMEGEKGKEMKKRTLEWKKKAEEATYQDGSSYSNLDKMIKEV  479



>ref|XP_010060023.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW66547.1| hypothetical protein EUGRSUZ_F00343 [Eucalyptus grandis]
Length=486

 Score =   363 bits (932),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 197/484 (41%), Positives = 283/484 (58%), Gaps = 17/484 (4%)
 Frame = +2

Query  80    TMDQRSSSHVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLR  259
             ++D+    H +  P+P QGH+N ML LA+LL H    HVTF+N+E+ H RLLR       
Sbjct  3     SIDKIQKPHAVCIPYPAQGHINPMLNLAKLL-HHRGFHVTFVNTEYNHSRLLRSRGPS-S  60

Query  260   FSSYPNFYFRTISDGLP-ADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSS--GRP  430
                 P+F FRTI DGLP +D       +  L  S +    P FR++L   + +S+  G P
Sbjct  61    LDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTLGSP  120

Query  431   PVTCIIADGIMCFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESDM-  607
             PV+C+++DG+M F +D    + +P +LF T SA  F  +     LI+ G  PL   S + 
Sbjct  121   PVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLKDASYLT  180

Query  608   ----DKLLENVEGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFED  775
                 D +++ + GM N+ +LRDLPSF +TTD  D     V+  T R  RA+ ++ NTF+ 
Sbjct  181   NGYLDTIIDWIPGMRNI-QLRDLPSFIQTTDPDDLMIHFVLRETERAKRASAIVFNTFDR  239

Query  776   LEESALAQIRKHIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQP  955
             LE   L  ++   P++ T+GPLH             +     S+LW+ED  C+ WLD +P
Sbjct  240   LEHEVLDALKAMFPSICTLGPLHLLTEQLPDDDTKSI----GSNLWKEDLGCLEWLDSKP  295

Query  956   LKSVVYVSFGSMTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI-PAELIEGTRK  1132
               SVVYV+FGS+TV++  Q +EF  G+ NS + FLW IRP+ V+GD  I P+E    TR+
Sbjct  296   PGSVVYVNFGSITVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRE  355

Query  1133  KGYMVGWAPQEEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAV  1312
             +  +  W PQE VL HPAVGGFLTHSGWNST+ESI  G+P++CWPF+A+QQ N R     
Sbjct  356   RSLLASWCPQERVLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEE  415

Query  1313  WKNGVDMKDTCDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRL  1489
             W  G+++     R  VE+ V+ELME  R  E  + +    ++AR+A    GSSY NLD +
Sbjct  416   WGIGMEIDGDVKRDKVERQVRELMEGERGKEMKRKAMEWQQMAREATRPSGSSYLNLDEV  475

Query  1490  VEDL  1501
             ++ +
Sbjct  476   MDKV  479



>ref|XP_006351766.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Solanum tuberosum]
Length=489

 Score =   363 bits (932),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 198/474 (42%), Positives = 286/474 (60%), Gaps = 14/474 (3%)
 Frame = +2

Query  104   HVLIFPFPVQGHVNCMLRLAELLCHESSIHVTFLNSEFAHQRLLRYTDLHLRFSSYPNFY  283
             H +  PFP QGH+N ML+L+ LL H    H+TF+NSE+ H+RLL+        +++ +F 
Sbjct  14    HAVCIPFPSQGHINPMLKLSILL-HSKGFHITFVNSEYNHKRLLKSKTPFFLDNNFQDFI  72

Query  284   FRTISDGLPADHPRTGDRVVDLFNSINAVTKPRFREMLSSGSLQSSGRPPVTCIIADGIM  463
             F TI DGLP         +  L  S        FRE+L   +  SS  PPVTCII DGIM
Sbjct  73    FETIPDGLPLIDADVTQHIPSLCLSTKENCLAPFRELLIKINNNSSNVPPVTCIIFDGIM  132

Query  464   CFAIDVGNELRIPTILFRTFSASCFWAFFCVPKLIESGDLPLNGESD-----MDKLLENV  628
              FA+    E+ +P++ FRT +A  F     +P LIE G LPL  ESD     +D +++ +
Sbjct  133   TFALLAAQEIGVPSVSFRTTNACSFMCNKHLPLLIEKGILPLKDESDITNGYLDTVIDFI  192

Query  629   EGMENVLRLRDLPSFCRTTDLSDRGFLSVILATLRTTRANGLILNTFEDLEESALAQIRK  808
               M+N LRLR+ PS  RTT+++D+    ++  T R ++A+ +I +TF+ LE + L+ +  
Sbjct  193   PSMKN-LRLREFPSQIRTTNINDKMLNFIMGETERASKASAIIFHTFDALEFNVLSDLSL  251

Query  809   HIPNLYTIGPLHAHLRARVSSSRGELPWRSSSSLWEEDRSCMAWLDEQPLKSVVYVSFGS  988
               P LYTIGPL          S   L     ++LW+ED +C+ WL+ +  KSVVYV+FGS
Sbjct  252   ICPPLYTIGPLQLLTNQLQEKSLKFL----RANLWKEDENCVKWLNSKEEKSVVYVNFGS  307

Query  989   MTVLTRNQFLEFWHGIVNSGKAFLWAIRPNSVIGDDNI--PAELIEGTRKKGYMVGWAPQ  1162
             +TVLT++Q +EF  G+ NS K F W IR ++VIGDD+I  P+E IE T+++G +  W  Q
Sbjct  308   ITVLTKDQLMEFAWGLANSKKNFFWVIRSDAVIGDDSIILPSEFIEETKERGLISRWCCQ  367

Query  1163  EEVLVHPAVGGFLTHSGWNSTLESICEGLPMICWPFYADQQVNSRLVGAVWKNGVDMKDT  1342
             E+VL H ++G F TH GWNS +ESI  G+PMICWPF+ADQ +N R     W  G+++   
Sbjct  368   EQVLQHSSIGAFFTHCGWNSVMESIGSGVPMICWPFFADQHINCRYACDEWGVGMEIDKN  427

Query  1343  CDRITVEKMVKELMEVRR-DEFTKCSNRMAKLARKAVTQHGSSYSNLDRLVEDL  1501
               R  VEK+++E+M+  +  E  K ++    LA +A    GSS  NLD+LV+D+
Sbjct  428   VKRDEVEKIIREMMDGDKGKEVKKKASEWKILAEEATGIEGSSSLNLDKLVKDV  481



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4424773723216