BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25229_g2_i1 len=480 path=[395:0-133 529:134-342 4903:343-371
823:372-479]

Length=480
                                                                      Score     E

ref|XP_010061646.1|  PREDICTED: serine carboxypeptidase-like 2          145   7e-38   
ref|XP_010320198.1|  PREDICTED: serine carboxypeptidase-like 17         141   2e-36   
gb|EMS46782.1|  Serine carboxypeptidase-like 18                         137   1e-35   
ref|XP_010321497.1|  PREDICTED: serine carboxypeptidase-like 12         138   2e-35   
gb|KHG16860.1|  Serine carboxypeptidase-like 19                         136   2e-35   
ref|XP_006472316.1|  PREDICTED: serine carboxypeptidase-like 18-l...    138   2e-35   
gb|KDO81474.1|  hypothetical protein CISIN_1g012236mg                   138   2e-35   
gb|EMT02053.1|  Serine carboxypeptidase-like 18                         138   2e-35   
dbj|BAF99698.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    138   2e-35   Gentiana triflora
dbj|BAF99697.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    138   3e-35   Gentiana triflora
ref|XP_002510077.1|  serine carboxypeptidase, putative                  138   3e-35   Ricinus communis
dbj|BAO04182.1|  hypothetical protein                                   137   4e-35   
ref|XP_010108030.1|  Serine carboxypeptidase-like 3                     133   6e-35   
gb|KDO81472.1|  hypothetical protein CISIN_1g012205mg                   136   6e-35   
ref|XP_006433655.1|  hypothetical protein CICLE_v10001060mg             137   6e-35   
emb|CBI19380.3|  unnamed protein product                                137   8e-35   
ref|XP_007018463.1|  Serine carboxypeptidase-like 7, putative           135   9e-35   
ref|XP_006472322.1|  PREDICTED: serine carboxypeptidase-like 18-like    136   1e-34   
ref|XP_007018461.1|  Serine carboxypeptidase-like 7, putative           136   1e-34   
gb|KDO81471.1|  hypothetical protein CISIN_1g012205mg                   136   1e-34   
ref|XP_006472320.1|  PREDICTED: serine carboxypeptidase-like 18-l...    136   1e-34   
gb|KDO81468.1|  hypothetical protein CISIN_1g012276mg                   136   1e-34   
ref|XP_009768014.1|  PREDICTED: serine carboxypeptidase-like 17         135   2e-34   
ref|XP_010689038.1|  PREDICTED: uncharacterized mitochondrial pro...    134   2e-34   
ref|XP_003525944.2|  PREDICTED: serine carboxypeptidase-like 19-l...    135   2e-34   
ref|XP_009771129.1|  PREDICTED: serine carboxypeptidase-like 13 i...    135   2e-34   
ref|XP_002283413.1|  PREDICTED: serine carboxypeptidase-like 2          135   2e-34   Vitis vinifera
ref|XP_009771128.1|  PREDICTED: serine carboxypeptidase-like 13 i...    135   2e-34   
ref|XP_009600999.1|  PREDICTED: serine carboxypeptidase-like 7 is...    135   3e-34   
emb|CDP01267.1|  unnamed protein product                                135   3e-34   
ref|XP_006581277.1|  PREDICTED: serine carboxypeptidase-like 19-l...    135   3e-34   
ref|XP_006581276.1|  PREDICTED: serine carboxypeptidase-like 19-l...    135   3e-34   
gb|KHN45135.1|  Serine carboxypeptidase-like 19                         135   3e-34   
ref|XP_006433653.1|  hypothetical protein CICLE_v10001059mg             134   4e-34   
ref|XP_003579296.2|  PREDICTED: serine carboxypeptidase-like 2          135   4e-34   
ref|XP_006433654.1|  hypothetical protein CICLE_v10001055mg             134   4e-34   
ref|XP_009761854.1|  PREDICTED: serine carboxypeptidase-like 18         134   5e-34   
ref|XP_002510076.1|  serine carboxypeptidase, putative                  134   5e-34   Ricinus communis
ref|XP_006345611.1|  PREDICTED: serine carboxypeptidase-like 19-like    133   8e-34   
dbj|BAF99694.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          134   1e-33   Clitoria ternatea
dbj|BAO04189.1|  hypothetical protein                                   130   1e-33   
gb|KHN45449.1|  Serine carboxypeptidase-like 11                         133   1e-33   
ref|XP_007134008.1|  hypothetical protein PHAVU_010G011400g             133   1e-33   
ref|XP_009601001.1|  PREDICTED: serine carboxypeptidase-like 7 is...    133   1e-33   
ref|XP_008352130.1|  PREDICTED: serine carboxypeptidase-like 18         130   1e-33   
ref|XP_003604927.1|  Serine carboxypeptidase                            134   1e-33   
ref|XP_003520964.1|  PREDICTED: serine carboxypeptidase-like 11-like    133   2e-33   
ref|XP_003573757.1|  PREDICTED: serine carboxypeptidase-like 13         133   2e-33   
gb|KDP41601.1|  hypothetical protein JCGZ_16008                         133   2e-33   
ref|XP_004983497.1|  PREDICTED: serine carboxypeptidase-like 18-like    133   2e-33   
gb|KEH36682.1|  1-O-acylglucose:anthocyanin acyltransferase             131   2e-33   
ref|XP_007047573.1|  Serine carboxypeptidase-like 2, putative iso...    132   2e-33   
emb|CDY01415.1|  BnaA07g11880D                                          126   3e-33   
ref|XP_006662125.1|  PREDICTED: serine carboxypeptidase-like 18-like    132   3e-33   
ref|XP_010277006.1|  PREDICTED: serine carboxypeptidase-like 1 is...    132   3e-33   
ref|XP_010277008.1|  PREDICTED: serine carboxypeptidase-like 18 i...    132   3e-33   
gb|KDP41600.1|  hypothetical protein JCGZ_16007                         132   4e-33   
dbj|BAO04183.1|  putative acyl-glucose-dependent anthocyanin acyl...    131   5e-33   
ref|XP_009365383.1|  PREDICTED: serine carboxypeptidase-like 13         131   5e-33   
ref|XP_006345612.1|  PREDICTED: serine carboxypeptidase-like 13-like    130   5e-33   
ref|XP_010231763.1|  PREDICTED: serine carboxypeptidase-like 13 i...    131   6e-33   
ref|XP_009764359.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    131   6e-33   
ref|XP_010231762.1|  PREDICTED: serine carboxypeptidase-like 19 i...    131   6e-33   
ref|XP_003566614.1|  PREDICTED: serine carboxypeptidase-like 13 i...    131   6e-33   
ref|XP_006343160.1|  PREDICTED: serine carboxypeptidase-like 18-l...    131   7e-33   
ref|XP_003593861.1|  Serine carboxypeptidase family protein             131   7e-33   
ref|XP_004252000.2|  PREDICTED: serine carboxypeptidase-like 7          131   8e-33   
ref|NP_001064014.1|  Os10g0101100                                       130   8e-33   Oryza sativa Japonica Group [Japonica rice]
gb|AAL73563.1|AC079632_7  Putative serine carboxypeptidase              130   9e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008337031.1|  PREDICTED: serine carboxypeptidase-like 18         130   9e-33   
ref|XP_006594522.1|  PREDICTED: serine carboxypeptidase-like 12-like    130   1e-32   
emb|CDP21038.1|  unnamed protein product                                130   1e-32   
ref|XP_010936155.1|  PREDICTED: serine carboxypeptidase-like 18         130   1e-32   
dbj|BAF99695.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          130   1e-32   Clitoria ternatea
ref|XP_010936148.1|  PREDICTED: serine carboxypeptidase-like 18 i...    129   1e-32   
ref|XP_008644916.1|  PREDICTED: serine carboxypeptidase-like 18 i...    130   1e-32   
ref|XP_007136774.1|  hypothetical protein PHAVU_009G072900g             130   2e-32   
ref|XP_011006039.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    128   2e-32   
ref|XP_010936156.1|  PREDICTED: serine carboxypeptidase-like 18         129   2e-32   
ref|XP_004288266.1|  PREDICTED: serine carboxypeptidase-like 18-like    130   2e-32   
ref|XP_009626153.1|  PREDICTED: serine carboxypeptidase-like 13         130   2e-32   
ref|XP_003604935.1|  Serine carboxypeptidase                            125   2e-32   
ref|XP_003602921.1|  Serine carboxypeptidase-like protein               127   2e-32   
tpg|DAA39924.1|  TPA: hypothetical protein ZEAMMB73_827985              122   2e-32   
ref|XP_010936147.1|  PREDICTED: serine carboxypeptidase-like 18 i...    128   3e-32   
ref|XP_010936154.1|  PREDICTED: serine carboxypeptidase-like 18         129   3e-32   
ref|XP_010936145.1|  PREDICTED: serine carboxypeptidase-like 18 i...    129   3e-32   
ref|XP_010936146.1|  PREDICTED: serine carboxypeptidase-like 18 i...    129   3e-32   
ref|XP_003593863.1|  Serine carboxypeptidase                            123   3e-32   
ref|XP_006597032.1|  PREDICTED: uncharacterized protein LOC100794...    129   4e-32   
ref|NP_001242803.1|  uncharacterized protein LOC100794342               129   4e-32   
ref|XP_006376415.1|  serine carboxypeptidase S10 family protein         128   5e-32   
ref|XP_006356867.1|  PREDICTED: serine carboxypeptidase-like 19-like    131   5e-32   
ref|XP_003604929.1|  Serine carboxypeptidase                            131   5e-32   
gb|KHN06942.1|  Serine carboxypeptidase-like 19                         129   5e-32   
ref|XP_006356866.1|  PREDICTED: uncharacterized protein LOC102592829    131   6e-32   
ref|XP_010320340.1|  PREDICTED: serine carboxypeptidase-like 13 i...    128   9e-32   
ref|XP_004292764.1|  PREDICTED: serine carboxypeptidase-like 18-like    128   9e-32   
gb|AFK37593.1|  unknown                                                 124   9e-32   
ref|XP_010321496.1|  PREDICTED: serine carboxypeptidase-like 13 i...    128   9e-32   
ref|XP_010321495.1|  PREDICTED: serine carboxypeptidase-like 13 i...    128   1e-31   
gb|KCW54736.1|  hypothetical protein EUGRSUZ_I00690                     128   1e-31   
ref|XP_004486284.1|  PREDICTED: serine carboxypeptidase-like 12-like    128   1e-31   
ref|XP_008790304.1|  PREDICTED: uncharacterized protein LOC103707550    130   1e-31   
ref|XP_009393004.1|  PREDICTED: serine carboxypeptidase-like 2          127   1e-31   
ref|XP_007159376.1|  hypothetical protein PHAVU_002G233100g             127   2e-31   
ref|XP_009384628.1|  PREDICTED: serine carboxypeptidase-like 18         127   2e-31   
gb|AES73172.2|  1-O-acylglucose:anthocyanin acyltransferase             127   2e-31   
ref|XP_006356850.1|  PREDICTED: serine carboxypeptidase-like 18-like    127   2e-31   
ref|XP_003604931.1|  Serine carboxypeptidase                            127   3e-31   
ref|XP_007138067.1|  hypothetical protein PHAVU_009G177800g             127   3e-31   
ref|XP_009382032.1|  PREDICTED: serine carboxypeptidase-like 7          126   3e-31   
gb|KHN47358.1|  ABC transporter B family member 9                       130   3e-31   
ref|XP_009103431.1|  PREDICTED: serine carboxypeptidase-like 10         126   3e-31   
ref|XP_010936152.1|  PREDICTED: serine carboxypeptidase-like 18 i...    126   4e-31   
ref|XP_010936150.1|  PREDICTED: serine carboxypeptidase-like 18 i...    126   4e-31   
ref|XP_010939016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    126   5e-31   
gb|KEH29043.1|  1-O-acylglucose:anthocyanin acyltransferase             125   5e-31   
ref|XP_010030506.1|  PREDICTED: serine carboxypeptidase-like 7          126   5e-31   
ref|XP_003593858.1|  Serine carboxypeptidase-like protein               125   5e-31   
ref|XP_008790306.1|  PREDICTED: uncharacterized protein LOC103707552    129   5e-31   
ref|NP_001189581.1|  serine carboxypeptidase-like 12                    122   6e-31   
ref|XP_006354895.1|  PREDICTED: serine carboxypeptidase-like 18-like    125   6e-31   
ref|XP_003571685.1|  PREDICTED: serine carboxypeptidase-like 17         125   6e-31   
ref|XP_009612206.1|  PREDICTED: serine carboxypeptidase-like 18 i...    125   7e-31   
gb|KEH29044.1|  1-O-acylglucose:anthocyanin acyltransferase             125   7e-31   
ref|XP_010314600.1|  PREDICTED: serine carboxypeptidase-like 11         125   7e-31   
ref|XP_010939013.1|  PREDICTED: serine carboxypeptidase-like 18 i...    125   8e-31   
ref|XP_010939015.1|  PREDICTED: serine carboxypeptidase-like 18 i...    125   8e-31   
ref|XP_004238067.1|  PREDICTED: uncharacterized protein LOC101252078    128   9e-31   
tpg|DAA39921.1|  TPA: Serine carboxypeptidase 1                         125   9e-31   
ref|XP_003593859.1|  Serine carboxypeptidase-like protein               125   1e-30   
ref|XP_009612197.1|  PREDICTED: serine carboxypeptidase-like 11 i...    125   1e-30   
ref|XP_002460078.1|  hypothetical protein SORBIDRAFT_02g022430          125   1e-30   Sorghum bicolor [broomcorn]
emb|CDY11114.1|  BnaC06g23660D                                          124   1e-30   
ref|XP_003604928.1|  Serine carboxypeptidase                            124   2e-30   
ref|XP_006404766.1|  hypothetical protein EUTSA_v10000651mg             124   2e-30   
gb|AAK95312.1|AF410326_1  T20K9.19/T20K9.19                             121   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855958.1|  hypothetical protein AMTR_s00037p00227730          124   2e-30   
emb|CDP01266.1|  unnamed protein product                                124   3e-30   
ref|XP_006342727.1|  PREDICTED: uncharacterized protein LOC102585123    126   3e-30   
ref|XP_010939017.1|  PREDICTED: serine carboxypeptidase-like 12 i...    124   3e-30   
ref|XP_009131550.1|  PREDICTED: serine carboxypeptidase-like 7 is...    123   3e-30   
ref|XP_009131551.1|  PREDICTED: serine carboxypeptidase-like 7 is...    123   3e-30   
ref|XP_004238557.1|  PREDICTED: uncharacterized protein LOC101252581    126   4e-30   
gb|EPS63835.1|  hypothetical protein M569_10950                         119   4e-30   
ref|XP_008778119.1|  PREDICTED: serine carboxypeptidase-like 18         121   4e-30   
ref|NP_179876.1|  serine carboxypeptidase-like 12                       123   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151152.1|  serine carboxypeptidase 1 precursor                123   4e-30   Zea mays [maize]
emb|CDX70702.1|  BnaC03g07860D                                          123   5e-30   
ref|XP_010515304.1|  PREDICTED: serine carboxypeptidase-like 7          123   5e-30   
ref|XP_010426467.1|  PREDICTED: serine carboxypeptidase-like 7          123   5e-30   
ref|XP_010503611.1|  PREDICTED: serine carboxypeptidase-like 7          122   5e-30   
gb|ABR16352.1|  unknown                                                 123   5e-30   Picea sitchensis
ref|XP_010237149.1|  PREDICTED: serine carboxypeptidase-like 18         121   6e-30   
ref|XP_006663407.1|  PREDICTED: serine carboxypeptidase-like 9-like     119   6e-30   
ref|XP_008790305.1|  PREDICTED: serine carboxypeptidase-like 18         125   6e-30   
ref|NP_179880.1|  serine carboxypeptidase-like 11                       122   6e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB03129.1|  serine carboxypeptidase                                122   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AFK49380.1|  unknown                                                 122   6e-30   
gb|KFK44962.1|  hypothetical protein AALP_AA1G326200                    122   7e-30   
ref|XP_006342726.1|  PREDICTED: serine carboxypeptidase-like 11-like    122   7e-30   
ref|XP_009139929.1|  PREDICTED: serine carboxypeptidase-like 7 is...    120   8e-30   
ref|XP_010429237.1|  PREDICTED: serine carboxypeptidase-like 12 i...    119   8e-30   
ref|XP_009140440.1|  PREDICTED: serine carboxypeptidase-like 13 i...    122   1e-29   
ref|NP_187828.1|  serine carboxypeptidase-like 17                       122   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416123.1|  PREDICTED: serine carboxypeptidase-like 2          122   1e-29   
ref|XP_010472297.1|  PREDICTED: serine carboxypeptidase-like 11 i...    122   1e-29   
gb|AFW69058.1|  hypothetical protein ZEAMMB73_415108                    122   1e-29   
ref|XP_010472296.1|  PREDICTED: serine carboxypeptidase-like 11 i...    121   1e-29   
gb|EEE60599.1|  hypothetical protein OsJ_13996                          118   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010429236.1|  PREDICTED: serine carboxypeptidase-like 12 i...    120   2e-29   
ref|XP_003604933.1|  Serine carboxypeptidase                            121   2e-29   
ref|XP_009139973.1|  PREDICTED: serine carboxypeptidase-like 13 i...    121   2e-29   
gb|AES87130.2|  1-O-acylglucose:anthocyanin acyltransferase             121   2e-29   
ref|XP_010429231.1|  PREDICTED: serine carboxypeptidase-like 11 i...    121   2e-29   
ref|XP_009599400.1|  PREDICTED: putative serine carboxypeptidase-...    114   2e-29   
ref|XP_009139971.1|  PREDICTED: serine carboxypeptidase-like 13 i...    121   2e-29   
gb|KFK39469.1|  hypothetical protein AALP_AA3G248300                    121   2e-29   
ref|XP_010464718.1|  PREDICTED: serine carboxypeptidase-like 7 is...    121   2e-29   
ref|XP_010468096.1|  PREDICTED: serine carboxypeptidase-like 7          117   2e-29   
ref|XP_010429230.1|  PREDICTED: serine carboxypeptidase-like 11 i...    121   2e-29   
ref|XP_010428248.1|  PREDICTED: serine carboxypeptidase-like 2 is...    121   2e-29   
ref|XP_010464717.1|  PREDICTED: serine carboxypeptidase-like 7 is...    121   2e-29   
ref|NP_001077946.1|  serine carboxypeptidase-like 13                    121   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39468.1|  hypothetical protein AALP_AA3G248300                    121   2e-29   
ref|NP_179881.3|  serine carboxypeptidase-like 13                       120   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464719.1|  PREDICTED: serine carboxypeptidase-like 7 is...    120   3e-29   
emb|CDX72978.1|  BnaC06g34260D                                          120   3e-29   
ref|XP_008452663.1|  PREDICTED: serine carboxypeptidase-like 13         121   3e-29   
emb|CAN83341.1|  hypothetical protein VITISV_021484                     121   3e-29   Vitis vinifera
ref|XP_006390568.1|  hypothetical protein EUTSA_v10018572mg             120   3e-29   
gb|KFK38434.1|  hypothetical protein AALP_AA3G112800                    120   3e-29   
ref|XP_009139928.1|  PREDICTED: serine carboxypeptidase-like 7 is...    120   3e-29   
gb|KEH29042.1|  1-O-acylglucose:anthocyanin acyltransferase             123   3e-29   
ref|XP_009139927.1|  PREDICTED: serine carboxypeptidase-like 7 is...    120   3e-29   
ref|XP_010428244.1|  PREDICTED: serine carboxypeptidase-like 2 is...    120   3e-29   
ref|XP_009105991.1|  PREDICTED: serine carboxypeptidase-like 2 is...    120   3e-29   
emb|CDY67053.1|  BnaA04g27850D                                          119   3e-29   
ref|XP_010533332.1|  PREDICTED: serine carboxypeptidase-like 18         118   4e-29   
ref|XP_003577669.1|  PREDICTED: serine carboxypeptidase-like 19 i...    120   4e-29   
emb|CDY30277.1|  BnaC04g31880D                                          120   4e-29   
ref|XP_010429235.1|  PREDICTED: serine carboxypeptidase-like 12 i...    120   4e-29   
ref|XP_002446557.1|  hypothetical protein SORBIDRAFT_06g018070          120   4e-29   Sorghum bicolor [broomcorn]
gb|EEC68118.1|  hypothetical protein OsI_36022                          120   4e-29   Oryza sativa Indica Group [Indian rice]
gb|AES87126.2|  1-O-acylglucose:anthocyanin acyltransferase             123   4e-29   
ref|XP_006376417.1|  serine carboxypeptidase S10 family protein         120   5e-29   
ref|XP_010429234.1|  PREDICTED: serine carboxypeptidase-like 12 i...    120   5e-29   
ref|NP_001176511.1|  Os11g0431700                                       113   5e-29   
ref|NP_001149348.1|  serine carboxypeptidase 1 precursor                120   5e-29   Zea mays [maize]
ref|XP_010464720.1|  PREDICTED: serine carboxypeptidase-like 7          120   5e-29   
ref|XP_006415268.1|  hypothetical protein EUTSA_v10007570mg             120   5e-29   
ref|XP_010314652.1|  PREDICTED: serine carboxypeptidase-like 11         122   6e-29   
emb|CDP20999.1|  unnamed protein product                                119   6e-29   
ref|XP_010471386.1|  PREDICTED: serine carboxypeptidase-like 2          120   6e-29   
ref|XP_006403281.1|  hypothetical protein EUTSA_v10003211mg             120   6e-29   
ref|XP_007018462.1|  Serine carboxypeptidase-like 19, putative          120   6e-29   
ref|XP_009784017.1|  PREDICTED: serine carboxypeptidase-like 7 is...    120   6e-29   
gb|KFK38432.1|  hypothetical protein AALP_AA3G112600                    120   7e-29   
gb|AES87127.2|  1-O-acylglucose:anthocyanin acyltransferase             120   7e-29   
emb|CDY49647.1|  BnaC09g41250D                                          119   7e-29   
emb|CDX96466.1|  BnaA07g30770D                                          119   7e-29   
ref|XP_009784016.1|  PREDICTED: serine carboxypeptidase-like 11 i...    119   8e-29   
emb|CDY53115.1|  BnaCnng24430D                                          119   8e-29   
ref|NP_001030669.1|  serine carboxypeptidase-like 7                     119   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001137115.1|  serine carboxypeptidase 1 precursor                119   8e-29   Zea mays [maize]
ref|NP_187656.1|  serine carboxypeptidase-like 7                        119   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179884.1|  serine carboxypeptidase-like 9                        119   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32094.1|  hypothetical protein JCGZ_12555                         119   9e-29   
ref|XP_008661499.1|  PREDICTED: uncharacterized protein LOC100216...    119   9e-29   
ref|XP_006299183.1|  hypothetical protein CARUB_v10015328mg             119   9e-29   
emb|CDM81579.1|  unnamed protein product                                122   9e-29   
gb|ACG36102.1|  serine carboxypeptidase 1 precursor                     119   9e-29   Zea mays [maize]
ref|XP_010238599.1|  PREDICTED: serine carboxypeptidase-like 3          119   1e-28   
ref|XP_008661498.1|  PREDICTED: uncharacterized protein LOC100216...    119   1e-28   
ref|XP_009126131.1|  PREDICTED: serine carboxypeptidase-like 3 is...    118   1e-28   
ref|XP_009126133.1|  PREDICTED: serine carboxypeptidase-like 3 is...    118   1e-28   
ref|XP_009133996.1|  PREDICTED: serine carboxypeptidase-like 10 i...    118   1e-28   
gb|KHG24307.1|  Serine carboxypeptidase-like 18                         119   1e-28   
emb|CDP17360.1|  unnamed protein product                                119   1e-28   
ref|XP_010320343.1|  PREDICTED: serine carboxypeptidase-like 10 i...    119   1e-28   
ref|XP_002882669.1|  hypothetical protein ARALYDRAFT_478377             119   1e-28   
ref|XP_010486655.1|  PREDICTED: serine carboxypeptidase-like 7 is...    119   1e-28   
ref|XP_010320344.1|  PREDICTED: serine carboxypeptidase-like 10 i...    118   1e-28   
ref|XP_009388678.1|  PREDICTED: serine carboxypeptidase-like 18         119   1e-28   
ref|XP_011006024.1|  PREDICTED: serine carboxypeptidase-like 3 is...    119   2e-28   
ref|XP_010647903.1|  PREDICTED: serine carboxypeptidase-like 13         119   2e-28   
ref|XP_010484310.1|  PREDICTED: serine carboxypeptidase-like 7          118   2e-28   
ref|XP_010486654.1|  PREDICTED: serine carboxypeptidase-like 7 is...    118   2e-28   
gb|EMT21721.1|  Serine carboxypeptidase-like 17                         119   2e-28   
ref|NP_973517.1|  serine carboxypeptidase-like 9                        118   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663397.1|  PREDICTED: serine carboxypeptidase-like 18-like    119   2e-28   
ref|XP_010320342.1|  PREDICTED: serine carboxypeptidase-like 10 i...    118   2e-28   
gb|KDP44525.1|  hypothetical protein JCGZ_16358                         115   2e-28   
ref|XP_006294239.1|  hypothetical protein CARUB_v10023237mg             118   2e-28   
ref|XP_010499905.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    118   2e-28   
ref|XP_009126130.1|  PREDICTED: serine carboxypeptidase-like 12 i...    118   2e-28   
ref|XP_006407566.1|  hypothetical protein EUTSA_v10020743mg             118   2e-28   
ref|XP_002878647.1|  hypothetical protein ARALYDRAFT_900755             114   2e-28   
ref|XP_009120828.1|  PREDICTED: serine carboxypeptidase-like 15 i...    118   2e-28   
ref|XP_010555479.1|  PREDICTED: serine carboxypeptidase-like 7          118   2e-28   
ref|XP_003577668.1|  PREDICTED: serine carboxypeptidase-like 19         118   2e-28   
ref|XP_006663388.1|  PREDICTED: serine carboxypeptidase-like 18-like    118   2e-28   
prf||1314177B  CPase I B                                                113   2e-28
ref|XP_009120822.1|  PREDICTED: serine carboxypeptidase-like 15 i...    118   2e-28   
ref|XP_010486651.1|  PREDICTED: serine carboxypeptidase-like 7 is...    118   2e-28   
ref|XP_004956082.1|  PREDICTED: serine carboxypeptidase-like 19-like    118   2e-28   
ref|XP_010486652.1|  PREDICTED: serine carboxypeptidase-like 7 is...    118   3e-28   
ref|XP_009133994.1|  PREDICTED: serine carboxypeptidase-like 10 i...    118   3e-28   
ref|XP_006294243.1|  hypothetical protein CARUB_v10023242mg             118   3e-28   
gb|KFK38433.1|  hypothetical protein AALP_AA3G112700                    117   3e-28   
ref|XP_010106919.1|  Serine carboxypeptidase-like 18                    118   3e-28   
ref|NP_565545.1|  putative serine carboxypeptidase-like 52              114   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415429.1|  hypothetical protein EUTSA_v10007675mg             118   3e-28   
ref|XP_004956083.1|  PREDICTED: serine carboxypeptidase-like 19-like    118   3e-28   
ref|XP_009146839.1|  PREDICTED: serine carboxypeptidase-like 7 is...    117   3e-28   
ref|XP_010556472.1|  PREDICTED: serine carboxypeptidase-like 18 i...    118   3e-28   
gb|AAM14928.1|  putative serine carboxypeptidase I                      114   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556473.1|  PREDICTED: serine carboxypeptidase-like 18 i...    118   3e-28   
ref|XP_008452657.1|  PREDICTED: serine carboxypeptidase-like 13 i...    117   3e-28   
ref|XP_006296360.1|  hypothetical protein CARUB_v10025532mg             117   3e-28   
ref|XP_008452655.1|  PREDICTED: serine carboxypeptidase-like 13 i...    117   3e-28   
ref|XP_009135217.1|  PREDICTED: serine carboxypeptidase-like 14         117   4e-28   
ref|XP_003604930.1|  Serine carboxypeptidase family protein             120   4e-28   
ref|XP_008350580.1|  PREDICTED: serine carboxypeptidase-like 20         111   4e-28   
ref|NP_001052165.1|  Os04g0176400                                       117   4e-28   
ref|XP_006415267.1|  hypothetical protein EUTSA_v10007571mg             117   4e-28   
sp|Q9C7Z9.2|SCP18_ARATH  RecName: Full=Serine carboxypeptidase-li...    117   4e-28   
gb|EAY93240.1|  hypothetical protein OsI_15047                          117   4e-28   
ref|XP_002525293.1|  serine carboxypeptidase, putative                  119   4e-28   
gb|EMT09764.1|  hypothetical protein F775_42793                         115   5e-28   
emb|CDX85493.1|  BnaA02g03200D                                          117   5e-28   
ref|XP_006297708.1|  hypothetical protein CARUB_v10013737mg             117   5e-28   
ref|XP_006297701.1|  hypothetical protein CARUB_v10013730mg             117   5e-28   
emb|CBI22421.3|  unnamed protein product                                118   5e-28   
ref|XP_002459781.1|  hypothetical protein SORBIDRAFT_02g010510          117   5e-28   
ref|XP_010556471.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    117   5e-28   
ref|XP_006296372.1|  hypothetical protein CARUB_v10025545mg             117   6e-28   
ref|XP_009146838.1|  PREDICTED: serine carboxypeptidase-like 7 is...    117   6e-28   
emb|CDP06916.1|  unnamed protein product                                114   6e-28   
emb|CDY68040.1|  BnaAnng25990D                                          117   6e-28   
gb|ABA95037.1|  Serine carboxypeptidase family protein                  117   6e-28   
emb|CDX77573.1|  BnaA07g07110D                                          117   7e-28   
ref|XP_010486653.1|  PREDICTED: serine carboxypeptidase-like 7 is...    116   7e-28   
ref|NP_001067796.1|  Os11g0432900                                       117   8e-28   
ref|XP_004163543.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    117   8e-28   
tpg|DAA60427.1|  TPA: hypothetical protein ZEAMMB73_620256              115   9e-28   
ref|NP_179883.1|  sinapoylglucose:anthocyanin sinapoyltransferase       116   9e-28   
ref|NP_177473.1|  serine carboxypeptidase-like 2                        116   9e-28   
emb|CDY38096.1|  BnaC02g06770D                                          117   9e-28   
ref|XP_006301868.1|  hypothetical protein CARUB_v10022339mg             116   9e-28   
ref|XP_009115052.1|  PREDICTED: serine carboxypeptidase-like 14         116   1e-27   
ref|XP_010509547.1|  PREDICTED: serine carboxypeptidase-like 9 is...    116   1e-27   
emb|CDY02322.1|  BnaA09g25800D                                          116   1e-27   
ref|XP_002878651.1|  hypothetical protein ARALYDRAFT_900758             116   1e-27   
ref|XP_004960851.1|  PREDICTED: serine carboxypeptidase-like 19-like    116   1e-27   
ref|XP_010472300.1|  PREDICTED: serine carboxypeptidase-like 9 is...    116   1e-27   
ref|XP_004975754.1|  PREDICTED: serine carboxypeptidase-like 7-like     116   1e-27   
emb|CDY59210.1|  BnaA09g54030D                                          116   1e-27   
ref|XP_010461188.1|  PREDICTED: serine carboxypeptidase-like 18         116   1e-27   
ref|XP_006295774.1|  hypothetical protein CARUB_v10024896mg             116   1e-27   
ref|XP_011100016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    115   1e-27   
ref|XP_010429241.1|  PREDICTED: serine carboxypeptidase-like 10 i...    115   1e-27   
gb|ABG22468.1|  Serine carboxypeptidase family protein, expressed       116   1e-27   
gb|ACN30985.1|  unknown                                                 116   1e-27   
ref|XP_006401830.1|  hypothetical protein EUTSA_v10015511mg             115   2e-27   
emb|CDX69437.1|  BnaA10g17860D                                          115   2e-27   
ref|XP_003569208.1|  PREDICTED: serine carboxypeptidase-like 18         116   2e-27   
emb|CDY00943.1|  BnaC05g42570D                                          115   2e-27   
ref|NP_198467.2|  serine carboxypeptidase-like 1                        115   2e-27   
ref|XP_011100015.1|  PREDICTED: serine carboxypeptidase-like 7 is...    115   2e-27   
ref|NP_001154529.1|  sinapoylglucose:malate sinapoyltransferase         114   2e-27   
ref|XP_009121469.1|  PREDICTED: serine carboxypeptidase-like 7          115   2e-27   
dbj|BAJ87293.1|  predicted protein                                      110   2e-27   
gb|AAX92990.1|  Serine carboxypeptidase                                 115   2e-27   
ref|XP_006418601.1|  hypothetical protein EUTSA_v10002783mg             115   2e-27   
ref|XP_006399445.1|  hypothetical protein EUTSA_v10015495mg             115   2e-27   
gb|EMS68839.1|  Serine carboxypeptidase-like 9                          114   2e-27   
ref|XP_010509542.1|  PREDICTED: serine carboxypeptidase-like 9 is...    115   2e-27   
ref|XP_010509543.1|  PREDICTED: serine carboxypeptidase-like 9 is...    115   2e-27   
emb|CDY09545.1|  BnaC05g23740D                                          115   2e-27   
emb|CDY22581.1|  BnaC05g24190D                                          115   2e-27   
gb|EMT10407.1|  Serine carboxypeptidase-like 19                         116   3e-27   
ref|XP_010235061.1|  PREDICTED: serine carboxypeptidase-like 10         115   3e-27   
emb|CDY08603.1|  BnaA05g28390D                                          115   3e-27   
ref|XP_010429240.1|  PREDICTED: serine carboxypeptidase-like 10 i...    115   3e-27   
ref|XP_010429239.1|  PREDICTED: serine carboxypeptidase-like 10 i...    115   3e-27   
sp|Q9CAU2.2|SCP5_ARATH  RecName: Full=Serine carboxypeptidase-lik...    115   3e-27   
ref|XP_010556479.1|  PREDICTED: serine carboxypeptidase-like 19         115   3e-27   
ref|XP_003572138.1|  PREDICTED: serine carboxypeptidase-like 10         115   3e-27   
emb|CDY52617.1|  BnaCnng22960D                                          117   3e-27   
ref|XP_002459780.1|  hypothetical protein SORBIDRAFT_02g010500          115   3e-27   
gb|ACN25790.1|  unknown                                                 115   3e-27   
emb|CDX78700.1|  BnaA03g06120D                                          115   3e-27   
emb|CDP06925.1|  unnamed protein product                                115   3e-27   
ref|XP_010464978.1|  PREDICTED: serine carboxypeptidase-like 14         115   3e-27   
ref|XP_006415270.1|  hypothetical protein EUTSA_v10009366mg             115   3e-27   
gb|AAQ91191.1|  1-O-sinapoylglucose:choline sinapoyltransferase         115   3e-27   
gb|ABG22467.1|  Serine carboxypeptidase family protein, expressed       115   4e-27   
emb|CAM91988.1|  sinapoylglucose:choline sinapoyltransferase            115   4e-27   
gb|EAZ21010.1|  hypothetical protein OsJ_36660                          115   4e-27   
ref|XP_009102688.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    114   4e-27   
gb|EMS49740.1|  Serine carboxypeptidase-like 19                         115   4e-27   
ref|XP_009125363.1|  PREDICTED: serine carboxypeptidase-like 19         115   4e-27   
emb|CAM91989.1|  sinapoylglucose:choline sinapoyltransferase            115   4e-27   
ref|XP_003560245.1|  PREDICTED: serine carboxypeptidase-like 18         115   4e-27   
ref|NP_001149249.1|  serine carboxypeptidase 1 precursor                115   4e-27   
gb|ACF84666.1|  unknown                                                 115   4e-27   
ref|XP_006300201.1|  hypothetical protein CARUB_v10016437mg             115   4e-27   
ref|XP_006404767.1|  hypothetical protein EUTSA_v10000306mg             112   4e-27   
ref|NP_177470.4|  serine carboxypeptidase-like 6                        114   4e-27   
ref|NP_565546.3|  sinapoylglucose:malate sinapoyltransferase            114   4e-27   
ref|NP_850034.1|  sinapoylglucose:malate sinapoyltransferase            114   4e-27   
emb|CDX76889.1|  BnaC08g34750D                                          114   4e-27   
ref|XP_010320338.1|  PREDICTED: serine carboxypeptidase-like 17 i...    114   4e-27   
emb|CDY21472.1|  BnaC03g27250D                                          114   5e-27   
ref|XP_006294237.1|  hypothetical protein CARUB_v10023234mg             114   5e-27   
ref|XP_008452662.1|  PREDICTED: serine carboxypeptidase-like 13         114   5e-27   
ref|XP_006415266.1|  hypothetical protein EUTSA_v10007559mg             114   5e-27   
gb|AFK41624.1|  unknown                                                 107   5e-27   
gb|AAG52139.1|AC010556_21  putative serine carboxypeptidase; 1519...    114   5e-27   
ref|NP_177471.1|  serine carboxypeptidase-like 3                        114   5e-27   
ref|XP_003576949.1|  PREDICTED: serine carboxypeptidase-like 18 i...    114   5e-27   
ref|XP_002443031.1|  hypothetical protein SORBIDRAFT_08g006610          110   5e-27   
ref|XP_009135216.1|  PREDICTED: serine carboxypeptidase-like 15         114   6e-27   
ref|XP_006376370.1|  hypothetical protein POPTR_0013s12450g             110   6e-27   
ref|XP_010320337.1|  PREDICTED: serine carboxypeptidase-like 13 i...    114   6e-27   
gb|EAZ18289.1|  hypothetical protein OsJ_33827                          114   6e-27   
ref|XP_010320339.1|  PREDICTED: serine carboxypeptidase-like 10 i...    114   7e-27   
ref|NP_177472.1|  serine carboxypeptidase-like 5                        114   7e-27   
gb|EEE52034.1|  hypothetical protein OsJ_33758                          110   7e-27   
gb|KFK44963.1|  hypothetical protein AALP_AA1G326300                    114   7e-27   
ref|XP_008669340.1|  PREDICTED: serine carboxypeptidase-like 7          114   8e-27   
ref|NP_001067860.1|  Os11g0460800                                       114   8e-27   
gb|KCW58998.1|  hypothetical protein EUGRSUZ_H01623                     107   8e-27   
gb|KFK25883.1|  hypothetical protein AALP_AA8G174700                    114   8e-27   
ref|XP_006662865.1|  PREDICTED: serine carboxypeptidase-like 19-like    114   9e-27   
gb|EMT14291.1|  Serine carboxypeptidase-like 19                         112   9e-27   
emb|CAN82419.1|  hypothetical protein VITISV_044004                     113   9e-27   
ref|XP_002884894.1|  hypothetical protein ARALYDRAFT_897434             114   9e-27   
ref|XP_006407354.1|  hypothetical protein EUTSA_v10022069mg             113   1e-26   
ref|XP_009120797.1|  PREDICTED: serine carboxypeptidase-like 15 i...    113   1e-26   
ref|XP_010238598.1|  PREDICTED: serine carboxypeptidase-like 3 is...    114   1e-26   
ref|XP_011100017.1|  PREDICTED: serine carboxypeptidase-like 13         114   1e-26   
ref|XP_009120791.1|  PREDICTED: serine carboxypeptidase-like 15 i...    113   1e-26   
ref|XP_008382766.1|  PREDICTED: serine carboxypeptidase-like 20         110   1e-26   
gb|KFK38584.1|  hypothetical protein AALP_AA3G132700                    116   1e-26   
ref|NP_973516.2|  sinapoylglucose:malate sinapoyltransferase            113   1e-26   
ref|XP_006296383.1|  hypothetical protein CARUB_v10025556mg             113   1e-26   
ref|XP_006290031.1|  hypothetical protein CARUB_v10003665mg             113   1e-26   
gb|AAC17816.2|  putative serine carboxypeptidase I                      113   1e-26   
gb|EMS49742.1|  Serine carboxypeptidase-like 19                         112   1e-26   
ref|XP_003576124.1|  PREDICTED: LOW QUALITY PROTEIN: putative ser...    109   1e-26   
ref|XP_010505112.1|  PREDICTED: serine carboxypeptidase-like 9 is...    113   1e-26   
ref|NP_001167902.1|  hypothetical protein precursor                     114   1e-26   
ref|XP_010505113.1|  PREDICTED: serine carboxypeptidase-like 9 is...    113   1e-26   
ref|XP_006662864.1|  PREDICTED: serine carboxypeptidase-like 18-like    113   1e-26   
gb|ABA99132.1|  Serine carboxypeptidase family protein                  113   1e-26   
gb|EEC68084.1|  hypothetical protein OsI_35952                          113   1e-26   
ref|XP_009395245.1|  PREDICTED: serine carboxypeptidase-like 12         113   1e-26   
dbj|BAJ99095.1|  predicted protein                                      113   1e-26   
ref|XP_009122528.1|  PREDICTED: serine carboxypeptidase-like 19         113   2e-26   
gb|EMT03311.1|  Serine carboxypeptidase-like 19                         113   2e-26   
ref|NP_187832.2|  serine carboxypeptidase-like 15                       113   2e-26   
ref|XP_002525854.1|  serine carboxypeptidase, putative                  112   2e-26   
gb|EAY83664.1|  hypothetical protein OsI_38889                          113   2e-26   
ref|XP_002878648.1|  SCPL11                                             113   2e-26   
gb|AAA32940.1|  carboxypeptidase I precursor                            112   2e-26   
gb|ABR17809.1|  unknown                                                 113   2e-26   
ref|XP_010656845.1|  PREDICTED: serine carboxypeptidase-like 13         113   2e-26   
ref|XP_006653168.1|  PREDICTED: serine carboxypeptidase-like 18-like    112   2e-26   
ref|XP_009343182.1|  PREDICTED: serine carboxypeptidase-like 18 i...    112   2e-26   
gb|EMS47612.1|  Serine carboxypeptidase-like 19                         112   2e-26   
emb|CDX68232.1|  BnaA07g22720D                                          112   2e-26   
ref|XP_010491604.1|  PREDICTED: serine carboxypeptidase-like 19         112   2e-26   
gb|EMS55667.1|  Serine carboxypeptidase-like 10                         108   2e-26   
ref|NP_187831.1|  serine carboxypeptidase-like 14                       112   2e-26   
ref|XP_010422959.1|  PREDICTED: serine carboxypeptidase-like 19         112   2e-26   
tpg|DAA37592.1|  TPA: hypothetical protein ZEAMMB73_449749              112   2e-26   
ref|XP_006663395.1|  PREDICTED: serine carboxypeptidase-like 18-like    112   3e-26   
dbj|BAB09519.1|  serine carboxypeptidase                                112   3e-26   
dbj|BAJ97596.1|  predicted protein                                      112   3e-26   
ref|NP_568215.2|  serine carboxypeptidase-like 19                       112   3e-26   
ref|XP_009343181.1|  PREDICTED: serine carboxypeptidase-like 1 is...    112   3e-26   
gb|AAK52316.1|  sinapoylglucose:choline sinapoyltransferase             112   3e-26   
ref|XP_004163541.1|  PREDICTED: serine carboxypeptidase-like 19-like    112   3e-26   
ref|XP_011009329.1|  PREDICTED: serine carboxypeptidase-like 20         112   4e-26   
sp|P07519.4|CBP1_HORVU  RecName: Full=Serine carboxypeptidase 1; ...    112   4e-26   
ref|XP_010028347.1|  PREDICTED: serine carboxypeptidase-like 18         112   4e-26   
emb|CDP06914.1|  unnamed protein product                                112   4e-26   
dbj|BAJ93955.1|  predicted protein                                      112   4e-26   
ref|XP_009117322.1|  PREDICTED: serine carboxypeptidase-like 8 is...    111   4e-26   
emb|CDP17658.1|  unnamed protein product                                112   4e-26   
tpg|DAA55429.1|  TPA: hypothetical protein ZEAMMB73_969275              110   4e-26   
ref|XP_003573745.1|  PREDICTED: serine carboxypeptidase-like 17 i...    112   4e-26   
ref|XP_009117321.1|  PREDICTED: serine carboxypeptidase-like 10 i...    112   5e-26   
emb|CBI17847.3|  unnamed protein product                                112   5e-26   
ref|XP_009125362.1|  PREDICTED: serine carboxypeptidase-like 19         112   5e-26   
ref|XP_009114926.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    112   5e-26   
ref|XP_007199794.1|  hypothetical protein PRUPE_ppa004538mg             112   5e-26   
emb|CDY49438.1|  BnaA09g42290D                                          111   5e-26   
ref|XP_008235895.1|  PREDICTED: serine carboxypeptidase-like 20         112   5e-26   
dbj|BAJ95123.1|  predicted protein                                      112   6e-26   
ref|XP_007200784.1|  hypothetical protein PRUPE_ppa024053mg             111   6e-26   
ref|XP_006297707.1|  hypothetical protein CARUB_v10013735mg             111   6e-26   
ref|XP_006399443.1|  hypothetical protein EUTSA_v10015958mg             111   6e-26   
ref|XP_006664470.1|  PREDICTED: serine carboxypeptidase 1-like          111   6e-26   
ref|XP_006401829.1|  hypothetical protein EUTSA_v10013495mg             111   7e-26   
dbj|BAJ96525.1|  predicted protein                                      111   7e-26   
emb|CDY50564.1|  BnaA01g30780D                                          111   7e-26   
emb|CDY52618.1|  BnaCnng22970D                                          111   7e-26   
ref|XP_003578731.1|  PREDICTED: serine carboxypeptidase 1               111   7e-26   
ref|XP_006294236.1|  hypothetical protein CARUB_v10023233mg             111   7e-26   
ref|XP_006404749.1|  hypothetical protein EUTSA_v10000411mg             104   7e-26   
dbj|BAK02394.1|  predicted protein                                      111   7e-26   
dbj|BAJ85413.1|  predicted protein                                      111   8e-26   
ref|XP_009343180.1|  PREDICTED: serine carboxypeptidase-like 1          111   8e-26   
gb|EYU37561.1|  hypothetical protein MIMGU_mgv1a005963mg                111   9e-26   
ref|XP_008236294.1|  PREDICTED: serine carboxypeptidase-like 14         111   9e-26   
ref|XP_011088733.1|  PREDICTED: serine carboxypeptidase-like 7          111   9e-26   
ref|XP_010556480.1|  PREDICTED: serine carboxypeptidase-like 1          110   9e-26   
gb|EEC68079.1|  hypothetical protein OsI_35943                          110   1e-25   
emb|CDY11116.1|  BnaC06g23680D                                          113   1e-25   
ref|XP_006299292.1|  hypothetical protein CARUB_v10015451mg             110   1e-25   
gb|KFK38585.1|  hypothetical protein AALP_AA3G132800                    110   1e-25   
ref|XP_002321240.1|  serine carboxypeptidase S10 family protein         111   1e-25   
ref|XP_006399444.1|  hypothetical protein EUTSA_v10016050mg             110   1e-25   
ref|XP_008338878.1|  PREDICTED: serine carboxypeptidase-like 1          111   1e-25   
ref|XP_010464977.1|  PREDICTED: serine carboxypeptidase-like 16         110   1e-25   
gb|KCW44823.1|  hypothetical protein EUGRSUZ_L016101                    105   1e-25   
ref|XP_004492215.1|  PREDICTED: serine carboxypeptidase-like 20-like    110   1e-25   
ref|XP_011089617.1|  PREDICTED: serine carboxypeptidase 1               111   1e-25   
ref|XP_009358971.1|  PREDICTED: serine carboxypeptidase-like 20 i...    111   1e-25   
ref|NP_001066510.1|  Os12g0257000                                       111   1e-25   
ref|XP_002888921.1|  hypothetical protein ARALYDRAFT_476459             110   1e-25   
gb|EEC69080.1|  hypothetical protein OsI_37959                          111   1e-25   
ref|XP_006418631.1|  hypothetical protein EUTSA_v10002940mg             110   1e-25   
gb|EYU37560.1|  hypothetical protein MIMGU_mgv1a005845mg                110   1e-25   
ref|XP_010498752.1|  PREDICTED: serine carboxypeptidase-like 16         110   1e-25   
gb|EEE53029.1|  hypothetical protein OsJ_35748                          111   2e-25   



>ref|XP_010061646.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW68630.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=477

 Score =   145 bits (365),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -2

Query  449  NIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVE  270
            N  N +   +  H  L      ++I SGDHDMIVP + T+AWI+SLNYSI+++WR WMV 
Sbjct  371  NYTNDISSTLQYHAKLSARGCRSLIYSGDHDMIVPFMGTQAWIRSLNYSIIDDWRSWMVR  430

Query  269  GQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            GQVAGYTRTYSNGMTFATVKG GH  PE+KP EC AMF RWI+ EPL
Sbjct  431  GQVAGYTRTYSNGMTFATVKGGGHTAPEYKPEECFAMFERWISREPL  477



>ref|XP_010320198.1| PREDICTED: serine carboxypeptidase-like 17 [Solanum lycopersicum]
Length=476

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 85/110 (77%), Gaps = 7/110 (6%)
 Frame = -2

Query  458  IIGNIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPW  279
            IIGN       + Y  NL +  + S +I SGDHD ++P  +TEAWI+SLNYSIV++WRPW
Sbjct  374  IIGN------SIPYHANLSVKGYRS-LIYSGDHDTMIPYTSTEAWIRSLNYSIVDDWRPW  426

Query  278  MVEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            +V+GQVAGYTRTYSN MTFATVKG GH  PE+KP+ECLAM  RW++Y+PL
Sbjct  427  IVDGQVAGYTRTYSNKMTFATVKGGGHTAPEYKPVECLAMLRRWLSYQPL  476



>gb|EMS46782.1| Serine carboxypeptidase-like 18 [Triticum urartu]
Length=364

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 8/110 (7%)
 Frame = -2

Query  458  IIGNIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPW  279
            I  ++E+H+ V         T    ++I SGDHDMIVP+I T+AWIKSLN+S+V+EWRPW
Sbjct  263  IFSSVEHHLDVT--------TRGYRSLIYSGDHDMIVPSIGTQAWIKSLNFSVVDEWRPW  314

Query  278  MVEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             V+ QVAGYTR+YSN +TFATVKG GH  PE+ P +CLAMF RW++ EPL
Sbjct  315  YVDAQVAGYTRSYSNNLTFATVKGGGHTAPEYMPKQCLAMFARWLSGEPL  364



>ref|XP_010321497.1| PREDICTED: serine carboxypeptidase-like 12 [Solanum lycopersicum]
Length=459

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 84/109 (77%), Gaps = 3/109 (3%)
 Frame = -2

Query  455  IGNIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWM  276
             G+I N+ I  +Y  NL    F S +I SGDHDM+VP I+T+ WIKSLNYSI+++WRPW+
Sbjct  354  FGDIINNTI--LYHSNLSRKGFRS-LIYSGDHDMVVPFISTQVWIKSLNYSIIDDWRPWI  410

Query  275  VEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            V+GQVAGYTR+YSN MTF TVKG GH  PE+KP++ LAM  RW++YE L
Sbjct  411  VDGQVAGYTRSYSNKMTFVTVKGAGHTTPEYKPVQSLAMLKRWLSYESL  459



>gb|KHG16860.1| Serine carboxypeptidase-like 19 [Gossypium arboreum]
Length=339

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHDM+VP +AT+AWI+ LNY I+++WRPWMV+ QVAGYTRTYSN MTFATVKG G
Sbjct  256  LIYSGDHDMVVPHLATQAWIRFLNYQIIDDWRPWMVQSQVAGYTRTYSNRMTFATVKGGG  315

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE+KP EC AMF RWI+ +PL
Sbjct  316  HTAPEYKPAECFAMFTRWISGQPL  339



>ref|XP_006472316.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM+VP + TEAWIKSLNYSI+++WRPW++  QVAGYTRTYSN
Sbjct  373  HVSLSTKGYRSLIYSGDHDMVVPFLGTEAWIKSLNYSIIDDWRPWILHSQVAGYTRTYSN  432

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+ATVKG GHI PE++P EC AMF RWI ++PL
Sbjct  433  RMTYATVKGGGHIAPEYRPAECYAMFQRWINHDPL  467



>gb|KDO81474.1| hypothetical protein CISIN_1g012236mg [Citrus sinensis]
Length=467

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM+VP + TEAWIKSLNYSI+++WRPW++  QVAGYTRTYSN
Sbjct  373  HVSLSTKGYRSLIYSGDHDMVVPFLGTEAWIKSLNYSIIDDWRPWILHSQVAGYTRTYSN  432

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+ATVKG GHI PE++P EC AMF RWI ++PL
Sbjct  433  RMTYATVKGGGHIAPEYRPAECYAMFQRWINHDPL  467



>gb|EMT02053.1| Serine carboxypeptidase-like 18 [Aegilops tauschii]
Length=514

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 8/110 (7%)
 Frame = -2

Query  458  IIGNIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPW  279
            I  ++E+H+ V         T    ++I SGDHDMIVP+I T+AWIKSLN+S+V+EWRPW
Sbjct  413  IFSSVEHHLDVT--------TRGYRSLIYSGDHDMIVPSIGTQAWIKSLNFSVVDEWRPW  464

Query  278  MVEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             V+ QVAGYTR+YSN +TFATVKG GH  PE+ P +CLAMF RW++ EPL
Sbjct  465  YVDAQVAGYTRSYSNNLTFATVKGGGHTAPEYMPKQCLAMFGRWLSGEPL  514



>dbj|BAF99698.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=484

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y  NL    + S +I SGDHD +VP +AT+AWI+SLNYSIV+EWR W+VEGQVAGYT
Sbjct  386  VVPYHANLSKKGYRS-LIYSGDHDAMVPFMATQAWIRSLNYSIVDEWRQWIVEGQVAGYT  444

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            RTY+N MTFATVKG GH  PE+KP EC AMF RWI ++PL
Sbjct  445  RTYANQMTFATVKGGGHTAPEYKPKECKAMFKRWITHKPL  484



>dbj|BAF99697.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=494

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y  NL    + S +I SGDHD +VP +AT+AWI+SLNYSIV+EWR W+VEGQVAGYT
Sbjct  396  VVPYHANLSKKGYRS-LIYSGDHDAMVPFMATQAWIRSLNYSIVDEWRQWIVEGQVAGYT  454

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            RTY+N MTFATVKG GH  PE+KP EC AMF RWI ++PL
Sbjct  455  RTYANQMTFATVKGGGHTAPEYKPKECKAMFKRWITHKPL  494



>ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52264.1| serine carboxypeptidase, putative [Ricinus communis]
Length=468

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDMIVP + T+ W++SLNYSI ++WRPW V+GQVAGYTRTYSN MTFATVKG 
Sbjct  384  SLIYSGDHDMIVPFLGTQGWVRSLNYSITDDWRPWKVQGQVAGYTRTYSNRMTFATVKGG  443

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAMF RW   EPL
Sbjct  444  GHTAPEYKPAECLAMFKRWTNQEPL  468



>dbj|BAO04182.1| hypothetical protein [Delphinium grandiflorum]
Length=475

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDMIVP + TEAWIKSLNYSI+++WR W V GQVAGYTRTY+N MTFATVKG 
Sbjct  391  SLIYSGDHDMIVPYMGTEAWIKSLNYSIIDDWRSWFVGGQVAGYTRTYANNMTFATVKGG  450

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAM  RW++YE L
Sbjct  451  GHTAPEYKPCECLAMLKRWLSYESL  475



>ref|XP_010108030.1| Serine carboxypeptidase-like 3 [Morus notabilis]
 gb|EXC17676.1| Serine carboxypeptidase-like 3 [Morus notabilis]
Length=248

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYSIV++WR W+V+G +AGYTRTYSN MTFATV+  
Sbjct  164  SLIYSGDHDMQVPFLATQAWIRSLNYSIVDDWRSWVVQGHIAGYTRTYSNLMTFATVRVA  223

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  P++KP EC AMF RWI YEPL
Sbjct  224  GHTAPQYKPKECFAMFKRWIHYEPL  248



>gb|KDO81472.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=414

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM+VP + TEAWIKSLNYSIV++WRPW++  QVAGYTRTYSN
Sbjct  320  HVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSN  379

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+ATVKG GH  PE++P EC AMF RWI ++PL
Sbjct  380  RMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  414



>ref|XP_006433655.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
 gb|ESR46895.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
Length=467

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDMI+P + TEAWIKSLNYSIV++WRPW++  QVAGYTRTYSN
Sbjct  373  HVSLSTKGYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSN  432

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+ATVKG GH  PE++P EC AMF RWI ++PL
Sbjct  433  QMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  467



>emb|CBI19380.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   137 bits (344),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDMIVP  +T+AWI+SLNYSIV++WR WMVEGQV GYTRTYSN MTFATVKG 
Sbjct  419  SLIYSGDHDMIVPFFSTQAWIRSLNYSIVDDWRSWMVEGQVGGYTRTYSNQMTFATVKGG  478

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P EC  M+ RW++ +PL
Sbjct  479  GHTAPEYRPKECFGMYKRWVSGQPL  503



>ref|XP_007018463.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15688.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=386

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDM+VP + TEAWIKSLNY IV++WRPWMV+ QVAGYTRTYSN MT+A++K  G
Sbjct  303  LVYSGDHDMLVPFLGTEAWIKSLNYPIVDDWRPWMVQDQVAGYTRTYSNQMTYASIKRGG  362

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE+KP EC AMF RWI+ EPL
Sbjct  363  HTAPEYKPAECFAMFKRWISREPL  386


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = -2

Query  272  EGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFN  153
            + ++ GYTRT+SN MTFAT+KG GH   E+ P EC AMF 
Sbjct  9    KAKLQGYTRTHSNRMTFATIKGGGHT-AEYTPKECFAMFK  47



>ref|XP_006472322.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=468

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM+VP + TEAWIKSLNYSIV++WRPW++  QVAGYTRTYSN
Sbjct  374  HVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSN  433

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+ATVKG GH  PE++P EC AMF RWI ++PL
Sbjct  434  RMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  468



>ref|XP_007018461.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15686.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=473

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHD+ VP +AT+AWI+SLNY+IV++WRPW++ GQV GYTRTYSN MTFATVKG G
Sbjct  390  LIYSGDHDLTVPFLATQAWIRSLNYTIVDDWRPWVLRGQVVGYTRTYSNRMTFATVKGGG  449

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECLAMF RWI+ EPL
Sbjct  450  HTAPEYRPAECLAMFKRWISEEPL  473



>gb|KDO81471.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=468

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM+VP + TEAWIKSLNYSIV++WRPW++  QVAGYTRTYSN
Sbjct  374  HVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSN  433

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+ATVKG GH  PE++P EC AMF RWI ++PL
Sbjct  434  RMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  468



>ref|XP_006472320.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472321.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM++P + TEAWIKSLNYSIV++WRPW++  QVAGYTRTYSN
Sbjct  373  HVSLSTKGYRSLIYSGDHDMLIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSN  432

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+ATVKG GH  PE++P EC AMF RWI ++PL
Sbjct  433  QMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  467



>gb|KDO81468.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=467

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM++P + TEAWIKSLNYSIV++WRPW++  QVAGYTRTYSN
Sbjct  373  HVSLSTKGYRSLIYSGDHDMLIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSN  432

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+ATVKG GH  PE++P EC AMF RWI ++PL
Sbjct  433  QMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  467



>ref|XP_009768014.1| PREDICTED: serine carboxypeptidase-like 17 [Nicotiana sylvestris]
Length=477

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDMI P I+T+AWIKSLNYSIV++WRPW+V GQVAGYTR++SN
Sbjct  383  HAYLSTKGLKSLIYSGDHDMITPFISTQAWIKSLNYSIVDDWRPWIVNGQVAGYTRSFSN  442

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MTFAT+KG GH  P W P ECLAM  RW++ +PL
Sbjct  443  QMTFATLKGAGHTAPNWAPAECLAMLKRWLSNKPL  477



>ref|XP_010689038.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810 [Beta 
vulgaris subsp. vulgaris]
Length=374

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDMIVP + T+AWI+SLNYSI+++WR WMV+GQVAG+TRTY+N MTFATVKG 
Sbjct  290  SLIYSGDHDMIVPFLGTQAWIRSLNYSILDDWRKWMVDGQVAGFTRTYTNKMTFATVKGA  349

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP +C +MF RWI  E L
Sbjct  350  GHTAPEYKPKQCASMFKRWIQGEAL  374



>ref|XP_003525944.2| PREDICTED: serine carboxypeptidase-like 19-like isoform X1 [Glycine 
max]
Length=438

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP +AT+AWI+SLNYSIV +WR W  +GQVAGYTRTYSN MTFATVKG 
Sbjct  354  SLIYSGDHDMVVPFLATQAWIRSLNYSIVSDWRQWYYDGQVAGYTRTYSNRMTFATVKGG  413

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAMF+RWI+  PL
Sbjct  414  GHTAPEYKPEECLAMFSRWISNMPL  438



>ref|XP_009771129.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Nicotiana 
sylvestris]
Length=437

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM +P  +T+ WIKSLNYSIV+EWRPW  +GQVAGYTR+YSN MTFATVKG 
Sbjct  353  SLIYSGDHDMGIPFQSTQFWIKSLNYSIVDEWRPWSFDGQVAGYTRSYSNQMTFATVKGA  412

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH+ PE+KP EC  MF RW+++EPL
Sbjct  413  GHVAPEYKPKECFTMFQRWLSHEPL  437



>ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2 [Vitis vinifera]
Length=469

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDMIVP  +T+AWI+SLNYSIV++WR WMVEGQV GYTRTYSN MTFATVKG 
Sbjct  385  SLIYSGDHDMIVPFFSTQAWIRSLNYSIVDDWRSWMVEGQVGGYTRTYSNQMTFATVKGG  444

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P EC  M+ RW++ +PL
Sbjct  445  GHTAPEYRPKECFGMYKRWVSGQPL  469



>ref|XP_009771128.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM +P  +T+ WIKSLNYSIV+EWRPW  +GQVAGYTR+YSN MTFATVKG 
Sbjct  383  SLIYSGDHDMGIPFQSTQFWIKSLNYSIVDEWRPWSFDGQVAGYTRSYSNQMTFATVKGA  442

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH+ PE+KP EC  MF RW+++EPL
Sbjct  443  GHVAPEYKPKECFTMFQRWLSHEPL  467



>ref|XP_009600999.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Nicotiana 
tomentosiformis]
Length=465

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -2

Query  425  VIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTR  246
            + Y  NL    + S I  SGDHD +V  ++T+AWIKSLNYSIV++WRPW+V+ QVAGYTR
Sbjct  367  IPYHANLSAKGYRSLIYSSGDHDKVVTFLSTQAWIKSLNYSIVDDWRPWIVDNQVAGYTR  426

Query  245  TYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            +YSN MTF TVKG GH  PE+KP ECLAM  RW++Y+PL
Sbjct  427  SYSNRMTFVTVKGAGHTAPEYKPRECLAMLKRWMSYKPL  465



>emb|CDP01267.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    +++ SGDHDM++P   T+ WI+SLNYSIV+EWRPW VEGQVAGYTRTY+N
Sbjct  384  HANLSTLGYRSLVYSGDHDMVLPHFGTQDWIRSLNYSIVDEWRPWFVEGQVAGYTRTYAN  443

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MTFAT  G GH  PE+KP+EC AMF RWI+YEPL
Sbjct  444  RMTFAT--GAGHTAPEYKPVECRAMFQRWISYEPL  476



>ref|XP_006581277.1| PREDICTED: serine carboxypeptidase-like 19-like isoform X3 [Glycine 
max]
Length=458

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP +AT+AWI+SLNYSIV +WR W  +GQVAGYTRTYSN MTFATVKG 
Sbjct  374  SLIYSGDHDMVVPFLATQAWIRSLNYSIVSDWRQWYYDGQVAGYTRTYSNRMTFATVKGG  433

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAMF+RWI+  PL
Sbjct  434  GHTAPEYKPEECLAMFSRWISNMPL  458



>ref|XP_006581276.1| PREDICTED: serine carboxypeptidase-like 19-like isoform X2 [Glycine 
max]
Length=491

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP +AT+AWI+SLNYSIV +WR W  +GQVAGYTRTYSN MTFATVKG 
Sbjct  407  SLIYSGDHDMVVPFLATQAWIRSLNYSIVSDWRQWYYDGQVAGYTRTYSNRMTFATVKGG  466

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAMF+RWI+  PL
Sbjct  467  GHTAPEYKPEECLAMFSRWISNMPL  491



>gb|KHN45135.1| Serine carboxypeptidase-like 19 [Glycine soja]
Length=471

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP +AT+AWI+SLNYSIV +WR W  +GQVAGYTRTYSN MTFATVKG 
Sbjct  387  SLIYSGDHDMVVPFLATQAWIRSLNYSIVSDWRQWYYDGQVAGYTRTYSNRMTFATVKGG  446

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAMF+RWI+  PL
Sbjct  447  GHTAPEYKPEECLAMFSRWISNMPL  471



>ref|XP_006433653.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
 gb|ESR46893.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
Length=467

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM+VP + TEAWIK+LNYSI+++WRPW++  QVAG+TRTYSN
Sbjct  373  HVSLSTKGYRSLIYSGDHDMVVPFLGTEAWIKTLNYSIIDDWRPWILHSQVAGFTRTYSN  432

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+A+VKG GHI PE++P EC AMF RWI ++PL
Sbjct  433  RMTYASVKGGGHIAPEYRPAECYAMFQRWINHDPL  467



>ref|XP_003579296.2| PREDICTED: serine carboxypeptidase-like 2 [Brachypodium distachyon]
Length=493

 Score =   135 bits (339),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDMI+P I T+AWI+SLN+S+V+EWRPW V+ QV+GYTR+YSN +TFATVKG 
Sbjct  409  SLVYSGDHDMIIPFIGTQAWIRSLNFSVVDEWRPWFVDAQVSGYTRSYSNNLTFATVKGG  468

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +CLAMF+RW++ +PL
Sbjct  469  GHTSPEFMPKQCLAMFSRWVSGDPL  493



>ref|XP_006433654.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
 gb|ESR46894.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
Length=468

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM+VP + TEAWIKSLNYSI ++WRPW++  QVAGYTRTYSN
Sbjct  374  HVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIADDWRPWILHSQVAGYTRTYSN  433

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+ATVKG GH  PE++P EC AMF RWI ++PL
Sbjct  434  RMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  468



>ref|XP_009761854.1| PREDICTED: serine carboxypeptidase-like 18 [Nicotiana sylvestris]
Length=429

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +V +++T+AWIKSLNYSI+++WRPW+++ QVAGYTR+YSN MTFATVKG 
Sbjct  345  SLIYSGDHDKVVISLSTQAWIKSLNYSIIDDWRPWVIDNQVAGYTRSYSNRMTFATVKGA  404

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAM  RW++Y+PL
Sbjct  405  GHTAPEYKPRECLAMLKRWMSYKPL  429



>ref|XP_002510076.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52263.1| serine carboxypeptidase, putative [Ricinus communis]
Length=453

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP + T+AWI+SLN+SIV++W+PW +EGQVAGYTR+YSN MT+ATVKG 
Sbjct  369  SLIYSGDHDMLVPFVGTQAWIRSLNFSIVDDWQPWHIEGQVAGYTRSYSNQMTYATVKGG  428

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  EC AMF RWI+ EPL
Sbjct  429  GHTAPEYKQAECFAMFKRWISREPL  453



>ref|XP_006345611.1| PREDICTED: serine carboxypeptidase-like 19-like [Solanum tuberosum]
Length=388

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 81/109 (74%), Gaps = 3/109 (3%)
 Frame = -2

Query  455  IGNIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWM  276
             G I N+   V Y  NL    F S +I SGDHDM+VP  +T+ WIKSL+YSI+++W+PW+
Sbjct  283  FGTIINNT--VPYHANLSRKGFRS-LIYSGDHDMVVPFSSTQLWIKSLSYSIIDDWKPWV  339

Query  275  VEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            V+GQVAGYTR+YSN MTFATVKG GH  PEWKP ECLAM  RW+++  L
Sbjct  340  VDGQVAGYTRSYSNQMTFATVKGGGHTAPEWKPAECLAMLKRWLSHVSL  388



>dbj|BAF99694.1| 1-O-acylglucose:anthocyanin-O-acyltransferase [Clitoria ternatea]
Length=487

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -2

Query  410  NLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNG  231
            NL    +  ++I SGDHDM+VP + T+AWI+SLNYSIV++WRPW   GQVAGYTRTYSN 
Sbjct  378  NLSRKGYYRSLIYSGDHDMMVPFLGTQAWIRSLNYSIVDDWRPWNTNGQVAGYTRTYSNR  437

Query  230  MTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            MT+AT+KG GH  PE+KP EC AM++RWI+  PL
Sbjct  438  MTYATIKGGGHTAPEFKPEECFAMYSRWISKRPL  471



>dbj|BAO04189.1| hypothetical protein, partial [Delphinium grandiflorum]
 dbj|BAO04190.1| hypothetical protein, partial [Delphinium grandiflorum]
Length=292

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +VP ++TE WI SLNYSI ++WRPW V GQVAGYTR+Y+N MTFATVKG 
Sbjct  208  SLIYSGDHDFLVPFLSTETWITSLNYSITDDWRPWFVGGQVAGYTRSYANNMTFATVKGA  267

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP EC +M  +W++YEPL
Sbjct  268  GHTAPEYKPYECFSMMKKWLSYEPL  292



>gb|KHN45449.1| Serine carboxypeptidase-like 11 [Glycine soja]
Length=433

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +VP ++T+AWI++LNYSIVE+WRPW++E QVAGYTRTYSN MTFATVKG+
Sbjct  349  SLIYSGDHDAVVPFMSTQAWIRALNYSIVEDWRPWLLEDQVAGYTRTYSNQMTFATVKGS  408

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E  AMF+RWIA  PL
Sbjct  409  GHTAPEYKPEEGFAMFSRWIANMPL  433



>ref|XP_007134008.1| hypothetical protein PHAVU_010G011400g [Phaseolus vulgaris]
 gb|ESW06002.1| hypothetical protein PHAVU_010G011400g [Phaseolus vulgaris]
Length=469

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +VP ++T+ WI++LNYSIV++WRPW++EGQVAGYTRTYSN MTFATVKG+
Sbjct  385  SLIYSGDHDAVVPFMSTQTWIRALNYSIVDDWRPWLLEGQVAGYTRTYSNQMTFATVKGS  444

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E  AMF+RWIA +PL
Sbjct  445  GHTAPEYKPDEGYAMFSRWIARKPL  469



>ref|XP_009601001.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
tomentosiformis]
Length=464

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +V  ++T+AWIKSLNYSIV++WRPW+V+ QVAGYTR+YSN MTF TVKG 
Sbjct  380  SLIYSGDHDKVVTFLSTQAWIKSLNYSIVDDWRPWIVDNQVAGYTRSYSNRMTFVTVKGA  439

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAM  RW++Y+PL
Sbjct  440  GHTAPEYKPRECLAMLKRWMSYKPL  464



>ref|XP_008352130.1| PREDICTED: serine carboxypeptidase-like 18 [Malus domestica]
Length=279

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYSIV +WRPW V+GQVAGYTRTYSN MT+ATVKG 
Sbjct  195  SLIYSGDHDMXVPFMATQAWIRSLNYSIVNDWRPWFVKGQVAGYTRTYSNRMTYATVKGA  254

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP EC  M+ +W+  EPL
Sbjct  255  GHTAPEYKPEECSTMYTKWLYEEPL  279



>ref|XP_003604927.1| Serine carboxypeptidase [Medicago truncatula]
Length=624

 Score =   134 bits (337),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 8/106 (8%)
 Frame = -2

Query  458  IIGNIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPW  279
            I+G+ E HV       NL    + S +I SGDHD +VP ++T+AWI++LNYSIV++WRPW
Sbjct  367  ILGSFEFHV-------NLSKKGYRS-LIYSGDHDAVVPFMSTQAWIRNLNYSIVDDWRPW  418

Query  278  MVEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIA  141
             V GQV GYTRTYSN MTFATVKG+GH  PE+ P +C AMF RWI+
Sbjct  419  FVNGQVGGYTRTYSNRMTFATVKGSGHTAPEYTPEQCFAMFTRWIS  464



>ref|XP_003520964.1| PREDICTED: serine carboxypeptidase-like 11-like [Glycine max]
Length=462

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +VP ++T+AWI++LNYSIVE+WRPW++E QVAGYTRTYSN MTFATVKG+
Sbjct  378  SLIYSGDHDAVVPFMSTQAWIRALNYSIVEDWRPWLLEDQVAGYTRTYSNQMTFATVKGS  437

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E  AMF+RWIA  PL
Sbjct  438  GHTAPEYKPEEGFAMFSRWIANMPL  462



>ref|XP_003573757.1| PREDICTED: serine carboxypeptidase-like 13 [Brachypodium distachyon]
Length=483

 Score =   133 bits (334),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDM++P I T+AWI+SLN+S+V+EWRPW V+ QVAGYTR+YSN +TFATVKG 
Sbjct  399  SLVYSGDHDMVIPFIGTQAWIRSLNFSVVDEWRPWYVDTQVAGYTRSYSNNLTFATVKGG  458

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +CLAMF RW++ +PL
Sbjct  459  GHTAPEYMPKQCLAMFARWVSGDPL  483



>gb|KDP41601.1| hypothetical protein JCGZ_16008 [Jatropha curcas]
Length=478

 Score =   133 bits (334),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGD DM+VP + T+AWI+SLNYSIV++WRPW+V GQ+AGYTRTYSN MTFATVKG 
Sbjct  394  SLIYSGDQDMVVPFLGTQAWIRSLNYSIVDDWRPWLVRGQIAGYTRTYSNQMTFATVKGG  453

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  P +KP  C AMF RW ++EPL
Sbjct  454  GHTAPTYKPEVCFAMFKRWKSHEPL  478



>ref|XP_004983497.1| PREDICTED: serine carboxypeptidase-like 18-like [Setaria italica]
Length=486

 Score =   133 bits (334),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDMI+P I T+AWIKSLN+SI++ WRPW V+GQVAG+TR+YSN +TFATVKG 
Sbjct  402  SLVYSGDHDMIIPHIGTQAWIKSLNFSIMDHWRPWFVDGQVAGFTRSYSNNLTFATVKGG  461

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +C AMF RWI+ +PL
Sbjct  462  GHTAPEYMPRQCFAMFARWISGDPL  486



>gb|KEH36682.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=360

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD+ +P + T+AWIKSLNYSIV++WR W  +GQVAGYTRTYSNGMTFATVKG 
Sbjct  276  SLIYSGDHDISIPFLDTKAWIKSLNYSIVDDWRQWHTDGQVAGYTRTYSNGMTFATVKGG  335

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E++P ECLAMF+RWI+  PL
Sbjct  336  GHTAAEYRPEECLAMFSRWISKRPL  360



>ref|XP_007047573.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007047574.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91730.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91731.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
Length=476

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T     +I SGDHD +VP + TEAWIKSLN+SIV++WRPW V+GQV GY+R Y N
Sbjct  382  HRYLNTKGYRALIYSGDHDTVVPYVGTEAWIKSLNFSIVDDWRPWFVDGQVGGYSREYGN  441

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
              TFATVKG GH  PE+KP ECLAMF RWI+ E L
Sbjct  442  NFTFATVKGGGHTAPEYKPKECLAMFKRWISQEHL  476



>emb|CDY01415.1| BnaA07g11880D [Brassica napus]
Length=157

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP+IAT+AWIKSLNYSI+++WRPWM++ Q+AGYTRTYSN MTF+T+KG+
Sbjct  74   SLIYSGDHDMTVPSIATQAWIKSLNYSIIDDWRPWMIKTQIAGYTRTYSNKMTFSTIKGS  133

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI+ +PL
Sbjct  134  GHT-AEYKPNETFIMFQRWISGQPL  157



>ref|XP_006662125.1| PREDICTED: serine carboxypeptidase-like 18-like [Oryza brachyantha]
Length=525

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM++P I T+AWIKSLN+ +V+EWRPW V GQVAGYTR+YSN
Sbjct  431  HLDLTTRGYRSLIYSGDHDMVIPFIGTQAWIKSLNFPVVDEWRPWFVNGQVAGYTRSYSN  490

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             +TFATVKG GH  PE+ P +CLAM  RW++ +PL
Sbjct  491  NLTFATVKGGGHTAPEYMPKQCLAMLGRWVSGDPL  525



>ref|XP_010277006.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010277007.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
Length=467

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD+IVP +AT+AWI SLNYSIV+ WR W+V+GQV GYTRTYSN MTFATVKG 
Sbjct  383  SLIYSGDHDLIVPFLATQAWIHSLNYSIVDGWRSWVVDGQVGGYTRTYSNNMTFATVKGG  442

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P  CLAM+ RWI  EPL
Sbjct  443  GHTAPEYQPKACLAMYKRWIDEEPL  467



>ref|XP_010277008.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD+IVP +AT+AWI SLNYSIV+ WR W+V+GQV GYTRTYSN MTFATVKG 
Sbjct  364  SLIYSGDHDLIVPFLATQAWIHSLNYSIVDGWRSWVVDGQVGGYTRTYSNNMTFATVKGG  423

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P  CLAM+ RWI  EPL
Sbjct  424  GHTAPEYQPKACLAMYKRWIDEEPL  448



>gb|KDP41600.1| hypothetical protein JCGZ_16007 [Jatropha curcas]
Length=472

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+V  + T+AWI+SLN+SIV++WRPW +EGQVAGYTR+YSN MT+AT+KG 
Sbjct  388  SLIYSGDHDMLVSFVGTQAWIRSLNFSIVDDWRPWHLEGQVAGYTRSYSNKMTYATIKGG  447

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP EC AMF RW + EPL
Sbjct  448  GHTAPEYKPEECFAMFKRWTSQEPL  472



>dbj|BAO04183.1| putative acyl-glucose-dependent anthocyanin acyltransferase [Delphinium 
grandiflorum]
Length=470

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +VP ++TE WI SLNYSI ++WRPW V GQVAGYTR+Y+N MTFATVKG 
Sbjct  386  SLIYSGDHDFLVPFLSTETWITSLNYSITDDWRPWFVGGQVAGYTRSYANNMTFATVKGA  445

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP EC +M  +W++YEPL
Sbjct  446  GHTAPEYKPYECFSMMKKWLSYEPL  470



>ref|XP_009365383.1| PREDICTED: serine carboxypeptidase-like 13 [Pyrus x bretschneideri]
Length=473

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = -2

Query  395  YFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFAT  216
            Y+ S +I SGDHDM+VP +AT+AWI+SLNYSIV +WRPW V+GQVAGYTRTYSN MT+AT
Sbjct  386  YYRS-LIYSGDHDMMVPFMATQAWIRSLNYSIVNDWRPWFVKGQVAGYTRTYSNRMTYAT  444

Query  215  VKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            VKG GH  PE+KP EC  M+ +W+  EPL
Sbjct  445  VKGAGHTAPEYKPEECSTMYTKWLYEEPL  473



>ref|XP_006345612.1| PREDICTED: serine carboxypeptidase-like 13-like [Solanum tuberosum]
Length=345

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 7/101 (7%)
 Frame = -2

Query  410  NLLLTYFESNIICS-------GDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGY  252
             +LL   + N+ CS       GDHDM+VP I+T+ WIKSLNYSI+++W+PW+V+GQVAGY
Sbjct  245  KILLHILKLNVECSSIFMFESGDHDMVVPFISTQVWIKSLNYSIIDDWKPWIVDGQVAGY  304

Query  251  TRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            TR+Y N MTF T+KG GH  PE+KP+E LAM  RW+ YE L
Sbjct  305  TRSYYNQMTFVTIKGAGHTGPEYKPVESLAMLKRWLTYESL  345



>ref|XP_010231763.1| PREDICTED: serine carboxypeptidase-like 13 isoform X3 [Brachypodium 
distachyon]
Length=471

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H +L+T     ++ SGDHDM+VP +AT+AWI+ L++SIV+EWRPW V GQVAGYTR YSN
Sbjct  377  HLILITRGYRALVYSGDHDMVVPYLATQAWIRQLDFSIVDEWRPWYVTGQVAGYTRMYSN  436

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWI  144
             +TFATVKG GH  PE++P EC AMF RW+
Sbjct  437  NLTFATVKGAGHTAPEFRPKECFAMFQRWL  466



>ref|XP_009764359.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
7 [Nicotiana sylvestris]
Length=461

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +V  ++T+AWIKSLNYSIV++WRPW+V+ QVAGYTR+YSN MTFATVKG 
Sbjct  377  SLIYSGDHDKVVTFLSTQAWIKSLNYSIVDDWRPWIVDNQVAGYTRSYSNRMTFATVKGA  436

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAM  R ++Y+PL
Sbjct  437  GHTAPEYKPRECLAMLKRLMSYKPL  461



>ref|XP_010231762.1| PREDICTED: serine carboxypeptidase-like 19 isoform X2 [Brachypodium 
distachyon]
Length=477

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H +L+T     ++ SGDHDM+VP +AT+AWI+ L++SIV+EWRPW V GQVAGYTR YSN
Sbjct  383  HLILITRGYRALVYSGDHDMVVPYLATQAWIRQLDFSIVDEWRPWYVTGQVAGYTRMYSN  442

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWI  144
             +TFATVKG GH  PE++P EC AMF RW+
Sbjct  443  NLTFATVKGAGHTAPEFRPKECFAMFQRWL  472



>ref|XP_003566614.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Brachypodium 
distachyon]
Length=498

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H +L+T     ++ SGDHDM+VP +AT+AWI+ L++SIV+EWRPW V GQVAGYTR YSN
Sbjct  404  HLILITRGYRALVYSGDHDMVVPYLATQAWIRQLDFSIVDEWRPWYVTGQVAGYTRMYSN  463

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWI  144
             +TFATVKG GH  PE++P EC AMF RW+
Sbjct  464  NLTFATVKGAGHTAPEFRPKECFAMFQRWL  493



>ref|XP_006343160.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=480

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y  NL    + S +I SGDHD+ +P I+TEAWI SLNYS+ ++WR W+V GQVAGYT
Sbjct  382  VVPYHANLSAKGYRS-LIYSGDHDLTIPFISTEAWIGSLNYSVTDDWRKWIVNGQVAGYT  440

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            ++YSN +TFATVKG+GH+ P WKPLECL M  +WI+Y+ L
Sbjct  441  KSYSNNLTFATVKGSGHVAPLWKPLECLTMLTKWISYKQL  480



>ref|XP_003593861.1| Serine carboxypeptidase family protein [Medicago truncatula]
 gb|AES64112.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=465

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD+ +P + T+AWIKSLNYSIV++WR W  +GQVAGYTRTYSNGMTFATVKG 
Sbjct  381  SLIYSGDHDISIPFLDTKAWIKSLNYSIVDDWRQWHTDGQVAGYTRTYSNGMTFATVKGG  440

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E++P ECLAMF+RWI+  PL
Sbjct  441  GHTAAEYRPEECLAMFSRWISKRPL  465



>ref|XP_004252000.2| PREDICTED: serine carboxypeptidase-like 7 [Solanum lycopersicum]
 ref|XP_010314007.1| PREDICTED: serine carboxypeptidase-like 7 [Solanum lycopersicum]
Length=499

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y  NL    + S +I SGDHD+ +P I+TEAWI+SLNYS++++WR W+V GQVAGYT
Sbjct  401  VVPYHANLSAKGYRS-LIYSGDHDLTIPFISTEAWIESLNYSVIDDWRKWIVNGQVAGYT  459

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            +TYSN +TFATVKG+GH+ P WKPLECL M  +WI+ + L
Sbjct  460  KTYSNNLTFATVKGSGHVAPLWKPLECLTMLTKWISSKQL  499



>ref|NP_001064014.1| Os10g0101100 [Oryza sativa Japonica Group]
 gb|ABB46564.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF25928.1| Os10g0101100 [Oryza sativa Japonica Group]
Length=460

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDMI+P I T+AWI+SLN+S+V+EWRPW V+GQVAGY R+YSN
Sbjct  366  HLDLTTRGYRSLIYSGDHDMIIPFIGTQAWIRSLNFSVVDEWRPWFVDGQVAGYIRSYSN  425

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             +TFATVKG GH  PE+ P +CLAM  RW++  PL
Sbjct  426  NLTFATVKGGGHTAPEYMPKQCLAMLARWVSGNPL  460



>gb|AAL73563.1|AC079632_7 Putative serine carboxypeptidase [Oryza sativa Japonica Group]
 gb|AAM08635.1|AC108883_8 Putative serine carboxypeptidase [Oryza sativa Japonica Group]
 gb|EAZ15041.1| hypothetical protein OsJ_30451 [Oryza sativa Japonica Group]
Length=432

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDMI+P I T+AWI+SLN+S+V+EWRPW V+GQVAGY R+YSN
Sbjct  338  HLDLTTRGYRSLIYSGDHDMIIPFIGTQAWIRSLNFSVVDEWRPWFVDGQVAGYIRSYSN  397

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             +TFATVKG GH  PE+ P +CLAM  RW++  PL
Sbjct  398  NLTFATVKGGGHTAPEYMPKQCLAMLARWVSGNPL  432



>ref|XP_008337031.1| PREDICTED: serine carboxypeptidase-like 18 [Malus domestica]
Length=432

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYSIV +WRPW V+GQVAGYTRTYSN MT+ATVKG 
Sbjct  348  SLIYSGDHDMXVPFMATQAWIRSLNYSIVNDWRPWFVKGQVAGYTRTYSNRMTYATVKGA  407

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP EC  M+ +W+  EPL
Sbjct  408  GHTAPEYKPEECSTMYTKWLYEEPL  432



>ref|XP_006594522.1| PREDICTED: serine carboxypeptidase-like 12-like [Glycine max]
Length=469

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM +P +AT+AWI+SLNYSIV+EWR W   GQVAGYTRTYSN MTFATVKG 
Sbjct  385  SLIYSGDHDMTIPFLATQAWIRSLNYSIVDEWRQWHTNGQVAGYTRTYSNRMTFATVKGG  444

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP EC AMF+RWI+   L
Sbjct  445  GHTAPEYKPDECFAMFSRWISNSAL  469



>emb|CDP21038.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDMIVP   T+AWIKSLNYSI+++WR W+++GQVAGYTRTY+N MTFAT  G 
Sbjct  406  SLIYSGDHDMIVPHFGTQAWIKSLNYSIIDDWRQWILQGQVAGYTRTYANKMTFAT--GG  463

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GHI PE+KP EC AMF RWI+++PL
Sbjct  464  GHIAPEYKPAECQAMFERWISHQPL  488



>ref|XP_010936155.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=476

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDMIVP + T+AWI+SLN+SIV++WRPW  +GQVAG+TRTYSN +TFATVKG G
Sbjct  393  LVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNNLTFATVKGAG  452

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECL M  RW++  PL
Sbjct  453  HTAPEYRPKECLVMLQRWLSDAPL  476



>dbj|BAF99695.1| 1-O-acylglucose:anthocyanin-O-acyltransferase [Clitoria ternatea]
Length=469

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -2

Query  410  NLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNG  231
            NL    +  +++ SGDHD++VP + T+AWI+SLNYSIV++WR W   GQVAGYTRTYSN 
Sbjct  376  NLSGKGYYRSLVYSGDHDLMVPFLGTQAWIRSLNYSIVDDWRQWNTNGQVAGYTRTYSNR  435

Query  230  MTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            MTFATVKG GH  PE+KP EC AM++RWI+  PL
Sbjct  436  MTFATVKGGGHTAPEFKPEECFAMYSRWISKRPL  469



>ref|XP_010936148.1| PREDICTED: serine carboxypeptidase-like 18 isoform X4 [Elaeis 
guineensis]
Length=342

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDMIVP + T+AWI+SLN+SIV++WRPW   GQVAG+TRTYSN +TFATVKG G
Sbjct  259  LVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNNLTFATVKGAG  318

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECL M  RW++  PL
Sbjct  319  HTAPEYRPKECLVMLQRWLSGAPL  342



>ref|XP_008644916.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Zea mays]
Length=481

 Score =   130 bits (327),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ +GDHDM+VP I T+AWI+SLN+S V+EWRPW V+GQVAG+TR+YSN +TFATVKG 
Sbjct  397  SLVYNGDHDMVVPFIGTQAWIRSLNFSTVDEWRPWFVDGQVAGFTRSYSNNLTFATVKGG  456

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +C AMF RW++ +PL
Sbjct  457  GHTAPEYMPRQCFAMFVRWVSGDPL  481



>ref|XP_007136774.1| hypothetical protein PHAVU_009G072900g [Phaseolus vulgaris]
 gb|ESW08768.1| hypothetical protein PHAVU_009G072900g [Phaseolus vulgaris]
Length=464

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP ++T+AWI++LNYSIV +WR W   GQVAGYTRTYSN MTFATVKG 
Sbjct  380  SLIYSGDHDMVVPLLSTQAWIRALNYSIVSDWRQWYYNGQVAGYTRTYSNRMTFATVKGG  439

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P ECLAMF RWI+  PL
Sbjct  440  GHTAPEFRPEECLAMFMRWISNRPL  464



>ref|XP_011006039.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
17 [Populus euphratica]
Length=325

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDM++P + T+AWI+SLNYSIV++W PW  +GQVAGYTRTYS+ +TFATV G G
Sbjct  242  VLNSGDHDMVIPFLGTQAWIRSLNYSIVDDWHPWHFQGQVAGYTRTYSSQLTFATVMGGG  301

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE KP EC AMF RWI  EPL
Sbjct  302  HTAPEHKPAECFAMFKRWILQEPL  325



>ref|XP_010936156.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=394

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDMIVP + T+AWI+SLN+SIV++WRPW  +GQVAG+TRTYSN +TF TVKG G
Sbjct  311  LVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNNLTFVTVKGGG  370

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H+ PE++P ECL M  RW++  PL
Sbjct  371  HLAPEYRPKECLVMLQRWLSGAPL  394



>ref|XP_004288266.1| PREDICTED: serine carboxypeptidase-like 18-like [Fragaria vesca 
subsp. vesca]
Length=485

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = -2

Query  443  ENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQ  264
            E +   V+  H  L T     +I SGDHDMI+P + T AWIKSLN+ IV+ WRPW+V+GQ
Sbjct  381  ERYFRSVLSYHQSLTTRGYRALIYSGDHDMIIPHLGTLAWIKSLNFIIVDHWRPWLVDGQ  440

Query  263  VAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            VAGY+  YSN  TFATVKG GH  PE++P EC AMF RWI+ EPL
Sbjct  441  VAGYSVEYSNNFTFATVKGGGHTAPEYQPKECFAMFKRWISDEPL  485



>ref|XP_009626153.1| PREDICTED: serine carboxypeptidase-like 13 [Nicotiana tomentosiformis]
Length=466

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM +P  +T+ WIK LNYSIV+EWRPW+V+ QVAGYTR+YSN MTFATVKG 
Sbjct  382  SLIYSGDHDMGIPFQSTQFWIKFLNYSIVDEWRPWIVDDQVAGYTRSYSNQMTFATVKGA  441

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH+ PE+KP EC  MF+RW+++E L
Sbjct  442  GHVAPEYKPKECFTMFHRWLSHEQL  466



>ref|XP_003604935.1| Serine carboxypeptidase [Medicago truncatula]
Length=219

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD++VP I+T+AWI+ LNYSIV++WR W V GQV GYTRTYSN MT+ATVKG+
Sbjct  135  SLIYSGDHDVVVPFISTQAWIRDLNYSIVDDWRSWFVNGQVGGYTRTYSNQMTYATVKGS  194

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GHI PE+ P  C  MF RWI+  PL
Sbjct  195  GHIAPEYTPELCFPMFTRWISNLPL  219



>ref|XP_003602921.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=270

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHDM VP +AT+AWI+SLNYSIV++WR W    QVAGYTRTYSN MTFATVKG G
Sbjct  187  LIYSGDHDMKVPFVATQAWIRSLNYSIVDDWRQWYSNSQVAGYTRTYSNRMTFATVKGAG  246

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE+K  ECLAM +RWI+  PL
Sbjct  247  HTAPEYKREECLAMLSRWISNNPL  270



>tpg|DAA39924.1| TPA: hypothetical protein ZEAMMB73_827985 [Zea mays]
Length=122

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDM VP I T++WI+SLN+SIV++WRPW V+GQVAGYT  YSN +TFATVKG 
Sbjct  38   SLVYSGDHDMGVPYIGTQSWIRSLNFSIVDDWRPWYVDGQVAGYTVLYSNNLTFATVKGA  97

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +CLAM +RW+A + L
Sbjct  98   GHTAPEYMPRQCLAMLSRWLAGDTL  122



>ref|XP_010936147.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Elaeis 
guineensis]
Length=370

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDMIVP + T+AWI+SLN+SIV++WRPW   GQVAG+TRTYSN +TFATVKG G
Sbjct  287  LVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNNLTFATVKGAG  346

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECL M  RW++  PL
Sbjct  347  HTAPEYRPKECLVMLQRWLSGAPL  370



>ref|XP_010936154.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=499

 Score =   129 bits (325),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHD++VP + T+AWI+SLN+SIV++WRPW  +GQVAG+TRTYSN +TFATVKG G
Sbjct  416  LVYSGDHDLLVPFVGTQAWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNNLTFATVKGAG  475

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECL M  RW++  PL
Sbjct  476  HTAPEYRPKECLVMLQRWLSGAPL  499



>ref|XP_010936145.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=394

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDMIVP + T+AWI+SLN+SIV++WRPW   GQVAG+TRTYSN +TFATVKG G
Sbjct  311  LVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNNLTFATVKGAG  370

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECL M  RW++  PL
Sbjct  371  HTAPEYRPKECLVMLQRWLSGAPL  394



>ref|XP_010936146.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=394

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDMIVP + T+AWI+SLN+SIV++WRPW   GQVAG+TRTYSN +TFATVKG G
Sbjct  311  LVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNNLTFATVKGAG  370

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECL M  RW++  PL
Sbjct  371  HTAPEYRPKECLVMLQRWLSGAPL  394



>ref|XP_003593863.1| Serine carboxypeptidase [Medicago truncatula]
Length=158

 Score =   123 bits (309),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD+ +P + T+AWI++LNYSIV++WR W  + QVAGYTRTYSNGMTFATVKG 
Sbjct  74   SLIYSGDHDISIPFLDTQAWIRALNYSIVDDWRQWHTDDQVAGYTRTYSNGMTFATVKGG  133

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P EC AMF+RWI+   L
Sbjct  134  GHTAPEFRPEECFAMFSRWISRRAL  158



>ref|XP_006597032.1| PREDICTED: uncharacterized protein LOC100794342 isoform X1 [Glycine 
max]
Length=461

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM +P + T+AWI SLNYSIV++WR W  +GQVAGYTRTYSN MTFATVKG 
Sbjct  377  SLIYSGDHDMKIPFLETQAWISSLNYSIVDDWRQWHTDGQVAGYTRTYSNRMTFATVKGG  436

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAMF RWI+ + L
Sbjct  437  GHTAPEYKPEECLAMFRRWISNKAL  461



>ref|NP_001242803.1| uncharacterized protein LOC100794342 [Glycine max]
 gb|ACU21515.1| unknown [Glycine max]
Length=485

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM +P + T+AWI SLNYSIV++WR W  +GQVAGYTRTYSN MTFATVKG 
Sbjct  401  SLIYSGDHDMKIPFLETQAWISSLNYSIVDDWRQWHTDGQVAGYTRTYSNRMTFATVKGG  460

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAMF RWI+ + L
Sbjct  461  GHTAPEYKPEECLAMFRRWISNKAL  485



>ref|XP_006376415.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|ERP54212.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=428

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHDM VP + T+AWI+SLNYSIV++W PW  +GQVAGYTRTYS+ +TFATVKG G
Sbjct  345  LIYSGDHDMEVPFLGTQAWIRSLNYSIVDDWHPWHFQGQVAGYTRTYSSQLTFATVKGGG  404

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  P ++P EC AMF RWI  EPL
Sbjct  405  HTAPGYRPAECFAMFKRWIVQEPL  428



>ref|XP_006356867.1| PREDICTED: serine carboxypeptidase-like 19-like [Solanum tuberosum]
Length=839

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -2

Query  443  ENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQ  264
            EN +   I  H  L      ++I SGDHDM V  ++T++WI+SLNYSIV++WR W V+ Q
Sbjct  344  ENMIFNSIPYHENLSRKGYRSLIYSGDHDMNVTFLSTQSWIRSLNYSIVDDWRAWTVDNQ  403

Query  263  VAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL*FMKHLERVIFKTS  87
            VAGYTR+YSN MTFATVKG GH  PE+KP ECLAM  RW++Y+PL ++     V  +++
Sbjct  404  VAGYTRSYSNQMTFATVKGAGHTAPEYKPRECLAMLTRWMSYQPLNYLSTSNEVEVRSA  462


 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L +    ++I SGDHDM V  ++T++WI+SLNYSIV++WR W V+ QVAGYTR+YSN
Sbjct  745  HENLSSKVYRSLIYSGDHDMNVTFLSTQSWIRSLNYSIVDDWRAWTVDNQVAGYTRSYSN  804

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MTFATVKG GH  PE+KP ECLAM  RW++Y+PL
Sbjct  805  QMTFATVKGAGHTAPEYKPRECLAMLTRWMSYQPL  839



>ref|XP_003604929.1| Serine carboxypeptidase [Medicago truncatula]
Length=923

 Score =   131 bits (330),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 62/113 (55%), Positives = 79/113 (70%), Gaps = 8/113 (7%)
 Frame = -2

Query  458  IIGNIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPW  279
            I G++E H        NL    + S +I SGDHD +VP I+T+AWI++LNYSIV++WRPW
Sbjct  369  IFGSVEFHA-------NLSKKGYRS-LIYSGDHDAVVPFISTQAWIRNLNYSIVDDWRPW  420

Query  278  MVEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL*FM  120
             V GQV GYTRTYSN MTF TVKG+GH  PE+ P +C  MF RWI+  PL ++
Sbjct  421  FVNGQVGGYTRTYSNQMTFVTVKGSGHTAPEYTPDQCFGMFTRWISNLPLYYL  473


 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SG  D IVP ++T+AWI+ LNYS V++WRPW V GQV GYTRT SN MTFATVKG+
Sbjct  839  SLIYSGVLDAIVPFMSTQAWIRDLNYSTVDDWRPWFVNGQVGGYTRTCSNRMTFATVKGS  898

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  P   P +C AMF RWI+  PL
Sbjct  899  GHTAPADAPEQCFAMFTRWISNLPL  923



>gb|KHN06942.1| Serine carboxypeptidase-like 19 [Glycine soja]
Length=475

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM +P + T+AWI SLNYSIV++WR W  +GQVAGYTRTYSN MTFATVKG 
Sbjct  391  SLIYSGDHDMKIPFLETQAWISSLNYSIVDDWRQWHTDGQVAGYTRTYSNRMTFATVKGG  450

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAMF RWI+ + L
Sbjct  451  GHTAPEYKPEECLAMFRRWISNKAL  475



>ref|XP_006356866.1| PREDICTED: uncharacterized protein LOC102592829 [Solanum tuberosum]
Length=1021

 Score =   131 bits (330),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD++V   +T+AWIKSLNYSIV++WR W V+ QVAGYTR+YSN MTFATVKG 
Sbjct  369  SLIYSGDHDIVVTFRSTQAWIKSLNYSIVDDWRAWTVDNQVAGYTRSYSNQMTFATVKGA  428

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL*FMKHLER  105
            GH  PE+KP ECLAM  +W++Y+P  F  H E+
Sbjct  429  GHTAPEYKPRECLAMLTKWMSYQPFHF--HCEK  459


 Score =   129 bits (325),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  383   NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
             ++I SGDHD +V   +T+AWIKSLNYS+V++WR W V+ +VAGYTR+YSN MTFATVKG 
Sbjct  937   SLIYSGDHDKLVTFQSTQAWIKSLNYSVVDDWRAWTVDNEVAGYTRSYSNQMTFATVKGA  996

Query  203   GHIPPEWKPLECLAMFNRWIAYEPL  129
             GH  PE+KP ECLAM  RW++Y+PL
Sbjct  997   GHTAPEYKPRECLAMLTRWMSYQPL  1021



>ref|XP_010320340.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=474

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y  NL +  + S +I SGDHD  VP  +T+ WIKSLNYSIV++WRPW V  QVAGYT
Sbjct  376  VVPYHANLSIKGYRS-LIYSGDHDYSVPFQSTQKWIKSLNYSIVDDWRPWNVNNQVAGYT  434

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            R+YSN MTFATVKG+GH    +KP EC  MF RWI Y+PL
Sbjct  435  RSYSNKMTFATVKGSGHTACRYKPEECFVMFKRWINYDPL  474



>ref|XP_004292764.1| PREDICTED: serine carboxypeptidase-like 18-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP + T+AWI+SLNYSIV++WRPW V  Q+AGYTRTY+N MTFATVKG 
Sbjct  389  SLIYSGDHDMLVPFLGTQAWIRSLNYSIVDDWRPWFVHSQIAGYTRTYANRMTFATVKGA  448

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  ECL MF RWI+ E L
Sbjct  449  GHTAPEYKREECLNMFTRWISGELL  473



>gb|AFK37593.1| unknown [Medicago truncatula]
Length=233

 Score =   124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHDM +P +AT+AWI+SLNYSIV++WR W    QVAGYTRTYSN MTFATVKG G
Sbjct  150  LIYSGDHDMKIPFLATQAWIRSLNYSIVDDWRQWHTNDQVAGYTRTYSNQMTFATVKGGG  209

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P EC  MF+RWI    L
Sbjct  210  HTAPEYRPKECFDMFSRWIFKRAL  233



>ref|XP_010321496.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Solanum 
lycopersicum]
Length=454

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = -2

Query  425  VIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTR  246
            V Y  NL    F S +I SGDHDM+VP  +T+ WIKSL YSI+++W+PW+V+GQVAGYTR
Sbjct  357  VSYHANLSRKGFRS-LIYSGDHDMVVPFSSTQLWIKSLKYSIIDDWKPWVVDGQVAGYTR  415

Query  245  TYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            +YSN MTFATVKG GH  PEWK +ECL M  RW+++  L
Sbjct  416  SYSNQMTFATVKGGGHTAPEWKRVECLEMLKRWLSHVSL  454



>ref|XP_010321495.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=457

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = -2

Query  425  VIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTR  246
            V Y  NL    F S +I SGDHDM+VP  +T+ WIKSL YSI+++W+PW+V+GQVAGYTR
Sbjct  360  VSYHANLSRKGFRS-LIYSGDHDMVVPFSSTQLWIKSLKYSIIDDWKPWVVDGQVAGYTR  418

Query  245  TYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            +YSN MTFATVKG GH  PEWK +ECL M  RW+++  L
Sbjct  419  SYSNQMTFATVKGGGHTAPEWKRVECLEMLKRWLSHVSL  457



>gb|KCW54736.1| hypothetical protein EUGRSUZ_I00690 [Eucalyptus grandis]
Length=492

 Score =   128 bits (321),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM++P + T++WIK+LN S +++WRPWMV  QVAG+TR YSNG+TFATVKG 
Sbjct  408  SLIYSGDHDMVIPYLGTQSWIKTLNLSTMDDWRPWMVGDQVAGFTREYSNGLTFATVKGG  467

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P EC AM+ RWI  EPL
Sbjct  468  GHTAPEYLPEECFAMYKRWIHREPL  492



>ref|XP_004486284.1| PREDICTED: serine carboxypeptidase-like 12-like [Cicer arietinum]
Length=464

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYSIV++WR W    QVAGY RTYSN MTFATVKG 
Sbjct  380  SLIYSGDHDMTVPFLATQAWIRSLNYSIVDDWRQWRTNDQVAGYKRTYSNQMTFATVKGG  439

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP EC  MF+RWI+ +PL
Sbjct  440  GHTAPEFKPKECFEMFSRWISKKPL  464



>ref|XP_008790304.1| PREDICTED: uncharacterized protein LOC103707550 [Phoenix dactylifera]
Length=982

 Score =   130 bits (328),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 77/110 (70%), Gaps = 15/110 (14%)
 Frame = -2

Query  413  HNLLLTY-------FESNI--------ICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPW  279
            H+LL TY       F  N+        + SGDHDM VP + T+ WI+SLN+SIV++WRPW
Sbjct  873  HDLLYTYDIPSSIKFHLNLTSRGYRALVYSGDHDMGVPFVGTQGWIRSLNFSIVDDWRPW  932

Query  278  MVEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             V+GQVAG+TRTYSN +TFATVKG GH  PE++P ECLAM  RW++  PL
Sbjct  933  SVDGQVAGFTRTYSNNLTFATVKGAGHTAPEYRPKECLAMLQRWLSGAPL  982


 Score =   130 bits (326),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDM+VP + T+ WI+SLN+SIV++WRPW  +GQVAG+TRTYSN +TFATVKG G
Sbjct  393  LVYSGDHDMLVPFLGTQGWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNNLTFATVKGAG  452

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECLAM  RW++  PL
Sbjct  453  HTAPEYRPKECLAMLQRWLSGVPL  476



>ref|XP_009393004.1| PREDICTED: serine carboxypeptidase-like 2 [Musa acuminata subsp. 
malaccensis]
Length=468

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHD++VP + T AWIKSLNYSIV++WR W V+GQVAGYT TY N +TFATVK  G
Sbjct  385  LVYSGDHDLVVPFLGTMAWIKSLNYSIVDDWRSWHVDGQVAGYTMTYVNNLTFATVKNGG  444

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECLAM  RWI+Y+PL
Sbjct  445  HTTPEYRPKECLAMIRRWISYQPL  468



>ref|XP_007159376.1| hypothetical protein PHAVU_002G233100g [Phaseolus vulgaris]
 gb|ESW31370.1| hypothetical protein PHAVU_002G233100g [Phaseolus vulgaris]
Length=480

 Score =   127 bits (319),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD+++P +AT+AWI+SLNYSIV++WR W  +GQVAGYTRTYSN MTFATVKG 
Sbjct  396  SLIYSGDHDLLIPFLATQAWIRSLNYSIVDDWRQWHTDGQVAGYTRTYSNRMTFATVKGA  455

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECL M++RW++   L
Sbjct  456  GHTAPEYKPKECLDMYSRWLSKRAL  480



>ref|XP_009384628.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384629.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  371  SGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTGHIP  192
            SGDHDM VP + T+AWI+SLN+SIV++WR W V+GQVAG+TRTYSN +TF T+KG GH  
Sbjct  392  SGDHDMSVPFVGTQAWIRSLNFSIVDDWRSWFVDGQVAGFTRTYSNNLTFVTIKGGGHTA  451

Query  191  PEWKPLECLAMFNRWIAYEPL  129
            PE+KP ECLAM +RW A  PL
Sbjct  452  PEYKPKECLAMVDRWFAGSPL  472



>gb|AES73172.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=496

 Score =   127 bits (319),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYSIV++WR W    QVAGYTRTYSN MTFATVKG 
Sbjct  412  SLIYSGDHDMKVPFVATQAWIRSLNYSIVDDWRQWYSNSQVAGYTRTYSNRMTFATVKGA  471

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  ECLAM +RWI+  PL
Sbjct  472  GHTAPEYKREECLAMLSRWISNNPL  496



>ref|XP_006356850.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=481

 Score =   127 bits (319),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP  +TEAWIKSLNYSIV+ WR W+V GQVAGYTR+Y+N MTFATVKG 
Sbjct  397  SLIYSGDHDMGVPFQSTEAWIKSLNYSIVDNWRQWIVNGQVAGYTRSYANKMTFATVKGA  456

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH+ PE+K  E   MF RWI++ PL
Sbjct  457  GHVAPEYKREESFNMFKRWISHNPL  481



>ref|XP_003604931.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES87128.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=470

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +VP ++T+AWI+ LNYSIV++WRPW V GQV GYTRTY+N MTFATVKG+
Sbjct  386  SLIYSGDHDAVVPFMSTQAWIRDLNYSIVDDWRPWFVNGQVGGYTRTYANRMTFATVKGS  445

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +C  MF RWI+  PL
Sbjct  446  GHTAPEYTPEQCFPMFTRWISNLPL  470



>ref|XP_007138067.1| hypothetical protein PHAVU_009G177800g [Phaseolus vulgaris]
 gb|ESW10061.1| hypothetical protein PHAVU_009G177800g [Phaseolus vulgaris]
Length=495

 Score =   127 bits (318),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP ++T+AWI+SLNYSIV++WRPW   GQVAGYTR+YSN MTFATVKG 
Sbjct  411  SLIYSGDHDMAVPFLSTQAWIRSLNYSIVDDWRPWHTNGQVAGYTRSYSNQMTFATVKGG  470

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
             HI P  KP EC AM+ RWI+   L
Sbjct  471  SHIAPMNKPEECFAMYTRWISKRAL  495



>ref|XP_009382032.1| PREDICTED: serine carboxypeptidase-like 7 [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   126 bits (317),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHD+ VP + T+AWI+SLN+SIV++WRPW VEGQVAG+TR+YSN +TFATVKG G
Sbjct  396  LVYSGDHDLTVPFLGTQAWIRSLNFSIVDDWRPWSVEGQVAGFTRSYSNNLTFATVKGGG  455

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P EC AM  RW++  PL
Sbjct  456  HTAPEYQPKECFAMVQRWLSGAPL  479



>gb|KHN47358.1| ABC transporter B family member 9 [Glycine soja]
Length=1648

 Score =   130 bits (326),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = -2

Query  383   NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
             ++I SGDHDM +P +AT+AWI+SLNYSIV+EWR W   GQVAGYTRTYSN MTFAT  G 
Sbjct  1566  SLIYSGDHDMTIPFLATQAWIRSLNYSIVDEWRQWHTNGQVAGYTRTYSNRMTFAT--GG  1623

Query  203   GHIPPEWKPLECLAMFNRWIAYEPL  129
             GH  PE+KP EC AMF+RWI+   L
Sbjct  1624  GHTAPEYKPDECFAMFSRWISNRAL  1648



>ref|XP_009103431.1| PREDICTED: serine carboxypeptidase-like 10 [Brassica rapa]
Length=440

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP+IAT+AWIKSLNYSI+++WRPWM++ Q+AGYTRTYSN MTF+T+KG+
Sbjct  357  SLIYSGDHDMTVPSIATQAWIKSLNYSIIDDWRPWMIKTQIAGYTRTYSNKMTFSTIKGS  416

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI+ +PL
Sbjct  417  GHT-AEYKPNETFIMFQRWISGQPL  440



>ref|XP_010936152.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=452

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDM+VP + T+AWI+SLN+SIV++WR W  +GQVAG+TRTYSN +TFATVKG G
Sbjct  369  LVYSGDHDMVVPFLGTQAWIRSLNFSIVDDWRSWSADGQVAGFTRTYSNNLTFATVKGGG  428

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECL M  RW++  PL
Sbjct  429  HTAPEYRPKECLVMLQRWLSGAPL  452



>ref|XP_010936150.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
 ref|XP_010936151.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=476

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDM+VP + T+AWI+SLN+SIV++WR W  +GQVAG+TRTYSN +TFATVKG G
Sbjct  393  LVYSGDHDMVVPFLGTQAWIRSLNFSIVDDWRSWSADGQVAGFTRTYSNNLTFATVKGGG  452

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECL M  RW++  PL
Sbjct  453  HTAPEYRPKECLVMLQRWLSGAPL  476



>ref|XP_010939016.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=498

 Score =   126 bits (316),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHD+++P + T+AWI SLN+S+V+EWR W V GQVAGYT TYSN +TFATVKG G
Sbjct  415  LIYSGDHDLMIPFLGTQAWISSLNFSVVDEWRSWHVGGQVAGYTTTYSNNLTFATVKGAG  474

Query  200  HIPPEWKPLECLAMFNRWIA  141
            H  PE+KP ECLAM  RWI+
Sbjct  475  HTAPEYKPEECLAMLQRWIS  494



>gb|KEH29043.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=419

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD++VP I+T+AWI+ LNYSIV++WR W V GQV GYTRTYSN MT+ATVKG+
Sbjct  335  SLIYSGDHDVVVPFISTQAWIRDLNYSIVDDWRSWFVNGQVGGYTRTYSNQMTYATVKGS  394

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GHI PE+ P  C  MF RWI+  PL
Sbjct  395  GHIAPEYTPELCFPMFTRWISNLPL  419



>ref|XP_010030506.1| PREDICTED: serine carboxypeptidase-like 7 [Eucalyptus grandis]
Length=506

 Score =   126 bits (316),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM++P + T++WIK+LN S +++WRPWMV  QVAG+TR YSNG+TFATVKG 
Sbjct  422  SLIYSGDHDMVIPYLGTQSWIKTLNLSTMDDWRPWMVGDQVAGFTREYSNGLTFATVKGG  481

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P EC AM+ RWI  EPL
Sbjct  482  GHTAPEYLPEECFAMYKRWIHREPL  506



>ref|XP_003593858.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES64109.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I +GDHDM VP +AT+AWI+SLNYSIV++WR W  + QVAGYTRTYSN MTFATVKG 
Sbjct  385  SLIYNGDHDMTVPFLATQAWIRSLNYSIVDDWRQWYTDDQVAGYTRTYSNQMTFATVKGG  444

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P EC  MF+RWI+   L
Sbjct  445  GHTAPEFRPKECFDMFSRWISKRAL  469



>ref|XP_008790306.1| PREDICTED: uncharacterized protein LOC103707552 [Phoenix dactylifera]
Length=972

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHDM VP + T+ WI+SLN+SIV++WRPW  +GQVAG+TRTYSN +TFATVKG G
Sbjct  889  LVYSGDHDMAVPFVGTQGWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNNLTFATVKGAG  948

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECLAM  RW++  PL
Sbjct  949  HTAPEYRPKECLAMLQRWLSGVPL  972


 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHD+++P + T+ WI+SLN+SIV++WRPW  +GQVAG+TR YSN +TFATVKG G
Sbjct  393  LVYSGDHDLLIPFLGTQGWIRSLNFSIVDDWRPWSADGQVAGFTRAYSNNLTFATVKGAG  452

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H+ PE++P E LAM  RW++  PL
Sbjct  453  HLAPEYRPKESLAMLQRWLSGAPL  476



>ref|NP_001189581.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
 gb|AEC07375.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
Length=256

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHD++VP +AT+AWIKSLNYSI+ EWRPWM++ Q+AGYTRTYSN MTFATVKG+G
Sbjct  174  LIYSGDHDLVVPFLATQAWIKSLNYSIIHEWRPWMIKDQIAGYTRTYSNKMTFATVKGSG  233

Query  200  HIPPEWKPLECLAMFNRWIA  141
            H   E+KP E   MF RWI+
Sbjct  234  HT-AEYKPNETFIMFQRWIS  252



>ref|XP_006354895.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=472

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y  NL    + S +I SGDHD  VP  +T+ WIKSLNYSIV++WRPW V  QVAGYT
Sbjct  374  VVPYHANLSTKGYRS-LIYSGDHDYSVPFQSTQKWIKSLNYSIVDDWRPWNVNNQVAGYT  432

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            R+YSN MTFATVKG+GH    +KP EC  MF RWI ++PL
Sbjct  433  RSYSNKMTFATVKGSGHTACRYKPEECFGMFKRWINHDPL  472



>ref|XP_003571685.1| PREDICTED: serine carboxypeptidase-like 17 [Brachypodium distachyon]
Length=467

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L +    ++I SGDHDM+VP + T+AWI+SL +S+ +EWRPW V  QVAG+TRTYSN
Sbjct  373  HRSLTSRGYRSLIYSGDHDMVVPFVGTQAWIRSLGFSVQDEWRPWYVNAQVAGFTRTYSN  432

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             +TFATVKG GH  PE+KP ECL M  RW++  PL
Sbjct  433  NLTFATVKGGGHTAPEYKPKECLDMVARWLSGHPL  467



>ref|XP_009612206.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nicotiana 
tomentosiformis]
Length=386

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP  +T+AWIK LNYSI+++WRPW ++GQVAGYTR++SN MT+ATVKG 
Sbjct  302  SLIYSGDHDMVVPFQSTQAWIKYLNYSIIDDWRPWTIDGQVAGYTRSFSNHMTYATVKGG  361

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  E   MF RWIA +PL
Sbjct  362  GHTAPEYKREESFHMFKRWIAQQPL  386



>gb|KEH29044.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=466

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD++VP I+T+AWI+ LNYSIV++WR W V GQV GYTRTYSN MT+ATVKG+
Sbjct  382  SLIYSGDHDVVVPFISTQAWIRDLNYSIVDDWRSWFVNGQVGGYTRTYSNQMTYATVKGS  441

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GHI PE+ P  C  MF RWI+  PL
Sbjct  442  GHIAPEYTPELCFPMFTRWISNLPL  466



>ref|XP_010314600.1| PREDICTED: serine carboxypeptidase-like 11 [Solanum lycopersicum]
Length=463

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP  +T+AWIK LNYSI+++WRPW V+GQV GYTR++SN MTFAT+KG 
Sbjct  379  SLIYSGDHDMVVPFQSTQAWIKYLNYSIIDDWRPWTVDGQVEGYTRSFSNHMTFATIKGG  438

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  E   MF RWIA +PL
Sbjct  439  GHTAPEYKRKESFHMFKRWIAQQPL  463



>ref|XP_010939013.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=456

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHD++VP + T+AWI+SLN+S+V+EWR W V GQVAGYT  +SN +TFATV+G G
Sbjct  373  LVYSGDHDLVVPFVGTQAWIRSLNFSVVDEWRSWHVGGQVAGYTTAFSNNLTFATVRGAG  432

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE+KP ECLAM  RWI+  PL
Sbjct  433  HTAPEYKPEECLAMLQRWISSRPL  456



>ref|XP_010939015.1| PREDICTED: serine carboxypeptidase-like 18 isoform X4 [Elaeis 
guineensis]
Length=432

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHD++VP + T+AWI+SLN+S+V+EWR W V GQVAGYT  +SN +TFATV+G G
Sbjct  349  LVYSGDHDLVVPFVGTQAWIRSLNFSVVDEWRSWHVGGQVAGYTTAFSNNLTFATVRGAG  408

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE+KP ECLAM  RWI+  PL
Sbjct  409  HTAPEYKPEECLAMLQRWISSRPL  432



>ref|XP_004238067.1| PREDICTED: uncharacterized protein LOC101252078 [Solanum lycopersicum]
Length=907

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP  +TEAWIKSLNYSIV+ WR W+V GQVAGYTR+Y+N MT+ATVKG 
Sbjct  823  SLIYSGDHDMGVPFQSTEAWIKSLNYSIVDNWRQWIVNGQVAGYTRSYANKMTYATVKGA  882

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH+ PE+K  EC  MF RWI++ PL
Sbjct  883  GHVAPEYKREECFNMFKRWISHNPL  907


 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD IV   +T+AWIKSLNYSIV++WR W V+ QVAGYTR+YSN MTFATVKG 
Sbjct  372  SLIYSGDHDKIVTFRSTQAWIKSLNYSIVDDWRAWTVDNQVAGYTRSYSNQMTFATVKGA  431

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL*FM  120
            GH  PE+KP ECLAM  RWI   PL F+
Sbjct  432  GHTAPEYKPRECLAMLTRWILNLPLNFL  459



>tpg|DAA39921.1| TPA: Serine carboxypeptidase 1 [Zea mays]
Length=522

 Score =   125 bits (314),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDM VP I T++WI+SLN+SIV++WRPW V+GQVAGYT  YSN +TFATVKG 
Sbjct  438  SLVYSGDHDMGVPYIGTQSWIRSLNFSIVDDWRPWYVDGQVAGYTVLYSNNLTFATVKGA  497

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +CLAM +RW+A + L
Sbjct  498  GHTAPEYMPRQCLAMLSRWLAGDTL  522



>ref|XP_003593859.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES64110.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM +P +AT+AWI+SLNYSIV++WR W    QVAGYTRTYSN MTFATVKG 
Sbjct  385  SLIYSGDHDMKIPFLATQAWIRSLNYSIVDDWRQWHTNDQVAGYTRTYSNQMTFATVKGG  444

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P EC  MF+RWI+   L
Sbjct  445  GHTAPEYRPKECFDMFSRWISKRAL  469



>ref|XP_009612197.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Nicotiana 
tomentosiformis]
Length=474

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP  +T+AWIK LNYSI+++WRPW ++GQVAGYTR++SN MT+ATVKG 
Sbjct  390  SLIYSGDHDMVVPFQSTQAWIKYLNYSIIDDWRPWTIDGQVAGYTRSFSNHMTYATVKGG  449

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  E   MF RWIA +PL
Sbjct  450  GHTAPEYKREESFHMFKRWIAQQPL  474



>ref|XP_002460078.1| hypothetical protein SORBIDRAFT_02g022430 [Sorghum bicolor]
 gb|EER96599.1| hypothetical protein SORBIDRAFT_02g022430 [Sorghum bicolor]
Length=457

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDM VP I T++WI+SLN+S+V++WRPW V+GQVAGYT  YSN +TFATVKG 
Sbjct  373  SLVYSGDHDMAVPYIGTQSWIRSLNFSVVDDWRPWYVDGQVAGYTTLYSNNLTFATVKGA  432

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +CLAM +RW+A  PL
Sbjct  433  GHTAPEYMPRQCLAMLSRWLAGLPL  457



>emb|CDY11114.1| BnaC06g23660D [Brassica napus]
Length=439

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = -2

Query  440  NHVIV--VIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEG  267
            NH IV  V Y  N  ++ + S +I SGDHDM VP + T+AWI+SLNYSI+ +WRPWM++ 
Sbjct  336  NHDIVSSVPYHKNNSISGYRS-LIFSGDHDMAVPYLGTQAWIRSLNYSIINDWRPWMIDD  394

Query  266  QVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            Q+AGYTRTY+N MTFAT+K +GH  PE+KP E   MF RWI+ +PL
Sbjct  395  QIAGYTRTYANKMTFATIKASGHT-PEYKPEESFIMFERWISGQPL  439



>ref|XP_003604928.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES87125.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=470

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGD D +VP I+T+AWI++LNYSIV++WRPW V+ QV GYTRTYSN MTFATVKG+
Sbjct  386  SLIYSGDQDAVVPFISTQAWIRNLNYSIVDDWRPWFVKDQVGGYTRTYSNRMTFATVKGS  445

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +C  MF RWI+  PL
Sbjct  446  GHTAPEYTPEQCFPMFTRWISNLPL  470



>ref|XP_006404766.1| hypothetical protein EUTSA_v10000651mg [Eutrema salsugineum]
 gb|ESQ46219.1| hypothetical protein EUTSA_v10000651mg [Eutrema salsugineum]
Length=435

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP +AT+AWI+SLNYSI+++WRPWMV  Q+AGYTRTY+N MTFATVKG 
Sbjct  352  SLIYSGDHDMVVPFMATQAWIRSLNYSIIDDWRPWMVNDQIAGYTRTYANKMTFATVKGG  411

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI+ +PL
Sbjct  412  GHT-AEYKPNETFIMFQRWISGQPL  435



>gb|AAK95312.1|AF410326_1 T20K9.19/T20K9.19 [Arabidopsis thaliana]
 gb|AAN18098.1| At2g22980/T20K9.19 [Arabidopsis thaliana]
Length=250

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I +GDHDM+VP +AT+AWI+SLNYSI ++W+PWM+  Q+AGYTR+YSN MTFAT+KG+
Sbjct  167  SLIYNGDHDMMVPFLATQAWIRSLNYSITDDWKPWMINDQIAGYTRSYSNKMTFATIKGS  226

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI+ +PL
Sbjct  227  GH-TAEYKPKETSIMFKRWISAQPL  250



>ref|XP_006855958.1| hypothetical protein AMTR_s00037p00227730 [Amborella trichopoda]
 gb|ERN17425.1| hypothetical protein AMTR_s00037p00227730 [Amborella trichopoda]
Length=521

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = -2

Query  425  VIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTR  246
            V+Y +NL +  + S +I SGDHD  VP I T+AWI+SL + I+++WR W+V+GQV GYTR
Sbjct  372  VVYHYNLTMRGY-SALIYSGDHDSSVPFIGTQAWIRSLEFPIIDDWRAWLVDGQVVGYTR  430

Query  245  TYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             Y+N +TFATVKG GH  PE+KP EC+AM  RWI+ EP 
Sbjct  431  KYTNNLTFATVKGAGHTAPEYKPKECVAMLKRWISNEPF  469



>emb|CDP01266.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHD +VP  AT+AWI+SLNY I+++WR W+VEGQVAGYTR+Y+N MTFAT  G 
Sbjct  393  SLMYSGDHDFVVPFFATQAWIRSLNYPIIDDWRQWVVEGQVAGYTRSYANRMTFAT--GG  450

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P EC AMF RWI++EPL
Sbjct  451  GHTAPEYRPAECKAMFKRWISHEPL  475



>ref|XP_006342727.1| PREDICTED: uncharacterized protein LOC102585123 [Solanum tuberosum]
Length=913

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDMIVP  +T+AWIK LNYSI+++WRPWMV+GQV GYT++YSN MT+AT+KG 
Sbjct  829  SLIYSGDHDMIVPFQSTQAWIKYLNYSIIDDWRPWMVDGQVGGYTKSYSNHMTYATIKGG  888

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  E   MF RWIA +PL
Sbjct  889  GHTAPEYKREESFHMFKRWIAQQPL  913


 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP  +T+AWIK LNYSI+++WRPW ++GQVAGYTR++SN MT+ATVKG 
Sbjct  379  SLIYSGDHDMVVPFQSTQAWIKYLNYSIIDDWRPWTIDGQVAGYTRSFSNHMTYATVKGG  438

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  E   MF RWIA +PL
Sbjct  439  GHTTPEYKREESFHMFKRWIAQQPL  463



>ref|XP_010939017.1| PREDICTED: serine carboxypeptidase-like 12 isoform X2 [Elaeis 
guineensis]
Length=471

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHD+++P + T+AWI SLN+S+V+EWR W V GQVAGYT TYSN +TFATVKG G
Sbjct  388  LIYSGDHDLMIPFLGTQAWISSLNFSVVDEWRSWHVGGQVAGYTTTYSNNLTFATVKGAG  447

Query  200  HIPPEWKPLECLAMFNRWIA  141
            H  PE+KP ECLAM  RWI+
Sbjct  448  HTAPEYKPEECLAMLQRWIS  467



>ref|XP_009131550.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Brassica 
rapa]
Length=449

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD++ P I+T+AWI+SLNYSIVE+WRPWM+  QVAGYT+TY+N MT+ATVKG 
Sbjct  366  SLIFSGDHDLMAPFISTQAWIRSLNYSIVEKWRPWMIHNQVAGYTQTYANKMTYATVKGG  425

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  426  GHT-PEYKPKESFIMFQRWISGQPL  449



>ref|XP_009131551.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Brassica 
rapa]
Length=447

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD++ P I+T+AWI+SLNYSIVE+WRPWM+  QVAGYT+TY+N MT+ATVKG 
Sbjct  364  SLIFSGDHDLMAPFISTQAWIRSLNYSIVEKWRPWMIHNQVAGYTQTYANKMTYATVKGG  423

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  424  GHT-PEYKPKESFIMFQRWISGQPL  447



>ref|XP_004238557.1| PREDICTED: uncharacterized protein LOC101252581 [Solanum lycopersicum]
Length=921

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDMIV   +T+AWIKSLNYSIV++WR W V+ QVA YTR+YSN MTFATVKG 
Sbjct  376  SLIYSGDHDMIVTFPSTQAWIKSLNYSIVDDWRAWTVDNQVARYTRSYSNQMTFATVKGA  435

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAM  RW++Y+ L
Sbjct  436  GHTAPEYKPRECLAMLTRWMSYQLL  460


 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +V   +T+AWIKSLNYS+V++WR W V+ +VAGYTR+YSN MTFATVKG 
Sbjct  837  SLIYSGDHDKLVTFQSTQAWIKSLNYSVVDDWRAWTVDNEVAGYTRSYSNQMTFATVKGA  896

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAM  RW++++PL
Sbjct  897  GHTAPEYKPRECLAMLTRWMSHQPL  921



>gb|EPS63835.1| hypothetical protein M569_10950 [Genlisea aurea]
Length=182

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            V++Y  +L       ++I SG  D IVPT++TEAWIKSL+Y IV++WR W+V+GQ AGYT
Sbjct  85   VILYHKDLSRRGGYRSLIYSGTADSIVPTLSTEAWIKSLDYPIVDQWRAWLVDGQCAGYT  144

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            R+Y+N MTFA+  G GH+ PE+KP EC AM  RWI++ PL
Sbjct  145  RSYANNMTFAS--GGGHVAPEYKPKECQAMLKRWISHAPL  182



>ref|XP_008778119.1| PREDICTED: serine carboxypeptidase-like 18, partial [Phoenix 
dactylifera]
Length=271

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHD++VP + T+AW +SLN+S+V+EWR W V G +AGYT TYSN +TFATV+G G
Sbjct  188  LVYSGDHDLVVPFLGTQAWTRSLNFSVVDEWRSWHVGGHIAGYTTTYSNNLTFATVRGAG  247

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE+KP EC AM  RWI+  PL
Sbjct  248  HTAPEYKPEECFAMVQRWISSRPL  271



>ref|NP_179876.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
 sp|O81009.1|SCP12_ARATH RecName: Full=Serine carboxypeptidase-like 12; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC32439.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07373.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
Length=435

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD++VP +AT+AWIKSLNYSI+ EWRPWM++ Q+AGYTRTYSN MTFATVKG+
Sbjct  352  SLIYSGDHDLVVPFLATQAWIKSLNYSIIHEWRPWMIKDQIAGYTRTYSNKMTFATVKGS  411

Query  203  GHIPPEWKPLECLAMFNRWIA  141
            GH   E+KP E   MF RWI+
Sbjct  412  GHT-AEYKPNETFIMFQRWIS  431



>ref|NP_001151152.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACG41791.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACN35614.1| unknown [Zea mays]
Length=477

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDM VP I T++WI+SLN+SIV++WRPW V+GQVAGYT  YSN +TFATVKG 
Sbjct  393  SLVYSGDHDMGVPYIGTQSWIRSLNFSIVDDWRPWYVDGQVAGYTVLYSNNLTFATVKGA  452

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +CLAM +RW+A + L
Sbjct  453  GHTAPEYMPRQCLAMLSRWLAGDTL  477



>emb|CDX70702.1| BnaC03g07860D [Brassica napus]
Length=432

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD++ P I+T+AWI+SLNYSIVE+WRPWM+  QVAGYT+TY+N MT+ATVK +
Sbjct  349  SLIFSGDHDLMAPFISTQAWIRSLNYSIVEKWRPWMIHNQVAGYTQTYANKMTYATVKAS  408

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  409  GHT-PEYKPKESFIMFQRWISGQPL  432



>ref|XP_010515304.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=442

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP + T+AWI+SLNYSI+++WRPWM+  Q+AGYTRTY+N MTFAT+KG 
Sbjct  359  SLIFSGDHDMMVPFLGTQAWIRSLNYSIIDDWRPWMIGDQIAGYTRTYANKMTFATIKGG  418

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  419  GHT-PEYKPEESYIMFQRWISGQPL  442



>ref|XP_010426467.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=441

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP + T+AWI+SLNYSI+++WRPWM+  Q+AGYTRTY+N MTFAT+KG 
Sbjct  358  SLIFSGDHDMMVPFLGTQAWIRSLNYSIIDDWRPWMIGDQIAGYTRTYANKMTFATIKGG  417

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  418  GHT-PEYKPEESYIMFQRWISGQPL  441



>ref|XP_010503611.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=440

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP + T+AWI+SLNYSI+++WRPWM+  Q+AGYTRTY+N MTFAT+KG 
Sbjct  357  SLIFSGDHDMMVPFLGTQAWIRSLNYSIIDDWRPWMIGDQIAGYTRTYANKMTFATIKGG  416

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  417  GHT-PEYKPEESYIMFQRWISGQPL  440



>gb|ABR16352.1| unknown [Picea sitchensis]
Length=505

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            V+ Y  NL    + + +I SGDHD+IVP I T+AWI+SLNY+IV++WRPW V+ QVAGYT
Sbjct  407  VIEYHRNLTRKGYRA-LIYSGDHDLIVPFIGTQAWIRSLNYTIVDDWRPWWVDRQVAGYT  465

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            R Y N +TFATVKG GH  PE+KP +   MF +W + EPL
Sbjct  466  RLYDNNLTFATVKGGGHTAPEYKPRQTFVMFKQWTSGEPL  505



>ref|XP_010237149.1| PREDICTED: serine carboxypeptidase-like 18 [Brachypodium distachyon]
Length=313

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDM+VP + T+AWI+SL ++IV++WRPW  + QVAG+TR YSN +TFATVKG 
Sbjct  229  SLVYSGDHDMVVPFVGTQAWIRSLGFAIVDQWRPWYADIQVAGFTRMYSNNLTFATVKGG  288

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP ECLAM  RW++  PL
Sbjct  289  GHTAPEYKPKECLAMVVRWLSGRPL  313



>ref|XP_006663407.1| PREDICTED: serine carboxypeptidase-like 9-like [Oryza brachyantha]
Length=203

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            ++ Y HNL    +   ++ SGDHD IVP   T+AW++SLNY IV++WR W ++GQ AG+T
Sbjct  105  IIKYHHNLTSRGYRV-LVYSGDHDSIVPFPGTQAWVRSLNYPIVDDWRAWHMDGQSAGFT  163

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             TY+NG+TFAT+KG GH  PE++P  CLAMF  WI+ +PL
Sbjct  164  ATYANGLTFATIKGGGHTAPEYQPERCLAMFGHWISEKPL  203



>ref|XP_008790305.1| PREDICTED: serine carboxypeptidase-like 18 [Phoenix dactylifera]
Length=884

 Score =   125 bits (315),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHD+ +P + T+ WIKSL+Y IV++WR W   GQVAGYTRTYSN +TFATVKG G
Sbjct  801  LVYSGDHDLAIPFLGTKEWIKSLDYFIVDDWRSWHAGGQVAGYTRTYSNNLTFATVKGAG  860

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P ECLAMF RWI ++PL
Sbjct  861  HTAPEYRPHECLAMFKRWINHKPL  884


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPW  279
            N +  GDHDM V  + T+ WI+SLN+SIV++WRPW
Sbjct  357  NQLSYGDHDMGVSFVGTQGWIRSLNFSIVDDWRPW  391



>ref|NP_179880.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
 sp|Q2V465.2|SCP11_ARATH RecName: Full=Serine carboxypeptidase-like 11; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC17814.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAK62651.1| T20K9.18/T20K9.18 [Arabidopsis thaliana]
 gb|AAM15007.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM47382.1| At2g22970/T20K9.18 [Arabidopsis thaliana]
 gb|AAN31888.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC07382.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
Length=433

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD++VP +AT+AWIKSLNYSI++EWRPWM+  Q+ GYTRTYSN MTFATVKG+
Sbjct  350  SLIYSGDHDLVVPFLATQAWIKSLNYSIIDEWRPWMIRDQITGYTRTYSNKMTFATVKGS  409

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E KP E   MF RWI  +PL
Sbjct  410  GHT-AENKPQESFIMFRRWINGQPL  433



>dbj|BAB03129.1| serine carboxypeptidase [Arabidopsis thaliana]
Length=405

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDM+VP + T+AWI+SLNYSIV++WRPWMV+ QVAGYTRTY+N MTFATVKG 
Sbjct  322  SLVFSGDHDMLVPFLGTQAWIRSLNYSIVDDWRPWMVQNQVAGYTRTYANKMTFATVKGG  381

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP+E   M  RW++ +PL
Sbjct  382  GHT-SEYKPVETYIMIKRWLSGQPL  405



>gb|AFK49380.1| unknown [Medicago truncatula]
Length=470

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD +VP ++T+AWI+ LNYSIV++ RPW V GQV GYTRTY+N MTFATVKG+
Sbjct  386  SLIYSGDHDAVVPFMSTQAWIRDLNYSIVDDRRPWFVNGQVGGYTRTYANRMTFATVKGS  445

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P +C  MF RWI+  PL
Sbjct  446  GHTAPEYTPEQCFPMFTRWISNLPL  470



>gb|KFK44962.1| hypothetical protein AALP_AA1G326200 [Arabis alpina]
Length=463

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP I T+AWIKSLNYSI++EWRPW+V  QV GYTRTY+N MTFAT+KG 
Sbjct  380  SLIYSGDHDMLVPYIGTQAWIKSLNYSIIDEWRPWLVNNQVMGYTRTYANNMTFATIKGG  439

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI  +PL
Sbjct  440  GHT-AEYKPEESFIMFQRWIRGQPL  463



>ref|XP_006342726.1| PREDICTED: serine carboxypeptidase-like 11-like [Solanum tuberosum]
Length=466

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L T    ++I SGDHDM+VP  +T+AWIK LNY I+++WRPWMV+ QV GYTR+YSN
Sbjct  372  HTNLSTKGYRSLIYSGDHDMVVPFQSTQAWIKFLNYPIIDDWRPWMVDEQVGGYTRSYSN  431

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MT+ATVKG GH  PE +P E   MF RWI+ +PL
Sbjct  432  HMTYATVKGGGHTAPEDRPEESFHMFKRWISQQPL  466



>ref|XP_009139929.1| PREDICTED: serine carboxypeptidase-like 7 isoform X3 [Brassica 
rapa]
Length=255

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP++ T+AWI+SLNYS+ ++WRPWM+  Q+AGYTRTY+N MTF T+KG 
Sbjct  172  SLIFSGDHDMYVPSLGTQAWIRSLNYSVTDDWRPWMIGDQIAGYTRTYANNMTFVTIKGG  231

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  232  GHT-PEYKPEESYIMFQRWISGQPL  255



>ref|XP_010429237.1| PREDICTED: serine carboxypeptidase-like 12 isoform X4 [Camelina 
sativa]
Length=254

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            HN +  Y   ++I SGDHD++VP +ATEAWIKSLNYSI+ EWRPWM++  +AGYTRTYSN
Sbjct  163  HNSINGY--RSLIYSGDHDLVVPFLATEAWIKSLNYSIIHEWRPWMIKDLIAGYTRTYSN  220

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MTFATVKG GH   E KP E   MF RWI  +PL
Sbjct  221  KMTFATVKGGGHT-VENKPNESFIMFQRWINGQPL  254



>ref|XP_009140440.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Brassica 
rapa]
Length=434

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP IAT+AWI+SLNYSIV++WRPWMV  Q+AGYTR Y+N MT+AT+KG 
Sbjct  351  SLIYSGDHDMVVPFIATQAWIRSLNYSIVDDWRPWMVNDQIAGYTRGYANKMTYATIKGG  410

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI+ +PL
Sbjct  411  GHT-AEYKPNETFVMFQRWISGQPL  434



>ref|NP_187828.1| serine carboxypeptidase-like 17 [Arabidopsis thaliana]
 sp|Q9C7D6.1|SCP17_ARATH RecName: Full=Serine carboxypeptidase-like 17; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51061.1|AC069472_1 serine carboxypeptidase, putative; 18637-16038 [Arabidopsis thaliana]
 gb|AAS99709.1| At3g12203 [Arabidopsis thaliana]
 gb|AEE75166.1| serine carboxypeptidase-like 17 [Arabidopsis thaliana]
Length=437

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDM+VP + T+AWI+SLNYSIV++WRPWMV+ QVAGYTRTY+N MTFATVKG 
Sbjct  354  SLVFSGDHDMLVPFLGTQAWIRSLNYSIVDDWRPWMVQNQVAGYTRTYANKMTFATVKGG  413

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP+E   M  RW++ +PL
Sbjct  414  GHT-SEYKPVETYIMIKRWLSGQPL  437



>ref|XP_010416123.1| PREDICTED: serine carboxypeptidase-like 2 [Camelina sativa]
Length=444

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYS++++WRPWM++ Q+ GYTRTY+N MTFAT+KG 
Sbjct  361  SLIFSGDHDMEVPFLATQAWIRSLNYSVIDDWRPWMIKDQIGGYTRTYANKMTFATIKGG  420

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI  +PL
Sbjct  421  GHT-PEYKPDETFIMFQRWINGQPL  444



>ref|XP_010472297.1| PREDICTED: serine carboxypeptidase-like 11 isoform X2 [Camelina 
sativa]
Length=425

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I +GDHD++VP +ATEAWIKSLNYSI+ EWRPWM++ Q+AGYTRTYSN MTFATVKG 
Sbjct  342  SLIYNGDHDLVVPFLATEAWIKSLNYSIIHEWRPWMIKDQIAGYTRTYSNKMTFATVKGG  401

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E KP E   MF RWI  +PL
Sbjct  402  GHT-VENKPNESFIMFQRWINGQPL  425



>gb|AFW69058.1| hypothetical protein ZEAMMB73_415108 [Zea mays]
Length=423

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 10/95 (11%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGY----------TRTYSN  234
            +++ +GDHDM+VP I T+AWI+SLN+S V+EWRPW V+GQVAGY          TR+YSN
Sbjct  329  SLVYNGDHDMVVPFIGTQAWIRSLNFSTVDEWRPWFVDGQVAGYIIQPGYLCRFTRSYSN  388

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             +TFATVKG GH  PE+ P +C AMF RW++ +PL
Sbjct  389  NLTFATVKGGGHTAPEYMPRQCFAMFVRWVSGDPL  423



>ref|XP_010472296.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Camelina 
sativa]
Length=432

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I +GDHD++VP +ATEAWIKSLNYSI+ EWRPWM++ Q+AGYTRTYSN MTFATVKG 
Sbjct  349  SLIYNGDHDLVVPFLATEAWIKSLNYSIIHEWRPWMIKDQIAGYTRTYSNKMTFATVKGG  408

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E KP E   MF RWI  +PL
Sbjct  409  GHT-VENKPNESFIMFQRWINGQPL  432



>gb|EEE60599.1| hypothetical protein OsJ_13996 [Oryza sativa Japonica Group]
Length=219

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 70/105 (67%), Gaps = 0/105 (0%)
 Frame = -2

Query  443  ENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQ  264
            +  ++  +  H  L+T     ++ SGDHD +V  I T+ W++SLN SI   WRPW V  Q
Sbjct  115  KKQIVSSVEYHLSLITQGYRGLVYSGDHDSVVSLIGTQGWLRSLNLSITHGWRPWYVNSQ  174

Query  263  VAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            V G+TRTYSN +T+ATVKG GH  PE+ P ECLAM +RW++ EPL
Sbjct  175  VVGFTRTYSNNLTYATVKGAGHTAPEYMPKECLAMVDRWLSGEPL  219



>ref|XP_010429236.1| PREDICTED: serine carboxypeptidase-like 12 isoform X3 [Camelina 
sativa]
Length=318

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            HN +  Y   ++I SGDHD++VP +ATEAWIKSLNYSI+ EWRPWM++  +AGYTRTYSN
Sbjct  227  HNSINGY--RSLIYSGDHDLVVPFLATEAWIKSLNYSIIHEWRPWMIKDLIAGYTRTYSN  284

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MTFATVKG GH   E KP E   MF RWI  +PL
Sbjct  285  KMTFATVKGGGHT-VENKPNESFIMFQRWINGQPL  318



>ref|XP_003604933.1| Serine carboxypeptidase [Medicago truncatula]
Length=469

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGD D+IVP  +T+AWI+ LNYSI+E+WR W V GQVAGYTRTYSN MT+ATVKG+
Sbjct  385  SLIYSGDLDLIVPFRSTQAWIRDLNYSIIEDWRSWYVNGQVAGYTRTYSNRMTYATVKGS  444

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GHI PE+ P  C  MF+RWI+  PL
Sbjct  445  GHIAPEYTPELCFPMFSRWISNLPL  469



>ref|XP_009139973.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Brassica 
rapa]
Length=381

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYSI+++WRPWM+  Q+AGYTRTY+N MTFATVKG 
Sbjct  298  SLIFSGDHDMTVPFLATQAWIRSLNYSIIDDWRPWMMNDQIAGYTRTYANKMTFATVKGG  357

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   ++KP E   MF RWI+ +PL
Sbjct  358  GHT-ADYKPDETFIMFKRWISGQPL  381



>gb|AES87130.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=470

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGD D+IVP  +T+AWI+ LNYSI+E+WR W V GQVAGYTRTYSN MT+ATVKG+
Sbjct  386  SLIYSGDLDLIVPFRSTQAWIRDLNYSIIEDWRSWYVNGQVAGYTRTYSNRMTYATVKGS  445

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GHI PE+ P  C  MF+RWI+  PL
Sbjct  446  GHIAPEYTPELCFPMFSRWISNLPL  470



>ref|XP_010429231.1| PREDICTED: serine carboxypeptidase-like 11 isoform X2 [Camelina 
sativa]
Length=425

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I  GDHD++VP +ATEAWIKSLNYSI+ EWRPWM++ Q+AGYTRTYSN MTFATVKG 
Sbjct  342  SLIYIGDHDLVVPFLATEAWIKSLNYSIIHEWRPWMIKDQIAGYTRTYSNKMTFATVKGG  401

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E KP E   MF RWI+ +PL
Sbjct  402  GHT-VENKPNESFIMFQRWISGQPL  425



>ref|XP_009599400.1| PREDICTED: putative serine carboxypeptidase-like 52, partial 
[Nicotiana tomentosiformis]
Length=82

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  362  HDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTGHIPPEW  183
            HDM  P I+T+AWIKSLNYSIV++WRPW+V GQVAGYTR++SN MTFAT+KG GH  P W
Sbjct  2    HDMKTPFISTQAWIKSLNYSIVDDWRPWIVNGQVAGYTRSFSNQMTFATLKGAGHTAPNW  61

Query  182  KPLECLAMFNRW  147
             P ECLAM   +
Sbjct  62   APAECLAMLKSY  73



>ref|XP_009139971.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Brassica 
rapa]
Length=436

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYSI+++WRPWM+  Q+AGYTRTY+N MTFATVKG 
Sbjct  353  SLIFSGDHDMTVPFLATQAWIRSLNYSIIDDWRPWMMNDQIAGYTRTYANKMTFATVKGG  412

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   ++KP E   MF RWI+ +PL
Sbjct  413  GHT-ADYKPDETFIMFKRWISGQPL  436



>gb|KFK39469.1| hypothetical protein AALP_AA3G248300 [Arabis alpina]
Length=421

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGD DM VP +AT+AWIKSLNYSI+++WRPWM+  Q+AGYTRTY+N MTFAT+KG 
Sbjct  338  SLIFSGDQDMQVPYLATQAWIKSLNYSIIDDWRPWMINDQIAGYTRTYANKMTFATIKGG  397

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P E   MF RWI  +PL
Sbjct  398  GHT-PEYTPEESFIMFQRWINGQPL  421



>ref|XP_010464718.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Camelina 
sativa]
Length=406

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP + T+AWI+SLNYS++++WRPWM+  Q AGYTRTY+N MTFAT+KG 
Sbjct  323  SLIFSGDHDMVVPFLGTQAWIRSLNYSLIDDWRPWMIGDQTAGYTRTYANKMTFATIKGG  382

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  383  GHT-PEYKPEETSIMFQRWISGQPL  406



>ref|XP_010468096.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=194

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+V  + T+AWI+SLNYS++++WRPWM+  Q+AGYTRTY+N MTFAT+KG 
Sbjct  111  SLIFSGDHDMVVQFLGTQAWIRSLNYSLIDDWRPWMIGDQIAGYTRTYANRMTFATIKGG  170

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P E   MF RWI+ +PL
Sbjct  171  GHT-PEYRPEETSIMFQRWISGQPL  194



>ref|XP_010429230.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Camelina 
sativa]
Length=432

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I  GDHD++VP +ATEAWIKSLNYSI+ EWRPWM++ Q+AGYTRTYSN MTFATVKG 
Sbjct  349  SLIYIGDHDLVVPFLATEAWIKSLNYSIIHEWRPWMIKDQIAGYTRTYSNKMTFATVKGG  408

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E KP E   MF RWI+ +PL
Sbjct  409  GHT-VENKPNESFIMFQRWISGQPL  432



>ref|XP_010428248.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Camelina 
sativa]
Length=419

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYS+++EWRPWM++ Q+ GYTRTY+N MTFATVKG 
Sbjct  336  SLIFSGDHDMEVPFLATQAWIRSLNYSVIDEWRPWMIKDQIGGYTRTYANKMTFATVKGG  395

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI  +PL
Sbjct  396  GHT-AEYKPDETFIMFQRWINGQPL  419



>ref|XP_010464717.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Camelina 
sativa]
Length=440

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP + T+AWI+SLNYS++++WRPWM+  Q AGYTRTY+N MTFAT+KG 
Sbjct  357  SLIFSGDHDMVVPFLGTQAWIRSLNYSLIDDWRPWMIGDQTAGYTRTYANKMTFATIKGG  416

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  417  GHT-PEYKPEETSIMFQRWISGQPL  440



>ref|NP_001077946.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 gb|AEC07387.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=432

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I +GDHDM+VP +AT+AWI+SLNYSI ++W+PWM+  Q+AGYTR+YSN MTFAT+KG+
Sbjct  349  SLIYNGDHDMMVPFLATQAWIRSLNYSITDDWKPWMINDQIAGYTRSYSNKMTFATIKGS  408

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI+ +PL
Sbjct  409  GHT-AEYKPKETSIMFKRWISAQPL  432



>gb|KFK39468.1| hypothetical protein AALP_AA3G248300 [Arabis alpina]
Length=444

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGD DM VP +AT+AWIKSLNYSI+++WRPWM+  Q+AGYTRTY+N MTFAT+KG 
Sbjct  361  SLIFSGDQDMQVPYLATQAWIKSLNYSIIDDWRPWMINDQIAGYTRTYANKMTFATIKGG  420

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P E   MF RWI  +PL
Sbjct  421  GHT-PEYTPEESFIMFQRWINGQPL  444



>ref|NP_179881.3| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 sp|Q8H780.2|SCP13_ARATH RecName: Full=Serine carboxypeptidase-like 13; AltName: Full=Sinapoylglucose--sinapoylglucose 
O-sinapoyltransferase; AltName: 
Full=Sinapoylglucose--sinapoylglucose acyltransferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17815.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AAM15008.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07385.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=430

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I +GDHDM+VP +AT+AWI+SLNYSI ++W+PWM+  Q+AGYTR+YSN MTFAT+KG+
Sbjct  347  SLIYNGDHDMMVPFLATQAWIRSLNYSITDDWKPWMINDQIAGYTRSYSNKMTFATIKGS  406

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI+ +PL
Sbjct  407  GHT-AEYKPKETSIMFKRWISAQPL  430



>ref|XP_010464719.1| PREDICTED: serine carboxypeptidase-like 7 isoform X3 [Camelina 
sativa]
Length=395

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP + T+AWI+SLNYS++++WRPWM+  Q AGYTRTY+N MTFAT+KG 
Sbjct  312  SLIFSGDHDMVVPFLGTQAWIRSLNYSLIDDWRPWMIGDQTAGYTRTYANKMTFATIKGG  371

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  372  GHT-PEYKPEETSIMFQRWISGQPL  395



>emb|CDX72978.1| BnaC06g34260D [Brassica napus]
Length=440

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP + T+AWI+SLNYSI+++WRPWM+  Q+AGYTRTY+N MTFATVK +
Sbjct  357  SLIFSGDHDMAVPYLGTQAWIRSLNYSIIDDWRPWMINDQIAGYTRTYANKMTFATVKAS  416

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI  +PL
Sbjct  417  GHT-PEYKPDESSIMFQRWINGQPL  440



>ref|XP_008452663.1| PREDICTED: serine carboxypeptidase-like 13 [Cucumis melo]
Length=464

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP + T+AWIKSLNYSIVE+WRPW +  QVAGYTR+Y+N MTFAT+KG 
Sbjct  381  SLIYSGDHDMVVPHLDTQAWIKSLNYSIVEDWRPWFIANQVAGYTRSYANNMTFATIKGG  440

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+   EC  +F+RWIA EPL
Sbjct  441  GHT-AEYTLKECSVVFSRWIAREPL  464



>emb|CAN83341.1| hypothetical protein VITISV_021484 [Vitis vinifera]
Length=488

 Score =   121 bits (303),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN---GMTFATVK  210
            +I SGDHDM+VP + T+ WI SLN SI ++W PW V+GQVAG++  YSN   GMTFATVK
Sbjct  402  LIYSGDHDMLVPHMGTQEWINSLNLSISKDWEPWFVDGQVAGFSIEYSNSKRGMTFATVK  461

Query  209  GTGHIPPEWKPLECLAMFNRWIAYEPL  129
            G GH  PE+KP ECLAM  RW+AY PL
Sbjct  462  GGGHTAPEYKPKECLAMIYRWLAYYPL  488



>ref|XP_006390568.1| hypothetical protein EUTSA_v10018572mg [Eutrema salsugineum]
 gb|ESQ27854.1| hypothetical protein EUTSA_v10018572mg [Eutrema salsugineum]
Length=438

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP + T+AWI+SLNYS+++ WRPWM+  Q+AGYTRTY+N MTFATVKG+
Sbjct  355  SLIFSGDHDMVVPFVGTQAWIRSLNYSLIDGWRPWMINDQIAGYTRTYANKMTFATVKGS  414

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI  +PL
Sbjct  415  GHT-LEYKPEESFIMFQRWINGQPL  438



>gb|KFK38434.1| hypothetical protein AALP_AA3G112800 [Arabis alpina]
Length=394

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP + T+AWI+SLNYSI E+WRPWM+  Q+AGYTRTY+N MTFAT+KG 
Sbjct  311  SLIFSGDHDMEVPFLGTQAWIRSLNYSITEDWRPWMIGDQIAGYTRTYANKMTFATIKGG  370

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI  +PL
Sbjct  371  GHT-PEYKPEESSIMFQRWIDGQPL  394



>ref|XP_009139928.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Brassica 
rapa]
Length=436

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP++ T+AWI+SLNYS+ ++WRPWM+  Q+AGYTRTY+N MTF T+KG 
Sbjct  353  SLIFSGDHDMYVPSLGTQAWIRSLNYSVTDDWRPWMIGDQIAGYTRTYANNMTFVTIKGG  412

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  413  GHT-PEYKPEESYIMFQRWISGQPL  436



>gb|KEH29042.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=887

 Score =   123 bits (309),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 73/104 (70%), Gaps = 8/104 (8%)
 Frame = -2

Query  458  IIGNIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPW  279
            I G++E H        NL    + S +I SGDHD +VP I+T+AWI++LNYSIV++WRPW
Sbjct  369  IFGSVEFHA-------NLSKKGYRS-LIYSGDHDAVVPFISTQAWIRNLNYSIVDDWRPW  420

Query  278  MVEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRW  147
             V GQV GYTRTYSN MTF TVKG+GH  PE+ P +C  MF R+
Sbjct  421  FVNGQVGGYTRTYSNQMTFVTVKGSGHTAPEYTPDQCFGMFTRY  464


 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SG  D IVP ++T+AWI+ LNYS V++WRPW V GQV GYTRT SN MTFATVKG+
Sbjct  803  SLIYSGVLDAIVPFMSTQAWIRDLNYSTVDDWRPWFVNGQVGGYTRTCSNRMTFATVKGS  862

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  P   P +C AMF RWI+  PL
Sbjct  863  GHTAPADAPEQCFAMFTRWISNLPL  887



>ref|XP_009139927.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Brassica 
rapa]
Length=441

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP++ T+AWI+SLNYS+ ++WRPWM+  Q+AGYTRTY+N MTF T+KG 
Sbjct  358  SLIFSGDHDMYVPSLGTQAWIRSLNYSVTDDWRPWMIGDQIAGYTRTYANNMTFVTIKGG  417

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  418  GHT-PEYKPEESYIMFQRWISGQPL  441



>ref|XP_010428244.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010428245.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010428246.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010428247.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
Length=442

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYS+++EWRPWM++ Q+ GYTRTY+N MTFATVKG 
Sbjct  359  SLIFSGDHDMEVPFLATQAWIRSLNYSVIDEWRPWMIKDQIGGYTRTYANKMTFATVKGG  418

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI  +PL
Sbjct  419  GHT-AEYKPDETFIMFQRWINGQPL  442



>ref|XP_009105991.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Brassica 
rapa]
Length=441

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP + T+AWI++LNYSI+++WRPWM+  Q+AGYTRTY+N MTFATVKG 
Sbjct  358  SLIFSGDHDMAVPYLGTQAWIRALNYSIIDDWRPWMINDQIAGYTRTYANKMTFATVKGG  417

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI  +PL
Sbjct  418  GHT-PEYKPDESSIMFQRWINGQPL  441



>emb|CDY67053.1| BnaA04g27850D, partial [Brassica napus]
Length=345

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP++ T+AWI+SLNYS++++WRPWM+  Q+AGYTRTY+N MTF T+K  
Sbjct  262  SLIFSGDHDMYVPSLGTQAWIRSLNYSVIDDWRPWMIGDQIAGYTRTYANNMTFVTIKAR  321

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  322  GHT-PEYKPEESYIMFQRWISGQPL  345



>ref|XP_010533332.1| PREDICTED: serine carboxypeptidase-like 18, partial [Tarenaya 
hassleriana]
Length=272

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD+ +P + T+AWI+SLN+S++++WRPW ++GQVAGYTRTY+N MTFAT+KG 
Sbjct  189  SLIYSGDHDINIPFLGTQAWIRSLNFSVIDDWRPWKIDGQVAGYTRTYANNMTFATIKGG  248

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+ P +C  MF RW++++PL
Sbjct  249  GHT-AEYTPEKCSVMFQRWVSFKPL  272



>ref|XP_003577669.1| PREDICTED: serine carboxypeptidase-like 19 isoform X3 [Brachypodium 
distachyon]
Length=478

 Score =   120 bits (302),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            ++ SGDHD +VP + T++W++SLN+ +V+EWR W ++GQ AG+T TY+N MTFAT+KG G
Sbjct  395  LVYSGDHDAVVPFLGTQSWVRSLNFPVVDEWRAWHLDGQSAGFTITYANNMTFATLKGGG  454

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P  CLAMF RWI+ EPL
Sbjct  455  HTAPEYQPERCLAMFRRWISTEPL  478



>emb|CDY30277.1| BnaC04g31880D [Brassica napus]
Length=439

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP++ T+AWI+SLNYS+ ++WRPWM+  Q+AGYTRTY+N MTFAT+K  
Sbjct  356  SLIFSGDHDMYVPSLGTQAWIRSLNYSVTDDWRPWMIGDQIAGYTRTYANQMTFATIKAR  415

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  416  GHT-PEYKPKESYIMFQRWISGQPL  439



>ref|XP_010429235.1| PREDICTED: serine carboxypeptidase-like 12 isoform X2 [Camelina 
sativa]
Length=424

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            HN +  Y   ++I SGDHD++VP +ATEAWIKSLNYSI+ EWRPWM++  +AGYTRTYSN
Sbjct  333  HNSINGY--RSLIYSGDHDLVVPFLATEAWIKSLNYSIIHEWRPWMIKDLIAGYTRTYSN  390

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MTFATVKG GH   E KP E   MF RWI  +PL
Sbjct  391  KMTFATVKGGGHT-VENKPNESFIMFQRWINGQPL  424



>ref|XP_002446557.1| hypothetical protein SORBIDRAFT_06g018070 [Sorghum bicolor]
 gb|EES10885.1| hypothetical protein SORBIDRAFT_06g018070 [Sorghum bicolor]
Length=468

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H+ L T     +I SGDHD +VP + T+AWI+ LN +IV++WRPW V GQVAG+TR+Y++
Sbjct  374  HSRLATKGYRALIYSGDHDAVVPHVGTQAWIRYLNLTIVDDWRPWYVGGQVAGFTRSYAS  433

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            G+T+ATVKG GHI P +KPLEC  M  RWI+ + L
Sbjct  434  GLTYATVKGAGHIAPMYKPLECQKMLIRWISGDSL  468



>gb|EEC68118.1| hypothetical protein OsI_36022 [Oryza sativa Indica Group]
Length=511

 Score =   120 bits (302),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTY-SNGMTFATVKGT  204
            II SGDHD  VP+I+T+AWI+ LN SI ++WRPW V+GQVAG+TR+Y SN +T+ATVKG 
Sbjct  427  IIYSGDHDSRVPSISTQAWIRLLNLSIADDWRPWYVDGQVAGFTRSYASNNLTYATVKGA  486

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP EC  MF RWI+  PL
Sbjct  487  GHTAAEYKPKECQEMFARWISGTPL  511



>gb|AES87126.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=905

 Score =   123 bits (308),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 73/104 (70%), Gaps = 8/104 (8%)
 Frame = -2

Query  458  IIGNIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPW  279
            I G++E H        NL    + S +I SGDHD +VP I+T+AWI++LNYSIV++WRPW
Sbjct  369  IFGSVEFHA-------NLSKKGYRS-LIYSGDHDAVVPFISTQAWIRNLNYSIVDDWRPW  420

Query  278  MVEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRW  147
             V GQV GYTRTYSN MTF TVKG+GH  PE+ P +C  MF R+
Sbjct  421  FVNGQVGGYTRTYSNQMTFVTVKGSGHTAPEYTPDQCFGMFTRY  464


 Score =   115 bits (287),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SG  D IVP ++T+AWI+ LNYS V++WRPW V GQV GYTRT SN MTFATVKG+
Sbjct  821  SLIYSGVLDAIVPFMSTQAWIRDLNYSTVDDWRPWFVNGQVGGYTRTCSNRMTFATVKGS  880

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  P   P +C AMF RWI+  PL
Sbjct  881  GHTAPADAPEQCFAMFTRWISNLPL  905



>ref|XP_006376417.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|ERP54214.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=433

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHDM  P + T+AWI+SLNYSIV +W PW  +GQVAGYTRTYS+ +TFATV+  G
Sbjct  350  LIYSGDHDMEAPFLGTQAWIRSLNYSIVNDWHPWHFQGQVAGYTRTYSSQLTFATVRDGG  409

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  P  +P EC AMF RWI  EPL
Sbjct  410  HTAPADRPAECFAMFKRWINQEPL  433



>ref|XP_010429234.1| PREDICTED: serine carboxypeptidase-like 12 isoform X1 [Camelina 
sativa]
Length=433

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            HN +  Y   ++I SGDHD++VP +ATEAWIKSLNYSI+ EWRPWM++  +AGYTRTYSN
Sbjct  342  HNSINGY--RSLIYSGDHDLVVPFLATEAWIKSLNYSIIHEWRPWMIKDLIAGYTRTYSN  399

Query  233  GMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             MTFATVKG GH   E KP E   MF RWI  +PL
Sbjct  400  KMTFATVKGGGHT-VENKPNESFIMFQRWINGQPL  433



>ref|NP_001176511.1| Os11g0431700 [Oryza sativa Japonica Group]
 dbj|BAH95239.1| Os11g0431700, partial [Oryza sativa Japonica Group]
Length=101

 Score =   113 bits (283),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  371  SGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTGHIP  192
            SGDHD +VP + T+AW++SLNY IV++WR W ++GQ AG+T  Y N +TFATVKG GH  
Sbjct  21   SGDHDAVVPFLGTQAWVRSLNYPIVDDWRAWHIDGQSAGFTIAYGNNLTFATVKGAGHTA  80

Query  191  PEWKPLECLAMFNRWIAYEPL  129
            PE++P  C AMF RWI+  PL
Sbjct  81   PEFEPERCFAMFKRWISSIPL  101



>ref|NP_001149348.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACG35127.1| serine carboxypeptidase 1 precursor [Zea mays]
Length=492

 Score =   120 bits (301),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y  NL    + + ++ SGDHD++VP + T+AW++SLN+ +V++WR W + GQ AG+T
Sbjct  394  VVKYHRNLTSRGYRA-LVYSGDHDLLVPHLGTQAWVRSLNFPVVDDWRAWHLGGQSAGFT  452

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             TYSN MTFAT+KG GH  PE++P  C AMF+RWI   PL
Sbjct  453  TTYSNNMTFATIKGAGHTAPEYEPERCFAMFSRWILNRPL  492



>ref|XP_010464720.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=443

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD+ VP +AT+AWI+SLNYS++++WRPWM+  Q+ GYTRTY+N MTFAT+KG 
Sbjct  360  SLIFSGDHDLTVPFLATQAWIRSLNYSLIDDWRPWMIGDQIGGYTRTYANKMTFATIKGG  419

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  420  GHT-PEYKPEESSIMFQRWISGQPL  443



>ref|XP_006415268.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
 gb|ESQ33621.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
Length=464

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  392  FESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATV  213
            F  +++ SGDHDM+VP + T+AWIKSLNYSI++EWRPW V  QV GYTRTY+N MTFAT+
Sbjct  378  FYRSLVYSGDHDMMVPFLGTQAWIKSLNYSIIDEWRPWFVNNQVIGYTRTYANNMTFATI  437

Query  212  KGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            KG GH   E+KP E   +F RWI  +PL
Sbjct  438  KGGGHT-AEYKPEESFMLFRRWIRGQPL  464



>ref|XP_010314652.1| PREDICTED: serine carboxypeptidase-like 11 [Solanum lycopersicum]
Length=677

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM+VP  +T+AWIK LNYSI+++WRPWMV GQV GYT +YSN MT+AT+KG 
Sbjct  372  SLIYSGDHDMVVPFQSTQAWIKYLNYSIIDDWRPWMVNGQVGGYTMSYSNHMTYATIKGG  431

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  E   MF RWI  +PL
Sbjct  432  GHTAPEYKREESFHMFKRWITQQPL  456


 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDH+M+VP  +T+AWIK LNYSI+++WRPWMV+ QV GYTR+YSN M +ATVKG 
Sbjct  593  SLIYSGDHEMVVPFQSTQAWIKYLNYSIIDDWRPWMVDEQVGGYTRSYSNHMAYATVKGG  652

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE +P E   MF RWI+ +PL
Sbjct  653  GHTAPEDRPEESFYMFKRWISQQPL  677



>emb|CDP20999.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y  NL    + S +I SGD+DMI P + TE WI+SLNY I+++WR W+ +GQVAGYT
Sbjct  255  VVPYHANLSTKGYRS-LIYSGDYDMISPYLGTEEWIRSLNYPIIDDWRQWIHQGQVAGYT  313

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            RTY+N MTFAT  G GH+ P  KP EC +MF RWI+Y+PL
Sbjct  314  RTYANKMTFAT--GAGHVAPYEKPAECRSMFGRWISYQPL  351



>ref|XP_010471386.1| PREDICTED: serine carboxypeptidase-like 2 [Camelina sativa]
Length=444

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD+ VP +AT+AWI+SLNYS++++WRPWM++ Q+ GYTRTY+N MTFAT+KG 
Sbjct  361  SLIFSGDHDLEVPFLATQAWIRSLNYSVIDDWRPWMIKYQIGGYTRTYANKMTFATIKGG  420

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI  +PL
Sbjct  421  GHT-PEYKPDETFIMFQRWINGQPL  444



>ref|XP_006403281.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
 gb|ESQ44734.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
Length=439

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP + T+ WI+SLNYSI+++WRPWM+  QVAGYTRTY+N MTFATVKG 
Sbjct  356  SLIFSGDHDMFVPFLETQDWIRSLNYSIIDDWRPWMIHNQVAGYTRTYANKMTFATVKGG  415

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH    +KP EC  MF RWI+ +PL
Sbjct  416  GHT-MVYKPEECSVMFKRWISDQPL  439



>ref|XP_007018462.1| Serine carboxypeptidase-like 19, putative [Theobroma cacao]
 gb|EOY15687.1| Serine carboxypeptidase-like 19, putative [Theobroma cacao]
Length=446

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 7/91 (8%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAG------YTRTYSNGMTF  222
            +I  SGDHDMIVP +AT+AWI++LNY IV++WRPWM++GQVAG      YTRT+SN MTF
Sbjct  357  SIQDSGDHDMIVPFLATQAWIRALNYPIVDDWRPWMLQGQVAGVSDDSDYTRTHSNRMTF  416

Query  221  ATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            AT+KG GH   E+ P EC AMF RWI  EPL
Sbjct  417  ATIKGGGHT-AEYTPKECFAMFKRWINGEPL  446



>ref|XP_009784017.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
sylvestris]
Length=457

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM++P  +T+AWIK LNYSI+++WRPW ++GQVAGYTR++SN +T+ATVKG 
Sbjct  373  SLIYSGDHDMVIPFQSTQAWIKYLNYSIIDDWRPWTIDGQVAGYTRSFSNHITYATVKGG  432

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  +   MF RWIA  PL
Sbjct  433  GHTAPEYKREDSFHMFKRWIAQLPL  457



>gb|KFK38432.1| hypothetical protein AALP_AA3G112600 [Arabis alpina]
Length=441

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP + T+AWI+SLNYSIV++WRPWM+  Q+AGYTRTY+N MTFAT+KG 
Sbjct  358  SLIFSGDHDMEVPFLGTQAWIRSLNYSIVDDWRPWMIGDQIAGYTRTYANKMTFATIKGG  417

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP +   MF RWI  +PL
Sbjct  418  GHT-PEYKPEDSSIMFQRWIDGQPL  441



>gb|AES87127.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 8/110 (7%)
 Frame = -2

Query  458  IIGNIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPW  279
            I  ++E HV       NL    + S +I SGD D++VP  +T+AWI+ LNYSIV++WR W
Sbjct  368  IFSSVEFHV-------NLSKKGYRS-LIYSGDLDLVVPFQSTQAWIRDLNYSIVDDWRSW  419

Query  278  MVEGQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             V GQVAGYTRTYSN MTFATVKG+GH  P   P +CLAMF RW +  PL
Sbjct  420  FVNGQVAGYTRTYSNRMTFATVKGSGHTAPAVTPEQCLAMFTRWTSNLPL  469



>emb|CDY49647.1| BnaC09g41250D [Brassica napus]
Length=433

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDMI+P  AT+ WI+SLNYSI+++WRPWM+  QVAGYT+TY+N MTFATVKG 
Sbjct  350  SLISSGDHDMIIPFTATQTWIRSLNYSIIDKWRPWMIHDQVAGYTKTYANKMTFATVKGG  409

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   ++KP E   MF RWI+ +PL
Sbjct  410  GHT-SKFKPEESFIMFRRWISGQPL  433



>emb|CDX96466.1| BnaA07g30770D [Brassica napus]
Length=441

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP + T+AWI++LNYSI+++WRPWM+  Q+AGYTRTY+N MTFATVK +
Sbjct  358  SLIFSGDHDMAVPYLGTQAWIRALNYSIIDDWRPWMINDQIAGYTRTYANKMTFATVKAS  417

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI  +PL
Sbjct  418  GHT-PEYKPDESSIMFQRWINGQPL  441



>ref|XP_009784016.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Nicotiana 
sylvestris]
Length=474

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM++P  +T+AWIK LNYSI+++WRPW ++GQVAGYTR++SN +T+ATVKG 
Sbjct  390  SLIYSGDHDMVIPFQSTQAWIKYLNYSIIDDWRPWTIDGQVAGYTRSFSNHITYATVKGG  449

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+K  +   MF RWIA  PL
Sbjct  450  GHTAPEYKREDSFHMFKRWIAQLPL  474



>emb|CDY53115.1| BnaCnng24430D [Brassica napus]
Length=436

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP +AT+AWI+SLNYSI+++WRPWM+  Q+AGYTRTY+N MTFATVK +
Sbjct  353  SLIFSGDHDMTVPFLATQAWIRSLNYSIIDDWRPWMMNDQIAGYTRTYANKMTFATVKAS  412

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   ++KP E   MF +WI+ +PL
Sbjct  413  GHT-ADYKPDETFIMFKKWISSQPL  436



>ref|NP_001030669.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
 gb|AEE74909.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
Length=394

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = -2

Query  386  SNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKG  207
            +++I SGDHDM VP + T+AWI+SLNYS++++WRPWM+  Q+AGYTRTY+N M FAT+KG
Sbjct  310  ASLIFSGDHDMEVPYLGTQAWIRSLNYSLIDDWRPWMIGDQIAGYTRTYANKMAFATIKG  369

Query  206  TGHIPPEWKPLECLAMFNRWIAYEPL  129
             GH  PE+KP E   MF RWI+ +PL
Sbjct  370  GGHT-PEYKPEESYIMFQRWISGQPL  394



>ref|NP_001137115.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACF83291.1| unknown [Zea mays]
 tpg|DAA39724.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=491

 Score =   119 bits (299),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y  NL    + + ++ SGDHD++VP + T+AW++SLN+ +V++WR W + GQ AG+T
Sbjct  393  VVKYHRNLTSRGYRA-MVYSGDHDLLVPHLGTQAWVRSLNFPVVDDWRAWHLGGQSAGFT  451

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
             TYSN MTFAT+KG GH  PE++P  C AMF+RWI   PL
Sbjct  452  ITYSNNMTFATIKGAGHTAPEYEPERCFAMFSRWILNRPL  491



>ref|NP_187656.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
 sp|Q9SQX6.1|SCP7_ARATH RecName: Full=Serine carboxypeptidase-like 7; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51371.1|AC011560_3 putative glucose acyltransferase; 97813-95037 [Arabidopsis thaliana]
 gb|AAF76347.1| glucose acyltransferase, putative [Arabidopsis thaliana]
 gb|AAM67067.1| putative glucose acyltransferase [Arabidopsis thaliana]
 gb|AEE74908.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
Length=437

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = -2

Query  386  SNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKG  207
            +++I SGDHDM VP + T+AWI+SLNYS++++WRPWM+  Q+AGYTRTY+N M FAT+KG
Sbjct  353  ASLIFSGDHDMEVPYLGTQAWIRSLNYSLIDDWRPWMIGDQIAGYTRTYANKMAFATIKG  412

Query  206  TGHIPPEWKPLECLAMFNRWIAYEPL  129
             GH  PE+KP E   MF RWI+ +PL
Sbjct  413  GGHT-PEYKPEESYIMFQRWISGQPL  437



>ref|NP_179884.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana]
 sp|O64811.1|SCP9_ARATH RecName: Full=Serine carboxypeptidase-like 9; AltName: Full=Sinapoylglucose--sinapoylglucose 
O-sinapoyltransferase; Short=SST; 
AltName: Full=Sinapoylglucose--sinapoylglucose acyltransferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17818.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07397.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana]
Length=437

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD+ +P  AT+AWIKSLNYSI+++WRPWM++GQ+AGYTRTYSN MTFATVKG 
Sbjct  354  SLIFSGDHDITMPFQATQAWIKSLNYSIIDDWRPWMIKGQIAGYTRTYSNKMTFATVKGG  413

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+ P E   MF RWI+ +PL
Sbjct  414  GHT-AEYLPEESSIMFQRWISGQPL  437



>gb|KDP32094.1| hypothetical protein JCGZ_12555 [Jatropha curcas]
Length=472

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHDMI+P + T +WIKS+N SIVE WRPW+V+GQVAGY   +SN   F TVKG G
Sbjct  389  LIYSGDHDMIIPYLGTLSWIKSMNLSIVEHWRPWLVDGQVAGYLMEFSNQFMFVTVKGGG  448

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H PPE++P EC A F RWI+ E L
Sbjct  449  HTPPEYRPRECFATFKRWISGESL  472



>ref|XP_008661499.1| PREDICTED: uncharacterized protein LOC100216996 isoform X2 [Zea 
mays]
Length=432

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y H+ L T     +I SGDHD +VP + T+AWI+ LN +IV++WRPW V GQVAG+T
Sbjct  334  VVDY-HSRLATKGYRALIYSGDHDAVVPHVGTQAWIRYLNLTIVDDWRPWYVGGQVAGFT  392

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            R+Y++G+TFATVKG GH+ P +K LEC  MF  WI+  PL
Sbjct  393  RSYASGLTFATVKGAGHVAPLYKTLECQKMFITWISGNPL  432



>ref|XP_006299183.1| hypothetical protein CARUB_v10015328mg [Capsella rubella]
 gb|EOA32081.1| hypothetical protein CARUB_v10015328mg [Capsella rubella]
Length=435

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +++ SGDHDM +P + T+AWI SLNYS++++WRPWMV  QVAGYT+TY+N MTFATVKG 
Sbjct  352  SLVISGDHDMTIPFVGTQAWISSLNYSVIDKWRPWMVLDQVAGYTKTYANKMTFATVKGG  411

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP EC  MF RWI+ +PL
Sbjct  412  GHT-LEYKPEECSIMFKRWISGQPL  435



>emb|CDM81579.1| unnamed protein product [Triticum aestivum]
Length=882

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP I T+AWI+SL + +V+EWRPW V GQVAG+T  Y+N +TFATVKG 
Sbjct  798  SLIYSGDHDMTVPFIGTQAWIRSLGFGVVDEWRPWHVNGQVAGFTTLYANNLTFATVKGG  857

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P ECLAM +RW++  PL
Sbjct  858  GHTAPEYMPKECLAMVDRWLSGRPL  882


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  413  HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN  234
            H  L +    ++I SGDHDM VP I T+AWI+SL +++V+EWRPW   GQVAG+T  Y+N
Sbjct  365  HRSLTSRGYRSLIYSGDHDMTVPFIGTQAWIRSLGFAVVDEWRPWYATGQVAGFTTLYAN  424

Query  233  GMTFATVK  210
             +TFAT+K
Sbjct  425  NLTFATIK  432



>gb|ACG36102.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|AFW58395.1| serine carboxypeptidase 1 [Zea mays]
Length=442

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y H+ L T     +I SGDHD +VP + T+AWI+ LN +IV++WRPW V GQVAG+T
Sbjct  344  VVDY-HSRLATKGYRALIYSGDHDAVVPHVGTQAWIRYLNLTIVDDWRPWYVGGQVAGFT  402

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            R+Y++G+TFATVKG GH+ P +K LEC  MF  WI+  PL
Sbjct  403  RSYASGLTFATVKGAGHVAPLYKTLECQKMFITWISGNPL  442



>ref|XP_010238599.1| PREDICTED: serine carboxypeptidase-like 3 [Brachypodium distachyon]
Length=491

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHD +VP + T++W++SLN+ IV+EWR W ++GQ AG+T TY N MTFAT+KG G
Sbjct  408  LIYSGDHDSVVPFLGTQSWVRSLNFPIVDEWRAWHLDGQSAGFTITYGNNMTFATIKGGG  467

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE++P  CLAMF RWI+ EPL
Sbjct  468  HTAPEFQPERCLAMFKRWISKEPL  491



>ref|XP_008661498.1| PREDICTED: uncharacterized protein LOC100216996 isoform X1 [Zea 
mays]
Length=469

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            VV Y H+ L T     +I SGDHD +VP + T+AWI+ LN +IV++WRPW V GQVAG+T
Sbjct  371  VVDY-HSRLATKGYRALIYSGDHDAVVPHVGTQAWIRYLNLTIVDDWRPWYVGGQVAGFT  429

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            R+Y++G+TFATVKG GH+ P +K LEC  MF  WI+  PL
Sbjct  430  RSYASGLTFATVKGAGHVAPLYKTLECQKMFITWISGNPL  469



>ref|XP_009126131.1| PREDICTED: serine carboxypeptidase-like 3 isoform X2 [Brassica 
rapa]
Length=366

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +II SGDHD++VP  +T+AWI+SL YSI++EWRPWMV  Q+AGYTRTY+N MT+ATVKG 
Sbjct  283  SIIFSGDHDLVVPFPSTQAWIRSLGYSIIDEWRPWMVHNQIAGYTRTYANNMTYATVKGG  342

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI+ +PL
Sbjct  343  GHT-LEFKPNESFIMFQRWISGQPL  366



>ref|XP_009126133.1| PREDICTED: serine carboxypeptidase-like 3 isoform X3 [Brassica 
rapa]
Length=365

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            +II SGDHD++VP  +T+AWI+SL YSI++EWRPWMV  Q+AGYTRTY+N MT+ATVKG 
Sbjct  282  SIIFSGDHDLVVPFPSTQAWIRSLGYSIIDEWRPWMVHNQIAGYTRTYANNMTYATVKGG  341

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH   E+KP E   MF RWI+ +PL
Sbjct  342  GHT-LEFKPNESFIMFQRWISGQPL  365



>ref|XP_009133996.1| PREDICTED: serine carboxypeptidase-like 10 isoform X2 [Brassica 
rapa]
Length=322

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 4/106 (4%)
 Frame = -2

Query  440  NHVIV--VIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEG  267
            +H I+  V Y  N+ L+ + S ++ SGDHD+ +P + T+AWIKSLNYSI+++WRPW ++ 
Sbjct  219  DHDIISSVPYHMNISLSGYRS-LVYSGDHDITMPFLGTQAWIKSLNYSIIDDWRPWKIKD  277

Query  266  QVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            Q+AGYTRTYSN MTFAT+KG GH   E+KP E   MF RWI+  PL
Sbjct  278  QIAGYTRTYSNKMTFATIKGGGHT-AEYKPNETFIMFQRWISGHPL  322



>gb|KHG24307.1| Serine carboxypeptidase-like 18 [Gossypium arboreum]
Length=446

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHD +VP + TE+WIKSLN SIV++WRPW V+ QVAGY+R Y N +TFAT  G G
Sbjct  365  LIYSGDHDRLVPYVGTESWIKSLNLSIVDDWRPWFVDDQVAGYSREYGNNLTFAT--GGG  422

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  PE+KP EC AMFNRWI+ + L
Sbjct  423  HTAPEFKPKECFAMFNRWISKKSL  446



>emb|CDP17360.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 11/115 (10%)
 Frame = -2

Query  443  ENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQ  264
            +N   VV Y  NL    + S +I SGDHDMI P + TE WI+SLNY I+++WR W+ +GQ
Sbjct  370  KNAGSVVPYHANLSTKGYRS-LIYSGDHDMISPYLGTEEWIRSLNYPIIDDWRQWIHQGQ  428

Query  263  VAGYTRTYSNGMTFATVK----------GTGHIPPEWKPLECLAMFNRWIAYEPL  129
            VAGYTRTY+N MTFATVK          G GHI    KP EC +MF RWI+Y+PL
Sbjct  429  VAGYTRTYANKMTFATVKARNPSFSCFSGAGHIASYNKPAECRSMFGRWISYQPL  483



>ref|XP_010320343.1| PREDICTED: serine carboxypeptidase-like 10 isoform X2 [Solanum 
lycopersicum]
Length=416

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            V+ Y  NL    + S +I SGDHD I+P  +T+AWIKSLNY+I ++WRPW V  QV+GYT
Sbjct  318  VIPYHANLSTKGYRS-LIYSGDHDYIIPFQSTQAWIKSLNYTIDDDWRPWNVNNQVSGYT  376

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            R+YSN MT+ATVKG GH     KP EC  MF RWI+ +PL
Sbjct  377  RSYSNKMTYATVKGAGHTACTDKPEECFVMFKRWISDDPL  416



>ref|XP_002882669.1| hypothetical protein ARALYDRAFT_478377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58928.1| hypothetical protein ARALYDRAFT_478377 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP + T+AWI+SLNYS++++WRPWM+  Q+ GYTRTY+N MTFAT+KG 
Sbjct  354  SLIFSGDHDMEVPYLGTQAWIRSLNYSLIDDWRPWMIGDQITGYTRTYANKMTFATIKGG  413

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  414  GHT-PEYKPEETYIMFQRWISGQPL  437



>ref|XP_010486655.1| PREDICTED: serine carboxypeptidase-like 7 isoform X5 [Camelina 
sativa]
Length=446

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP + T+AWI+SLNYS+ ++WRPWM+  Q+AGYTRTY+N MTFAT+KG 
Sbjct  363  SLIFSGDHDMRVPFLGTQAWIRSLNYSLTDDWRPWMIGDQIAGYTRTYANKMTFATIKGG  422

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI+ +PL
Sbjct  423  GHT-PEYKPEESSIMFQRWISGQPL  446



>ref|XP_010320344.1| PREDICTED: serine carboxypeptidase-like 10 isoform X3 [Solanum 
lycopersicum]
Length=391

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = -2

Query  428  VVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYT  249
            V+ Y  NL    + S +I SGDHD I+P  +T+AWIKSLNY+I ++WRPW V  QV+GYT
Sbjct  293  VIPYHANLSTKGYRS-LIYSGDHDYIIPFQSTQAWIKSLNYTIDDDWRPWNVNNQVSGYT  351

Query  248  RTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            R+YSN MT+ATVKG GH     KP EC  MF RWI+ +PL
Sbjct  352  RSYSNKMTYATVKGAGHTACTDKPEECFVMFKRWISDDPL  391



>ref|XP_009388678.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 8/107 (7%)
 Frame = -2

Query  449  NIENHVIVVIY*HNLLLTYFESNIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVE  270
            N+E H+       NL    F + ++ SGDHD+ +P + T AWIKSLN+S+V++WR W VE
Sbjct  381  NLEYHL-------NLTTRGFRA-LVYSGDHDLYIPFVGTMAWIKSLNFSLVDDWRSWHVE  432

Query  269  GQVAGYTRTYSNGMTFATVKGTGHIPPEWKPLECLAMFNRWIAYEPL  129
            GQVAGYT  Y+N +TFATVKG GH  PE++P +CLAM  RWI +E L
Sbjct  433  GQVAGYTMKYANNLTFATVKGGGHTAPEYRPKQCLAMIQRWIFHEHL  479



>ref|XP_011006024.1| PREDICTED: serine carboxypeptidase-like 3 isoform X2 [Populus 
euphratica]
Length=463

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGTG  201
            +I SGDHDM  P + T+AWI+ LNYS+V++W+PW  +GQVAGYTRTYS+ + FATVKG G
Sbjct  380  LIYSGDHDMEAPFLGTQAWIRYLNYSVVDDWQPWHYQGQVAGYTRTYSSQLAFATVKGGG  439

Query  200  HIPPEWKPLECLAMFNRWIAYEPL  129
            H  P ++P EC AMF RWI  E L
Sbjct  440  HTAPAYRPAECFAMFGRWIVQEHL  463



>ref|XP_010647903.1| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=464

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = -2

Query  380  IICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSN---GMTFATVK  210
            +I SGDHDM+VP + T+ WI SLN SI ++W PW V+GQVAG++  YSN   GMTFATVK
Sbjct  378  LIYSGDHDMLVPHMGTQEWINSLNLSISKDWEPWFVDGQVAGFSIEYSNSKRGMTFATVK  437

Query  209  GTGHIPPEWKPLECLAMFNRWIAYEPL  129
            G GH  PE+KP ECLAM  RW+AY PL
Sbjct  438  GGGHTAPEYKPKECLAMIYRWLAYYPL  464



>ref|XP_010484310.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=440

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHD++VP + T+AWI+SLNYS+ ++WRPWM+  Q+AGYTRTY+N MTFAT+KG 
Sbjct  357  SLIFSGDHDLMVPFLGTQAWIRSLNYSLTDDWRPWMIGDQIAGYTRTYANKMTFATIKGG  416

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE++P E   MF RWI+ +PL
Sbjct  417  GHT-PEYRPEETSIMFQRWISGQPL  440



>ref|XP_010486654.1| PREDICTED: serine carboxypeptidase-like 7 isoform X4 [Camelina 
sativa]
Length=350

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I +GDHDM VP + T+AWI+SLNYS++++WRPWM+  Q AGYTRTY+N MTFATVKG 
Sbjct  267  SLIFNGDHDMAVPFLGTQAWIRSLNYSLIDDWRPWMIGDQTAGYTRTYANKMTFATVKGG  326

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+KP E   MF RWI  +PL
Sbjct  327  GHT-PEYKPEETYIMFQRWIRGQPL  350



>gb|EMT21721.1| Serine carboxypeptidase-like 17 [Aegilops tauschii]
Length=489

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  383  NIICSGDHDMIVPTIATEAWIKSLNYSIVEEWRPWMVEGQVAGYTRTYSNGMTFATVKGT  204
            ++I SGDHDM VP I+T+AWI+SL +++V+EWRPW   GQVAG+T  Y+N +TFATVKG 
Sbjct  405  SLIYSGDHDMTVPFISTQAWIRSLGFAVVDEWRPWYATGQVAGFTTLYANNLTFATVKGG  464

Query  203  GHIPPEWKPLECLAMFNRWIAYEPL  129
            GH  PE+ P ECLAM +RW++  P+
Sbjct  465  GHTAPEYMPKECLAMVDRWLSGRPV  489



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519922816592