BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25227_g1_i2 len=1272 path=[294:0-134 3677:135-187 4746:188-203
2292:204-207 2296:208-218 513:219-289 4785:290-298 3096:299-326
4815:327-345 4834:346-349 2161:350-375 2187:376-383 3178:384-461
4887:462-529 4932:530-597 3386:598-626 2063:627-658 3445:659-662
5027:663-683 611:684-1271]

Length=1272
                                                                      Score     E

ref|XP_004240097.1|  PREDICTED: probable polygalacturonase              363   4e-117   
ref|XP_009599786.1|  PREDICTED: probable polygalacturonase isofor...    362   6e-117   
ref|XP_011092828.1|  PREDICTED: probable polygalacturonase              362   9e-117   
ref|XP_009599780.1|  PREDICTED: probable polygalacturonase isofor...    361   2e-116   
ref|XP_006345582.1|  PREDICTED: probable polygalacturonase-like i...    360   3e-116   
ref|XP_006345581.1|  PREDICTED: probable polygalacturonase-like i...    360   5e-116   
ref|XP_009767883.1|  PREDICTED: probable polygalacturonase              358   1e-115   
ref|XP_009762711.1|  PREDICTED: probable polygalacturonase isofor...    357   8e-115   
ref|XP_009762710.1|  PREDICTED: probable polygalacturonase isofor...    356   2e-114   
ref|XP_006339619.1|  PREDICTED: probable polygalacturonase-like         354   5e-114   
ref|XP_009624373.1|  PREDICTED: probable polygalacturonase              353   2e-113   
gb|EPS72197.1|  hypothetical protein M569_02558                         350   2e-112   
gb|EYU35105.1|  hypothetical protein MIMGU_mgv1a005694mg                349   4e-112   
ref|XP_004229920.2|  PREDICTED: probable polygalacturonase              348   1e-111   
emb|CBI40426.3|  unnamed protein product                                340   6e-110   
ref|XP_006491165.1|  PREDICTED: probable polygalacturonase-like         342   2e-109   
emb|CDP20376.1|  unnamed protein product                                342   2e-109   
ref|XP_004133855.1|  PREDICTED: probable polygalacturonase-like         342   6e-109   
ref|XP_006444979.1|  hypothetical protein CICLE_v10019597mg             343   6e-109   
ref|XP_004172137.1|  PREDICTED: probable polygalacturonase-like         342   6e-109   
ref|XP_004510753.1|  PREDICTED: probable polygalacturonase-like         341   7e-109   
ref|XP_003633958.1|  PREDICTED: probable polygalacturonase              341   8e-109   
sp|A7PZL3.1|PGLR_VITVI  RecName: Full=Probable polygalacturonase;...    341   1e-108   Vitis vinifera
ref|XP_010255225.1|  PREDICTED: probable polygalacturonase isofor...    339   3e-108   
ref|XP_010276902.1|  PREDICTED: probable polygalacturonase isofor...    339   5e-108   
ref|XP_010255224.1|  PREDICTED: probable polygalacturonase isofor...    339   5e-108   
ref|XP_010112958.1|  putative polygalacturonase                         338   6e-108   
ref|XP_010255223.1|  PREDICTED: probable polygalacturonase isofor...    340   7e-108   
ref|XP_002511903.1|  polygalacturonase, putative                        338   1e-107   Ricinus communis
ref|XP_006402475.1|  hypothetical protein EUTSA_v10005939mg             337   2e-107   
ref|XP_010469084.1|  PREDICTED: probable polygalacturonase              337   4e-107   
ref|XP_004298828.1|  PREDICTED: probable polygalacturonase-like         337   4e-107   
ref|XP_006580552.1|  PREDICTED: probable polygalacturonase-like i...    336   4e-107   
ref|XP_003532926.1|  PREDICTED: probable polygalacturonase-like i...    337   4e-107   
ref|XP_007219266.1|  hypothetical protein PRUPE_ppa018224mg             336   4e-107   
ref|XP_003525377.2|  PREDICTED: probable polygalacturonase-like i...    337   6e-107   
ref|XP_008438007.1|  PREDICTED: probable polygalacturonase              337   6e-107   
ref|XP_007209970.1|  hypothetical protein PRUPE_ppa004996mg             336   6e-107   
ref|XP_006584731.1|  PREDICTED: probable polygalacturonase-like i...    337   8e-107   
emb|CBI34379.3|  unnamed protein product                                334   1e-106   
ref|XP_006291035.1|  hypothetical protein CARUB_v10017147mg             335   2e-106   
ref|XP_010413390.1|  PREDICTED: probable polygalacturonase              335   2e-106   
gb|KDO76318.1|  hypothetical protein CISIN_1g011659mg                   335   2e-106   
gb|KDP28587.1|  hypothetical protein JCGZ_14358                         335   2e-106   
ref|NP_191708.1|  polygalacturonase-like protein                        334   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006439488.1|  hypothetical protein CICLE_v10019941mg             334   4e-106   
ref|XP_006476506.1|  PREDICTED: probable polygalacturonase-like         334   5e-106   
ref|XP_007139799.1|  hypothetical protein PHAVU_008G059700g             334   7e-106   
ref|XP_002876618.1|  glycoside hydrolase family 28 protein              333   7e-106   
ref|XP_002278930.1|  PREDICTED: probable polygalacturonase              333   9e-106   Vitis vinifera
ref|XP_007051731.1|  Polygalacturonase, putative isoform 1              333   1e-105   
ref|XP_007051732.1|  Polygalacturonase, putative isoform 2              333   1e-105   
ref|XP_008238946.1|  PREDICTED: probable polygalacturonase              333   1e-105   
ref|XP_011023291.1|  PREDICTED: probable polygalacturonase isofor...    332   2e-105   
ref|XP_011023292.1|  PREDICTED: probable polygalacturonase isofor...    332   2e-105   
ref|XP_002301370.1|  polygalacturonase-like family protein              332   3e-105   Populus trichocarpa [western balsam poplar]
ref|XP_009793070.1|  PREDICTED: probable polygalacturonase              332   3e-105   
ref|XP_007160099.1|  hypothetical protein PHAVU_002G292300g             332   3e-105   
ref|XP_008343414.1|  PREDICTED: probable polygalacturonase              332   3e-105   
gb|KHF98838.1|  putative polygalacturonase                              324   3e-105   
ref|XP_010089056.1|  putative polygalacturonase                         331   4e-105   
ref|XP_004306749.1|  PREDICTED: probable polygalacturonase-like         332   4e-105   
ref|XP_004245570.1|  PREDICTED: probable polygalacturonase              332   4e-105   
ref|XP_003552411.1|  PREDICTED: probable polygalacturonase              332   5e-105   
gb|KHN16795.1|  Putative polygalacturonase                              330   5e-105   
gb|KDP25392.1|  hypothetical protein JCGZ_20548                         331   5e-105   
gb|AAP33475.1|  polygalacturonase-like protein                          331   5e-105   Fragaria x ananassa
ref|XP_003533597.1|  PREDICTED: probable polygalacturonase-like         331   6e-105   
ref|XP_003548644.2|  PREDICTED: probable polygalacturonase-like i...    331   7e-105   
gb|KEH21119.1|  polygalacturonase/glycoside hydrolase family protein    330   7e-105   
emb|CDY65355.1|  BnaC08g49000D                                          330   7e-105   
ref|XP_006598941.1|  PREDICTED: probable polygalacturonase-like i...    331   8e-105   
ref|XP_009349812.1|  PREDICTED: probable polygalacturonase              331   8e-105   
gb|KHM99951.1|  Putative polygalacturonase                              329   8e-105   
gb|KHN26934.1|  Putative polygalacturonase                              331   9e-105   
ref|XP_006343936.1|  PREDICTED: probable polygalacturonase-like         330   1e-104   
ref|XP_004503680.1|  PREDICTED: probable polygalacturonase-like i...    330   1e-104   
emb|CDY48913.1|  BnaA09g39240D                                          330   1e-104   
ref|XP_010523770.1|  PREDICTED: probable polygalacturonase isofor...    330   2e-104   
ref|XP_007144550.1|  hypothetical protein PHAVU_007G165300g             330   2e-104   
ref|XP_010053221.1|  PREDICTED: probable polygalacturonase              330   2e-104   
gb|AFK44529.1|  unknown                                                 329   2e-104   
ref|XP_010523769.1|  PREDICTED: probable polygalacturonase isofor...    329   2e-104   
ref|XP_009345122.1|  PREDICTED: probable polygalacturonase              330   3e-104   
gb|KHG15709.1|  hypothetical protein F383_10492                         329   3e-104   
ref|XP_003528838.1|  PREDICTED: probable polygalacturonase              329   3e-104   
gb|KHG15710.1|  hypothetical protein F383_10492                         329   3e-104   
gb|KHN46704.1|  Putative polygalacturonase                              328   5e-104   
ref|XP_004492778.1|  PREDICTED: probable polygalacturonase-like         329   6e-104   
ref|XP_009116814.1|  PREDICTED: probable polygalacturonase              328   7e-104   
ref|XP_010276903.1|  PREDICTED: probable polygalacturonase isofor...    327   8e-104   
ref|XP_003529926.1|  PREDICTED: probable polygalacturonase-like         328   1e-103   
gb|AFK37962.1|  unknown                                                 327   1e-103   
gb|ACU20792.1|  unknown                                                 319   2e-103   Glycine max [soybeans]
ref|XP_010676424.1|  PREDICTED: probable polygalacturonase              327   4e-103   
ref|XP_004503678.1|  PREDICTED: probable polygalacturonase-like i...    326   8e-103   
ref|XP_009363435.1|  PREDICTED: probable polygalacturonase              325   1e-102   
ref|XP_010276899.1|  PREDICTED: probable polygalacturonase isofor...    325   2e-102   
ref|XP_010055093.1|  PREDICTED: probable polygalacturonase              324   2e-102   
gb|EYU23462.1|  hypothetical protein MIMGU_mgv1a006147mg                322   6e-102   
ref|XP_009604283.1|  PREDICTED: probable polygalacturonase              323   7e-102   
ref|XP_002509850.1|  polygalacturonase, putative                        323   8e-102   Ricinus communis
ref|XP_011046019.1|  PREDICTED: probable polygalacturonase              322   8e-102   
ref|XP_004295492.1|  PREDICTED: probable polygalacturonase-like         324   9e-102   
ref|XP_006372397.1|  glycoside hydrolase family 28 family protein       322   1e-101   
ref|XP_002513653.1|  polygalacturonase, putative                        322   1e-101   Ricinus communis
gb|AAZ32910.1|  polygalacturonase-like protein                          312   2e-101   Medicago sativa [alfalfa]
ref|XP_010436421.1|  PREDICTED: probable polygalacturonase              318   1e-100   
ref|XP_004298190.1|  PREDICTED: probable polygalacturonase-like         319   2e-100   
ref|XP_010055091.1|  PREDICTED: probable polygalacturonase isofor...    318   6e-100   
ref|XP_010055092.1|  PREDICTED: probable polygalacturonase isofor...    318   6e-100   
ref|XP_003622464.1|  Polygalacturonase-like protein                     318   7e-100   
ref|XP_010448699.1|  PREDICTED: probable polygalacturonase              318   1e-99    
gb|KFK28901.1|  hypothetical protein AALP_AA7G062800                    318   1e-99    
ref|XP_007217591.1|  hypothetical protein PRUPE_ppa018901mg             315   1e-99    
ref|XP_003592202.1|  hypothetical protein MTR_1g100060                  317   2e-99    
ref|XP_010439166.1|  PREDICTED: probable polygalacturonase              317   2e-99    
ref|XP_006422033.1|  hypothetical protein CICLE_v10004864mg             317   3e-99    
ref|XP_008229768.1|  PREDICTED: probable polygalacturonase              316   4e-99    
ref|XP_008232996.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    316   4e-99    
ref|XP_007038809.1|  Pectin lyase-like superfamily protein isoform 2    316   4e-99    
ref|XP_006413548.1|  hypothetical protein EUTSA_v10025011mg             316   5e-99    
ref|XP_007038808.1|  Pectin lyase-like superfamily protein isoform 1    315   5e-99    
gb|AES62453.2|  pectin lyase superfamily protein                        317   6e-99    
ref|XP_010530415.1|  PREDICTED: probable polygalacturonase              314   7e-99    
ref|XP_009137356.1|  PREDICTED: probable polygalacturonase              316   8e-99    
ref|XP_006283603.1|  hypothetical protein CARUB_v10004660mg             316   9e-99    
ref|XP_004496831.1|  PREDICTED: probable polygalacturonase-like         315   9e-99    
ref|XP_002299511.1|  hypothetical protein POPTR_0001s09790g             315   9e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010541188.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    315   1e-98    
ref|XP_009395434.1|  PREDICTED: probable polygalacturonase isofor...    315   1e-98    
ref|XP_007215325.1|  hypothetical protein PRUPE_ppa005185mg             314   2e-98    
ref|XP_009395433.1|  PREDICTED: probable polygalacturonase isofor...    315   2e-98    
ref|NP_194081.1|  putative polygalacturonase                            315   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004496829.1|  PREDICTED: probable polygalacturonase-like         314   2e-98    
ref|XP_004496830.1|  PREDICTED: probable polygalacturonase-like         313   3e-98    
ref|XP_008234837.1|  PREDICTED: probable polygalacturonase              313   3e-98    
ref|XP_002437680.1|  hypothetical protein SORBIDRAFT_10g000660          314   4e-98    Sorghum bicolor [broomcorn]
ref|XP_011022627.1|  PREDICTED: probable polygalacturonase              313   4e-98    
ref|XP_009137085.1|  PREDICTED: probable polygalacturonase              313   5e-98    
ref|XP_007219377.1|  hypothetical protein PRUPE_ppa020086mg             314   6e-98    
ref|XP_009368731.1|  PREDICTED: probable polygalacturonase              313   6e-98    
gb|KHN21785.1|  Putative polygalacturonase                              312   6e-98    
ref|XP_003592200.1|  Polygalacturonase-like protein                     312   1e-97    
ref|XP_002869777.1|  glycoside hydrolase family 28 protein              313   1e-97    
ref|XP_003536450.1|  PREDICTED: probable polygalacturonase-like         312   1e-97    
emb|CDP12065.1|  unnamed protein product                                311   2e-97    
ref|XP_008234902.1|  PREDICTED: probable polygalacturonase              311   2e-97    
ref|XP_004234221.1|  PREDICTED: probable polygalacturonase              311   3e-97    
gb|AFW04075.1|  polygalacturonase                                       311   4e-97    
ref|XP_008376628.1|  PREDICTED: probable polygalacturonase              311   4e-97    
gb|AES62452.2|  pectin lyase superfamily protein                        310   8e-97    
ref|XP_003592201.1|  Polygalacturonase-like protein                     310   8e-97    
ref|XP_010941157.1|  PREDICTED: probable polygalacturonase              310   1e-96    
gb|KHG19046.1|  putative polygalacturonase                              302   1e-96    
ref|XP_010276919.1|  PREDICTED: probable polygalacturonase              313   1e-96    
ref|XP_002303605.2|  hypothetical protein POPTR_0003s13160g             309   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_011029346.1|  PREDICTED: probable polygalacturonase              309   2e-96    
ref|XP_011035342.1|  PREDICTED: probable polygalacturonase              309   2e-96    
gb|KHG23155.1|  putative polygalacturonase                              308   3e-96    
dbj|BAD67712.1|  putative polygalacturonase                             309   3e-96    Oryza sativa Japonica Group [Japonica rice]
gb|KDO86268.1|  hypothetical protein CISIN_1g0090752mg                  301   4e-96    
ref|XP_003624874.1|  hypothetical protein MTR_7g088550                  308   4e-96    
ref|XP_003624048.1|  Polygalacturonase                                  308   5e-96    
ref|XP_002305262.1|  glycoside hydrolase family 28 family protein       306   6e-96    Populus trichocarpa [western balsam poplar]
gb|KDP22229.1|  hypothetical protein JCGZ_26060                         307   9e-96    
ref|XP_003535598.1|  PREDICTED: probable polygalacturonase-like         307   1e-95    
gb|KHN21784.1|  Putative polygalacturonase                              306   2e-95    
gb|AFK43011.1|  unknown                                                 307   2e-95    
ref|XP_007040335.1|  Pectin lyase-like superfamily protein isoform 1    306   2e-95    
ref|XP_003533980.1|  PREDICTED: probable polygalacturonase-like         306   2e-95    
gb|KHN42438.1|  Putative polygalacturonase                              306   2e-95    
ref|XP_009772512.1|  PREDICTED: probable polygalacturonase              306   3e-95    
ref|XP_009377556.1|  PREDICTED: probable polygalacturonase              306   3e-95    
ref|XP_010105745.1|  putative polygalacturonase                         305   6e-95    
ref|NP_001240215.1|  uncharacterized protein LOC100785005 precursor     305   9e-95    
ref|XP_004964293.1|  PREDICTED: probable polygalacturonase-like i...    305   1e-94    
ref|XP_008380132.1|  PREDICTED: probable polygalacturonase              304   1e-94    
ref|XP_004964294.1|  PREDICTED: probable polygalacturonase-like i...    305   1e-94    
ref|XP_009607671.1|  PREDICTED: probable polygalacturonase              304   1e-94    
ref|XP_004964295.1|  PREDICTED: probable polygalacturonase-like i...    305   2e-94    
ref|XP_009375527.1|  PREDICTED: probable polygalacturonase              303   2e-94    
gb|KHG19694.1|  putative polygalacturonase                              303   2e-94    
ref|XP_007151452.1|  hypothetical protein PHAVU_004G047700g             303   3e-94    
ref|XP_006656549.1|  PREDICTED: probable polygalacturonase-like         303   3e-94    
ref|XP_007151453.1|  hypothetical protein PHAVU_004G047800g             303   3e-94    
ref|XP_010519488.1|  PREDICTED: probable polygalacturonase isofor...    302   5e-94    
gb|ACL54166.1|  unknown                                                 302   7e-94    Zea mays [maize]
gb|ACG41831.1|  glycoside hydrolase, family 28                          301   7e-94    Zea mays [maize]
ref|XP_010317519.1|  PREDICTED: probable polygalacturonase              302   7e-94    
ref|XP_007152185.1|  hypothetical protein PHAVU_004G108800g             302   9e-94    
ref|XP_010519487.1|  PREDICTED: probable polygalacturonase isofor...    302   9e-94    
ref|NP_001151164.1|  glycoside hydrolase, family 28 precursor           302   1e-93    Zea mays [maize]
gb|AFW75224.1|  glycoside hydrolase, family 28                          302   2e-93    
ref|XP_010089055.1|  putative polygalacturonase                         301   2e-93    
ref|XP_003592197.1|  Endo-polygalacturonase-like protein                301   2e-93    
ref|XP_008437531.1|  PREDICTED: probable polygalacturonase              300   4e-93    
ref|XP_002273177.2|  PREDICTED: probable polygalacturonase              300   4e-93    Vitis vinifera
ref|XP_010550764.1|  PREDICTED: probable polygalacturonase              299   1e-92    
ref|XP_008794781.1|  PREDICTED: probable polygalacturonase isofor...    299   2e-92    
ref|XP_004160401.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    299   2e-92    
ref|XP_004145976.1|  PREDICTED: probable polygalacturonase-like         299   2e-92    
ref|XP_008794779.1|  PREDICTED: probable polygalacturonase isofor...    298   3e-92    
ref|XP_010934935.1|  PREDICTED: probable polygalacturonase              298   3e-92    
ref|XP_008794778.1|  PREDICTED: probable polygalacturonase isofor...    298   3e-92    
ref|XP_007143467.1|  hypothetical protein PHAVU_007G074300g             297   4e-92    
ref|XP_008794777.1|  PREDICTED: probable polygalacturonase isofor...    298   4e-92    
ref|XP_011076107.1|  PREDICTED: probable polygalacturonase              298   5e-92    
gb|KDP22227.1|  hypothetical protein JCGZ_26058                         298   5e-92    
ref|XP_010519492.1|  PREDICTED: probable polygalacturonase              297   6e-92    
ref|XP_002273143.3|  PREDICTED: probable polygalacturonase              296   6e-92    Vitis vinifera
ref|XP_010671628.1|  PREDICTED: probable polygalacturonase              297   8e-92    
ref|XP_008796910.1|  PREDICTED: probable polygalacturonase              296   1e-91    
ref|XP_004513187.1|  PREDICTED: probable polygalacturonase-like         296   3e-91    
gb|KHN21786.1|  Putative polygalacturonase                              294   4e-91    
ref|XP_010228132.1|  PREDICTED: probable polygalacturonase isofor...    296   5e-91    
ref|XP_010228133.1|  PREDICTED: probable polygalacturonase isofor...    296   5e-91    
gb|KCW90638.1|  hypothetical protein EUGRSUZ_A02742                     294   6e-91    
ref|XP_003535597.1|  PREDICTED: probable polygalacturonase-like i...    295   6e-91    
gb|KDP22228.1|  hypothetical protein JCGZ_26059                         294   8e-91    
ref|XP_010024977.1|  PREDICTED: probable polygalacturonase              294   8e-91    
gb|KGN49922.1|  hypothetical protein Csa_5G140480                       294   1e-90    
emb|CBI22656.3|  unnamed protein product                                298   1e-90    
dbj|BAJ90091.1|  predicted protein                                      294   2e-90    
gb|EYU25143.1|  hypothetical protein MIMGU_mgv1a005601mg                291   1e-89    
gb|ABR18040.1|  unknown                                                 291   1e-89    Picea sitchensis
emb|CBI22657.3|  unnamed protein product                                287   1e-89    
emb|CDY05885.1|  BnaC08g20620D                                          290   3e-89    
ref|XP_006829063.1|  hypothetical protein AMTR_s00001p00258260          290   4e-89    
ref|XP_006362679.1|  PREDICTED: probable polygalacturonase-like         290   1e-88    
ref|XP_008810119.1|  PREDICTED: probable polygalacturonase isofor...    289   1e-88    
ref|XP_009149779.1|  PREDICTED: probable polygalacturonase              288   2e-88    
gb|ABE66001.1|  glycoside hydrolase family 28 protein/polygalactu...    286   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_190464.1|  pectin lyase-like superfamily protein                 287   4e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875935.1|  predicted protein                                  286   7e-88    
ref|XP_002273669.1|  PREDICTED: probable polygalacturonase              287   7e-88    Vitis vinifera
ref|XP_010024966.1|  PREDICTED: probable polygalacturonase              286   9e-88    
ref|XP_010426397.1|  PREDICTED: probable polygalacturonase              286   1e-87    
emb|CDY08095.1|  BnaA06g16310D                                          285   4e-87    
gb|KFK27673.1|  hypothetical protein AALP_AA8G413900                    282   5e-87    
ref|XP_006292567.1|  hypothetical protein CARUB_v10018803mg             283   1e-86    
ref|XP_010503541.1|  PREDICTED: probable polygalacturonase              282   3e-86    
ref|XP_010450744.1|  PREDICTED: probable polygalacturonase              282   3e-86    
ref|XP_006404198.1|  hypothetical protein EUTSA_v10011050mg             281   5e-86    
ref|XP_002513652.1|  Exopolygalacturonase precursor, putative           281   7e-86    Ricinus communis
ref|XP_009382257.1|  PREDICTED: probable polygalacturonase isofor...    281   1e-85    
gb|KFK32698.1|  hypothetical protein AALP_AA6G277200                    281   1e-85    
ref|XP_010933983.1|  PREDICTED: probable polygalacturonase isofor...    281   1e-85    
emb|CDY20264.1|  BnaC04g36920D                                          281   2e-85    
ref|XP_010933982.1|  PREDICTED: probable polygalacturonase isofor...    281   2e-85    
gb|AGZ62594.1|  pollen-specific polygalacturonase                       281   2e-85    
gb|EPS71449.1|  hypothetical protein M569_03308                         280   2e-85    
ref|XP_009140503.1|  PREDICTED: probable polygalacturonase              280   2e-85    
emb|CDY39678.1|  BnaA04g13950D                                          280   2e-85    
ref|XP_006404874.1|  hypothetical protein EUTSA_v10000145mg             280   3e-85    
ref|XP_009382256.1|  PREDICTED: probable polygalacturonase isofor...    278   2e-84    
ref|XP_006295548.1|  hypothetical protein CARUB_v10024654mg             278   2e-84    
ref|XP_002878707.1|  glycoside hydrolase family 28 protein              278   3e-84    
gb|AAC63679.1|  putative polygalacturonase                              277   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|NP_179968.2|  pectin lyase-like protein                             277   3e-84    Arabidopsis thaliana [mouse-ear cress]
gb|ABK28510.1|  unknown                                                 277   3e-84    Arabidopsis thaliana [mouse-ear cress]
gb|KHN09300.1|  Putative polygalacturonase                              275   5e-84    
ref|XP_010429342.1|  PREDICTED: probable polygalacturonase              274   7e-83    
ref|XP_010472382.1|  PREDICTED: probable polygalacturonase              275   9e-83    
ref|XP_010417129.1|  PREDICTED: probable polygalacturonase              273   1e-82    
emb|CDY44105.1|  BnaA01g13130D                                          271   3e-82    
ref|XP_006589526.1|  PREDICTED: probable polygalacturonase-like i...    270   9e-82    
gb|EYU25144.1|  hypothetical protein MIMGU_mgv1a023393mg                269   1e-81    
ref|XP_007051304.1|  Pectin lyase-like superfamily protein isoform 3    264   7e-80    
ref|XP_006657587.1|  PREDICTED: probable polygalacturonase-like i...    265   8e-80    
ref|XP_004494475.1|  PREDICTED: probable polygalacturonase-like i...    265   9e-80    
ref|XP_004494474.1|  PREDICTED: probable polygalacturonase-like i...    265   1e-79    
ref|XP_006657586.1|  PREDICTED: probable polygalacturonase-like i...    265   2e-79    
ref|XP_006574520.1|  PREDICTED: probable polygalacturonase-like i...    258   2e-79    
ref|XP_007051302.1|  Pectin lyase-like superfamily protein isoform 1    265   2e-79    
gb|KEH24447.1|  polygalacturonase/glycoside hydrolase family protein    265   2e-79    
ref|XP_003626072.1|  Polygalacturonase                                  265   2e-79    
gb|AIU50445.1|  pectin lyase-like superfamily protein                   262   3e-79    
ref|XP_008660018.1|  PREDICTED: probable polygalacturonase              258   6e-79    
gb|KCW46748.1|  hypothetical protein EUGRSUZ_K00562                     262   9e-79    
gb|EEC81792.1|  hypothetical protein OsI_25505                          264   1e-78    
ref|XP_002459610.1|  hypothetical protein SORBIDRAFT_02g007470          263   1e-78    
gb|EEE66877.1|  hypothetical protein OsJ_23693                          264   1e-78    
ref|XP_009363066.1|  PREDICTED: probable polygalacturonase isofor...    263   1e-78    
gb|AES61557.2|  polygalacturonase/glycoside hydrolase family protein    263   1e-78    
ref|XP_010230291.1|  PREDICTED: probable polygalacturonase              261   2e-78    
ref|XP_008381624.1|  PREDICTED: probable polygalacturonase              262   2e-78    
ref|XP_010035373.1|  PREDICTED: probable polygalacturonase              262   2e-78    
ref|XP_009363065.1|  PREDICTED: probable polygalacturonase isofor...    262   2e-78    
ref|XP_003519731.2|  PREDICTED: probable polygalacturonase-like i...    261   3e-78    
ref|XP_007145093.1|  hypothetical protein PHAVU_007G209200g             261   3e-78    
ref|NP_001183080.1|  hypothetical protein precursor                     262   3e-78    
gb|KHN00242.1|  Putative polygalacturonase                              261   3e-78    
ref|XP_003535296.2|  PREDICTED: probable polygalacturonase-like         261   3e-78    
ref|XP_010909275.1|  PREDICTED: probable polygalacturonase isofor...    260   4e-78    
ref|XP_010523877.1|  PREDICTED: probable polygalacturonase isofor...    261   5e-78    
ref|XP_006444619.1|  hypothetical protein CICLE_v10020035mg             261   5e-78    
ref|XP_010544928.1|  PREDICTED: probable polygalacturonase              261   6e-78    
ref|XP_010909269.1|  PREDICTED: probable polygalacturonase isofor...    260   8e-78    
ref|XP_010523874.1|  PREDICTED: probable polygalacturonase isofor...    261   8e-78    
ref|XP_010512598.1|  PREDICTED: probable polygalacturonase isofor...    260   1e-77    
ref|XP_006291055.1|  hypothetical protein CARUB_v10017170mg             260   1e-77    
ref|XP_010468984.1|  PREDICTED: probable polygalacturonase              260   1e-77    
ref|XP_004955888.1|  PREDICTED: probable polygalacturonase-like i...    260   2e-77    
ref|XP_007163248.1|  hypothetical protein PHAVU_001G218400g             259   2e-77    
ref|XP_002876663.1|  glycoside hydrolase family 28 protein              259   2e-77    
ref|XP_006840361.1|  hypothetical protein AMTR_s00045p00118570          259   2e-77    
ref|XP_010271039.1|  PREDICTED: probable polygalacturonase isofor...    259   2e-77    
ref|XP_003554577.1|  PREDICTED: probable polygalacturonase-like i...    259   2e-77    
ref|XP_006604763.1|  PREDICTED: probable polygalacturonase-like i...    259   2e-77    
ref|XP_010271038.1|  PREDICTED: probable polygalacturonase isofor...    259   3e-77    
ref|NP_567126.1|  pectin lyase-like superfamily protein                 259   3e-77    
gb|KFK35395.1|  hypothetical protein AALP_AA5G279500                    259   3e-77    
ref|XP_010413306.1|  PREDICTED: probable polygalacturonase              259   3e-77    
gb|KFK35396.1|  hypothetical protein AALP_AA5G279500                    259   4e-77    
dbj|BAJ94566.1|  predicted protein                                      259   4e-77    
ref|XP_006386685.1|  hypothetical protein POPTR_0002s18800g             258   4e-77    
emb|CDY10897.1|  BnaC01g15120D                                          251   4e-77    
ref|XP_006402409.1|  hypothetical protein EUTSA_v10005945mg             258   4e-77    
dbj|BAJ96905.1|  predicted protein                                      259   4e-77    
ref|XP_009412155.1|  PREDICTED: probable polygalacturonase              258   6e-77    
ref|XP_010512597.1|  PREDICTED: probable polygalacturonase isofor...    261   6e-77    
ref|XP_003557344.1|  PREDICTED: probable polygalacturonase              258   7e-77    
ref|XP_007221479.1|  hypothetical protein PRUPE_ppa005310mg             258   7e-77    
ref|XP_006576262.1|  PREDICTED: uncharacterized protein LOC100817...    258   8e-77    
ref|XP_006404169.1|  hypothetical protein EUTSA_v10010343mg             258   8e-77    
ref|XP_009396562.1|  PREDICTED: probable polygalacturonase              257   8e-77    
ref|XP_008227776.1|  PREDICTED: probable polygalacturonase              258   8e-77    
gb|AIU50406.1|  pectin lyase-like superfamily protein                   253   9e-77    
ref|XP_006576263.1|  PREDICTED: uncharacterized protein LOC100817...    257   1e-76    
ref|XP_004985902.1|  PREDICTED: probable polygalacturonase-like         257   1e-76    
ref|NP_001241086.1|  uncharacterized protein LOC100817309 precursor     257   1e-76    
ref|XP_002273855.2|  PREDICTED: probable polygalacturonase              257   1e-76    
ref|XP_009116889.1|  PREDICTED: probable polygalacturonase              257   2e-76    
gb|KHN43408.1|  Putative polygalacturonase                              259   2e-76    
ref|NP_001051812.1|  Os03g0833800                                       257   2e-76    
gb|ABF99735.1|  glycoside hydrolase family 28 protein, putative, ...    256   2e-76    
ref|XP_011005969.1|  PREDICTED: probable polygalacturonase              256   2e-76    
gb|KDP28345.1|  hypothetical protein JCGZ_14116                         256   2e-76    
ref|XP_002535132.1|  Polygalacturonase precursor, putative              256   3e-76    
gb|KHN14175.1|  Putative polygalacturonase                              257   3e-76    
emb|CAB71871.1|  putative protein                                       256   3e-76    
ref|XP_002463589.1|  hypothetical protein SORBIDRAFT_01g002550          256   3e-76    
ref|NP_001151102.1|  glycoside hydrolase, family 28 precursor           256   3e-76    
ref|XP_002320934.2|  hypothetical protein POPTR_0014s10770g             256   4e-76    
ref|XP_004288344.1|  PREDICTED: probable polygalacturonase-like         256   4e-76    
ref|XP_002988771.1|  hypothetical protein SELMODRAFT_128450             255   5e-76    
ref|XP_002468601.1|  hypothetical protein SORBIDRAFT_01g048880          256   5e-76    
ref|XP_006402410.1|  hypothetical protein EUTSA_v10005945mg             255   6e-76    
gb|AIU50401.1|  pectin lyase-like superfamily protein                   253   8e-76    
ref|NP_001048813.1|  Os03g0124900                                       255   9e-76    
ref|XP_003563034.1|  PREDICTED: probable polygalacturonase              255   1e-75    
ref|XP_002986281.1|  hypothetical protein SELMODRAFT_124011             254   1e-75    
gb|AIU50421.1|  pectin lyase-like superfamily protein                   253   1e-75    
ref|XP_006650993.1|  PREDICTED: probable polygalacturonase-like         258   2e-75    
ref|XP_011040145.1|  PREDICTED: probable polygalacturonase              254   2e-75    
ref|XP_008788175.1|  PREDICTED: probable polygalacturonase              254   2e-75    
ref|XP_010091430.1|  putative polygalacturonase                         254   2e-75    
ref|XP_002875985.1|  glycoside hydrolase family 28 protein              253   3e-75    
ref|XP_006650856.1|  PREDICTED: probable polygalacturonase-like i...    254   4e-75    
ref|XP_009104364.1|  PREDICTED: probable polygalacturonase              253   5e-75    
ref|XP_009387922.1|  PREDICTED: probable polygalacturonase              253   5e-75    
ref|XP_010914786.1|  PREDICTED: probable polygalacturonase              253   6e-75    
ref|XP_002960960.1|  hypothetical protein SELMODRAFT_33152              250   7e-75    
ref|NP_001151479.1|  polygalacturonase precursor                        253   7e-75    
gb|ACN35154.1|  unknown                                                 251   8e-75    
ref|XP_002962842.1|  hypothetical protein SELMODRAFT_78556              252   8e-75    
ref|XP_002989426.1|  hypothetical protein SELMODRAFT_129742             251   1e-74    
gb|EMT00190.1|  Putative polygalacturonase                              250   1e-74    
ref|XP_008807914.1|  PREDICTED: probable polygalacturonase              252   2e-74    
gb|ACN28107.1|  unknown                                                 251   3e-74    
ref|XP_002967047.1|  hypothetical protein SELMODRAFT_408393             251   3e-74    
ref|XP_010241441.1|  PREDICTED: probable polygalacturonase isofor...    251   4e-74    
ref|XP_008679595.1|  PREDICTED: polygalacturonase isoform X1            251   4e-74    
ref|XP_001781065.1|  predicted protein                                  249   7e-74    
ref|XP_002967400.1|  hypothetical protein SELMODRAFT_87398              249   8e-74    
ref|XP_002960312.1|  hypothetical protein SELMODRAFT_74934              249   1e-73    
ref|XP_006355845.1|  PREDICTED: probable polygalacturonase-like         249   2e-73    
gb|KFK34204.1|  hypothetical protein AALP_AA5G114700                    261   2e-73    
ref|XP_009784614.1|  PREDICTED: probable polygalacturonase isofor...    248   2e-73    
ref|XP_009784607.1|  PREDICTED: probable polygalacturonase isofor...    248   2e-73    
gb|KFK34205.1|  hypothetical protein AALP_AA5G114700                    261   2e-73    
ref|XP_004240577.1|  PREDICTED: probable polygalacturonase              248   2e-73    
gb|KHG11864.1|  putative polygalacturonase                              248   9e-73    
gb|KHG13059.1|  putative polygalacturonase                              247   1e-72    
ref|XP_001775589.1|  predicted protein                                  247   1e-72    
gb|AIU50422.1|  pectin lyase-like superfamily protein                   245   1e-72    
gb|EAZ41253.1|  hypothetical protein OsJ_25761                          247   1e-72    
ref|XP_002443718.1|  hypothetical protein SORBIDRAFT_07g000740          247   1e-72    
ref|XP_009149760.1|  PREDICTED: probable polygalacturonase              246   1e-72    
gb|AIU50447.1|  pectin lyase-like superfamily protein                   244   2e-72    
ref|NP_001060796.1|  Os08g0107300                                       247   2e-72    
ref|XP_007145183.1|  hypothetical protein PHAVU_007G217500g             246   2e-72    
gb|EAZ05322.1|  hypothetical protein OsI_27527                          247   2e-72    
emb|CDY05907.1|  BnaC08g20840D                                          245   2e-72    
ref|XP_010911559.1|  PREDICTED: probable polygalacturonase              246   2e-72    
emb|CDY08113.1|  BnaA06g16130D                                          245   4e-72    
ref|XP_004247394.1|  PREDICTED: probable polygalacturonase              246   4e-72    
ref|XP_008810829.1|  PREDICTED: probable polygalacturonase              245   5e-72    
ref|XP_010547890.1|  PREDICTED: probable polygalacturonase              246   5e-72    
gb|AIU50402.1|  pectin lyase-like superfamily protein                   243   5e-72    
ref|XP_010924850.1|  PREDICTED: probable polygalacturonase              244   6e-72    
gb|AIU50407.1|  pectin lyase-like superfamily protein                   243   7e-72    
ref|XP_009395761.1|  PREDICTED: probable polygalacturonase              244   8e-72    
ref|NP_001141464.1|  uncharacterized protein LOC100273574 precursor     244   8e-72    
gb|AIU50440.1|  pectin lyase-like superfamily protein                   243   1e-71    
ref|XP_011079616.1|  PREDICTED: probable polygalacturonase isofor...    244   1e-71    
ref|XP_011079615.1|  PREDICTED: probable polygalacturonase isofor...    244   1e-71    
gb|AIU50438.1|  pectin lyase-like superfamily protein                   243   1e-71    
ref|XP_006365531.1|  PREDICTED: probable polygalacturonase-like         245   1e-71    
ref|XP_004969187.1|  PREDICTED: probable polygalacturonase-like         244   1e-71    
emb|CDY03516.1|  BnaC01g15660D                                          243   1e-71    
ref|XP_009399273.1|  PREDICTED: probable polygalacturonase isofor...    244   1e-71    
ref|XP_009624281.1|  PREDICTED: probable polygalacturonase              244   2e-71    
ref|XP_004951285.1|  PREDICTED: probable polygalacturonase-like         243   2e-71    
ref|XP_008810903.1|  PREDICTED: probable polygalacturonase              244   2e-71    
ref|XP_004979886.1|  PREDICTED: probable polygalacturonase-like         243   2e-71    
ref|XP_002451891.1|  hypothetical protein SORBIDRAFT_04g009310          243   2e-71    
ref|XP_007146299.1|  hypothetical protein PHAVU_006G028800g             243   2e-71    
gb|AIU50449.1|  pectin lyase-like superfamily protein                   241   3e-71    
ref|XP_009137402.1|  PREDICTED: probable polygalacturonase              243   3e-71    
gb|KHN26935.1|  Putative polygalacturonase                              241   3e-71    
ref|XP_002455965.1|  hypothetical protein SORBIDRAFT_03g028140          243   3e-71    
gb|AIU50418.1|  pectin lyase-like superfamily protein                   241   3e-71    
emb|CDY47619.1|  BnaA01g13460D                                          243   3e-71    
gb|AIU50432.1|  pectin lyase-like superfamily protein                   241   3e-71    
gb|AIU50419.1|  pectin lyase-like superfamily protein                   240   4e-71    
ref|XP_010652214.1|  PREDICTED: probable polygalacturonase              243   4e-71    
ref|XP_010679488.1|  PREDICTED: probable polygalacturonase isofor...    243   4e-71    
ref|XP_009792174.1|  PREDICTED: probable polygalacturonase              243   4e-71    
ref|XP_010679489.1|  PREDICTED: probable polygalacturonase isofor...    243   4e-71    
gb|AIU50444.1|  pectin lyase-like superfamily protein                   241   4e-71    
ref|XP_008661941.1|  PREDICTED: polygalacturonase isoform X1            242   5e-71    
gb|AFW56470.1|  polygalacturonase                                       242   5e-71    
ref|XP_009793676.1|  PREDICTED: probable polygalacturonase              243   5e-71    
ref|NP_001170283.1|  uncharacterized protein LOC100384246 precursor     242   5e-71    
ref|XP_010245458.1|  PREDICTED: probable polygalacturonase isofor...    242   5e-71    
ref|XP_004242037.1|  PREDICTED: probable polygalacturonase              243   6e-71    
emb|CBI36899.3|  unnamed protein product                                243   6e-71    
ref|XP_008239046.1|  PREDICTED: probable polygalacturonase              242   6e-71    
ref|XP_010259446.1|  PREDICTED: probable polygalacturonase              242   6e-71    
ref|XP_010245459.1|  PREDICTED: probable polygalacturonase isofor...    242   7e-71    
ref|XP_006842393.1|  hypothetical protein AMTR_s00209p00025840          243   7e-71    
ref|XP_010913831.1|  PREDICTED: probable polygalacturonase isofor...    241   8e-71    
gb|EAY99223.1|  hypothetical protein OsI_21181                          241   8e-71    
gb|AIU50400.1|  pectin lyase-like superfamily protein                   240   9e-71    
gb|AIU50442.1|  pectin lyase-like superfamily protein                   240   9e-71    
ref|NP_001148987.1|  polygalacturonase precursor                        241   1e-70    
gb|AIU50431.1|  pectin lyase-like superfamily protein                   240   1e-70    
ref|NP_001056466.1|  Os05g0587000                                       241   1e-70    
ref|XP_010914507.1|  PREDICTED: probable polygalacturonase              241   1e-70    
gb|AIU50437.1|  pectin lyase-like superfamily protein                   239   1e-70    
ref|XP_010659126.1|  PREDICTED: probable polygalacturonase              241   1e-70    
ref|XP_009613774.1|  PREDICTED: probable polygalacturonase              242   2e-70    
ref|XP_010261531.1|  PREDICTED: probable polygalacturonase              241   2e-70    
ref|XP_007209143.1|  hypothetical protein PRUPE_ppa005818mg             240   2e-70    
gb|AIU50404.1|  pectin lyase-like superfamily protein                   239   2e-70    
ref|NP_194113.1|  glycoside hydrolase family 28 protein / polygal...    240   2e-70    
ref|XP_008807372.1|  PREDICTED: probable polygalacturonase              240   2e-70    
gb|AIU50436.1|  pectin lyase-like superfamily protein                   239   2e-70    
ref|XP_010266478.1|  PREDICTED: probable polygalacturonase              240   3e-70    
ref|XP_002516982.1|  Polygalacturonase, putative                        240   3e-70    
ref|XP_010670927.1|  PREDICTED: probable polygalacturonase              240   3e-70    
ref|XP_008810197.1|  PREDICTED: probable polygalacturonase isofor...    240   3e-70    
ref|XP_006841512.1|  hypothetical protein AMTR_s00003p00141260          241   3e-70    
emb|CDP17099.1|  unnamed protein product                                240   3e-70    
ref|XP_009624502.1|  PREDICTED: probable polygalacturonase              244   3e-70    
ref|NP_001066993.1|  Os12g0554800                                       239   4e-70    
ref|XP_004972433.1|  PREDICTED: probable polygalacturonase-like         241   4e-70    
ref|XP_001755533.1|  predicted protein                                  238   4e-70    
gb|AIU50439.1|  pectin lyase-like superfamily protein                   238   4e-70    
ref|XP_003519755.1|  PREDICTED: probable polygalacturonase              239   4e-70    
ref|XP_009383709.1|  PREDICTED: probable polygalacturonase              239   5e-70    
ref|XP_007048405.1|  Pectin lyase-like superfamily protein isoform 2    240   5e-70    
gb|AIU50429.1|  pectin lyase-like superfamily protein                   238   7e-70    
gb|AIU50405.1|  pectin lyase-like superfamily protein                   238   7e-70    
ref|XP_009384145.1|  PREDICTED: probable polygalacturonase              239   7e-70    
ref|XP_001779181.1|  predicted protein                                  237   8e-70    
gb|AIU50399.1|  pectin lyase-like superfamily protein                   238   8e-70    
ref|XP_011031186.1|  PREDICTED: probable polygalacturonase              240   9e-70    
ref|XP_009383737.1|  PREDICTED: probable polygalacturonase              239   9e-70    
gb|KDP27854.1|  hypothetical protein JCGZ_18934                         239   1e-69    
gb|KFK28938.1|  hypothetical protein AALP_AA7G068200                    238   1e-69    
ref|XP_006588584.1|  PREDICTED: probable polygalacturonase-like         239   1e-69    
emb|CDP12145.1|  unnamed protein product                                238   1e-69    
ref|XP_003575492.1|  PREDICTED: probable polygalacturonase              238   1e-69    
ref|XP_002867688.1|  glycoside hydrolase family 28 protein              238   1e-69    
ref|XP_010433858.1|  PREDICTED: probable polygalacturonase              238   1e-69    
ref|XP_004499965.1|  PREDICTED: probable polygalacturonase-like         238   2e-69    
ref|XP_011073737.1|  PREDICTED: probable polygalacturonase              238   2e-69    
ref|XP_006343870.1|  PREDICTED: probable polygalacturonase-like         238   2e-69    
emb|CDM83426.1|  unnamed protein product                                238   2e-69    
ref|XP_003551949.1|  PREDICTED: probable polygalacturonase-like         238   2e-69    
ref|XP_010439131.1|  PREDICTED: probable polygalacturonase              238   3e-69    
ref|XP_006586032.1|  PREDICTED: probable polygalacturonase-like         237   3e-69    
gb|KHG14610.1|  putative polygalacturonase                              238   3e-69    
ref|XP_010325363.1|  PREDICTED: probable polygalacturonase isofor...    238   3e-69    
ref|XP_007040496.1|  Pectin lyase-like superfamily protein              238   3e-69    
ref|XP_004245522.1|  PREDICTED: probable polygalacturonase isofor...    238   3e-69    
gb|EAY85246.1|  hypothetical protein OsI_06620                          237   3e-69    



>ref|XP_004240097.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=486

 Score =   363 bits (931),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAHSASI DFGGVGDGKTLNTKAF+EA+N LS+Y++ GGA+LIVPAG+WLTGS
Sbjct  49   EYSAISCRAHSASITDFGGVGDGKTLNTKAFQEAVNRLSQYASDGGAQLIVPAGQWLTGS  108

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDA+LLASQDIN W ++ PLPSYGHGRDTSGGR ISL+FG+NL DV+I
Sbjct  109  FNLTSHFTLFLHKDAILLASQDINEWAVIDPLPSYGHGRDTSGGRYISLLFGTNLTDVII  168

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG +WWQ+F SKKLKYTRPYLIEIMHSD IQIS++TL+NSPSWN+HPVYSS
Sbjct  169  TGENGTIDGQGEIWWQKFHSKKLKYTRPYLIEIMHSDNIQISHITLVNSPSWNIHPVYSS  228

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+QG+TILAPVKS NTDGINPDS
Sbjct  229  NIIVQGITILAPVKSPNTDGINPDS  253



>ref|XP_009599786.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana tomentosiformis]
Length=474

 Score =   362 bits (928),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS RAHSASIKDFGGVGDGKTLNTKAF+EA+N LS+Y++ GG++LIVPAG+WLTGS
Sbjct  37   EYKAISCRAHSASIKDFGGVGDGKTLNTKAFQEAVNQLSQYASDGGSQLIVPAGQWLTGS  96

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAVLLASQ+IN W ++ PLPSYGHGRD +GGR ISL+FG+NL DV+I
Sbjct  97   FNLTSHFTLFLQKDAVLLASQEINEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVII  156

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGALWWQ+F SKKLKYTRPYLIE+MHSD IQISNLTL+NSPSWN+HPVYSS
Sbjct  157  TGENGTIDGQGALWWQKFHSKKLKYTRPYLIELMHSDNIQISNLTLVNSPSWNIHPVYSS  216

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIIIQG+TILAPVKS NTDGINPDS
Sbjct  217  NIIIQGITILAPVKSPNTDGINPDS  241



>ref|XP_011092828.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=505

 Score =   362 bits (930),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSAIS RAHSASI+DFGGVGDG TLNT+AF++A+N+LS+Y++ GGA+L VPAGKWLTGS
Sbjct  67   DYSAISCRAHSASIEDFGGVGDGATLNTQAFQQAVNHLSQYASDGGAQLFVPAGKWLTGS  126

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDA+LLASQDIN+WP+V PLPSYGHGRD +GGR ISLIFG+NL DVV+
Sbjct  127  FNLTSHFTLYLHKDAILLASQDINSWPVVDPLPSYGHGRDAAGGRYISLIFGTNLTDVVV  186

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGALWWQQF  KKLKYTRPYLIEIMHS+ +QISNLTL+NSPSWNVHPVYSS
Sbjct  187  TGENGTIDGQGALWWQQFHRKKLKYTRPYLIEIMHSENVQISNLTLVNSPSWNVHPVYSS  246

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+I+QGLTILAPV S NTDGINPDS
Sbjct  247  NVIVQGLTILAPVTSPNTDGINPDS  271



>ref|XP_009599780.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana tomentosiformis]
Length=486

 Score =   361 bits (927),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS RAHSASIKDFGGVGDGKTLNTKAF+EA+N LS+Y++ GG++LIVPAG+WLTGS
Sbjct  49   EYKAISCRAHSASIKDFGGVGDGKTLNTKAFQEAVNQLSQYASDGGSQLIVPAGQWLTGS  108

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAVLLASQ+IN W ++ PLPSYGHGRD +GGR ISL+FG+NL DV+I
Sbjct  109  FNLTSHFTLFLQKDAVLLASQEINEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVII  168

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGALWWQ+F SKKLKYTRPYLIE+MHSD IQISNLTL+NSPSWN+HPVYSS
Sbjct  169  TGENGTIDGQGALWWQKFHSKKLKYTRPYLIELMHSDNIQISNLTLVNSPSWNIHPVYSS  228

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIIIQG+TILAPVKS NTDGINPDS
Sbjct  229  NIIIQGITILAPVKSPNTDGINPDS  253



>ref|XP_006345582.1| PREDICTED: probable polygalacturonase-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006345583.1| PREDICTED: probable polygalacturonase-like isoform X3 [Solanum 
tuberosum]
Length=477

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAHSASI DFGGVGDGKTLNTKAF+EA+N LSKY++ GG++LIVPAG+WLTGS
Sbjct  40   EYSAISCRAHSASITDFGGVGDGKTLNTKAFQEAVNQLSKYASDGGSQLIVPAGQWLTGS  99

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAVLLASQDIN W ++ PLPSYGHGRD +GGR ISL+FG+NL DV+I
Sbjct  100  FNLTSHFTLFLHKDAVLLASQDINEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVII  159

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG +WWQ+F SKKLKYTRPYLIEIMHSD IQIS++TL+NSPSWN+HPVYSS
Sbjct  160  TGENGTIDGQGEIWWQKFHSKKLKYTRPYLIEIMHSDNIQISDITLVNSPSWNIHPVYSS  219

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TILAPVKS NTDGINPDS
Sbjct  220  NIIVKGITILAPVKSPNTDGINPDS  244



>ref|XP_006345581.1| PREDICTED: probable polygalacturonase-like isoform X1 [Solanum 
tuberosum]
Length=481

 Score =   360 bits (923),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAHSASI DFGGVGDGKTLNTKAF+EA+N LSKY++ GG++LIVPAG+WLTGS
Sbjct  44   EYSAISCRAHSASITDFGGVGDGKTLNTKAFQEAVNQLSKYASDGGSQLIVPAGQWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAVLLASQDIN W ++ PLPSYGHGRD +GGR ISL+FG+NL DV+I
Sbjct  104  FNLTSHFTLFLHKDAVLLASQDINEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVII  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG +WWQ+F SKKLKYTRPYLIEIMHSD IQIS++TL+NSPSWN+HPVYSS
Sbjct  164  TGENGTIDGQGEIWWQKFHSKKLKYTRPYLIEIMHSDNIQISDITLVNSPSWNIHPVYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TILAPVKS NTDGINPDS
Sbjct  224  NIIVKGITILAPVKSPNTDGINPDS  248



>ref|XP_009767883.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=476

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            YSAI+ R HSASIKDFGGVGDGKTLNTKAF++A+N LS+Y++ GGA+L++PAG+WLTGSF
Sbjct  40   YSAINCRKHSASIKDFGGVGDGKTLNTKAFQKAVNQLSQYASDGGAQLVIPAGQWLTGSF  99

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFLHKDAVLLASQ+IN WPL+ PLPSYGHGRD  GGR ISLIFG+NL DV+IT
Sbjct  100  NLTSHFTLFLHKDAVLLASQEINQWPLIDPLPSYGHGRDAPGGRYISLIFGTNLTDVIIT  159

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G NGTIDGQGALWWQQF  KKLKYTRPYLIE+MHS++IQISNLTL+NSPSWN+HPVYSSN
Sbjct  160  GENGTIDGQGALWWQQFHRKKLKYTRPYLIELMHSNKIQISNLTLVNSPSWNIHPVYSSN  219

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            IIIQGLTILAPV S NTDGI+PDS
Sbjct  220  IIIQGLTILAPVTSPNTDGIDPDS  243



>ref|XP_009762711.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana sylvestris]
Length=479

 Score =   357 bits (915),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS RAHSASI DFGGVGDGKTLNTKAF+EA+N LS+Y++ GG++LIVPAG+WLTGS
Sbjct  42   EYKAISCRAHSASITDFGGVGDGKTLNTKAFQEAVNQLSQYASDGGSQLIVPAGQWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAVLLASQ+IN W ++ PLPSYGHGRD +GGR ISL+FG+NL DV+I
Sbjct  102  FNLTSHFTLFLQKDAVLLASQEINEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVII  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWWQ+F SKKLKYTRPYLIE+MHSD IQIS+LTL+NSPSWN+HPVYSS
Sbjct  162  TGENGTIDGQGELWWQKFHSKKLKYTRPYLIELMHSDNIQISDLTLVNSPSWNIHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIIIQG+TILAPVKS NTDGINPDS
Sbjct  222  NIIIQGITILAPVKSPNTDGINPDS  246



>ref|XP_009762710.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana sylvestris]
Length=486

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS RAHSASI DFGGVGDGKTLNTKAF+EA+N LS+Y++ GG++LIVPAG+WLTGS
Sbjct  49   EYKAISCRAHSASITDFGGVGDGKTLNTKAFQEAVNQLSQYASDGGSQLIVPAGQWLTGS  108

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAVLLASQ+IN W ++ PLPSYGHGRD +GGR ISL+FG+NL DV+I
Sbjct  109  FNLTSHFTLFLQKDAVLLASQEINEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVII  168

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWWQ+F SKKLKYTRPYLIE+MHSD IQIS+LTL+NSPSWN+HPVYSS
Sbjct  169  TGENGTIDGQGELWWQKFHSKKLKYTRPYLIELMHSDNIQISDLTLVNSPSWNIHPVYSS  228

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIIIQG+TILAPVKS NTDGINPDS
Sbjct  229  NIIIQGITILAPVKSPNTDGINPDS  253



>ref|XP_006339619.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=476

 Score =   354 bits (909),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            YSAI+ R HSASIKDFGG+GDGKTLNTKAF++A+N LSKY++ GGA+LI+PAG WLTGSF
Sbjct  40   YSAINCRKHSASIKDFGGIGDGKTLNTKAFQKAVNQLSKYASDGGAQLIIPAGHWLTGSF  99

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFLHKDAVLLASQ+IN WP++ PLPSYGHGRD  GGR ISLIFG+NL DV+IT
Sbjct  100  NLTSHFTLFLHKDAVLLASQEINQWPVIDPLPSYGHGRDAPGGRYISLIFGTNLTDVIIT  159

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G NGTIDGQGALWWQQF   KLKYTRPYLIE+MHS++IQISNLTLLNSPSWN+HPVYSS+
Sbjct  160  GENGTIDGQGALWWQQFHMNKLKYTRPYLIELMHSNKIQISNLTLLNSPSWNIHPVYSSD  219

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            IIIQG+TILAPV S NTDGINPDS
Sbjct  220  IIIQGITILAPVTSPNTDGINPDS  243



>ref|XP_009624373.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=470

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  ESSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGK  451
            ++S   YSAI  R HSASIKDFGG+GDGKTLNTKAF++A+N LS+Y++ GGA+L++PAG 
Sbjct  27   KTSELTYSAIKCRKHSASIKDFGGIGDGKTLNTKAFQKAVNQLSQYASDGGAQLVIPAGH  86

Query  450  WLTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNL  271
            WLT SFNLTSHFTLFLHKDA+LLASQ+IN WPL+ PLPSYGHGRD  GGR ISLIFG+NL
Sbjct  87   WLTASFNLTSHFTLFLHKDALLLASQEINQWPLIDPLPSYGHGRDAPGGRYISLIFGTNL  146

Query  270  VDVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVH  91
             DV+ITG NGTIDGQGA+WWQQF  KKLKYTRPYLIE+MHS++IQISNLTL+NSPSWN+H
Sbjct  147  TDVIITGENGTIDGQGAVWWQQFHRKKLKYTRPYLIELMHSNKIQISNLTLVNSPSWNIH  206

Query  90   PVYSSNIIIQGLTILAPVKSANTDGINPDS  1
            PVYSSNIIIQGLTILAPV S NTDGI+PDS
Sbjct  207  PVYSSNIIIQGLTILAPVTSPNTDGIDPDS  236



>gb|EPS72197.1| hypothetical protein M569_02558, partial [Genlisea aurea]
Length=458

 Score =   350 bits (897),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            Y+AIS RAH+ASI DFGGVGDG TLNT AFR+A++ L +Y + GGA+L VP GKWLTGSF
Sbjct  29   YTAISCRAHTASILDFGGVGDGDTLNTLAFRQAVDQLGRYGSDGGAQLFVPPGKWLTGSF  88

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFLH+DAVLLASQDI +WPLV PLPSYGHGRD  GGR  SLIFG+NL DVVIT
Sbjct  89   NLTSHFTLFLHRDAVLLASQDIESWPLVDPLPSYGHGRDAPGGRYASLIFGTNLTDVVIT  148

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G NGTIDGQG +WW+QFR KKLKYTRPYLIEIMHSD IQISNLTL+NSPSWNVHPVYSSN
Sbjct  149  GGNGTIDGQGEVWWEQFRGKKLKYTRPYLIEIMHSDNIQISNLTLVNSPSWNVHPVYSSN  208

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            +IIQGLTILAPV S NTDGINPDS
Sbjct  209  VIIQGLTILAPVTSPNTDGINPDS  232



>gb|EYU35105.1| hypothetical protein MIMGU_mgv1a005694mg [Erythranthe guttata]
Length=474

 Score =   349 bits (896),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAHSASI DFGGVGDG TLNT+AFR A+++LS++ + GGA+L VPAGKWLTGS
Sbjct  35   EYSAISCRAHSASILDFGGVGDGVTLNTQAFRSAVDHLSQFQSDGGAQLFVPAGKWLTGS  94

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LH+DAV+LASQ+INTW ++ PLPSYGHGRD +GGR ISLIFG+NL DVVI
Sbjct  95   FNLTSHFTLYLHQDAVILASQEINTWAVIDPLPSYGHGRDAAGGRYISLIFGTNLTDVVI  154

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGT+DGQG +WWQQF+ KKLKYTRPYL+EIMHSD IQISNLT LNSPSWN+HPVY+S
Sbjct  155  TGENGTVDGQGLVWWQQFKKKKLKYTRPYLLEIMHSDNIQISNLTFLNSPSWNIHPVYTS  214

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIIIQG+TILAP+ S NTDGINPDS
Sbjct  215  NIIIQGITILAPITSPNTDGINPDS  239



>ref|XP_004229920.2| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=476

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            YSAI+ R HSASIKDFGG+GDG TLNT+AF++A+N LSKY++ GGA+L++PAG WLTGSF
Sbjct  40   YSAINCRKHSASIKDFGGIGDGTTLNTEAFQKAVNQLSKYASDGGAQLVIPAGHWLTGSF  99

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFLHKDAVLLASQ+IN WPL+ PLPSYGHGRD  GGR ISLIFG+NL DV+IT
Sbjct  100  NLTSHFTLFLHKDAVLLASQEINQWPLIDPLPSYGHGRDAPGGRYISLIFGTNLTDVIIT  159

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G NGTIDGQGALWWQQF   KLKYTRPYLIE+MHS++IQISNLTLLNSPSWN+HPVYSSN
Sbjct  160  GENGTIDGQGALWWQQFHLNKLKYTRPYLIELMHSNKIQISNLTLLNSPSWNIHPVYSSN  219

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            III G+TILAPV S NTDGI+PDS
Sbjct  220  IIINGITILAPVTSPNTDGIDPDS  243



>emb|CBI40426.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAHSAS+ DFGGVGDG+TLNTKAF++A++ LSKY + GGA+L VPAGKWLTGS
Sbjct  38   EYSAISCRAHSASLVDFGGVGDGQTLNTKAFQDAVSELSKYGSEGGAQLYVPAGKWLTGS  97

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTLFLH+DAVLLASQDI+ WP++ PLPSYG GRD + GR  SLIFG+NL DV+I
Sbjct  98   FSLTSHFTLFLHRDAVLLASQDISQWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVII  157

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+F   KLKYTRPYLIE+M+S  IQISNLTLLNSPSWNVHPVYS 
Sbjct  158  TGDNGTIDGQGGLWWQRFHGGKLKYTRPYLIELMYSADIQISNLTLLNSPSWNVHPVYSR  217

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQG+TILAPV+S NTDGINPDS
Sbjct  218  NILIQGITILAPVRSPNTDGINPDS  242



>ref|XP_006491165.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=481

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS RAHSASI DFGGVGDGKT NTKAF++A+N LS+YS+ GGA+L VPAGKWLTGS
Sbjct  43   EYNAISCRAHSASITDFGGVGDGKTSNTKAFKDAINQLSQYSSDGGAQLYVPAGKWLTGS  102

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNL SHFTL+LHKDA LLASQD+N WP++ PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  103  FNLISHFTLYLHKDAFLLASQDLNEWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVIV  162

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGALWWQQF   KLKYTRPYLIE M++D IQIS+LTLLNSPSWNVHPVYSS
Sbjct  163  TGDNGTIDGQGALWWQQFHKGKLKYTRPYLIEFMYTDNIQISSLTLLNSPSWNVHPVYSS  222

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TI+APV S NTDGINPDS
Sbjct  223  NILVQGITIIAPVTSPNTDGINPDS  247



>emb|CDP20376.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS R HSASI++FGGVGDG+TLNTKAF+EA+N LS+Y++ GGA+L VPAGKWLTGS
Sbjct  47   EYSAISCRGHSASIEEFGGVGDGRTLNTKAFQEAVNQLSQYASEGGAQLYVPAGKWLTGS  106

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDAVLLASQDI +WP+V PLPSYGHGRD +GGR ISL+FG+NL DVVI
Sbjct  107  FNLTSHFTLYLHKDAVLLASQDIGSWPVVDPLPSYGHGRDAAGGRYISLLFGTNLTDVVI  166

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGALWWQQF  KKLK+TRPYLIEIMHSD +QISNLTL+NSPSWNVHPVYSS
Sbjct  167  TGDNGTIDGQGALWWQQFHKKKLKFTRPYLIEIMHSDTVQISNLTLVNSPSWNVHPVYSS  226

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIIIQG+TI+AP+ S NTDGINPDS
Sbjct  227  NIIIQGITIIAPITSPNTDGINPDS  251



>ref|XP_004133855.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
 gb|KGN56496.1| hypothetical protein Csa_3G121720 [Cucumis sativus]
Length=493

 Score =   342 bits (877),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  ESSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGK  451
            E +G EY AIS RAH+ASI +FGGVGDG T NTKAF+ A+  LS+Y+  GGA+L VPAGK
Sbjct  50   EGNGIEYGAISCRAHTASITEFGGVGDGVTSNTKAFQAAVEQLSQYTDDGGAQLYVPAGK  109

Query  450  WLTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNL  271
            WLTGSFNLTSHFTLFLH+DAVLLASQD N WP+V PLPSYGHGRDTSGGR ISLIFG+NL
Sbjct  110  WLTGSFNLTSHFTLFLHQDAVLLASQDPNEWPVVEPLPSYGHGRDTSGGRYISLIFGTNL  169

Query  270  VDVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVH  91
             DVVITGNNGTIDGQG  WWQ F   KLKYTRPYLIE+M+S  IQIS+LTLLNSP+WNVH
Sbjct  170  TDVVITGNNGTIDGQGDRWWQLFHQGKLKYTRPYLIELMYSSDIQISSLTLLNSPAWNVH  229

Query  90   PVYSSNIIIQGLTILAPVKSANTDGINPDS  1
            PVYSSNI+IQG+TI+APV+S NTDGINPDS
Sbjct  230  PVYSSNILIQGITIIAPVRSPNTDGINPDS  259



>ref|XP_006444979.1| hypothetical protein CICLE_v10019597mg [Citrus clementina]
 gb|ESR58219.1| hypothetical protein CICLE_v10019597mg [Citrus clementina]
Length=544

 Score =   343 bits (881),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS RAHSASI DFGGVGDGKT NTKAF++A+N LS+YS+ GGA+L VPAGKWLTGS
Sbjct  106  EYNAISCRAHSASITDFGGVGDGKTSNTKAFKDAINQLSQYSSDGGAQLYVPAGKWLTGS  165

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNL SHFTL+LHKDA LLASQD+N WP++ PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  166  FNLISHFTLYLHKDAFLLASQDLNEWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVIV  225

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGALWWQQF   KLKYTRPYLIE M++D IQIS+LTLLNSPSWNVHPVYSS
Sbjct  226  TGDNGTIDGQGALWWQQFHKGKLKYTRPYLIEFMYTDNIQISSLTLLNSPSWNVHPVYSS  285

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TI+APV S NTDGINPDS
Sbjct  286  NILVQGITIIAPVTSPNTDGINPDS  310



>ref|XP_004172137.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
Length=493

 Score =   342 bits (876),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  ESSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGK  451
            E +G EY AIS RAH+ASI +FGGVGDG T NTKAF+ A+  LS+Y+  GGA+L VPAGK
Sbjct  50   EGNGIEYGAISCRAHTASITEFGGVGDGVTSNTKAFQAAVEQLSQYTDDGGAQLYVPAGK  109

Query  450  WLTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNL  271
            WLTGSFNLTSHFTLFLH+DAVLLASQD N WP+V PLPSYGHGRDTSGGR ISLIFG+NL
Sbjct  110  WLTGSFNLTSHFTLFLHQDAVLLASQDPNEWPVVEPLPSYGHGRDTSGGRYISLIFGTNL  169

Query  270  VDVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVH  91
             DVVITGNNGTIDGQG  WWQ F   KLKYTRPYLIE+M+S  IQIS+LTLLNSP+WNVH
Sbjct  170  TDVVITGNNGTIDGQGDRWWQLFHQGKLKYTRPYLIELMYSSDIQISSLTLLNSPAWNVH  229

Query  90   PVYSSNIIIQGLTILAPVKSANTDGINPDS  1
            PVYSSNI+IQG+TI+APV+S NTDGINPDS
Sbjct  230  PVYSSNILIQGITIIAPVRSPNTDGINPDS  259



>ref|XP_004510753.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=481

 Score =   341 bits (875),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -1

Query  624  SGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWL  445
            S  EY+AI+ RAHS SIKDFGGVGDGKTLNTKAF  A+N+L++Y + GG++L VPAGKWL
Sbjct  43   SSFEYNAINCRAHSVSIKDFGGVGDGKTLNTKAFESAINHLNQYGSEGGSQLYVPAGKWL  102

Query  444  TGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVD  265
            TGSF+L SHFTL+L+KDAVLLASQD+N WP++ PLPSYG GRDT+GGR  SLIFG+NL D
Sbjct  103  TGSFSLISHFTLYLNKDAVLLASQDMNEWPVIKPLPSYGRGRDTAGGRYTSLIFGTNLTD  162

Query  264  VVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPV  85
            V++TG+NGTIDGQG+ WWQQF  KKLKYTRPYLIE+M SD IQISNLTLLNSPSWN+HPV
Sbjct  163  VIVTGDNGTIDGQGSFWWQQFHMKKLKYTRPYLIELMFSDSIQISNLTLLNSPSWNIHPV  222

Query  84   YSSNIIIQGLTILAPVKSANTDGINPDS  1
            YSSNII++G+TI+APV+S NTDGINPDS
Sbjct  223  YSSNIIVKGITIIAPVRSPNTDGINPDS  250



>ref|XP_003633958.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=479

 Score =   341 bits (875),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAHSAS+ DFGGVGDG+TLNTKAF++A++ LSKY + GGA+L VPAGKWLTGS
Sbjct  40   EYSAISCRAHSASLVDFGGVGDGQTLNTKAFQDAVSELSKYGSEGGAQLYVPAGKWLTGS  99

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTLFLH+DAVLLASQDI+ WP++ PLPSYG GRD + GR  SLIFG+NL DV+I
Sbjct  100  FSLTSHFTLFLHRDAVLLASQDISQWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVII  159

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+F   KLKYTRPYLIE+M+S  IQISNLTLLNSPSWNVHPVYS 
Sbjct  160  TGDNGTIDGQGGLWWQRFHGGKLKYTRPYLIELMYSADIQISNLTLLNSPSWNVHPVYSR  219

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQG+TILAPV+S NTDGINPDS
Sbjct  220  NILIQGITILAPVRSPNTDGINPDS  244



>sp|A7PZL3.1|PGLR_VITVI RecName: Full=Probable polygalacturonase; Short=PG; AltName: 
Full=Pectinase [Vitis vinifera]
Length=491

 Score =   341 bits (874),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAHSAS+ DFGGVGDG+TLNTKAF++A++ LSKY + GGA+L VPAGKWLTGS
Sbjct  52   EYSAISCRAHSASLVDFGGVGDGQTLNTKAFQDAVSELSKYGSEGGAQLYVPAGKWLTGS  111

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTLFLH+DAVLLASQDI+ WP++ PLPSYG GRD + GR  SLIFG+NL DV+I
Sbjct  112  FSLTSHFTLFLHRDAVLLASQDISQWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVII  171

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+F   KLKYTRPYLIE+M+S  IQISNLTLLNSPSWNVHPVYS 
Sbjct  172  TGDNGTIDGQGGLWWQRFHGGKLKYTRPYLIELMYSADIQISNLTLLNSPSWNVHPVYSR  231

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQG+TILAPV+S NTDGINPDS
Sbjct  232  NILIQGITILAPVRSPNTDGINPDS  256



>ref|XP_010255225.1| PREDICTED: probable polygalacturonase isoform X3 [Nelumbo nucifera]
Length=468

 Score =   339 bits (870),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA+S R HSAS+ D+GGVGDG+TLNTKAF+ A+++LS++++ GGA+L VP G+WLTGS
Sbjct  30   QYSAMSCRVHSASLTDYGGVGDGQTLNTKAFQSAIDHLSQFASDGGAQLFVPPGRWLTGS  89

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAVLLASQD++ WP++ PLPSYG GRDT+GGR +SLIFG+NL DVVI
Sbjct  90   FNLTSHFTLFLHRDAVLLASQDVSQWPVIEPLPSYGRGRDTAGGRYVSLIFGTNLTDVVI  149

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGALWWQ+F   +LKYTRPYLIEIM SDQ+QISNL L+NSPSWNVHPVYSS
Sbjct  150  TGDNGTIDGQGALWWQKFHKGQLKYTRPYLIEIMFSDQVQISNLMLVNSPSWNVHPVYSS  209

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QG+TI+APV S NTDGINPDS
Sbjct  210  NVLVQGITIIAPVTSPNTDGINPDS  234



>ref|XP_010276902.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=482

 Score =   339 bits (869),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+A+S RAHSAS+ DFG VGDG TLNTKAF+ A+++LS++++ GGA+L VP G+WLTGS
Sbjct  42   EYTAVSCRAHSASLTDFGAVGDGVTLNTKAFQAAIDHLSQFASDGGAQLFVPRGRWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDAVLLASQD++ WPL+ PLPSYG GRD  GGR ISLIFG+NL DVVI
Sbjct  102  FNLTSHFTLYLHKDAVLLASQDVSEWPLIEPLPSYGRGRDAPGGRYISLIFGTNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ++RS +L YTRPYLIEIM+SDQ+QISNL L+NSPSWNVHPVYSS
Sbjct  162  TGDNGTIDGQGDLWWQKYRSGQLNYTRPYLIEIMYSDQVQISNLALVNSPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+I+QGLTI APV S NTDGINPDS
Sbjct  222  NVIVQGLTITAPVTSPNTDGINPDS  246



>ref|XP_010255224.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=489

 Score =   339 bits (870),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA+S R HSAS+ D+GGVGDG+TLNTKAF+ A+++LS++++ GGA+L VP G+WLTGS
Sbjct  51   QYSAMSCRVHSASLTDYGGVGDGQTLNTKAFQSAIDHLSQFASDGGAQLFVPPGRWLTGS  110

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAVLLASQD++ WP++ PLPSYG GRDT+GGR +SLIFG+NL DVVI
Sbjct  111  FNLTSHFTLFLHRDAVLLASQDVSQWPVIEPLPSYGRGRDTAGGRYVSLIFGTNLTDVVI  170

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGALWWQ+F   +LKYTRPYLIEIM SDQ+QISNL L+NSPSWNVHPVYSS
Sbjct  171  TGDNGTIDGQGALWWQKFHKGQLKYTRPYLIEIMFSDQVQISNLMLVNSPSWNVHPVYSS  230

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QG+TI+APV S NTDGINPDS
Sbjct  231  NVLVQGITIIAPVTSPNTDGINPDS  255



>ref|XP_010112958.1| putative polygalacturonase [Morus notabilis]
 gb|EXC35117.1| putative polygalacturonase [Morus notabilis]
Length=454

 Score =   338 bits (866),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS R HSAS+ +FGGVGDGKT NTKAF++A+N+LS++++ GGA+L VPAGKWLTGS
Sbjct  42   EYNAISCRGHSASLTEFGGVGDGKTSNTKAFQDAINHLSQFASDGGAQLFVPAGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L SHFTL+LHKDAVLLASQDIN WP++ PLPSYG GRD +GGR  SLIFG+NL D+V+
Sbjct  102  FSLISHFTLYLHKDAVLLASQDINEWPVLKPLPSYGRGRDAAGGRFTSLIFGTNLTDIVV  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG+ WWQQF   KLKYTRPYLIEIM SD IQISNLTLLN+PSWNVHPVYSS
Sbjct  162  TGENGTIDGQGSFWWQQFHKGKLKYTRPYLIEIMFSDSIQISNLTLLNAPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQG+TI+APV S NTDGINPDS
Sbjct  222  NILIQGITIIAPVTSPNTDGINPDS  246



>ref|XP_010255223.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=508

 Score =   340 bits (871),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA+S R HSAS+ D+GGVGDG+TLNTKAF+ A+++LS++++ GGA+L VP G+WLTGS
Sbjct  70   QYSAMSCRVHSASLTDYGGVGDGQTLNTKAFQSAIDHLSQFASDGGAQLFVPPGRWLTGS  129

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAVLLASQD++ WP++ PLPSYG GRDT+GGR +SLIFG+NL DVVI
Sbjct  130  FNLTSHFTLFLHRDAVLLASQDVSQWPVIEPLPSYGRGRDTAGGRYVSLIFGTNLTDVVI  189

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGALWWQ+F   +LKYTRPYLIEIM SDQ+QISNL L+NSPSWNVHPVYSS
Sbjct  190  TGDNGTIDGQGALWWQKFHKGQLKYTRPYLIEIMFSDQVQISNLMLVNSPSWNVHPVYSS  249

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QG+TI+APV S NTDGINPDS
Sbjct  250  NVLVQGITIIAPVTSPNTDGINPDS  274



>ref|XP_002511903.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF50572.1| polygalacturonase, putative [Ricinus communis]
Length=472

 Score =   338 bits (866),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS RAHSASI DFGGVGDG T NTKAF++A+ +LS+Y+  GG++L VPAGKWLTGS
Sbjct  43   EYNAISCRAHSASITDFGGVGDGITSNTKAFQDAIAHLSQYATDGGSQLFVPAGKWLTGS  102

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTLFLHKDAVLL SQD+  WPL+ PLPSYG GRD + GR  SLIFG+NL D+++
Sbjct  103  FSLTSHFTLFLHKDAVLLGSQDLKEWPLLKPLPSYGRGRDAAAGRYSSLIFGTNLTDIIV  162

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WWQQF+  KLKYTRPYLIEIM+SD IQISNLTLLNSPSWNVHPVYSS
Sbjct  163  TGNNGTIDGQGAFWWQQFKKGKLKYTRPYLIEIMYSDNIQISNLTLLNSPSWNVHPVYSS  222

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQG+TI+APV S NTDGINPD 
Sbjct  223  NILIQGITIIAPVTSPNTDGINPDC  247



>ref|XP_006402475.1| hypothetical protein EUTSA_v10005939mg [Eutrema salsugineum]
 gb|ESQ43928.1| hypothetical protein EUTSA_v10005939mg [Eutrema salsugineum]
Length=475

 Score =   337 bits (864),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ R+HSASI +FGGVGDGKTLNTKAF+ A+++LS+Y++ GGA+L VPAGKWLTGS
Sbjct  35   EYTAITCRSHSASITEFGGVGDGKTLNTKAFQSAVDHLSQYASDGGAQLFVPAGKWLTGS  94

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDA+LLA+QDIN +P++  LPSYG GRD +GGR  SL+FG+NL DVVI
Sbjct  95   FNLTSHFTLFLHKDAILLAAQDINEYPILKALPSYGRGRDAAGGRFASLLFGTNLSDVVI  154

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WWQ+F   KLKYTRPYLIE+M SD IQISNLTLL+SPSWN+HPVYSS
Sbjct  155  TGNNGTIDGQGSFWWQKFHGGKLKYTRPYLIELMFSDTIQISNLTLLDSPSWNIHPVYSS  214

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TI+APVKS NTDGINPDS
Sbjct  215  NIIVKGVTIIAPVKSPNTDGINPDS  239



>ref|XP_010469084.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=476

 Score =   337 bits (863),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+A + R+HSASI +FGGVGDGKTLNTKAF+ A+++LS+YS+ GGA+L VPAGKWLTGS
Sbjct  34   EYTATTCRSHSASITEFGGVGDGKTLNTKAFQSAVDHLSQYSSDGGAQLFVPAGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDA LLA+QD+N +P++  LPSYG GRDT+GGR  SLIFG+NL DV+I
Sbjct  94   FNLTSHFTLFLHKDATLLAAQDLNEYPILKALPSYGRGRDTAGGRFASLIFGTNLSDVII  153

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WWQ+F   KLKYTRPYLIEIM SD IQISNLT L+SPSWN+HPVYSS
Sbjct  154  TGNNGTIDGQGSFWWQKFHGGKLKYTRPYLIEIMFSDTIQISNLTFLDSPSWNIHPVYSS  213

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TI+APVKS NTDGINPDS
Sbjct  214  NIIVKGVTIIAPVKSPNTDGINPDS  238



>ref|XP_004298828.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=503

 Score =   337 bits (865),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSAIS RA+ AS+ DFGGVGDG T NTKAF+ A+ +LS+Y + GG++L VPAGKWLTGS
Sbjct  65   QYSAISCRAYGASLADFGGVGDGTTSNTKAFQAAIQHLSQYESQGGSQLFVPAGKWLTGS  124

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDAVLLASQD N WP++ PLPSYG GRDT+GGR ISLIFG+NL DVV+
Sbjct  125  FNLTSHFTLYLHKDAVLLASQDENEWPVIDPLPSYGRGRDTAGGRFISLIFGTNLTDVVV  184

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWWQ+FR  +LKYTRPYLIEIM S+ IQISNLT +NSPSWNVHPVYSS
Sbjct  185  TGENGTIDGQGELWWQKFRKGELKYTRPYLIEIMFSENIQISNLTFINSPSWNVHPVYSS  244

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QGLTILAPV S NTDGINPDS
Sbjct  245  NVLVQGLTILAPVTSPNTDGINPDS  269



>ref|XP_006580552.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=469

 Score =   336 bits (862),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S RA+SAS+++FGGVGDG TLNTKAF+ A+++LS+Y++ GG++L VP GKWLTGS
Sbjct  32   EYCAMSCRAYSASLEEFGGVGDGTTLNTKAFQAAIDHLSQYASSGGSQLYVPPGKWLTGS  91

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LASQD N WP++ PLPSYG GRDT GGR  SLIFG+NL DV+I
Sbjct  92   FNLTSHFTLFLHKDAVILASQDENDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVII  151

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+FR  +LKYTRPYLIEIM+SD +QISNLTL+NSPSWNVHP+YSS
Sbjct  152  TGDNGTIDGQGDLWWQKFRKGELKYTRPYLIEIMYSDNVQISNLTLVNSPSWNVHPIYSS  211

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QG+TILAPV S NTDGINPDS
Sbjct  212  NLVVQGITILAPVTSPNTDGINPDS  236



>ref|XP_003532926.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=494

 Score =   337 bits (864),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S RA+SAS+++FGGVGDG TLNTKAF+ A+ NLS+Y+A GG++L VP GKWLTGS
Sbjct  57   EYCAMSCRAYSASLEEFGGVGDGTTLNTKAFQAAIENLSQYAASGGSQLYVPPGKWLTGS  116

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LASQD N WP++ PLPSYG GRDT GGR  SLIFG+NL DV+I
Sbjct  117  FNLTSHFTLFLHKDAVILASQDENDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVII  176

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+F   +LKYTRPYL+EIM+SD +QISNLTL+NSPSWNVHP+YSS
Sbjct  177  TGDNGTIDGQGDLWWQKFHKGELKYTRPYLVEIMYSDNVQISNLTLVNSPSWNVHPIYSS  236

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QG+TILAPV S NTDGINPDS
Sbjct  237  NVVVQGITILAPVTSPNTDGINPDS  261



>ref|XP_007219266.1| hypothetical protein PRUPE_ppa018224mg, partial [Prunus persica]
 gb|EMJ20465.1| hypothetical protein PRUPE_ppa018224mg, partial [Prunus persica]
Length=463

 Score =   336 bits (862),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS RAHSAS+ +FGGVGDGKT NTKAF+ A++ LS+Y++ GGA+L VPAGKWLTGS
Sbjct  38   EYTAISCRAHSASLTEFGGVGDGKTSNTKAFQAAISQLSQYASEGGAQLFVPAGKWLTGS  97

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNL SHFTL+LHKDAVLLASQD+N WP++ PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  98   FNLISHFTLYLHKDAVLLASQDMNEWPVLKPLPSYGRGRDAAAGRFSSLIFGTNLTDVIV  157

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG  WWQQF  KKLKYTRPYLIEIM S  IQISNLTLL+SPSWNVHPVYSS
Sbjct  158  TGDNGTIDGQGEFWWQQFHKKKLKYTRPYLIEIMFSTDIQISNLTLLDSPSWNVHPVYSS  217

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TI+AP+ S NTDGINPDS
Sbjct  218  NILVQGITIIAPITSPNTDGINPDS  242



>ref|XP_003525377.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=492

 Score =   337 bits (863),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S RA+SAS+++FGGVGDG TLNTKAF+ A+++LS+Y++ GG++L VP GKWLTGS
Sbjct  55   EYCAMSCRAYSASLEEFGGVGDGTTLNTKAFQAAIDHLSQYASSGGSQLYVPPGKWLTGS  114

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LASQD N WP++ PLPSYG GRDT GGR  SLIFG+NL DV+I
Sbjct  115  FNLTSHFTLFLHKDAVILASQDENDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVII  174

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+FR  +LKYTRPYLIEIM+SD +QISNLTL+NSPSWNVHP+YSS
Sbjct  175  TGDNGTIDGQGDLWWQKFRKGELKYTRPYLIEIMYSDNVQISNLTLVNSPSWNVHPIYSS  234

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QG+TILAPV S NTDGINPDS
Sbjct  235  NLVVQGITILAPVTSPNTDGINPDS  259



>ref|XP_008438007.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=493

 Score =   337 bits (863),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -1

Query  630  ESSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGK  451
            E +G EY AI+ RAH+ASI +FGGVGDG T NTKAF+ A+  L +Y+  GGA+L VPAG+
Sbjct  50   EGNGIEYGAINCRAHTASITEFGGVGDGVTSNTKAFQAAVERLGQYANDGGAQLYVPAGR  109

Query  450  WLTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNL  271
            WLTGSFNLTSHFTLFLH+DAVLLASQD N WP+V PLPSYGHGRDTSGGR ISLIFG+NL
Sbjct  110  WLTGSFNLTSHFTLFLHQDAVLLASQDPNEWPVVEPLPSYGHGRDTSGGRYISLIFGTNL  169

Query  270  VDVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVH  91
             DVVITGNNGTIDGQG  WWQ F   KLKYTRPYLIE+M+S  IQIS+LTLLNSP+WNVH
Sbjct  170  TDVVITGNNGTIDGQGDRWWQLFHQGKLKYTRPYLIELMYSRDIQISSLTLLNSPAWNVH  229

Query  90   PVYSSNIIIQGLTILAPVKSANTDGINPDS  1
            PVYSSNI+IQG+TI+APV+S NTDGINPDS
Sbjct  230  PVYSSNILIQGITIIAPVRSPNTDGINPDS  259



>ref|XP_007209970.1| hypothetical protein PRUPE_ppa004996mg [Prunus persica]
 gb|EMJ11169.1| hypothetical protein PRUPE_ppa004996mg [Prunus persica]
Length=482

 Score =   336 bits (862),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S RAHSAS+ +FGGVGDG T NTKAF+ A+N+LS+Y + GGA+L VP GKWLTGS
Sbjct  44   EYCAMSCRAHSASLAEFGGVGDGSTSNTKAFQAAINHLSQYQSDGGAQLFVPPGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDAVLLASQ+ + WP++ PLPSYG GRDT GGR ISLIFG+NL DVV+
Sbjct  104  FNLTSHFTLYLHKDAVLLASQEESEWPVIEPLPSYGRGRDTDGGRFISLIFGTNLTDVVV  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+F+  +LKYTRPYLIEIM+S+ IQISNLTL+NSPSWNVHPVYSS
Sbjct  164  TGDNGTIDGQGELWWQKFKKGELKYTRPYLIEIMYSENIQISNLTLINSPSWNVHPVYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QG+TILAPV S NTDGINPDS
Sbjct  224  NVLVQGITILAPVTSPNTDGINPDS  248



>ref|XP_006584731.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=506

 Score =   337 bits (863),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S RA+SAS+++FGGVGDG TLNTKAF+ A+ NLS+Y+A GG++L VP GKWLTGS
Sbjct  69   EYCAMSCRAYSASLEEFGGVGDGTTLNTKAFQAAIENLSQYAASGGSQLYVPPGKWLTGS  128

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LASQD N WP++ PLPSYG GRDT GGR  SLIFG+NL DV+I
Sbjct  129  FNLTSHFTLFLHKDAVILASQDENDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVII  188

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+F   +LKYTRPYL+EIM+SD +QISNLTL+NSPSWNVHP+YSS
Sbjct  189  TGDNGTIDGQGDLWWQKFHKGELKYTRPYLVEIMYSDNVQISNLTLVNSPSWNVHPIYSS  248

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QG+TILAPV S NTDGINPDS
Sbjct  249  NVVVQGITILAPVTSPNTDGINPDS  273



>emb|CBI34379.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAI+ RAHSAS+ DFGGVGDG T NTKAF+ A+++LS++++ GG++L VP G+WLTGS
Sbjct  42   EYSAINCRAHSASLTDFGGVGDGTTSNTKAFQAAIDHLSQFASDGGSQLFVPPGRWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDAVLLASQD + WP++ PLPSYG GRDT GGR ISLIFG+NL DVVI
Sbjct  102  FNLTSHFTLYLHKDAVLLASQDEHEWPVIDPLPSYGRGRDTQGGRYISLIFGTNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGALWW +F   +LKYTRPYLIEIMHSD +QIS+LTL+NSPSWNVHPVYSS
Sbjct  162  TGENGTIDGQGALWWAKFHKGELKYTRPYLIEIMHSDNVQISSLTLVNSPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+IIQGLTI APV S NTDGINPDS
Sbjct  222  NVIIQGLTITAPVTSPNTDGINPDS  246



>ref|XP_006291035.1| hypothetical protein CARUB_v10017147mg [Capsella rubella]
 gb|EOA23933.1| hypothetical protein CARUB_v10017147mg [Capsella rubella]
Length=475

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ R+HS SI +FGGVGDGKTLNTKAF+ A+++LS+YS+ GGA+L VPAGKWLTGS
Sbjct  34   EYTAITCRSHSTSITEFGGVGDGKTLNTKAFQSAVDHLSQYSSDGGAQLFVPAGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDA+LLA+QD+N +P++  LPSYG GRD +GGR  SLIFG+NL DV+I
Sbjct  94   FNLTSHFTLFLHKDAILLAAQDLNEYPILKALPSYGRGRDAAGGRFASLIFGTNLSDVII  153

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WWQ+F   KLKYTRPYLIE+M SD IQISNLT L+SPSWN+HPVYSS
Sbjct  154  TGNNGTIDGQGSFWWQKFHGGKLKYTRPYLIELMFSDTIQISNLTFLDSPSWNIHPVYSS  213

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TI+APVKS NTDGINPDS
Sbjct  214  NIIVKGVTIIAPVKSPNTDGINPDS  238



>ref|XP_010413390.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010413391.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010413392.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=476

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ R+HS SI +FGGVGDGKTLNTKAF+ A+++LS+YS+ GGA+L VPAGKWLTGS
Sbjct  34   EYTAITCRSHSVSITEFGGVGDGKTLNTKAFQSAVDHLSQYSSDGGAQLFVPAGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDA LLA+QD+N +P++  LPSYG GRD +GGR  SLIFG+NL DV+I
Sbjct  94   FNLTSHFTLFLHKDATLLAAQDLNEYPILKALPSYGRGRDAAGGRFASLIFGTNLSDVII  153

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WWQ+F   KLKYTRPYLIEIM SD IQISNLT L+SPSWN+HPVYSS
Sbjct  154  TGNNGTIDGQGSFWWQKFHGGKLKYTRPYLIEIMFSDTIQISNLTFLDSPSWNIHPVYSS  213

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TI+APVKS NTDGINPDS
Sbjct  214  NIIVKGVTIIAPVKSPNTDGINPDS  238



>gb|KDO76318.1| hypothetical protein CISIN_1g011659mg [Citrus sinensis]
Length=480

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAHSAS+++FGGVGDG T NTKAF+ A+++LS++ + GG++L VP GKWLTGS
Sbjct  42   EYSAISCRAHSASLEEFGGVGDGTTSNTKAFKAAIDHLSRFQSEGGSQLFVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAVLLASQD   WP++ PLPSYG GRDT GGR  SLIFG+NL DVVI
Sbjct  102  FNLTSHFTLFLHKDAVLLASQDEKEWPVIEPLPSYGRGRDTEGGRYSSLIFGTNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWW++FR+ +LKYTRPYLIEIM+S  IQISNLTL+NSPSWNVHPVYSS
Sbjct  162  TGDNGTIDGQGELWWRKFRAGELKYTRPYLIEIMYSQNIQISNLTLINSPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            ++I+QG+TILAPV S NTDGINPDS
Sbjct  222  SVIVQGITILAPVTSPNTDGINPDS  246



>gb|KDP28587.1| hypothetical protein JCGZ_14358 [Jatropha curcas]
Length=479

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ RAHSASI DFGGVGDG   NTKAF++A+N+LS+YS+ GG++L VPAGKWLTGS
Sbjct  43   EYNAINCRAHSASITDFGGVGDGVKSNTKAFQDAINHLSQYSSDGGSQLFVPAGKWLTGS  102

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L SHFTLFLH+DAVLLASQD+  WPL+ PLPSYG GRD + GR  SLIFG+NL DVV+
Sbjct  103  FSLISHFTLFLHQDAVLLASQDLKEWPLLKPLPSYGRGRDAAAGRYASLIFGTNLTDVVV  162

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGA WWQQF   KLKYTRPYLIEIM S+ IQISNLTLLNSPSWNVHPVYSS
Sbjct  163  TGKNGTIDGQGAFWWQQFHKGKLKYTRPYLIEIMFSENIQISNLTLLNSPSWNVHPVYSS  222

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TILAPV S NTDGINPDS
Sbjct  223  NILVQGITILAPVSSPNTDGINPDS  247



>ref|NP_191708.1| polygalacturonase-like protein [Arabidopsis thaliana]
 ref|NP_974473.1| polygalacturonase-like protein [Arabidopsis thaliana]
 ref|NP_001190154.1| polygalacturonase-like protein [Arabidopsis thaliana]
 emb|CAB71079.1| putative protein [Arabidopsis thaliana]
 gb|AEE80211.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AEE80212.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AEE80213.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=476

 Score =   334 bits (857),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI  R+HSASI ++GGVGDGKTLNTKAF+ A+++LS+YS+ GGA+L VPAGKWLTGS
Sbjct  34   EYTAIICRSHSASITEYGGVGDGKTLNTKAFQSAVDHLSQYSSEGGAQLFVPAGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDA+LLA+QD+N +P++  LPSYG GRD +GGR  SLIFG+NL DV+I
Sbjct  94   FNLTSHFTLFLHKDAILLAAQDLNEYPILKALPSYGRGRDAAGGRFASLIFGTNLSDVII  153

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WWQ+F   KLKYTRPYLIE+M SD IQISNLT L+SPSWN+HPVYSS
Sbjct  154  TGNNGTIDGQGSFWWQKFHGGKLKYTRPYLIELMFSDTIQISNLTFLDSPSWNIHPVYSS  213

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TI+APVKS NTDGINPDS
Sbjct  214  NIIVKGVTIIAPVKSPNTDGINPDS  238



>ref|XP_006439488.1| hypothetical protein CICLE_v10019941mg [Citrus clementina]
 gb|ESR52728.1| hypothetical protein CICLE_v10019941mg [Citrus clementina]
Length=480

 Score =   334 bits (857),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAHSAS+++FGGVGDG T NTKAF+ A+++LS++ + GG++L VP GKWLTGS
Sbjct  42   EYSAISCRAHSASLEEFGGVGDGITSNTKAFKAAIDHLSRFQSEGGSQLFVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAVLLASQD   WP++ PLPSYG GRDT GGR  SLIFG+NL DVVI
Sbjct  102  FNLTSHFTLFLHKDAVLLASQDEKEWPVIEPLPSYGRGRDTEGGRYSSLIFGTNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWW++FR+ +LKYTRPYLIEIM+S  IQISNLTL+NSPSWNVHPVYSS
Sbjct  162  TGDNGTIDGQGELWWRKFRAGELKYTRPYLIEIMYSQNIQISNLTLINSPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            ++I+QG+TILAPV S NTDGINPDS
Sbjct  222  SVIVQGITILAPVTSPNTDGINPDS  246



>ref|XP_006476506.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=480

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAHSAS+++FGGVGDG T NTKAF+ A+++LS++ + GG++L VP GKWLTGS
Sbjct  42   EYSAISCRAHSASLEEFGGVGDGTTSNTKAFKAAIDHLSRFQSEGGSQLFVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAVLLASQD   WP++ PLPSYG GRDT GGR  SLIFG+NL DVVI
Sbjct  102  FNLTSHFTLFLHKDAVLLASQDEKEWPVIEPLPSYGRGRDTEGGRYSSLIFGTNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG  WW++FR+ +LKYTRPYLIEIMHS  IQISNLTL+NSPSWNVHPVYSS
Sbjct  162  TGDNGTIDGQGEPWWRKFRAGELKYTRPYLIEIMHSQNIQISNLTLINSPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            ++I+QG+TILAPV S NTDGINPDS
Sbjct  222  SVIVQGITILAPVTSPNTDGINPDS  246



>ref|XP_007139799.1| hypothetical protein PHAVU_008G059700g [Phaseolus vulgaris]
 gb|ESW11793.1| hypothetical protein PHAVU_008G059700g [Phaseolus vulgaris]
Length=486

 Score =   334 bits (856),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ RAHSAS+ DFGGVGDGKT NTKAF+ A++ LS+Y++ GG++L VPAGKWLTGS
Sbjct  42   EYNAINCRAHSASLTDFGGVGDGKTSNTKAFQSAISQLSQYASEGGSQLYVPAGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+L KDAVLLASQDI  WP++ PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  102  FSLTSHFTLYLDKDAVLLASQDITEWPVLEPLPSYGRGRDAAAGRFASLIFGTNLTDVIV  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WWQQF  KKLKYTRPYLIE+M SD IQISNLTLLNSPSWNVHPVYSS
Sbjct  162  TGENGTIDGQGEFWWQQFHRKKLKYTRPYLIELMFSDNIQISNLTLLNSPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+QG+TI AP+ S NTDGINPDS
Sbjct  222  NIIVQGITIFAPITSPNTDGINPDS  246



>ref|XP_002876618.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52877.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score =   333 bits (855),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ R+HSASI ++GGVGDGKTLNTKAF+ A+++LS+YS+ GGA+L VPAGKWLTGS
Sbjct  34   EYTAITCRSHSASITEYGGVGDGKTLNTKAFQSAVDHLSQYSSDGGAQLFVPAGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDA+LLA+QD+N +P++  LPSYG GRD +GGR  SL FG+NL DV+I
Sbjct  94   FNLTSHFTLFLHKDAILLAAQDLNEYPILKALPSYGRGRDAAGGRFASLFFGTNLSDVII  153

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WWQ+F   KLKYTRPYLIE+M SD IQISNLT L+SPSWN+HPVYSS
Sbjct  154  TGNNGTIDGQGSFWWQKFHGGKLKYTRPYLIELMFSDTIQISNLTFLDSPSWNIHPVYSS  213

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TI+APVKS NTDGINPDS
Sbjct  214  NIIVKGVTIIAPVKSPNTDGINPDS  238



>ref|XP_002278930.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=480

 Score =   333 bits (854),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAI+ RAHSAS+ DFGGVGDG T NTKAF+ A+++LS++++ GG++L VP G+WLTGS
Sbjct  42   EYSAINCRAHSASLTDFGGVGDGTTSNTKAFQAAIDHLSQFASDGGSQLFVPPGRWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDAVLLASQD + WP++ PLPSYG GRDT GGR ISLIFG+NL DVVI
Sbjct  102  FNLTSHFTLYLHKDAVLLASQDEHEWPVIDPLPSYGRGRDTQGGRYISLIFGTNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGALWW +F   +LKYTRPYLIEIMHSD +QIS+LTL+NSPSWNVHPVYSS
Sbjct  162  TGENGTIDGQGALWWAKFHKGELKYTRPYLIEIMHSDNVQISSLTLVNSPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+IIQGLTI APV S NTDGINPDS
Sbjct  222  NVIIQGLTITAPVTSPNTDGINPDS  246



>ref|XP_007051731.1| Polygalacturonase, putative isoform 1 [Theobroma cacao]
 gb|EOX95888.1| Polygalacturonase, putative isoform 1 [Theobroma cacao]
Length=484

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS R H+ASI DFGGVGDGKT NTKAF++A+N+LS+Y++ GGA+L VPAG+WLTGS
Sbjct  46   EYTAISCRGHTASITDFGGVGDGKTSNTKAFQDAVNHLSQYASDGGAQLYVPAGQWLTGS  105

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+LHKDAVLLASQD++ WP++ PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  106  FSLTSHFTLYLHKDAVLLASQDMSEWPVLKPLPSYGRGRDAAAGRFTSLIFGTNLTDVIV  165

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGA WWQ F   KLKYTRPYLIE M+SD IQISNLTLLN+PSWNVHPVYSS
Sbjct  166  TGANGTIDGQGAFWWQNFHKGKLKYTRPYLIEFMYSDTIQISNLTLLNAPSWNVHPVYSS  225

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TI+AP+ S NTDGINPDS
Sbjct  226  NILVQGITIIAPITSPNTDGINPDS  250



>ref|XP_007051732.1| Polygalacturonase, putative isoform 2 [Theobroma cacao]
 gb|EOX95889.1| Polygalacturonase, putative isoform 2 [Theobroma cacao]
Length=481

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS R H+ASI DFGGVGDGKT NTKAF++A+N+LS+Y++ GGA+L VPAG+WLTGS
Sbjct  43   EYTAISCRGHTASITDFGGVGDGKTSNTKAFQDAVNHLSQYASDGGAQLYVPAGQWLTGS  102

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+LHKDAVLLASQD++ WP++ PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  103  FSLTSHFTLYLHKDAVLLASQDMSEWPVLKPLPSYGRGRDAAAGRFTSLIFGTNLTDVIV  162

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGA WWQ F   KLKYTRPYLIE M+SD IQISNLTLLN+PSWNVHPVYSS
Sbjct  163  TGANGTIDGQGAFWWQNFHKGKLKYTRPYLIEFMYSDTIQISNLTLLNAPSWNVHPVYSS  222

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TI+AP+ S NTDGINPDS
Sbjct  223  NILVQGITIIAPITSPNTDGINPDS  247



>ref|XP_008238946.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=482

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S RAHSAS+ +FGGVGDG T NTKAF+ A+N+LS+Y + GGA+L VP GKWLTGS
Sbjct  44   EYCAMSCRAHSASLAEFGGVGDGSTSNTKAFQAAINHLSQYQSDGGAQLFVPPGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDAVLLASQ+ + WP++ PLPSYG GRDT GGR ISLIFG+NL DVVI
Sbjct  104  FNLTSHFTLYLHKDAVLLASQEESEWPVIQPLPSYGRGRDTDGGRFISLIFGTNLTDVVI  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+F+  +LKYTRPYLIEIM+S+ IQISNLTL+NSPSWNVHPVYSS
Sbjct  164  TGHNGTIDGQGELWWQKFKKGELKYTRPYLIEIMYSENIQISNLTLINSPSWNVHPVYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            ++++QG+TILAPV S NTDGINPDS
Sbjct  224  HVLVQGITILAPVTSPNTDGINPDS  248



>ref|XP_011023291.1| PREDICTED: probable polygalacturonase isoform X1 [Populus euphratica]
Length=473

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAI+ RAHSAS+ DFGGVGDGKT NTKAF++A+++LS++S+ GG++L VPAG WLTGS
Sbjct  35   EYSAINCRAHSASLTDFGGVGDGKTSNTKAFKDAIDHLSQFSSDGGSQLFVPAGNWLTGS  94

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+LHKDAVLLASQD+  WP++ PLPSYG GRD + GR  SLIFG+NL DV+I
Sbjct  95   FSLTSHFTLYLHKDAVLLASQDMQEWPVMKPLPSYGRGRDAAAGRYSSLIFGTNLTDVII  154

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WWQ F   KLKYTRPYLIEIM SD IQISNLTLLNSPSWNVHPVYS 
Sbjct  155  TGNNGTIDGQGAFWWQNFHKGKLKYTRPYLIEIMFSDTIQISNLTLLNSPSWNVHPVYSR  214

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            +I++QG+TI+AP+ S NTDGINPDS
Sbjct  215  DILVQGITIIAPITSPNTDGINPDS  239



>ref|XP_011023292.1| PREDICTED: probable polygalacturonase isoform X2 [Populus euphratica]
Length=470

 Score =   332 bits (850),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAI+ RAHSAS+ DFGGVGDGKT NTKAF++A+++LS++S+ GG++L VPAG WLTGS
Sbjct  32   EYSAINCRAHSASLTDFGGVGDGKTSNTKAFKDAIDHLSQFSSDGGSQLFVPAGNWLTGS  91

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+LHKDAVLLASQD+  WP++ PLPSYG GRD + GR  SLIFG+NL DV+I
Sbjct  92   FSLTSHFTLYLHKDAVLLASQDMQEWPVMKPLPSYGRGRDAAAGRYSSLIFGTNLTDVII  151

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WWQ F   KLKYTRPYLIEIM SD IQISNLTLLNSPSWNVHPVYS 
Sbjct  152  TGNNGTIDGQGAFWWQNFHKGKLKYTRPYLIEIMFSDTIQISNLTLLNSPSWNVHPVYSR  211

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            +I++QG+TI+AP+ S NTDGINPDS
Sbjct  212  DILVQGITIIAPITSPNTDGINPDS  236



>ref|XP_002301370.1| polygalacturonase-like family protein [Populus trichocarpa]
 gb|EEE80643.1| polygalacturonase-like family protein [Populus trichocarpa]
Length=470

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAI+ RAHSAS+ DFGGVGDG T NTKAF++A+++LS++S+ GG++L VPAGKWLTGS
Sbjct  32   EYSAINCRAHSASLTDFGGVGDGTTSNTKAFKDAIDHLSQFSSDGGSQLFVPAGKWLTGS  91

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+LHKDAVLLASQD+  WP++ PLPSYG GRD + GR  SLIFG+NL DV+I
Sbjct  92   FSLTSHFTLYLHKDAVLLASQDMQEWPVMKPLPSYGRGRDAAAGRYSSLIFGTNLTDVII  151

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WWQ F   KLKYTRPYLIEIM SD IQISNLTLLNSPSWNVHPVYS 
Sbjct  152  TGNNGTIDGQGAFWWQNFHKGKLKYTRPYLIEIMFSDTIQISNLTLLNSPSWNVHPVYSR  211

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            +I++QG+TI+AP+ S NTDGINPDS
Sbjct  212  DILVQGITIIAPISSPNTDGINPDS  236



>ref|XP_009793070.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=482

 Score =   332 bits (851),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAH+AS+ DFGGVGDG TLNT AF+ A+++LS++ + GG+ L VPAGKWLTGS
Sbjct  44   EYSAISCRAHTASLTDFGGVGDGTTLNTNAFKSAVDHLSQFQSDGGSMLYVPAGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+L KDAVLLASQD N +P++ PLPSYG GRDT GGR ISLIFG+NL DVVI
Sbjct  104  FNLTSHFTLYLDKDAVLLASQDENDYPVIAPLPSYGRGRDTDGGRFISLIFGTNLTDVVI  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWW +F  K+L+YTRPYLIEIM+SD IQIS+LTL+NSPSWNVHPVY S
Sbjct  164  TGENGTIDGQGQLWWDKFHKKELQYTRPYLIEIMYSDNIQISSLTLVNSPSWNVHPVYCS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIIIQG+TILAPV+S NTDGINPDS
Sbjct  224  NIIIQGITILAPVRSPNTDGINPDS  248



>ref|XP_007160099.1| hypothetical protein PHAVU_002G292300g [Phaseolus vulgaris]
 gb|ESW32093.1| hypothetical protein PHAVU_002G292300g [Phaseolus vulgaris]
Length=469

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S RA+SAS+++FGGVGDG TLNTKAF+ A+++LS+Y++ GG++L VP G+WLTGS
Sbjct  32   EYCAMSCRAYSASLEEFGGVGDGTTLNTKAFQAAIDHLSQYASSGGSQLYVPPGRWLTGS  91

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LASQD N WP++ PLPSYG GRDT GGR  SLIFG+NL DV+I
Sbjct  92   FNLTSHFTLFLHKDAVILASQDENDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVII  151

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGT+DGQG LWWQ+F   +LKYTRPYLIEIM+SD +QISNLTL+NSPSWNVHPVYSS
Sbjct  152  TGANGTLDGQGDLWWQKFHKGELKYTRPYLIEIMYSDNVQISNLTLVNSPSWNVHPVYSS  211

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QG+TILAPV S NTDGINPDS
Sbjct  212  NVVVQGVTILAPVTSPNTDGINPDS  236



>ref|XP_008343414.1| PREDICTED: probable polygalacturonase [Malus domestica]
 ref|XP_008354013.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=483

 Score =   332 bits (851),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+A++ RAHSAS+ DFGGVGDGKT NTKAF  A++ LS+Y   GGA+L VPAGKWLTGS
Sbjct  45   EYTAMNCRAHSASLTDFGGVGDGKTSNTKAFHAAVSQLSQYETQGGAQLFVPAGKWLTGS  104

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDAVLLASQDIN WP++  LPSYG GRD + GR  SLI+G+NL DVV+
Sbjct  105  FNLTSHFTLYLHKDAVLLASQDINEWPVLKALPSYGRGRDAAAGRYTSLIWGTNLTDVVV  164

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG  WWQQF  KKLKYTRPYLIEIM S  +QISNLTLLNSPSWNVHPVYSS
Sbjct  165  TGDNGTIDGQGEFWWQQFHKKKLKYTRPYLIEIMFSTDVQISNLTLLNSPSWNVHPVYSS  224

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+++G+TI+AP+ S NTDGINPDS
Sbjct  225  NILVKGITIIAPISSPNTDGINPDS  249



>gb|KHF98838.1| putative polygalacturonase [Gossypium arboreum]
Length=267

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            Y+ IS R H+ASI DFGGVGDGKT NTKAF++A+N+LSKY++ GGA+L VPAGKWLTGSF
Sbjct  45   YTGISCRRHTASITDFGGVGDGKTSNTKAFQDAVNHLSKYASDGGAQLYVPAGKWLTGSF  104

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            +LTSHFTL+L K A LLASQD+  WP++ PLPSYG GRD +GGR  SLI+G+NL DV++T
Sbjct  105  SLTSHFTLYLQKHAFLLASQDMKEWPVLKPLPSYGRGRDAAGGRFTSLIYGTNLTDVIVT  164

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G NGTIDGQG+ WWQ+F   KLKYTRPYLIE M+SD IQISNLTLLNSPSWNVHPVYSSN
Sbjct  165  GANGTIDGQGSFWWQKFHKGKLKYTRPYLIEFMYSDTIQISNLTLLNSPSWNVHPVYSSN  224

Query  72   IIIQGLTILAPVKSANTDGINP  7
            I+IQG+TILAPVKS NTDGINP
Sbjct  225  ILIQGITILAPVKSPNTDGINP  246



>ref|XP_010089056.1| putative polygalacturonase [Morus notabilis]
 gb|EXB37303.1| putative polygalacturonase [Morus notabilis]
Length=466

 Score =   331 bits (849),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAI+ R HSAS+ DFGGVGDG T NT+AF+ A+++LS++S+ GG+ L VP GKWLTGS
Sbjct  28   EYSAINCRGHSASLTDFGGVGDGITSNTEAFQAAISHLSQFSSDGGSLLFVPPGKWLTGS  87

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FN+TSHFTLFLHKDAVLL SQD N WP++ PLPSYG GRDT GGR  SLIFG+NL DV+I
Sbjct  88   FNVTSHFTLFLHKDAVLLGSQDENEWPVIEPLPSYGRGRDTEGGRFSSLIFGTNLTDVII  147

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+FRSK+L YTRPYLIE+MHS+ IQISNLTL+NSPSWN+HPVY S
Sbjct  148  TGDNGTIDGQGELWWQKFRSKQLLYTRPYLIELMHSENIQISNLTLVNSPSWNIHPVYCS  207

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+I+QG+TILAPV S NTDGINPDS
Sbjct  208  NVIVQGITILAPVTSPNTDGINPDS  232



>ref|XP_004306749.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA++ RAHSAS+ +FGGVGDGKT NTKAF+ A++ LS+Y+  GGA+L VPAGKWLTGS
Sbjct  37   EYSAMNCRAHSASLTEFGGVGDGKTSNTKAFQTAISKLSQYATDGGAQLFVPAGKWLTGS  96

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+LHKDAVLLASQD+N WP++  LPSYG GRD + GR  SLIFG+NL DV++
Sbjct  97   FSLTSHFTLYLHKDAVLLASQDLNEWPVLKALPSYGRGRDAAAGRYSSLIFGTNLTDVIV  156

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WWQQF  KKLKYTRPYLIEIM S  IQISNLTLLNSPSWNVHPVYSS
Sbjct  157  TGENGTIDGQGEFWWQQFHKKKLKYTRPYLIEIMFSSDIQISNLTLLNSPSWNVHPVYSS  216

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TI+AP+ S NTDGINPDS
Sbjct  217  NILVQGITIIAPISSPNTDGINPDS  241



>ref|XP_004245570.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=483

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS RAH+AS+ DFGGVGDGKTLNT AFR A+++LS++ + GG+ L VPAGKWLTGS
Sbjct  44   EYPAISCRAHTASLTDFGGVGDGKTLNTDAFRTAVDHLSQFQSDGGSMLYVPAGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+L KDAVLLASQD N +P++ PLPSYG GRDT GGR ISLIFGSNL DVVI
Sbjct  104  FNLTSHFTLYLDKDAVLLASQDENDYPVIAPLPSYGRGRDTEGGRFISLIFGSNLTDVVI  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWW +F + +LK+TRPYLIEIM+SD IQIS+LTL+NSPSWNVHPVY S
Sbjct  164  TGENGTIDGQGQLWWDKFHNGELKFTRPYLIEIMYSDNIQISSLTLVNSPSWNVHPVYCS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+IIQG+TILAPV+S NTDGINPDS
Sbjct  224  NVIIQGITILAPVRSPNTDGINPDS  248



>ref|XP_003552411.1| PREDICTED: probable polygalacturonase [Glycine max]
 gb|KHM99339.1| Putative polygalacturonase [Glycine soja]
Length=484

 Score =   332 bits (850),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ RAHSA++ DFGGVGDGKT NTKAF+ A+++LS+Y++ GG++L VPAGKWLTGS
Sbjct  44   EYNAINCRAHSAALTDFGGVGDGKTSNTKAFQSAISHLSQYASEGGSQLYVPAGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+L KDAVLLASQDI  WP++ PLPSYG GRD   GR  SLIFG+NL DV++
Sbjct  104  FSLTSHFTLYLDKDAVLLASQDITEWPVLEPLPSYGRGRDAPAGRFTSLIFGTNLTDVIV  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WWQQF  KKLKYTRPYLIE+M SD IQISNLTLLNSPSWNVHPVYSS
Sbjct  164  TGENGTIDGQGEFWWQQFHRKKLKYTRPYLIELMFSDNIQISNLTLLNSPSWNVHPVYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+QG+TI APV S NTDGINPDS
Sbjct  224  NIIVQGITIYAPVTSPNTDGINPDS  248



>gb|KHN16795.1| Putative polygalacturonase [Glycine soja]
Length=434

 Score =   330 bits (845),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -1

Query  603  ISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLT  424
            +S RA+SAS+++FGGVGDG TLNTKAF+ A+ NLS+Y+A GG++L VP GKWLTGSFNLT
Sbjct  1    MSCRAYSASLEEFGGVGDGTTLNTKAFQAAIENLSQYAASGGSQLYVPPGKWLTGSFNLT  60

Query  423  SHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNN  244
            SHFTLFLHKDAV+LASQD N WP++ PLPSYG GRDT GGR  SLIFG+NL DV+ITG+N
Sbjct  61   SHFTLFLHKDAVILASQDENDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVIITGDN  120

Query  243  GTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIII  64
            GTIDGQG LWWQ+F   +LKYTRPYL+EIM+SD +QISNLTL+NSPSWNVHP+YSSN+++
Sbjct  121  GTIDGQGDLWWQKFHKGELKYTRPYLVEIMYSDNVQISNLTLVNSPSWNVHPIYSSNVVV  180

Query  63   QGLTILAPVKSANTDGINPDS  1
            QG+TILAPV S NTDGINPDS
Sbjct  181  QGITILAPVTSPNTDGINPDS  201



>gb|KDP25392.1| hypothetical protein JCGZ_20548 [Jatropha curcas]
Length=480

 Score =   331 bits (849),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS RAH AS++DFGGVGDG+T NT AF+ A+ +LS++S+ GG++L VP GKWLTGS
Sbjct  42   EYAAISCRAHEASLEDFGGVGDGQTSNTNAFKSAIEHLSQFSSDGGSQLYVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAVLLASQD + WP++ PLPSYG GRD  GGR ISLIFG+NL DV+I
Sbjct  102  FNLTSHFTLFLDKDAVLLASQDESEWPVIEPLPSYGRGRDADGGRYISLIFGTNLTDVII  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG +WWQ+FR+K+L YTRPYLIE+M+S  IQISNLTL+NSPSWNVHPVYSS
Sbjct  162  TGANGTIDGQGDIWWQKFRNKELNYTRPYLIELMYSSNIQISNLTLMNSPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TILAPV+S NTDGINPDS
Sbjct  222  NIVVQGITILAPVRSPNTDGINPDS  246



>gb|AAP33475.1| polygalacturonase-like protein [Fragaria x ananassa]
Length=474

 Score =   331 bits (849),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA++ RAHSAS+ +FGGVGDGKT NTKAF+ A++ LS+Y+  GGA+L VPAGKWLTGS
Sbjct  37   EYSAMNCRAHSASLTEFGGVGDGKTSNTKAFQTAISKLSQYATDGGAQLFVPAGKWLTGS  96

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+LHKD+VLLASQD+N WP++  LPSYG GRD + GR  SLIFG+NL DV++
Sbjct  97   FSLTSHFTLYLHKDSVLLASQDLNEWPVLKALPSYGRGRDAAAGRYSSLIFGTNLTDVIV  156

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WWQQF  KKLKYTRPYLIEIM S  IQISNLTLLNSPSWNVHPVYSS
Sbjct  157  TGENGTIDGQGEFWWQQFHKKKLKYTRPYLIEIMFSSDIQISNLTLLNSPSWNVHPVYSS  216

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+QG+TI+AP+ S NTDGINPDS
Sbjct  217  NIIVQGITIIAPISSPNTDGINPDS  241



>ref|XP_003533597.1| PREDICTED: probable polygalacturonase-like [Glycine max]
 gb|KHN29325.1| Putative polygalacturonase [Glycine soja]
Length=484

 Score =   331 bits (849),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ RAHSAS+ DFGGVGDGK  NTKAF+ A+++LS+Y++ GG++L VPAGKWLTGS
Sbjct  44   EYNAINCRAHSASLTDFGGVGDGKASNTKAFQSAISHLSQYASEGGSQLYVPAGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+L KDAVLLASQDI  WP++ PLPSYG GRD   GR  SLIFG+NL DV++
Sbjct  104  FSLTSHFTLYLDKDAVLLASQDITEWPVLEPLPSYGRGRDAPAGRFTSLIFGTNLTDVIV  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WWQQF  KKLKYTRPYLIE+M SD IQISNLTLLNSPSWNVHPVYSS
Sbjct  164  TGENGTIDGQGEFWWQQFHRKKLKYTRPYLIELMFSDNIQISNLTLLNSPSWNVHPVYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+QG+TI APV S NTDGINPDS
Sbjct  224  NIIVQGITIFAPVTSPNTDGINPDS  248



>ref|XP_003548644.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=491

 Score =   331 bits (849),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ RAHSAS+ DFGGVGDG T NTKAF+ A+++LS+Y++ GGA+L VPAGKWLTGS
Sbjct  56   EYKAINCRAHSASLIDFGGVGDGNTSNTKAFQSAISHLSQYASKGGAQLYVPAGKWLTGS  115

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L SHFTL+L+KDA LLASQDI  WP++ PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  116  FSLISHFTLYLNKDAFLLASQDIREWPVIEPLPSYGRGRDAAAGRYTSLIFGTNLTDVIV  175

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGA WWQ+F+ KKLKYTRPYLIE+M SD+IQISNLTLLNSPSWNVHPVYSS
Sbjct  176  TGDNGTIDGQGAFWWQKFQKKKLKYTRPYLIELMFSDKIQISNLTLLNSPSWNVHPVYSS  235

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII+GLTI+APV S NTDGINPDS
Sbjct  236  NIIIKGLTIIAPVPSPNTDGINPDS  260



>gb|KEH21119.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=470

 Score =   330 bits (847),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S RA+SAS+ +FG  GDG TLNTKAF+ A+++LS+YS++GG++L VP G+WLTGS
Sbjct  33   EYCAVSCRAYSASVTEFGAAGDGNTLNTKAFQSAIDHLSQYSSNGGSQLYVPPGRWLTGS  92

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+L SQD + WP++ PLPSYG GRDT GGR  SLIFG+NL DVVI
Sbjct  93   FNLTSHFTLFLHKDAVILGSQDESEWPVIDPLPSYGRGRDTQGGRYSSLIFGTNLTDVVI  152

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGT+DGQG LWWQ+F   KL YTRPYLIEIM+SD IQISNLTL+NSPSWNVHPVYSS
Sbjct  153  TGNNGTLDGQGELWWQKFHKGKLTYTRPYLIEIMYSDNIQISNLTLVNSPSWNVHPVYSS  212

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+QG+TILAPV S NTDGINPDS
Sbjct  213  NIIVQGITILAPVNSPNTDGINPDS  237



>emb|CDY65355.1| BnaC08g49000D [Brassica napus]
Length=472

 Score =   330 bits (847),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ R+HSASI DFGGVGDGKTLNTKAF+ A+++LS+YS+ GGA+L VPAGKWLTGS
Sbjct  34   EYTAITCRSHSASITDFGGVGDGKTLNTKAFQSAVDHLSQYSSDGGAQLFVPAGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTLFLHKDA LLA+QD+  +P++  LPSYG GRD +GGR  SL+FG+NL DV+I
Sbjct  94   FSLTSHFTLFLHKDATLLAAQDLEEYPVLKALPSYGRGRDAAGGRFASLVFGTNLSDVII  153

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WWQ+F   KLKYTRPYLIE+M SD IQISN+TL++SPSWN+HPVYSS
Sbjct  154  TGNNGTIDGQGSFWWQKFHGGKLKYTRPYLIELMFSDTIQISNITLIDSPSWNIHPVYSS  213

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+++G+TI+APVKS NTDGINPDS
Sbjct  214  NILVKGVTIIAPVKSPNTDGINPDS  238



>ref|XP_006598941.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=489

 Score =   331 bits (849),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ RAHSAS+ DFGGVGDG T NTKAF+ A+++LS+Y++ GGA+L VPAGKWLTGS
Sbjct  54   EYKAINCRAHSASLIDFGGVGDGNTSNTKAFQSAISHLSQYASKGGAQLYVPAGKWLTGS  113

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L SHFTL+L+KDA LLASQDI  WP++ PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  114  FSLISHFTLYLNKDAFLLASQDIREWPVIEPLPSYGRGRDAAAGRYTSLIFGTNLTDVIV  173

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGA WWQ+F+ KKLKYTRPYLIE+M SD+IQISNLTLLNSPSWNVHPVYSS
Sbjct  174  TGDNGTIDGQGAFWWQKFQKKKLKYTRPYLIELMFSDKIQISNLTLLNSPSWNVHPVYSS  233

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII+GLTI+APV S NTDGINPDS
Sbjct  234  NIIIKGLTIIAPVPSPNTDGINPDS  258



>ref|XP_009349812.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=483

 Score =   331 bits (848),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+A++ RAHSAS+ DFGGVGDGKT NTKAF  A++ LS+Y   GGA+L VPAGKWLTGS
Sbjct  45   EYTAMNCRAHSASLIDFGGVGDGKTSNTKAFHAAVSQLSQYETQGGAQLFVPAGKWLTGS  104

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDAVLLASQDIN WP++  LPSYG GRD + GR  SLI+G+NL DVV+
Sbjct  105  FNLTSHFTLYLHKDAVLLASQDINEWPVLKALPSYGRGRDAAAGRYTSLIWGTNLTDVVV  164

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG  WWQQF  KKLKYTRPYLIE+M S  +QISNLTLLNSPSWNVHPVYSS
Sbjct  165  TGDNGTIDGQGEFWWQQFHKKKLKYTRPYLIEVMFSTDVQISNLTLLNSPSWNVHPVYSS  224

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+++G+TI+AP+ S NTDGINPDS
Sbjct  225  NILVKGITIIAPISSPNTDGINPDS  249



>gb|KHM99951.1| Putative polygalacturonase [Glycine soja]
Length=434

 Score =   329 bits (844),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  603  ISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLT  424
            +S RA+SAS+++FGGVGDG TLNTKAF+ A+++LS+Y++ GG++L VP GKWLTGSFNLT
Sbjct  1    MSCRAYSASLEEFGGVGDGTTLNTKAFQAAIDHLSQYASSGGSQLYVPPGKWLTGSFNLT  60

Query  423  SHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNN  244
            SHFTLFLHKDAV+LASQD N WP++ PLPSYG GRDT GGR  SLIFG+NL DV+ITG+N
Sbjct  61   SHFTLFLHKDAVILASQDENDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVIITGDN  120

Query  243  GTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIII  64
            GTIDGQG LWWQ+FR  +LKYTRPYLIEIM+SD +QISNLTL+NSPSWNVHP+YSSN+++
Sbjct  121  GTIDGQGDLWWQKFRKGELKYTRPYLIEIMYSDNVQISNLTLVNSPSWNVHPIYSSNLVV  180

Query  63   QGLTILAPVKSANTDGINPDS  1
            QG+TILAPV S NTDGINPDS
Sbjct  181  QGITILAPVTSPNTDGINPDS  201



>gb|KHN26934.1| Putative polygalacturonase [Glycine soja]
Length=482

 Score =   331 bits (848),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSAS+ DFGGVGDGKT NTKAF+ A+++LS+Y++ GGA+L VPAGKWLTGS
Sbjct  44   KYEAINCRTHSASLTDFGGVGDGKTSNTKAFQSAISHLSQYASKGGAQLYVPAGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L SHFTL+L+KDAVLLASQDI+ WP + PLPSYG GRD   GR  SLIFG+NL DV++
Sbjct  104  FSLISHFTLYLNKDAVLLASQDISEWPAIEPLPSYGRGRDAPAGRYTSLIFGTNLTDVIV  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGA WWQ+F  KKLKYTRPYLIE+M SDQIQISNLTLLNSPSWNVHPVYSS
Sbjct  164  TGGNGTIDGQGAFWWQKFHKKKLKYTRPYLIELMFSDQIQISNLTLLNSPSWNVHPVYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII+GLTI+APV S NTDGINPDS
Sbjct  224  NIIIKGLTIIAPVPSPNTDGINPDS  248



>ref|XP_006343936.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=483

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAH+AS+ DFGG+GDG TLNT AFR A+++LS++ + GG+ L VPAGKWLTGS
Sbjct  44   EYSAISCRAHTASLTDFGGIGDGTTLNTDAFRTAVDHLSQFQSDGGSMLYVPAGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+L KDAVLLASQD N +P++ PLPSYG GRDT GGR ISL+FGSNL DVVI
Sbjct  104  FNLTSHFTLYLDKDAVLLASQDENDYPVIAPLPSYGRGRDTDGGRFISLVFGSNLTDVVI  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWW +F + +LK+TRPYLIEIM+SD IQIS+LTL+NSPSWNVHPVY S
Sbjct  164  TGENGTIDGQGQLWWDKFHNGELKFTRPYLIEIMYSDNIQISSLTLINSPSWNVHPVYCS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIIIQG+TILAPV+S NTDGINPDS
Sbjct  224  NIIIQGITILAPVRSPNTDGINPDS  248



>ref|XP_004503680.1| PREDICTED: probable polygalacturonase-like isoform X3 [Cicer 
arietinum]
Length=470

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A++ RA+SAS+ DFGGVGDG+TLNTKAF+ A+++LS+YS++GG++L VP G+WLTGS
Sbjct  32   EYCAVNCRAYSASLTDFGGVGDGETLNTKAFQTAIDHLSQYSSNGGSQLYVPPGRWLTGS  91

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FN+TSHFTLF+HKDAV+L SQD N WP++ PLPSYG GRDT GGR  SLIFG+NL DV+I
Sbjct  92   FNVTSHFTLFIHKDAVILGSQDENDWPVIDPLPSYGRGRDTQGGRFRSLIFGTNLTDVII  151

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGT+DGQG LWWQ+F   +L YTRPYLIEIM+SD IQISNLTL+NSPSWNVHPVYSS
Sbjct  152  TGDNGTLDGQGELWWQKFHHGQLSYTRPYLIEIMYSDNIQISNLTLVNSPSWNVHPVYSS  211

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+I+QG+TILAPV S NTDGINPDS
Sbjct  212  NVIVQGITILAPVNSPNTDGINPDS  236



>emb|CDY48913.1| BnaA09g39240D [Brassica napus]
Length=471

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ R+HSASI DFGGVGDGKTLNTKAF+ A+++LS+YS+ GGA+L VPAGKWLTGS
Sbjct  34   EYTAITCRSHSASITDFGGVGDGKTLNTKAFQSAVDHLSQYSSDGGAQLFVPAGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTLFLHKDA LLA+QD+  +P++  LPSYG GRD +GGR  SL+FG+NL DV+I
Sbjct  94   FSLTSHFTLFLHKDATLLAAQDLEEYPVLKALPSYGRGRDAAGGRFASLVFGTNLSDVII  153

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDG+G+ WWQ+F   KLKYTRPYLIE+M SD IQISN+TL++SPSWN+HPVYSS
Sbjct  154  TGNNGTIDGRGSFWWQKFHGGKLKYTRPYLIELMFSDTIQISNITLIDSPSWNIHPVYSS  213

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TI+APVKS NTDGINPDS
Sbjct  214  NIIVKGVTIIAPVKSPNTDGINPDS  238



>ref|XP_010523770.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=472

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+A++ R HSASI +FGGVGDG+TLNTKAF+ A+ +LS+YS +GGA+L VPAGKWLTGS
Sbjct  36   EYTAMACREHSASITEFGGVGDGQTLNTKAFQSAVEHLSQYSDNGGAQLYVPAGKWLTGS  95

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTLFLH+DAVLLA+QDIN +P++  LPSYG GRD +GGR  SLIFG+NL DVV+
Sbjct  96   FSLTSHFTLFLHRDAVLLAAQDINEFPVLKALPSYGRGRDAAGGRFASLIFGTNLTDVVV  155

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WWQ F   KLKYTRPYLIE M SD IQISNLTLL+SPSWN+HPVYSS
Sbjct  156  TGNNGTIDGQGSFWWQSFHKGKLKYTRPYLIEFMFSDSIQISNLTLLDSPSWNIHPVYSS  215

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TI+APV S NTDGINPDS
Sbjct  216  NIIVKGITIIAPVTSPNTDGINPDS  240



>ref|XP_007144550.1| hypothetical protein PHAVU_007G165300g [Phaseolus vulgaris]
 gb|ESW16544.1| hypothetical protein PHAVU_007G165300g [Phaseolus vulgaris]
Length=474

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKW  448
            S+  EY AI+ RA+SAS+ DFGGVGDGKT NTKAF+ A+++LS+Y++ GGA+L VPAGKW
Sbjct  32   STSFEYKAINCRAYSASLTDFGGVGDGKTSNTKAFKSAISHLSEYASKGGAQLYVPAGKW  91

Query  447  LTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLV  268
            LTGSF+L+SHFTL+L+KDAVLLASQDI+ WP++ PLPSYG GRD + GR  SLIFG+NL 
Sbjct  92   LTGSFSLSSHFTLYLNKDAVLLASQDISEWPVIEPLPSYGRGRDAAAGRYTSLIFGTNLT  151

Query  267  DVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHP  88
            DV++TG+NGTIDGQGA WWQ+F  K+LKYTRPYLIE+M SD+IQISNLTLLNSPSWNVHP
Sbjct  152  DVIVTGDNGTIDGQGAFWWQKFHKKQLKYTRPYLIELMFSDKIQISNLTLLNSPSWNVHP  211

Query  87   VYSSNIIIQGLTILAPVKSANTDGINPDS  1
            VYSSNIII+GLTI+A + S NTDGINPDS
Sbjct  212  VYSSNIIIKGLTIIATLPSPNTDGINPDS  240



>ref|XP_010053221.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW77483.1| hypothetical protein EUGRSUZ_D01821 [Eucalyptus grandis]
Length=482

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
             YSAIS RA+SAS+ +FGGVGDG TLNT AF+ A+N LS+Y A GG++L VP G+WLTGS
Sbjct  44   RYSAISCRAYSASVTEFGGVGDGITLNTMAFQAAVNYLSQYEAQGGSQLFVPPGRWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LH+DAVLLASQD + WPL+ PLPSYG GRD  GGR  SL+FG+NL D+VI
Sbjct  104  FNLTSHFTLYLHRDAVLLASQDESDWPLIDPLPSYGRGRDAVGGRYGSLLFGTNLTDIVI  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+FR  KL YTRPYLIEIM+SD++QISNLTLLNSPSWNVHPVYSS
Sbjct  164  TGDNGTIDGQGELWWQKFRGGKLNYTRPYLIEIMYSDKVQISNLTLLNSPSWNVHPVYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+I+QG+TILAP  S NTDGINPDS
Sbjct  224  NVIVQGITILAPTNSPNTDGINPDS  248



>gb|AFK44529.1| unknown [Lotus japonicus]
Length=469

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A++ RA+SAS+ DFGGVGDG TLNT+AFR+A+ +LS+YS++GG++L VP G+WLTGS
Sbjct  32   EYCAVNCRAYSASVTDFGGVGDGTTLNTQAFRKAIEHLSQYSSNGGSQLYVPPGRWLTGS  91

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLF+HKDAV+L SQD N WP++ PLPSYG GRDT GGR  SLIFG++L DV+I
Sbjct  92   FNLTSHFTLFIHKDAVILGSQDENEWPVIDPLPSYGRGRDTQGGRFSSLIFGTHLTDVII  151

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGT+DGQG LWW++F +K+L+YTRPYLIEIM+SD +QISNLTL+NSPSWN+HPVY S
Sbjct  152  TGDNGTLDGQGDLWWKKFHNKQLQYTRPYLIEIMYSDNVQISNLTLVNSPSWNIHPVYCS  211

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+I+QG+TILAPV S NTDGINPDS
Sbjct  212  NVIVQGITILAPVTSPNTDGINPDS  236



>ref|XP_010523769.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+A++ R HSASI +FGGVGDG+TLNTKAF+ A+ +LS+YS +GGA+L VPAGKWLTGS
Sbjct  36   EYTAMACREHSASITEFGGVGDGQTLNTKAFQSAVEHLSQYSDNGGAQLYVPAGKWLTGS  95

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTLFLH+DAVLLA+QDIN +P++  LPSYG GRD +GGR  SLIFG+NL DVV+
Sbjct  96   FSLTSHFTLFLHRDAVLLAAQDINEFPVLKALPSYGRGRDAAGGRFASLIFGTNLTDVVV  155

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WWQ F   KLKYTRPYLIE M SD IQISNLTLL+SPSWN+HPVYSS
Sbjct  156  TGNNGTIDGQGSFWWQSFHKGKLKYTRPYLIEFMFSDSIQISNLTLLDSPSWNIHPVYSS  215

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TI+APV S NTDGINPDS
Sbjct  216  NIIVKGITIIAPVTSPNTDGINPDS  240



>ref|XP_009345122.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=485

 Score =   330 bits (845),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS RA SAS+ D+GGVGDG T NTKAF+EA+ +LS+Y + GG++L+VP GKWLTGS
Sbjct  46   EYCAISCRAKSASLTDYGGVGDGTTSNTKAFQEAITHLSQYESEGGSQLVVPPGKWLTGS  105

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRD-TSGGRCISLIFGSNLVDVV  259
            FNLTSHFTL+LHKDAVLLASQD + WP++ PLPSYG GRD T GGR ISLIFG+NL DVV
Sbjct  106  FNLTSHFTLYLHKDAVLLASQDESEWPVIEPLPSYGRGRDNTDGGRFISLIFGTNLTDVV  165

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQG +WWQ+F+  +L YTRPYLIEIM+S++IQISNLTL+NSPSWNVHP+YS
Sbjct  166  ITGDNGTIDGQGEVWWQKFKKGQLNYTRPYLIEIMYSEKIQISNLTLVNSPSWNVHPIYS  225

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SN+++QG+TILAPV S NTDGINPDS
Sbjct  226  SNVLVQGITILAPVTSPNTDGINPDS  251



>gb|KHG15709.1| hypothetical protein F383_10492 [Gossypium arboreum]
Length=482

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S RAHSASI DFGG+GDGKT NTKAF++A+N+LS+Y+  GGA+L VPAG+WLTGS
Sbjct  44   EYIAMSCRAHSASITDFGGIGDGKTSNTKAFQDAVNHLSQYANDGGAQLYVPAGQWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L+SHFTL+LHKDAVLLASQD++ WP++  LPSYG GRD +GGR  SLIFG+NL DVV+
Sbjct  104  FSLSSHFTLYLHKDAVLLASQDMSEWPVLKALPSYGRGRDAAGGRFASLIFGTNLTDVVV  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGA WWQ F   KLKYTRPYLIE M+SD IQISNLT LNSPSWNVHPVYSS
Sbjct  164  TGANGTIDGQGAFWWQNFHKGKLKYTRPYLIEFMYSDNIQISNLTFLNSPSWNVHPVYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TI+AP+ S NTDGINPDS
Sbjct  224  NILVQGITIIAPITSPNTDGINPDS  248



>ref|XP_003528838.1| PREDICTED: probable polygalacturonase [Glycine max]
Length=482

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSAS+ DFGGVGDGKT NTKAF+ A+++LS+Y++ GGA+L VPAGKWLTGS
Sbjct  44   KYEAINCRTHSASLTDFGGVGDGKTSNTKAFQSAISHLSQYASKGGAQLYVPAGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L SHFTL+L+KDAVLLASQDI+ WP + PLPSYG GRD   GR  SLIFG+NL DV++
Sbjct  104  FSLISHFTLYLNKDAVLLASQDISEWPAIEPLPSYGRGRDAPAGRYTSLIFGTNLTDVIV  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGA WWQ+F  KKLKYTRPYLIE+M SDQIQISNLTLLNSPSWN+HPVYSS
Sbjct  164  TGGNGTIDGQGAFWWQKFHKKKLKYTRPYLIELMFSDQIQISNLTLLNSPSWNLHPVYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII+GLTI+APV S NTDGINPDS
Sbjct  224  NIIIKGLTIIAPVPSPNTDGINPDS  248



>gb|KHG15710.1| hypothetical protein F383_10492 [Gossypium arboreum]
Length=481

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S RAHSASI DFGG+GDGKT NTKAF++A+N+LS+Y+  GGA+L VPAG+WLTGS
Sbjct  43   EYIAMSCRAHSASITDFGGIGDGKTSNTKAFQDAVNHLSQYANDGGAQLYVPAGQWLTGS  102

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L+SHFTL+LHKDAVLLASQD++ WP++  LPSYG GRD +GGR  SLIFG+NL DVV+
Sbjct  103  FSLSSHFTLYLHKDAVLLASQDMSEWPVLKALPSYGRGRDAAGGRFASLIFGTNLTDVVV  162

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGA WWQ F   KLKYTRPYLIE M+SD IQISNLT LNSPSWNVHPVYSS
Sbjct  163  TGANGTIDGQGAFWWQNFHKGKLKYTRPYLIEFMYSDNIQISNLTFLNSPSWNVHPVYSS  222

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TI+AP+ S NTDGINPDS
Sbjct  223  NILVQGITIIAPITSPNTDGINPDS  247



>gb|KHN46704.1| Putative polygalacturonase [Glycine soja]
Length=477

 Score =   328 bits (842),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ RAHSAS+ DFGGVGDG T NTKAF+ A+++LS+Y+  GGA+L VPAGKWLTGS
Sbjct  42   EYKAINCRAHSASLIDFGGVGDGNTSNTKAFQSAISHLSQYAFKGGAQLYVPAGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L SHFTL+L+KDA LLASQDI  WP++ PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  102  FSLISHFTLYLNKDAFLLASQDIREWPVIEPLPSYGRGRDAAAGRYTSLIFGTNLTDVIV  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGA WWQ+F  KKLKYTRPYLIE+M SD+IQISNLTLLNSPSWNVHPVYSS
Sbjct  162  TGDNGTIDGQGAFWWQKFHKKKLKYTRPYLIELMFSDKIQISNLTLLNSPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII+GLTI+APV S NTDGINPDS
Sbjct  222  NIIIKGLTIIAPVPSPNTDGINPDS  246



>ref|XP_004492778.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=483

 Score =   329 bits (843),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+ I+ RA SAS+ DFGGVGDGKT NTKAF  A+++LS+Y   GG++L VPAGKWLTGS
Sbjct  42   EYNGINCRAQSASLTDFGGVGDGKTSNTKAFESAISHLSQYGNEGGSQLYVPAGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL+L KDA+LLASQDI  WP++ PLPSYG GRD   GR  SLIFG+NL DV++
Sbjct  102  FSLTSHFTLYLDKDAILLASQDITEWPVIEPLPSYGRGRDAPAGRYTSLIFGTNLTDVIV  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGA WWQQF  KKLKYTRPYLIE+M SD IQISNLTLLNSPSWN+HPVYSS
Sbjct  162  TGENGTIDGQGAFWWQQFHRKKLKYTRPYLIELMFSDTIQISNLTLLNSPSWNIHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+QG+TI+APV S NTDGINPDS
Sbjct  222  NIIVQGITIIAPVSSPNTDGINPDS  246



>ref|XP_009116814.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=470

 Score =   328 bits (841),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AI+ R+HSASI DFGGVGDGKTLNTKAF+ A+++LS+YS+ GGA+L VPAGKWLTGS
Sbjct  34   EYTAITCRSHSASITDFGGVGDGKTLNTKAFQSAVDHLSQYSSDGGAQLFVPAGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTLFLHKDA LLA+QD+  + ++  LPSYG GRD +GGR  SL+FG+NL DV+I
Sbjct  94   FSLTSHFTLFLHKDATLLAAQDLEEYLVLKALPSYGRGRDAAGGRFASLVFGTNLSDVII  153

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WWQ+F   KLKYTRPYLIE+M SD IQISN+TL++SPSWN+HPVYSS
Sbjct  154  TGNNGTIDGQGSFWWQKFHGGKLKYTRPYLIELMFSDTIQISNITLIDSPSWNIHPVYSS  213

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII++G+TI+APVKS NTDGINPDS
Sbjct  214  NIIVKGVTIIAPVKSPNTDGINPDS  238



>ref|XP_010276903.1| PREDICTED: probable polygalacturonase isoform X3 [Nelumbo nucifera]
Length=434

 Score =   327 bits (837),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = -1

Query  591  AHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLTSHFT  412
            AHSAS+ DFG VGDG TLNTKAF+ A+++LS++++ GGA+L VP G+WLTGSFNLTSHFT
Sbjct  2    AHSASLTDFGAVGDGVTLNTKAFQAAIDHLSQFASDGGAQLFVPRGRWLTGSFNLTSHFT  61

Query  411  LFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNNGTID  232
            L+LHKDAVLLASQD++ WPL+ PLPSYG GRD  GGR ISLIFG+NL DVVITG+NGTID
Sbjct  62   LYLHKDAVLLASQDVSEWPLIEPLPSYGRGRDAPGGRYISLIFGTNLTDVVITGDNGTID  121

Query  231  GQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIIIQGLT  52
            GQG LWWQ++RS +L YTRPYLIEIM+SDQ+QISNL L+NSPSWNVHPVYSSN+I+QGLT
Sbjct  122  GQGDLWWQKYRSGQLNYTRPYLIEIMYSDQVQISNLALVNSPSWNVHPVYSSNVIVQGLT  181

Query  51   ILAPVKSANTDGINPDS  1
            I APV S NTDGINPDS
Sbjct  182  ITAPVTSPNTDGINPDS  198



>ref|XP_003529926.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=498

 Score =   328 bits (841),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+A++ RAHSAS+ DFGGVGDG T NTKAF+ A++ LS+Y++ GGA+L VPAGKWLTGS
Sbjct  59   EYNALNCRAHSASLTDFGGVGDGNTSNTKAFQSAISYLSQYASKGGAQLYVPAGKWLTGS  118

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F++TSHFTL+L+KDAVLLASQD+N WP++ PLPSYG GRD   GR  S IFG+NL DV++
Sbjct  119  FSMTSHFTLYLNKDAVLLASQDMNEWPVIKPLPSYGRGRDAPAGRYTSFIFGTNLTDVIV  178

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGA WWQQF +K+L YTRPYLIE+M SD+IQISNLT LNSPSWNVHPVYSS
Sbjct  179  TGDNGTIDGQGAFWWQQFYNKRLNYTRPYLIELMFSDKIQISNLTFLNSPSWNVHPVYSS  238

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII+GLTI+APV S NTDGINPDS
Sbjct  239  NIIIKGLTIIAPVPSPNTDGINPDS  263



>gb|AFK37962.1| unknown [Lotus japonicus]
Length=469

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A++ RA+SAS+ DFGGVGDG TLNT+AFR+A+ +LS+YS++GG++L VP G+WLTGS
Sbjct  32   EYCAVNCRAYSASVTDFGGVGDGTTLNTQAFRKAIEHLSQYSSNGGSQLYVPPGRWLTGS  91

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
             NLTSHFTLF+HKDAV+L SQD N WP++ PLPSYG GRDT GGR  SLIFG++L DV+I
Sbjct  92   LNLTSHFTLFIHKDAVILGSQDENEWPVIDPLPSYGRGRDTQGGRFSSLIFGTHLTDVII  151

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGT+DGQG LWW++F +K+L+YTRPYLIEIM+SD +QISNLTL+NSPSWN+HPVY S
Sbjct  152  TGDNGTLDGQGDLWWKKFHNKQLQYTRPYLIEIMYSDNVQISNLTLVNSPSWNIHPVYCS  211

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+I+QG+TILAPV S NTDGINPDS
Sbjct  212  NVIVQGITILAPVTSPNTDGINPDS  236



>gb|ACU20792.1| unknown [Glycine max]
Length=243

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSAS+ DFGGVGDGKT NTKAF+ A+++LS+Y++ GGA+L VPAGKWLTGS
Sbjct  44   KYEAINCRTHSASLTDFGGVGDGKTSNTKAFQSAISHLSQYASKGGAQLYVPAGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L SHFTL+L+KDAVLLASQDI+ WP + PLPSYG GRD   GR  SLIFG+NL DV++
Sbjct  104  FSLISHFTLYLNKDAVLLASQDISEWPAIEPLPSYGRGRDAPAGRYTSLIFGTNLTDVIV  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGA WWQ+F  KKLKYTRPYLIE+M SDQIQISNLTLLNSPSWN+HPVYSS
Sbjct  164  TGGNGTIDGQGAFWWQKFHKKKLKYTRPYLIELMFSDQIQISNLTLLNSPSWNLHPVYSS  223

Query  75   NIIIQGLTILAPVKSANTDG  16
            NIII+GLTI+APV S NTDG
Sbjct  224  NIIIKGLTIIAPVPSPNTDG  243



>ref|XP_010676424.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   327 bits (837),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAI+ R+HSASI DFGGVGDG T NTKAF  A+++L ++ + GGA L VPAGKWLTGS
Sbjct  47   EYSAINCRSHSASITDFGGVGDGSTSNTKAFITAVDHLRQFESDGGALLFVPAGKWLTGS  106

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FN+TSHFTL+LHKDAVLLASQD+N WPL+ PLPSYG GRD  GGR  SLIFG+NL DV+I
Sbjct  107  FNVTSHFTLYLHKDAVLLASQDMNEWPLIDPLPSYGRGRDAPGGRYASLIFGTNLTDVII  166

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG +WWQ+F  K+LK+TRPYLIE+M+SD IQIS+LTL+NSPSWNVHP+YSS
Sbjct  167  TGENGTIDGQGEMWWQKFHHKQLKHTRPYLIELMYSDSIQISHLTLINSPSWNVHPIYSS  226

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQG+TI APV S NTDGINPDS
Sbjct  227  NILIQGITISAPVNSPNTDGINPDS  251



>ref|XP_004503678.1| PREDICTED: probable polygalacturonase-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503679.1| PREDICTED: probable polygalacturonase-like isoform X2 [Cicer 
arietinum]
Length=500

 Score =   326 bits (836),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A++ RA+SAS+ DFGGVGDG+TLNTKAF+ A+++LS+YS++GG++L VP G+WLTGS
Sbjct  32   EYCAVNCRAYSASLTDFGGVGDGETLNTKAFQTAIDHLSQYSSNGGSQLYVPPGRWLTGS  91

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FN+TSHFTLF+HKDAV+L SQD N WP++ PLPSYG GRDT GGR  SLIFG+NL DV+I
Sbjct  92   FNVTSHFTLFIHKDAVILGSQDENDWPVIDPLPSYGRGRDTQGGRFRSLIFGTNLTDVII  151

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGT+DGQG LWWQ+F   +L YTRPYLIEIM+SD IQISNLTL+NSPSWNVHPVYSS
Sbjct  152  TGDNGTLDGQGELWWQKFHHGQLSYTRPYLIEIMYSDNIQISNLTLVNSPSWNVHPVYSS  211

Query  75   NIIIQGLTILAPVKSANTDGINP  7
            N+I+QG+TILAPV S NTDGINP
Sbjct  212  NVIVQGITILAPVNSPNTDGINP  234



>ref|XP_009363435.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=473

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS RA SAS+ DFGGVGDG T NTKAF+EA+  LS+Y + GG++L+VP GKW+TGS
Sbjct  33   EYCAISCRAKSASLTDFGGVGDGTTSNTKAFQEAITYLSQYESEGGSQLVVPPGKWITGS  92

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRD-TSGGRCISLIFGSNLVDVV  259
            FNLTSHFTL LHKDAVL+ASQD + WP++ PLPSYG GRD T GGR ISLIFG+NL DVV
Sbjct  93   FNLTSHFTLHLHKDAVLVASQDESEWPVIEPLPSYGRGRDNTDGGRFISLIFGTNLTDVV  152

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQG +WWQ+F+  +L YTRPYLIEIM+S+ IQISNLTL+NSPSWNVHP+YS
Sbjct  153  ITGDNGTIDGQGEVWWQKFKRGQLNYTRPYLIEIMYSENIQISNLTLVNSPSWNVHPIYS  212

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SN+++QG+TILAPV S NTDGINPDS
Sbjct  213  SNVLVQGITILAPVTSPNTDGINPDS  238



>ref|XP_010276899.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=483

 Score =   325 bits (832),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = -1

Query  591  AHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLTSHFT  412
            AHSAS+ DFG VGDG TLNTKAF+ A+++LS++++ GGA+L VP G+WLTGSFNLTSHFT
Sbjct  51   AHSASLTDFGAVGDGVTLNTKAFQAAIDHLSQFASDGGAQLFVPRGRWLTGSFNLTSHFT  110

Query  411  LFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNNGTID  232
            L+LHKDAVLLASQD++ WPL+ PLPSYG GRD  GGR ISLIFG+NL DVVITG+NGTID
Sbjct  111  LYLHKDAVLLASQDVSEWPLIEPLPSYGRGRDAPGGRYISLIFGTNLTDVVITGDNGTID  170

Query  231  GQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIIIQGLT  52
            GQG LWWQ++RS +L YTRPYLIEIM+SDQ+QISNL L+NSPSWNVHPVYSSN+I+QGLT
Sbjct  171  GQGDLWWQKYRSGQLNYTRPYLIEIMYSDQVQISNLALVNSPSWNVHPVYSSNVIVQGLT  230

Query  51   ILAPVKSANTDGINPDS  1
            I APV S NTDGINPDS
Sbjct  231  ITAPVTSPNTDGINPDS  247



>ref|XP_010055093.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW71569.1| hypothetical protein EUGRSUZ_E00105 [Eucalyptus grandis]
Length=472

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+A++ RAHSAS+ DFG VGDG+T NTKAF+ A++ LSK++  GG +L VPAGKWLTGS
Sbjct  34   EYTAMNCRAHSASLTDFGAVGDGQTSNTKAFKAAVDQLSKFADDGGVQLYVPAGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+L SHFTL+LH+DAVLLASQD+  WP + PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  94   FSLVSHFTLYLHRDAVLLASQDMTEWPALKPLPSYGRGRDAAAGRYQSLIFGTNLTDVIV  153

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGA WWQ+F   KLKYTRPYLIE M SD IQISNLTLLNSPSWNVHPVYSS
Sbjct  154  TGDNGTIDGQGAFWWQKFHGGKLKYTRPYLIEFMFSDTIQISNLTLLNSPSWNVHPVYSS  213

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++Q +TILAPVKS NTDGINPDS
Sbjct  214  NILVQRITILAPVKSPNTDGINPDS  238



>gb|EYU23462.1| hypothetical protein MIMGU_mgv1a006147mg [Erythranthe guttata]
Length=455

 Score =   322 bits (826),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AIS RAH+AS+ DFGGVGDG T NT+AF+ A+++LS++ + GG+ L VP GKWLTGS
Sbjct  9    QYCAISCRAHTASLADFGGVGDGTTSNTRAFQTAVDHLSQFESDGGSMLFVPPGKWLTGS  68

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAVLLASQD N W ++ PLPSYG GRDT GGR ISLIFG+NL DV+I
Sbjct  69   FNLTSHFTLFLHQDAVLLASQDENEWAVIEPLPSYGRGRDTEGGRYISLIFGTNLTDVII  128

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG  WW +F   +L YTRPYLIEIM+S+ +QISNLTL+NSPSWNVHPVY S
Sbjct  129  TGDNGTIDGQGETWWNKFHKGELSYTRPYLIEIMYSENVQISNLTLVNSPSWNVHPVYCS  188

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+I+QGLTILAPV S NTDGINPDS
Sbjct  189  NVIVQGLTILAPVTSPNTDGINPDS  213



>ref|XP_009604283.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=482

 Score =   323 bits (828),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RAH+A + DFGGVGDG TLNT AF+ A+++LS++ + GG+ L VPAGKWLTGS
Sbjct  44   EYSAISCRAHTAWLTDFGGVGDGTTLNTNAFKTAVDHLSQFQSDGGSLLYVPAGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+  KDAVLLAS+D N +P++ PLPSYG GRD  GGR ISLIFG+NL DVVI
Sbjct  104  FNLTSHFTLYFDKDAVLLASEDENDYPVIAPLPSYGRGRDNDGGRFISLIFGANLTDVVI  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWW +F  K+L+YTRPYLIEIM+SD IQIS+LTL+NSPSWNVHPVY S
Sbjct  164  TGENGTIDGQGQLWWDKFHKKELQYTRPYLIEIMYSDNIQISSLTLVNSPSWNVHPVYCS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIIIQG+TILAPV+S NTDGINPDS
Sbjct  224  NIIIQGITILAPVRSPNTDGINPDS  248



>ref|XP_002509850.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF51237.1| polygalacturonase, putative [Ricinus communis]
Length=480

 Score =   323 bits (828),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS RAH AS++DFGGVGDG+T NTKAF+ A+++LS++S  GG++L VP GKWLTGS
Sbjct  42   EYAAISCRAHEASLEDFGGVGDGQTSNTKAFQAAIDHLSQFSYDGGSQLYVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAVLLASQD + WP++ PLPSYG GRDT GGR  SLIFG+NL DVVI
Sbjct  102  FNLTSHFTLFLDKDAVLLASQDESEWPVIEPLPSYGRGRDTEGGRYSSLIFGTNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWW++F + ++ YTRPYLIEIM+S+ IQISNLTL+NSPSWN+HP YSS
Sbjct  162  TGANGTIDGQGDLWWKKFHNGEINYTRPYLIEIMYSNNIQISNLTLMNSPSWNIHPTYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QG+TILAPV S NTDGINPDS
Sbjct  222  NVVVQGITILAPVNSPNTDGINPDS  246



>ref|XP_011046019.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=452

 Score =   322 bits (825),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSA + DFGGVGDGKT NTKAF+ A+  LS+Y+A GGA+LIVP G+WLTGS
Sbjct  21   EYQAINCRKHSAVLTDFGGVGDGKTSNTKAFKAAIAELSQYAADGGAQLIVPPGRWLTGS  80

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNL+SHFTLFLHKDAVLLASQD   WP  PPLPSYG GRD   GR  SLIFG++L DVV+
Sbjct  81   FNLSSHFTLFLHKDAVLLASQDEAEWPAFPPLPSYGVGRDEHAGRFSSLIFGTHLTDVVV  140

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA+WW +F  KKLK TRPYLIE ++SDQ+QISNLTL+NSPSWNVHP Y S
Sbjct  141  TGNNGTIDGQGAVWWDKFHQKKLKLTRPYLIEFLYSDQVQISNLTLINSPSWNVHPTYCS  200

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N++IQ LTILAPV S NTDGINPDS
Sbjct  201  NVLIQWLTILAPVDSPNTDGINPDS  225



>ref|XP_004295492.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   324 bits (830),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKW  448
             S  EY+AIS RAHS S+ DFG VGDGKT NTKAF+ A+N+LS++SA GGA+L VPAGK+
Sbjct  35   ESSFEYNAISCRAHSFSLTDFGAVGDGKTSNTKAFQAAINHLSQFSAQGGAQLYVPAGKY  94

Query  447  LTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLV  268
            LTGSFNLTSHFTL+LHK+AVLLASQD   WP++ PLPSYG GRD   GR  SL+FG+NL 
Sbjct  95   LTGSFNLTSHFTLYLHKEAVLLASQDPQEWPVLKPLPSYGRGRDAPEGRYASLLFGTNLT  154

Query  267  DVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHP  88
            DVVITG+NGTIDGQG  WW +F SKKL+YTRPYLIE+M S  +QISNLTL+NSPSWNVHP
Sbjct  155  DVVITGDNGTIDGQGEFWWNKFHSKKLQYTRPYLIEVMFSSNVQISNLTLINSPSWNVHP  214

Query  87   VYSSNIIIQGLTILAPVKSANTDGINPDS  1
            +YSS+I++QGLTILAPV S NTDG+NPDS
Sbjct  215  IYSSDILVQGLTILAPVSSPNTDGVNPDS  243



>ref|XP_006372397.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|ERP50194.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=452

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSA + DFGGVGDGKT NTKAF+ A+  LS+Y++ GGA+LIVP GKWLTGS
Sbjct  21   EYQAINCRKHSAVLTDFGGVGDGKTSNTKAFKAAIAELSQYASDGGAQLIVPPGKWLTGS  80

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNL+SHFTLFLHKDAVLLASQD   WP  PPLPSYG GRD   GR  SLIFG++L DVV+
Sbjct  81   FNLSSHFTLFLHKDAVLLASQDEAEWPAFPPLPSYGVGRDEHAGRFSSLIFGTHLTDVVV  140

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA+WW +F  KKLK TRPYLIE ++SDQ+QISNLTL+NSPSWNVHP Y S
Sbjct  141  TGNNGTIDGQGAVWWDKFHQKKLKLTRPYLIEFLYSDQVQISNLTLINSPSWNVHPTYCS  200

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N++IQ LTILAPV S NTDGINPDS
Sbjct  201  NVLIQWLTILAPVDSPNTDGINPDS  225



>ref|XP_002513653.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF49056.1| polygalacturonase, putative [Ricinus communis]
Length=473

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            YSAIS R HSA + DFGGVGDGKT NTK F+ A+ NLSKYS  GGA+LI+PAGKWLTGSF
Sbjct  43   YSAISCRKHSAVLTDFGGVGDGKTSNTKVFQTAIANLSKYSPDGGAQLIIPAGKWLTGSF  102

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFLHK+AVLLASQD   WP++PPLPSYG GRD +GGR  SLIFG+NL DVVIT
Sbjct  103  NLTSHFTLFLHKEAVLLASQDEAEWPILPPLPSYGRGRDATGGRFSSLIFGTNLKDVVIT  162

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            GNNGTIDGQGA WW +F    L  TRPYLIE+++S +IQISNL L+NSPSWNVHP YSSN
Sbjct  163  GNNGTIDGQGATWWNKFHKGLLNQTRPYLIELLYSHKIQISNLILINSPSWNVHPTYSSN  222

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            ++IQGLTILAPV S NTDGINPDS
Sbjct  223  VLIQGLTILAPVDSPNTDGINPDS  246



>gb|AAZ32910.1| polygalacturonase-like protein [Medicago sativa]
Length=206

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            YSA++ RAHS S+KDFGGVGDGKT NTKAF+ A+++LS+ ++ GG++L VPAGKWLTGSF
Sbjct  1    YSALNCRAHSVSLKDFGGVGDGKTSNTKAFKSAISHLSQNASEGGSQLYVPAGKWLTGSF  60

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            +L SHFTL+LHKDAVLLASQDIN WP++ PLPSYG GRD + GR  SLIFG+NL DV++T
Sbjct  61   SLISHFTLYLHKDAVLLASQDINEWPVIKPLPSYGRGRDAAAGRHTSLIFGTNLTDVIVT  120

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G+NGTIDGQG+ WWQQF +KKLKYTRPYLIE+M SD IQISNLTLL+SPSWN+HPVYSSN
Sbjct  121  GDNGTIDGQGSFWWQQFHNKKLKYTRPYLIELMFSDNIQISNLTLLDSPSWNIHPVYSSN  180

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            III+G+TI+AP++S NTDGINPDS
Sbjct  181  IIIKGITIIAPIRSPNTDGINPDS  204



>ref|XP_010436421.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=417

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RA+SAS+ +FG VGDG T NT AFR+A++ LS+++ HGG+ L VPAG+WLTGS
Sbjct  59   EYSAISCRAYSASLDEFGAVGDGVTSNTAAFRDAVSQLSRFADHGGSLLFVPAGRWLTGS  118

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH DAV+LASQ+ + + ++ PLPSYG GRDT GGR ISL+FGSNL DVVI
Sbjct  119  FNLTSHFTLFLHPDAVILASQEESDYEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVI  178

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYLIEIMHSD IQISNLT LNSPSW++HPVYSS
Sbjct  179  TGENGTIDGQGEPWWGKFKRGELKYTRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSS  238

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQGLTILAPV   NTDGINPDS
Sbjct  239  NILIQGLTILAPVTVPNTDGINPDS  263



>ref|XP_004298190.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=462

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            YSAI+ R HSA + DFG VGDGK LNTKAF+ A++ LS+Y++ GGA+LIVP GKWLTGSF
Sbjct  29   YSAIACRKHSALLTDFGAVGDGKILNTKAFKAAVDKLSQYASDGGAQLIVPPGKWLTGSF  88

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFLHKDAV+LASQ+ + WPL+PPLPSYG GRD  GGR  SLIFG+NL DVVIT
Sbjct  89   NLTSHFTLFLHKDAVILASQEESQWPLLPPLPSYGQGRDAPGGRFSSLIFGTNLTDVVIT  148

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            GNNGTIDGQGA WW +F    L  TRPYL+EIM S+QIQISNLT  NSPSW++HPVYSSN
Sbjct  149  GNNGTIDGQGAPWWDKFEKGLLNVTRPYLLEIMFSNQIQISNLTFTNSPSWHIHPVYSSN  208

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            I IQG+TILAPV+  NTDGINPDS
Sbjct  209  ITIQGITILAPVEVPNTDGINPDS  232



>ref|XP_010055091.1| PREDICTED: probable polygalacturonase isoform X1 [Eucalyptus 
grandis]
 gb|KCW71568.1| hypothetical protein EUGRSUZ_E00104 [Eucalyptus grandis]
Length=481

 Score =   318 bits (816),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA+S RAHSAS+ +FG +GDGKTLNTKAF  A+ +LS+YSA GG  L VPAG+WLTG+
Sbjct  47   EYSAMSCRAHSASVTEFGAIGDGKTLNTKAFEAAIAHLSRYSAVGGGLLYVPAGRWLTGT  106

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LH+ AVLLASQDI +WPL  PLPSYGHGR+  GGR +S IFG+NL DV+I
Sbjct  107  FNLTSHFTLYLHRHAVLLASQDIKSWPLSDPLPSYGHGREAPGGRYMSFIFGTNLTDVII  166

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NG IDGQG +WW +F    LKYTRP+LIEI+HS  IQISNLTLLNSP W VHPVYSS
Sbjct  167  TGDNGKIDGQGGVWWNKFHKGSLKYTRPHLIEILHSRSIQISNLTLLNSPFWTVHPVYSS  226

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            +I+IQG+TILAPVKS NTDGI+PDS
Sbjct  227  DIVIQGVTILAPVKSPNTDGIDPDS  251



>ref|XP_010055092.1| PREDICTED: probable polygalacturonase isoform X2 [Eucalyptus 
grandis]
Length=479

 Score =   318 bits (815),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA+S RAHSAS+ +FG +GDGKTLNTKAF  A+ +LS+YSA GG  L VPAG+WLTG+
Sbjct  45   EYSAMSCRAHSASVTEFGAIGDGKTLNTKAFEAAIAHLSRYSAVGGGLLYVPAGRWLTGT  104

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LH+ AVLLASQDI +WPL  PLPSYGHGR+  GGR +S IFG+NL DV+I
Sbjct  105  FNLTSHFTLYLHRHAVLLASQDIKSWPLSDPLPSYGHGREAPGGRYMSFIFGTNLTDVII  164

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NG IDGQG +WW +F    LKYTRP+LIEI+HS  IQISNLTLLNSP W VHPVYSS
Sbjct  165  TGDNGKIDGQGGVWWNKFHKGSLKYTRPHLIEILHSRSIQISNLTLLNSPFWTVHPVYSS  224

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            +I+IQG+TILAPVKS NTDGI+PDS
Sbjct  225  DIVIQGVTILAPVKSPNTDGIDPDS  249



>ref|XP_003622464.1| Polygalacturonase-like protein [Medicago truncatula]
 gb|KEH18815.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=479

 Score =   318 bits (815),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKW  448
            S+  EYSA++ RAHS S+KDFGGVGDGKT NTKAF+ A+++LS+ ++ GG++L VPAGKW
Sbjct  40   STSFEYSALNCRAHSVSLKDFGGVGDGKTSNTKAFKSAISHLSQNASEGGSQLYVPAGKW  99

Query  447  LTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLV  268
            LTGSF+L SHFTL+LHKDAVLLASQDIN WP++ PLPSYG GRD + GR  SLIFG+NL 
Sbjct  100  LTGSFSLISHFTLYLHKDAVLLASQDINEWPVIKPLPSYGRGRDAAAGRHTSLIFGTNLT  159

Query  267  DVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHP  88
            DV++TG+NGTIDGQG+ WWQQF +KKLKYTRPYLIE+M SD IQISNLTLL+SPSWN+HP
Sbjct  160  DVIVTGDNGTIDGQGSFWWQQFHNKKLKYTRPYLIELMFSDNIQISNLTLLDSPSWNIHP  219

Query  87   VYSSNIIIQGLTILAPVKSANTDGINPDS  1
            VYSSNIII+G+TI+AP++S NTDGINPDS
Sbjct  220  VYSSNIIIKGITIIAPIRSPNTDGINPDS  248



>ref|XP_010448699.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=490

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RA+SAS+ +FG VGDG T NT AFR+A++ LS+++ HGG+ L VPAG+WLTGS
Sbjct  59   EYSAISCRAYSASLDEFGAVGDGVTSNTAAFRDAVSQLSRFADHGGSLLFVPAGRWLTGS  118

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH DAV+LASQ+ + + ++ PLPSYG GRDT GGR ISL+FGSNL DVVI
Sbjct  119  FNLTSHFTLFLHPDAVILASQEESDYEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVI  178

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYLIEIMHSD IQISNLT LNSPSW++HPVYSS
Sbjct  179  TGENGTIDGQGEPWWGKFKRGELKYTRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSS  238

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQGLTILAPV   NTDGINPDS
Sbjct  239  NILIQGLTILAPVTVPNTDGINPDS  263



>gb|KFK28901.1| hypothetical protein AALP_AA7G062800 [Arabis alpina]
Length=494

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA+S RA+SAS+ +FG VGDG T NT AFR+A++ LS+++ +GG+ L VPAG+WLTGS
Sbjct  56   EYSAVSCRAYSASLDEFGAVGDGVTSNTAAFRDAVSQLSRFADYGGSLLFVPAGRWLTGS  115

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAVLLASQ+ + + ++ PLPSYG GRDT GGR ISL+FGSNL DVVI
Sbjct  116  FNLTSHFTLFLHRDAVLLASQEESDYEVIAPLPSYGRGRDTDGGRFISLLFGSNLTDVVI  175

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYL+EIMHSD IQISNLT LNSPSW++HPVYSS
Sbjct  176  TGENGTIDGQGEPWWGKFKRGELKYTRPYLVEIMHSDSIQISNLTFLNSPSWHIHPVYSS  235

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQGLTILAPV   NTDGINPDS
Sbjct  236  NIVIQGLTILAPVTVPNTDGINPDS  260



>ref|XP_007217591.1| hypothetical protein PRUPE_ppa018901mg, partial [Prunus persica]
 gb|EMJ18790.1| hypothetical protein PRUPE_ppa018901mg, partial [Prunus persica]
Length=391

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA+S R HSA + DFG VGDGKT NTKAF+ A+++LS+ ++ GGA+LIVP GKWLTGS
Sbjct  22   KYSALSCRKHSALLTDFGAVGDGKTSNTKAFKAAIDHLSQSASDGGAQLIVPPGKWLTGS  81

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LA+QD + WPLVP LPSYG GRD  GGR  SLIFG+NL D+VI
Sbjct  82   FNLTSHFTLFLHKDAVILATQDESEWPLVPVLPSYGRGRDAPGGRFSSLIFGTNLTDIVI  141

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG  WW+++++ +L  TRPY+IEIM+S+QIQISNLTL+NSPSW VHP+YSS
Sbjct  142  TGNNGTIDGQGTSWWKKYKAGQLNETRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSS  201

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQGLTILAP+ S NTDGI+PDS
Sbjct  202  NITIQGLTILAPIDSPNTDGIDPDS  226



>ref|XP_003592202.1| hypothetical protein MTR_1g100060 [Medicago truncatula]
Length=487

 Score =   317 bits (813),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSA + DFGGVGDGKTLNTKAF  A+ NLS+Y+  GGA+LIVP GKWLTGS
Sbjct  53   DYPAINCRKHSAVLTDFGGVGDGKTLNTKAFNSAITNLSQYANDGGAQLIVPPGKWLTGS  112

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAV+LASQ  + WP +P LPSYG GR+  GGR  SLIFG+NL+DV+I
Sbjct  113  FNLTSHFTLFLQKDAVILASQYESDWPQLPALPSYGRGREKPGGRFSSLIFGTNLIDVII  172

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WW +F+ K+LK TRPY+IEIM+SDQIQISNLTL+NSPSW VHPVYSS
Sbjct  173  TGNNGTIDGQGSTWWDKFQKKQLKITRPYMIEIMYSDQIQISNLTLVNSPSWFVHPVYSS  232

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII GLTILAPV   NTDGI+PDS
Sbjct  233  NIIINGLTILAPVDVPNTDGIDPDS  257



>ref|XP_010439166.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=497

 Score =   317 bits (813),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RA+SAS+ +FG VGDG T NT AFR+A++ LS+++ HGG+ L VPAG+WLTGS
Sbjct  59   EYSAISCRAYSASLDEFGAVGDGVTSNTVAFRDAVSQLSRFADHGGSLLFVPAGRWLTGS  118

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH DAV+LASQ+ + + ++ PLPSYG GRDT GGR ISL+FGSNL DVVI
Sbjct  119  FNLTSHFTLFLHPDAVILASQEESDYEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVI  178

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYLIEIMHSD IQISNLT LNSPSW++HPVYSS
Sbjct  179  TGENGTIDGQGEPWWGKFKRGELKYTRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSS  238

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQGLTILAPV   NTDGINPDS
Sbjct  239  NILIQGLTILAPVTVPNTDGINPDS  263



>ref|XP_006422033.1| hypothetical protein CICLE_v10004864mg [Citrus clementina]
 ref|XP_006490634.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
 gb|ESR35273.1| hypothetical protein CICLE_v10004864mg [Citrus clementina]
 gb|KDO56791.1| hypothetical protein CISIN_1g011615mg [Citrus sinensis]
Length=481

 Score =   317 bits (811),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            E+ A++ R HSA + DFGGVGDGKT NTKAF  A++NLSKY+A GGA+LIVP GKWLTGS
Sbjct  46   EFQALNCRKHSAVLTDFGGVGDGKTSNTKAFNTAISNLSKYAADGGAQLIVPPGKWLTGS  105

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL++HKDA+LLASQD + WPL+PPLPSYG GRD  GGR  SLIFG+NL DVV+
Sbjct  106  FNLTSHFTLYIHKDALLLASQDESEWPLLPPLPSYGRGRDEPGGRFSSLIFGTNLTDVVV  165

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG N TI+GQG  WW ++R K+   TRPYLIE+M SD +QISNLTL++SPSWNVHPVYSS
Sbjct  166  TGGNATINGQGEPWWIKYRKKQFNVTRPYLIEVMFSDNVQISNLTLIDSPSWNVHPVYSS  225

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N++IQGLTI AP+ S NTDGINPDS
Sbjct  226  NVLIQGLTIRAPIDSPNTDGINPDS  250



>ref|XP_008229768.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA+S R HSA + DFG VGDGKT NTKAF+ A+++LS+ ++ GGA+LIVP GKWLTGS
Sbjct  38   KYSALSCRKHSALLTDFGAVGDGKTSNTKAFKAAIDHLSQCASDGGAQLIVPPGKWLTGS  97

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LA+Q+ + WPLVP LPSYG GRD  GGR  SLIFG+NL DVVI
Sbjct  98   FNLTSHFTLFLHKDAVILATQEESKWPLVPVLPSYGRGRDAPGGRFSSLIFGTNLTDVVI  157

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW++F++  L  TRPY+IEIM+S+QIQISNLTL+NSPSW VHP+YSS
Sbjct  158  TGNNGTIDGQGASWWKKFKAGLLNETRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSS  217

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQGLTILAP+ S NTDGI+PDS
Sbjct  218  NITIQGLTILAPIDSPNTDGIDPDS  242



>ref|XP_008232996.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase [Prunus 
mume]
Length=476

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS RAHSAS+ +FGGVGDGKT NTKAF+ A++ LS+Y++ GGA+L VPAGKWLTGS
Sbjct  38   EYTAISCRAHSASLTEFGGVGDGKTSNTKAFQAAISQLSQYASEGGAQLFVPAGKWLTGS  97

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNL SHFTL+LHKDAVLLASQD+N WP++ PLPSYG GRD +           N  D++I
Sbjct  98   FNLISHFTLYLHKDAVLLASQDVNEWPVLKPLPSYGRGRDAAAXXXXGCFVXFNFQDLII  157

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            +G+NGTIDGQG  WWQQF  KKLKYTRPYLIEIM S  IQISNLTLL+SPSWNVHPVYSS
Sbjct  158  SGDNGTIDGQGEFWWQQFHKKKLKYTRPYLIEIMFSTDIQISNLTLLDSPSWNVHPVYSS  217

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++QG+TI+AP+ S NTDGINPDS
Sbjct  218  NILVQGITIIAPITSPNTDGINPDS  242



>ref|XP_007038809.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY23310.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
Length=473

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            E+ A++ R H A + DFGGVGDGKT NT+AF+ A+ NLS+ +A GGA+LIVP GKWLTGS
Sbjct  40   EFPALNCRKHIAVLTDFGGVGDGKTSNTQAFKAAIANLSQLAADGGAQLIVPPGKWLTGS  99

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLF+HKDAV+L +QD + WPL+P LPSYG GRD   GR  SLIFG+NL DVVI
Sbjct  100  FNLTSHFTLFVHKDAVILGAQDESEWPLLPVLPSYGRGRDAPDGRFSSLIFGTNLTDVVI  159

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW++F+  KL  TRPYLIEIM+S+QIQISNLTL+NSPSWNVHP+YSS
Sbjct  160  TGNNGTIDGQGAYWWKKFKEDKLNETRPYLIEIMYSNQIQISNLTLINSPSWNVHPIYSS  219

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            ++IIQ LTILAPV S NTDGINPDS
Sbjct  220  DVIIQHLTILAPVDSPNTDGINPDS  244



>ref|XP_006413548.1| hypothetical protein EUTSA_v10025011mg [Eutrema salsugineum]
 gb|ESQ55001.1| hypothetical protein EUTSA_v10025011mg [Eutrema salsugineum]
Length=493

 Score =   316 bits (810),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA+S RA+SAS+ +FG VGDG T NT AFR+A++ LS+++ HGG+ L VPAG+WLTGS
Sbjct  55   EYSAVSCRAYSASLDEFGAVGDGVTSNTAAFRDAVSQLSRFADHGGSLLFVPAGRWLTGS  114

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAVLLASQ+ + + ++ PLPSYG GRDT GGR ISL+FG NL DVVI
Sbjct  115  FNLTSHFTLFLHRDAVLLASQEESDYEVIEPLPSYGRGRDTDGGRFISLLFGLNLTDVVI  174

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYLIEIMHSD IQISNLT LNSPSW++HPVYS 
Sbjct  175  TGENGTIDGQGEPWWGKFKRGELKYTRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSR  234

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQGLTILAPV   NTDGINPDS
Sbjct  235  NIVIQGLTILAPVTVPNTDGINPDS  259



>ref|XP_007038808.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY23309.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=469

 Score =   315 bits (808),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            E+ A++ R H A + DFGGVGDGKT NT+AF+ A+ NLS+ +A GGA+LIVP GKWLTGS
Sbjct  36   EFPALNCRKHIAVLTDFGGVGDGKTSNTQAFKAAIANLSQLAADGGAQLIVPPGKWLTGS  95

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLF+HKDAV+L +QD + WPL+P LPSYG GRD   GR  SLIFG+NL DVVI
Sbjct  96   FNLTSHFTLFVHKDAVILGAQDESEWPLLPVLPSYGRGRDAPDGRFSSLIFGTNLTDVVI  155

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW++F+  KL  TRPYLIEIM+S+QIQISNLTL+NSPSWNVHP+YSS
Sbjct  156  TGNNGTIDGQGAYWWKKFKEDKLNETRPYLIEIMYSNQIQISNLTLINSPSWNVHPIYSS  215

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            ++IIQ LTILAPV S NTDGINPDS
Sbjct  216  DVIIQHLTILAPVDSPNTDGINPDS  240



>gb|AES62453.2| pectin lyase superfamily protein [Medicago truncatula]
Length=516

 Score =   317 bits (812),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSA + DFGGVGDGKTLNTKAF  A+ NLS+Y+  GGA+LIVP GKWLTGS
Sbjct  82   DYPAINCRKHSAVLTDFGGVGDGKTLNTKAFNSAITNLSQYANDGGAQLIVPPGKWLTGS  141

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAV+LASQ  + WP +P LPSYG GR+  GGR  SLIFG+NL+DV+I
Sbjct  142  FNLTSHFTLFLQKDAVILASQYESDWPQLPALPSYGRGREKPGGRFSSLIFGTNLIDVII  201

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WW +F+ K+LK TRPY+IEIM+SDQIQISNLTL+NSPSW VHPVYSS
Sbjct  202  TGNNGTIDGQGSTWWDKFQKKQLKITRPYMIEIMYSDQIQISNLTLVNSPSWFVHPVYSS  261

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII GLTILAPV   NTDGI+PDS
Sbjct  262  NIIINGLTILAPVDVPNTDGIDPDS  286



>ref|XP_010530415.1| PREDICTED: probable polygalacturonase, partial [Tarenaya hassleriana]
Length=445

 Score =   314 bits (805),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA+S RA+SAS+ +FGGVGDG T NT AFR+A+  LS+YS  GG  L VPAG+WLTGS
Sbjct  7    EYSAVSCRAYSASLDEFGGVGDGVTSNTAAFRDAVAQLSRYSDDGGGLLFVPAGRWLTGS  66

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAV+LASQ+ + + ++ PLPSYG GRDT GGR ISLIFG+NL D +I
Sbjct  67   FNLTSHFTLFLHRDAVILASQNESDYEVIEPLPSYGRGRDTEGGRYISLIFGTNLTDAII  126

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGT+DGQG  WW +F+  +L+YTRPYLIEIMHSD IQISNLT LNSPSW++HPVYSS
Sbjct  127  TGENGTVDGQGEPWWGKFKRGELEYTRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSS  186

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQGLTILAPV   NTDGINPDS
Sbjct  187  NILIQGLTILAPVTVPNTDGINPDS  211



>ref|XP_009137356.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=493

 Score =   316 bits (809),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA+S RA+SAS+ +FG VGDG T NT AFR+A++ LS+++ +GG+ L VPAG+WLTGS
Sbjct  55   EYSALSCRAYSASLDEFGAVGDGVTSNTAAFRDAVSQLSRFADYGGSLLFVPAGRWLTGS  114

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAVLLASQ+ + + ++ PLPSYG GRDT GGR ISL+FGSNL DVVI
Sbjct  115  FNLTSHFTLFLHRDAVLLASQEESDYEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVI  174

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYLIEIMHS+ IQISNLT LNSPSW++HPVYSS
Sbjct  175  TGENGTIDGQGEPWWGKFKRGELKYTRPYLIEIMHSNGIQISNLTFLNSPSWHIHPVYSS  234

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQGLTILAPV   NTDGINPDS
Sbjct  235  NIVIQGLTILAPVTVPNTDGINPDS  259



>ref|XP_006283603.1| hypothetical protein CARUB_v10004660mg [Capsella rubella]
 gb|ACC91278.1| glycoside hydrolase family 28 protein [Capsella rubella]
 gb|EOA16501.1| hypothetical protein CARUB_v10004660mg [Capsella rubella]
Length=494

 Score =   316 bits (809),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RA+SAS+ +FG VGDG T NTKAFR+A++ LS++  +GG+ L VPAG+WLTG+
Sbjct  56   EYSAISCRAYSASLDEFGAVGDGVTSNTKAFRDAVSQLSRFEDYGGSLLFVPAGRWLTGN  115

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAV+LASQ+ + + ++ PLPSYG GRDT GGR ISL+FGSNL DVVI
Sbjct  116  FNLTSHFTLFLHRDAVILASQEESDYEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVI  175

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYLIEIMHSD IQISNLT LNSPSW++HPVYS 
Sbjct  176  TGENGTIDGQGEPWWGKFKRGELKYTRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSR  235

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQGLTILAPV   NTDGINPDS
Sbjct  236  NIFIQGLTILAPVTVPNTDGINPDS  260



>ref|XP_004496831.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=481

 Score =   315 bits (807),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSA + DFG VGDGKT NTKAF +A+N LS+Y+  GGA+LIVP GKWLTGS
Sbjct  44   DYPAINCRKHSAVLTDFGAVGDGKTSNTKAFNDAINKLSQYANDGGAQLIVPPGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL K AV+L SQD + WP +P LPSYG GRD  GGR  SLIFG++L DV+I
Sbjct  104  FNLTSHFTLFLQKGAVILGSQDESEWPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVII  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WW +F+ K++K TRPY+IEIM+SDQIQISNLTL+NSPSW VHP+YSS
Sbjct  164  TGNNGTIDGQGSYWWGKFKKKQMKLTRPYMIEIMYSDQIQISNLTLINSPSWFVHPIYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+QGLTILAPV S NTDGINPDS
Sbjct  224  NIIVQGLTILAPVTSPNTDGINPDS  248



>ref|XP_002299511.1| hypothetical protein POPTR_0001s09790g [Populus trichocarpa]
 gb|EEE84316.1| hypothetical protein POPTR_0001s09790g [Populus trichocarpa]
Length=481

 Score =   315 bits (807),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+A+S RAHSAS+ DFGGVGDG T NTKAF+ A+++LS++S+ GG+ L VP G+WLTGS
Sbjct  42   EYAALSCRAHSASVSDFGGVGDGTTANTKAFQAAIDHLSQFSSEGGSILYVPPGRWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTS+FTL+L KDAVLLASQD + +PL+ PLPSYG GRD  G R  SLIFG+NL DV+I
Sbjct  102  FNLTSYFTLYLDKDAVLLASQDESEYPLIEPLPSYGRGRDADGARYSSLIFGNNLTDVII  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWW +FR+ +L YTRPYLIEIM S  IQISNLTL+NSPSWNVHPVY S
Sbjct  162  TGANGTIDGQGELWWTKFRAGELNYTRPYLIEIMFSTNIQISNLTLINSPSWNVHPVYCS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QGLTILAPV+S NTDGINPDS
Sbjct  222  NVVVQGLTILAPVRSPNTDGINPDS  246



>ref|XP_010541188.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase [Tarenaya 
hassleriana]
Length=479

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA+S RA+SAS+ +FGGVGDG T NT AFR+A+  LS++S +GG  L VPAG+WLTGS
Sbjct  48   EYSAVSCRAYSASLDEFGGVGDGVTSNTAAFRDAVEQLSRFSDYGGGLLFVPAGRWLTGS  107

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLT HFTLFLH+DAV+LASQD + + ++ PLPSYG GRDT GGR ISLIFG+NL DVVI
Sbjct  108  FNLTRHFTLFLHRDAVILASQDESDYEVIEPLPSYGRGRDTEGGRYISLIFGTNLTDVVI  167

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYLIEIMHSD IQIS+LT LNSPSW++HPVYSS
Sbjct  168  TGENGTIDGQGEPWWGKFKRGELKYTRPYLIEIMHSDGIQISSLTFLNSPSWHIHPVYSS  227

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQ LTILAPV   NTDGINPDS
Sbjct  228  NILIQSLTILAPVTVPNTDGINPDS  252



>ref|XP_009395434.1| PREDICTED: probable polygalacturonase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=491

 Score =   315 bits (807),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA + RAH+AS++DFGGVGDG T NT+AF  A+ +LS++++ GG  L VPAG+WLTG 
Sbjct  54   KYSATACRAHTASLEDFGGVGDGATSNTEAFSAAVTHLSQFASDGGGMLFVPAGRWLTGP  113

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTS FTLFLH+DAV+LA+QD+N WP++ PLPSYG GRD +GGR  SLI GSNL DV+I
Sbjct  114  FNLTSSFTLFLHRDAVILATQDMNAWPIIDPLPSYGRGRDAAGGRYSSLIGGSNLTDVII  173

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGA WW +F   KLKYTR YLIE+MHSDQI ISNLTLLNSPSWN+HPVYSS
Sbjct  174  TGDNGTIDGQGAFWWSKFHGHKLKYTRGYLIELMHSDQIFISNLTLLNSPSWNIHPVYSS  233

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++ G+TILAPV S NTDGINPDS
Sbjct  234  NIVVSGITILAPVHSPNTDGINPDS  258



>ref|XP_007215325.1| hypothetical protein PRUPE_ppa005185mg [Prunus persica]
 gb|EMJ16524.1| hypothetical protein PRUPE_ppa005185mg [Prunus persica]
Length=473

 Score =   314 bits (805),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA+S R HSA + DFG VGDGKT NTKAF+ A+++LS+ ++ GGA+LIVP GKWLTGS
Sbjct  32   KYSALSCRRHSALLTDFGAVGDGKTSNTKAFKAAIDHLSQSASDGGAQLIVPPGKWLTGS  91

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LA+QD + WPLVP LPSYG GRD  GGR  SLIFG+NL DVVI
Sbjct  92   FNLTSHFTLFLHKDAVILATQDESEWPLVPVLPSYGRGRDAPGGRFSSLIFGTNLTDVVI  151

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG  WW+++++ +L  TRPY+IEIM+S+QIQISNLTL+NSPSW VHP+YSS
Sbjct  152  TGNNGTIDGQGISWWKKYKAGQLNETRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSS  211

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQGLTILAP+ S NTDGI+PDS
Sbjct  212  NITIQGLTILAPIDSPNTDGIDPDS  236



>ref|XP_009395433.1| PREDICTED: probable polygalacturonase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA + RAH+AS++DFGGVGDG T NT+AF  A+ +LS++++ GG  L VPAG+WLTG 
Sbjct  60   KYSATACRAHTASLEDFGGVGDGATSNTEAFSAAVTHLSQFASDGGGMLFVPAGRWLTGP  119

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTS FTLFLH+DAV+LA+QD+N WP++ PLPSYG GRD +GGR  SLI GSNL DV+I
Sbjct  120  FNLTSSFTLFLHRDAVILATQDMNAWPIIDPLPSYGRGRDAAGGRYSSLIGGSNLTDVII  179

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGA WW +F   KLKYTR YLIE+MHSDQI ISNLTLLNSPSWN+HPVYSS
Sbjct  180  TGDNGTIDGQGAFWWSKFHGHKLKYTRGYLIELMHSDQIFISNLTLLNSPSWNIHPVYSS  239

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI++ G+TILAPV S NTDGINPDS
Sbjct  240  NIVVSGITILAPVHSPNTDGINPDS  264



>ref|NP_194081.1| putative polygalacturonase [Arabidopsis thaliana]
 emb|CAA20471.1| putative protein [Arabidopsis thaliana]
 emb|CAB79305.1| putative protein [Arabidopsis thaliana]
 gb|AAN13048.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD95012.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84768.1| putative polygalacturonase [Arabidopsis thaliana]
Length=495

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RA+SAS+ +FG VGDG T NT AFR+A++ LS+++ +GG+ L VPAG+WLTG+
Sbjct  57   EYSAISCRAYSASLDEFGAVGDGVTSNTAAFRDAVSQLSRFADYGGSLLFVPAGRWLTGN  116

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAV+LASQ+ + + ++ PLPSYG GRDT GGR ISL+FGSNL DVVI
Sbjct  117  FNLTSHFTLFLHRDAVILASQEESDYEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVI  176

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYLIEIMHSD IQISNLT LNSPSW++HPVYSS
Sbjct  177  TGENGTIDGQGEPWWGKFKRGELKYTRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSS  236

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQGLTILAPV   NTDGINPDS
Sbjct  237  NIYIQGLTILAPVTVPNTDGINPDS  261



>ref|XP_004496829.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=475

 Score =   314 bits (804),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSA + DFG VGDGKT NTKAF  A++ LS+Y+  GGA+LIVP GKWLTGS
Sbjct  38   DYPAINCRKHSAVLTDFGAVGDGKTSNTKAFNAAISKLSQYANDGGAQLIVPPGKWLTGS  97

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAV+L SQD + WP +P LPSYG GRD  GGR  SLIFG++L DV+I
Sbjct  98   FNLTSHFTLFLQKDAVILGSQDESEWPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVII  157

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WW +F+ K++K TRPY+IEIM+SDQIQISNLTL+NSPSW VHP+YSS
Sbjct  158  TGNNGTIDGQGSYWWGKFKKKQMKLTRPYMIEIMYSDQIQISNLTLINSPSWFVHPIYSS  217

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+QGLTILAPV S NTDGI+PDS
Sbjct  218  NIIVQGLTILAPVTSPNTDGIDPDS  242



>ref|XP_004496830.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=469

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSA + DFG VGDGKT NTKAF +A+N LS+Y+  GGA+LIVP GKWLTGS
Sbjct  38   DYLAINCRKHSAVLTDFGAVGDGKTSNTKAFNDAINKLSQYANDGGAQLIVPPGKWLTGS  97

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL K AV+L SQD + WP +P LPSYG GRD  GGR  SLIFG++L DV+I
Sbjct  98   FNLTSHFTLFLQKGAVILGSQDESEWPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVII  157

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WW +F+  K+K TRPY+IEIM+SDQIQISNLTL+NSPSW VHP+YSS
Sbjct  158  TGNNGTIDGQGSYWWSKFKKDKMKLTRPYMIEIMYSDQIQISNLTLINSPSWFVHPIYSS  217

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIIIQGLTILAPV S NTDGI+PDS
Sbjct  218  NIIIQGLTILAPVTSPNTDGIDPDS  242



>ref|XP_008234837.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA+S R HSA + DFG VGDGKT NTKAF+ A+++LS+ ++ GGA+LIVP GKWLTGS
Sbjct  38   KYSALSCRKHSALLTDFGAVGDGKTSNTKAFKAAIHHLSQSASDGGAQLIVPPGKWLTGS  97

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LA+QD + WPL+  LPSYG GRD  GGR  SLIFG+NL DVVI
Sbjct  98   FNLTSHFTLFLHKDAVILATQDESEWPLISVLPSYGRGRDAPGGRFSSLIFGTNLTDVVI  157

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW++F++ +L  TRPY+IEIM+S+QIQISNLTL+NSPSW VHP+YSS
Sbjct  158  TGNNGTIDGQGASWWKKFKAGQLNETRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSS  217

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQGLTILAP+ S NTDGI+PDS
Sbjct  218  NITIQGLTILAPMNSPNTDGIDPDS  242



>ref|XP_002437680.1| hypothetical protein SORBIDRAFT_10g000660 [Sorghum bicolor]
 gb|EER89047.1| hypothetical protein SORBIDRAFT_10g000660 [Sorghum bicolor]
Length=495

 Score =   314 bits (804),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 171/206 (83%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAH--GGAKLIVPAGKWLTG  439
            Y A + RAH+AS+ DFGGVGDG T NT AFR A+++LS+YS    GGA L VPAGKWLTG
Sbjct  51   YLAPACRAHTASLADFGGVGDGTTSNTAAFRSAVDHLSQYSGEDAGGAMLYVPAGKWLTG  110

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTLFLH DAV+LASQDIN WP++ PLPSYG GRD  GGR  SL+ GSNL DVV
Sbjct  111  PFNLTSHFTLFLHSDAVILASQDINEWPIIDPLPSYGRGRDKIGGRFASLVGGSNLTDVV  170

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITGNNGTIDGQGA+WW +F   +LKYTR YLIE+MHSD I ISNLTLLNSP+WN+HPVYS
Sbjct  171  ITGNNGTIDGQGAMWWSKFHKNQLKYTRGYLIELMHSDTIYISNLTLLNSPAWNIHPVYS  230

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI++QG+TILAP  S NTDGINPDS
Sbjct  231  SNIVVQGITILAPTNSPNTDGINPDS  256



>ref|XP_011022627.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=479

 Score =   313 bits (803),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            E++A+S RAHSAS+ DFGGVGDG T+NTKAF+ A+++LS++S+ GG+ L VP G+WLTGS
Sbjct  42   EHAAVSCRAHSASVSDFGGVGDGTTVNTKAFQAAIDHLSQFSSKGGSILYVPPGRWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTS+FTL+L KDAVLL SQD N +PL+ PLPSYG GRD  G R  SLIFG+NL DVVI
Sbjct  102  FNLTSYFTLYLDKDAVLLGSQDENEYPLIEPLPSYGRGRDADGARFGSLIFGNNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWW +FR+ +L YTRPYLIEIM S  IQISNLTL++SPSWNVHPVY S
Sbjct  162  TGANGTIDGQGELWWTKFRAGELNYTRPYLIEIMFSTNIQISNLTLIDSPSWNVHPVYCS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QGLTILAPV+S NTDGINPDS
Sbjct  222  NVVVQGLTILAPVRSPNTDGINPDS  246



>ref|XP_009137085.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=493

 Score =   313 bits (803),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA+S RA+SAS+ +FG VGDG T NT AFR+A++ LS ++ +GG+ L VPAG+WLTGS
Sbjct  55   EYSALSCRAYSASLDEFGAVGDGVTSNTAAFRDAVSQLSHFADYGGSLLFVPAGRWLTGS  114

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAVLLASQ+ + + ++ PLPSYG GRDT GGR ISL+FGSNL DVVI
Sbjct  115  FNLTSHFTLFLHRDAVLLASQEESDYEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVI  174

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYLIEIMHSD IQISNLT LNSPSW++HPVYSS
Sbjct  175  TGENGTIDGQGEPWWGKFKRGELKYTRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSS  234

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI+IQ LTILAPV   NTDGINPDS
Sbjct  235  NIVIQDLTILAPVTVPNTDGINPDS  259



>ref|XP_007219377.1| hypothetical protein PRUPE_ppa020086mg [Prunus persica]
 gb|EMJ20576.1| hypothetical protein PRUPE_ppa020086mg [Prunus persica]
Length=517

 Score =   314 bits (805),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA+S R HSA + DFG VGDGKT NTKAF+ A+++LS+ ++ GGA+LIVP GKWLTGS
Sbjct  38   KYSALSCRKHSALLTDFGAVGDGKTSNTKAFKAAIHHLSQNASEGGAQLIVPPGKWLTGS  97

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LA+QD + WPLVP LPSYG GRD  GGR  S IFG+NL DVVI
Sbjct  98   FNLTSHFTLFLHKDAVILATQDESEWPLVPALPSYGRGRDAPGGRFSSFIFGTNLTDVVI  157

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW++F++ +L  TRPY+IEIM+S+QIQISN+TL+NSPSW VHP YSS
Sbjct  158  TGNNGTIDGQGASWWKKFKAGQLNETRPYMIEIMYSNQIQISNITLVNSPSWFVHPTYSS  217

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI I GLTILAP+ S NTDGINPDS
Sbjct  218  NITIHGLTILAPIDSPNTDGINPDS  242


 Score =   122 bits (305),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA+S R HSA + DFG VGDGKT NTKAF+ A+++LS+ ++ GGA+LIVP GKWLTGS
Sbjct  436  KYSALSCRKHSALLTDFGAVGDGKTSNTKAFKAAIHHLSQSASDGGAQLIVPPGKWLTGS  495

Query  435  FNLTSHFTLFLHKDAVLLASQ  373
            FNLTSHFTLFLHKDAV+LA+Q
Sbjct  496  FNLTSHFTLFLHKDAVILATQ  516



>ref|XP_009368731.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=472

 Score =   313 bits (801),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            YSAI+ R HSA + DFG VGDGKT NTKAF+ A+ +LS+ ++ GGA+LIVP G+WLTGSF
Sbjct  37   YSAINCRKHSALLTDFGAVGDGKTSNTKAFKAAVGHLSQLASDGGAQLIVPPGRWLTGSF  96

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFL KDAV+LA+QD + WP +P LPSYG GRD  GGRC SL+FG+NL DVVIT
Sbjct  97   NLTSHFTLFLQKDAVILATQDESEWPHLPVLPSYGRGRDAPGGRCSSLVFGTNLTDVVIT  156

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            GNNGTIDGQGA WW +F+   L  TRPY+IEIM+S+QIQISNLTL+NSPSW VHP+YSSN
Sbjct  157  GNNGTIDGQGASWWAKFKQGHLTLTRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSSN  216

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            I IQGLTILAPV S NTDGI+PDS
Sbjct  217  ITIQGLTILAPVDSPNTDGIDPDS  240



>gb|KHN21785.1| Putative polygalacturonase [Glycine soja]
Length=456

 Score =   312 bits (800),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSA + DFGGVGDGKT NTKAF+ A++ LS+ ++ GGA+LIVP GKWLTGS
Sbjct  22   EYPAINCRKHSAVLTDFGGVGDGKTSNTKAFQSAISKLSRVASDGGAQLIVPPGKWLTGS  81

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LASQD + WP +P LPSYG GRD  GGR  SLIFG++L DVVI
Sbjct  82   FNLTSHFTLFLHKDAVILASQDESEWPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVI  141

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG+ WW +F   +L  TRPY+IEIM+SDQIQISNLTL+NSPSW VHP+YSS
Sbjct  142  TGQNGTIDGQGSYWWDKFHKNQLNLTRPYMIEIMYSDQIQISNLTLVNSPSWFVHPIYSS  201

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI I+GLTILAPV S NTDGI+PDS
Sbjct  202  NITIKGLTILAPVDSPNTDGIDPDS  226



>ref|XP_003592200.1| Polygalacturonase-like protein [Medicago truncatula]
 gb|AES62451.1| pectin lyase superfamily protein [Medicago truncatula]
Length=481

 Score =   312 bits (800),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSA + DFGGVGDGKTLNTKAF  A+ NLS+Y+  GGA+LIVP GKWLTGS
Sbjct  45   DYPAINCRKHSAVLTDFGGVGDGKTLNTKAFNSAITNLSQYANDGGAQLIVPPGKWLTGS  104

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KD+V+LASQD + WP  P LPSYG GR+ S GR  SL+FG+NL DV+I
Sbjct  105  FNLTSHFTLFLQKDSVILASQDESEWPQFPVLPSYGSGRNASDGRFSSLVFGTNLTDVII  164

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WW +F   ++K TRPY+IEIM+SDQIQISNLTL+NSPSW VHPVYSS
Sbjct  165  TGNNGTIDGQGSYWWDKFHKGQMKITRPYMIEIMYSDQIQISNLTLINSPSWFVHPVYSS  224

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII GLTILAPV   NTDGI+PDS
Sbjct  225  NIIINGLTILAPVDIPNTDGIDPDS  249



>ref|XP_002869777.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46036.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   313 bits (801),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAIS RA+SAS+ +FG VGDG T NT AFR+A++ LS+++ +GG+ L VPAG+WLTGS
Sbjct  56   EYSAISCRAYSASLDEFGAVGDGVTSNTAAFRDAVSQLSRFADYGGSLLFVPAGRWLTGS  115

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLH+DAV+LASQ+ + + ++ PLPSYG GRDT GGR ISL+FGSNL DVVI
Sbjct  116  FNLTSHFTLFLHRDAVILASQEESDYEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVI  175

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F+  +LKYTRPYLIEIMHSD IQISNLT LNSPSW++HPVYS 
Sbjct  176  TGENGTIDGQGEPWWGKFKRGELKYTRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSR  235

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQ LTILAPV   NTDGINPDS
Sbjct  236  NIFIQSLTILAPVTVPNTDGINPDS  260



>ref|XP_003536450.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=476

 Score =   312 bits (799),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSA + DFGGVGDGKT NTKAF+ A++ LS+ ++ GGA+LIVP GKWLTGS
Sbjct  42   EYPAINCRKHSAVLTDFGGVGDGKTSNTKAFQSAISKLSRVASDGGAQLIVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LASQD + WP +P LPSYG GRD  GGR  SLIFG++L DVVI
Sbjct  102  FNLTSHFTLFLHKDAVILASQDESEWPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG+ WW +F   +L  TRPY+IEIM+SDQIQISNLTL+NSPSW VHP+YSS
Sbjct  162  TGHNGTIDGQGSYWWDKFHKNQLNLTRPYMIEIMYSDQIQISNLTLVNSPSWFVHPIYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI I+GLTILAPV S NTDGI+PDS
Sbjct  222  NITIKGLTILAPVDSPNTDGIDPDS  246



>emb|CDP12065.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYS+I+ R HSAS+ DFGGVGDG T NTKAF++A+N LS++ + GG+ L VP+GKWLTGS
Sbjct  43   EYSSINCREHSASLTDFGGVGDGTTSNTKAFQDAINYLSQFESEGGSILYVPSGKWLTGS  102

Query  435  FNLTS-HFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
            FN+TS HFTLFLH+DAVLLASQD + W ++ PLPSYG GRDT GGR IS IFG+NL DVV
Sbjct  103  FNITSDHFTLFLHQDAVLLASQDESEWTVIEPLPSYGRGRDTEGGRYISFIFGTNLTDVV  162

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQG  WW +F   +L+YTRPYLIE+++SD IQISNLTL+NSPSWN+HP YS
Sbjct  163  ITGDNGTIDGQGEPWWDKFHKGELQYTRPYLIELLYSDNIQISNLTLVNSPSWNIHPTYS  222

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SN+I+QG+TI APV S NTDGINPDS
Sbjct  223  SNVIVQGVTITAPVTSPNTDGINPDS  248



>ref|XP_008234902.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSA+S R HSA + DFG VGDGKT NTKAF+ A+++LS+ ++ GGA+LIVP GKWLTGS
Sbjct  38   KYSALSCRKHSALLTDFGAVGDGKTSNTKAFKAAIDHLSQCASDGGAQLIVPPGKWLTGS  97

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LA+QD + WPLV  LPSYG GRD  GGR  SLIFG+NL DVVI
Sbjct  98   FNLTSHFTLFLHKDAVILATQDESEWPLVSALPSYGRGRDAPGGRFSSLIFGTNLTDVVI  157

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW++F++ +L  TRPY+IEIM+S+QIQISNLTL+NSPSW VHP YSS
Sbjct  158  TGNNGTIDGQGASWWKKFKAGRLNETRPYMIEIMYSNQIQISNLTLVNSPSWFVHPTYSS  217

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI I GLTI AP+ S NTDGINPDS
Sbjct  218  NITIHGLTIHAPIDSPNTDGINPDS  242



>ref|XP_004234221.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=467

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S R H+A + DFGG GDGKT NTKAFR+A++ LSK++  GGA+LIVP GKWLTG 
Sbjct  33   EYEALSCRKHTALLTDFGGKGDGKTSNTKAFRKAIHELSKFATDGGAQLIVPPGKWLTGP  92

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTS FTL++HKDAVLL SQD   W L+PPLPSYG GRDT G R IS IFG+NL DVVI
Sbjct  93   FNLTSKFTLYIHKDAVLLVSQDEAEWDLIPPLPSYGVGRDTPGPRFISFIFGTNLTDVVI  152

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +FR  +LK TRPYLIEIM SD +QISNLTL+NSPSWNVHPVYSS
Sbjct  153  TGGNGTIDGQGQPWWTKFRQGQLKNTRPYLIEIMFSDHVQISNLTLINSPSWNVHPVYSS  212

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
             ++I+GLTILAPV S NTDGINPDS
Sbjct  213  VVVIKGLTILAPVDSPNTDGINPDS  237



>gb|AFW04075.1| polygalacturonase [Litchi chinensis]
Length=481

 Score =   311 bits (797),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            E+ A++ R HSA + DFGGVGDGKT NTKAFR A++ LSK ++ GGA L+VP GKWLTGS
Sbjct  45   EFLALNCRKHSAVLTDFGGVGDGKTSNTKAFRSAIDKLSKLASDGGAALVVPPGKWLTGS  104

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL++HKDAVLL SQ  + WP +P LPSYG GRD +GGR  SLIFG+NL DVV+
Sbjct  105  FNLTSHFTLYIHKDAVLLGSQVESEWPRLPVLPSYGRGRDAAGGRLSSLIFGTNLTDVVV  164

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQGA WW +F+  +L  TRPYLIEIM+S+Q+QISNLT +NSPSWNVHP+YSS
Sbjct  165  TGANGTIDGQGAYWWGKFKKNQLDVTRPYLIEIMYSNQVQISNLTFVNSPSWNVHPIYSS  224

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+IIQGLTILAPV S NTDGI+PDS
Sbjct  225  NVIIQGLTILAPVDSPNTDGIDPDS  249



>ref|XP_008376628.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=475

 Score =   311 bits (796),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAI+ R HSA + DFG VGDGKT NTKAF+ A+ +LS+ ++ GGA+LIVP G+WLTGS
Sbjct  36   EYSAINCRKHSALLTDFGAVGDGKTSNTKAFKAAVGHLSQLASDGGAQLIVPPGRWLTGS  95

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+L +QD + WP +P LPSYG GRD  GGR  SL+FG+NL DVVI
Sbjct  96   FNLTSHFTLFLHKDAVILGTQDESEWPHLPVLPSYGRGRDAPGGRFSSLVFGTNLTDVVI  155

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW +F+   L  TRPY+IEIM+S+QIQISNLTL+NSPSW VHP+YSS
Sbjct  156  TGNNGTIDGQGASWWAKFKQGHLTLTRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSS  215

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQGLTILAPV S NTDGI+PDS
Sbjct  216  NITIQGLTILAPVDSPNTDGIDPDS  240



>gb|AES62452.2| pectin lyase superfamily protein [Medicago truncatula]
Length=473

 Score =   310 bits (794),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSA + DFG VGDGKTLNTKAF  A+ NLS+Y+  GGA+LIVP GKWLTGS
Sbjct  39   DYPAINCRKHSAVLTDFGAVGDGKTLNTKAFNAAITNLSQYANDGGAQLIVPPGKWLTGS  98

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAV+L SQD + WP +  LPSYG GRD   GR  SLIFG+NL DV+I
Sbjct  99   FNLTSHFTLFLQKDAVILGSQDESEWPQLLVLPSYGRGRDAPAGRFSSLIFGTNLTDVII  158

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG+ WW +F  K+L  TRPY+IEIM+SDQIQISNLTL+NSP+W VHP+YSS
Sbjct  159  TGDNGTIDGQGSYWWDKFHKKQLTLTRPYMIEIMYSDQIQISNLTLINSPTWFVHPIYSS  218

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII GLTILAPV S NTDGINPDS
Sbjct  219  NIIINGLTILAPVDSPNTDGINPDS  243



>ref|XP_003592201.1| Polygalacturonase-like protein [Medicago truncatula]
Length=478

 Score =   310 bits (794),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSA + DFG VGDGKTLNTKAF  A+ NLS+Y+  GGA+LIVP GKWLTGS
Sbjct  44   DYPAINCRKHSAVLTDFGAVGDGKTLNTKAFNAAITNLSQYANDGGAQLIVPPGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAV+L SQD + WP +  LPSYG GRD   GR  SLIFG+NL DV+I
Sbjct  104  FNLTSHFTLFLQKDAVILGSQDESEWPQLLVLPSYGRGRDAPAGRFSSLIFGTNLTDVII  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG+ WW +F  K+L  TRPY+IEIM+SDQIQISNLTL+NSP+W VHP+YSS
Sbjct  164  TGDNGTIDGQGSYWWDKFHKKQLTLTRPYMIEIMYSDQIQISNLTLINSPTWFVHPIYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII GLTILAPV S NTDGINPDS
Sbjct  224  NIIINGLTILAPVDSPNTDGINPDS  248



>ref|XP_010941157.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=486

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLI-VPAGKWLTG  439
            +Y+A S RA++AS+KDFGGVGDGKT NTKAF+ A+ +L++++  GG  ++ VPAG+WLTG
Sbjct  51   QYAATSCRANTASLKDFGGVGDGKTSNTKAFQAAVAHLAQFAGDGGGGMLYVPAGRWLTG  110

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTS FTLFLH+DAV+LA+QDI+ WP++ PLPSYG GRD +GGR  SLI GSNL DV+
Sbjct  111  PFNLTSSFTLFLHRDAVILATQDISEWPVIDPLPSYGRGRDHAGGRYSSLIGGSNLTDVI  170

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQGA WWQQF   KLKYTR YLIE++HSDQI ISNLTLLNSP+WNVHPVYS
Sbjct  171  ITGDNGTIDGQGAFWWQQFHGGKLKYTRGYLIELLHSDQIFISNLTLLNSPAWNVHPVYS  230

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNIII G+TILAP+ S NTDGINPDS
Sbjct  231  SNIIISGITILAPLHSPNTDGINPDS  256



>gb|KHG19046.1| putative polygalacturonase [Gossypium arboreum]
Length=253

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            + +A  +R +SAS+ DFGGVGDG T NTKAF+ A++NLS Y+++GG+ L VP GKWLTGS
Sbjct  42   DSAAGCSRKYSASLADFGGVGDGVTSNTKAFQAAIDNLSLYASYGGSLLFVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL+LHKDA +LASQD + W ++ PLPSYG GRD  GGR ISLIFG+NL DVVI
Sbjct  102  FNLTSHFTLYLHKDATILASQDESEWAVIDPLPSYGRGRDADGGRYISLIFGTNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGT+DGQG  WW +F   +LKYTRPYLIEI +S  +QISNLTL+NSPSWNVHPVYSS
Sbjct  162  TGDNGTVDGQGVTWWDKFHKGELKYTRPYLIEIRYSQGVQISNLTLMNSPSWNVHPVYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINP  7
            N+++QG+TILAPV S NTDGINP
Sbjct  222  NVVVQGITILAPVTSPNTDGINP  244



>ref|XP_010276919.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=607

 Score =   313 bits (803),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -1

Query  624  SGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWL  445
            S  EY AI+ R HSAS+ DFG VGDG T+NTKAF+ A+N+LS++S+ GGA+LIVP GKWL
Sbjct  28   SQLEYQAINCRKHSASLTDFGAVGDGTTVNTKAFQAAINHLSQFSSDGGAQLIVPPGKWL  87

Query  444  TGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVD  265
            TGSFNLTSHFTL+L KDA +L S D + +P++ PLPSYG GRD  GGR ISLIFG+NL D
Sbjct  88   TGSFNLTSHFTLYLQKDATILGSVDESEYPIIDPLPSYGRGRDAPGGRYISLIFGTNLTD  147

Query  264  VVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPV  85
            VVITG+NGTIDGQG  WW +F  KK+K TRPYLIEI++SDQ+QISNLTL+NSPSWNVHP 
Sbjct  148  VVITGDNGTIDGQGEHWWGKFHQKKIKNTRPYLIEILYSDQVQISNLTLVNSPSWNVHPT  207

Query  84   YSSNIIIQGLTILAPVKSANTDGINPDS  1
            Y SN+IIQG+TILAPV S NTDGI+PDS
Sbjct  208  YCSNVIIQGITILAPVNSPNTDGIDPDS  235



>ref|XP_002303605.2| hypothetical protein POPTR_0003s13160g [Populus trichocarpa]
 gb|EEE78584.2| hypothetical protein POPTR_0003s13160g [Populus trichocarpa]
Length=479

 Score =   309 bits (791),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+A+S R HSAS+ DFGGVGDG T+NT+AF+ A+++LS++S+ GG+ L VP G+W TGS
Sbjct  42   EYAAVSCRVHSASVSDFGGVGDGTTVNTEAFQAAIDHLSQFSSEGGSLLYVPPGRWSTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTS+FTL+L KDAVLL SQD + +PL+ PLPSYG GRD  G R  SLIFG+NL DVVI
Sbjct  102  FNLTSYFTLYLDKDAVLLGSQDESEYPLIEPLPSYGRGRDADGARFSSLIFGNNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWW +FR+ +L +TRPYLIEIM S  IQISNLTL+NSPSWNVHPVY S
Sbjct  162  TGANGTIDGQGELWWTKFRAGELNHTRPYLIEIMFSTNIQISNLTLINSPSWNVHPVYCS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QGLTILAPV+S NTDGINPDS
Sbjct  222  NVVVQGLTILAPVRSPNTDGINPDS  246



>ref|XP_011029346.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=481

 Score =   309 bits (791),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            E +A S RAHSAS+ DFG VGDGKT NTKAF+ A+++LS++S+ GG+ L VP G+WLTGS
Sbjct  42   ENAASSCRAHSASVSDFGAVGDGKTANTKAFQAAIDHLSQFSSKGGSILYVPPGRWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTS+FTL+L KDAVLLASQD + +PL+ PLPSYG GRD  G R  SLIFG+NL DV++
Sbjct  102  FNLTSYFTLYLDKDAVLLASQDESEYPLIEPLPSYGRGRDADGARYSSLIFGNNLTDVIV  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWW +FR+ +L YTRPYLIEIM S  IQISNLTL+NSPSWNVHPVY S
Sbjct  162  TGANGTIDGQGELWWTKFRAGELNYTRPYLIEIMFSTNIQISNLTLINSPSWNVHPVYCS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+++QGLTILAPV+S NTDGINPDS
Sbjct  222  NVVVQGLTILAPVRSPNTDGINPDS  246



>ref|XP_011035342.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=475

 Score =   309 bits (791),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 172/207 (83%), Gaps = 2/207 (1%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSA + DFG VGDGKT NTKAF EA+  LSKY+  GGA+LIVPAGKWLTGS
Sbjct  41   EYKAINCRKHSAVLTDFGAVGDGKTSNTKAFEEAIKKLSKYAPDGGAQLIVPAGKWLTGS  100

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNLVDVV  259
            FNLTSHFTLFLHKDAVLLASQD + WPL+ PLPSYG  R+ +  GR   LIF SN+ DV+
Sbjct  101  FNLTSHFTLFLHKDAVLLASQDEDEWPLLTPLPSYGGVRENAAFGRPGGLIFASNVTDVI  160

Query  258  ITGNNGTIDGQGALWWQQFRSKKL-KYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVY  82
            ITGNNGT+DGQGA+WW++F  KKL K  RPYLIEIM+SDQ+QISN+TL+NSP W+VHP+Y
Sbjct  161  ITGNNGTVDGQGAVWWEKFTEKKLKKLERPYLIEIMYSDQVQISNITLINSPQWHVHPIY  220

Query  81   SSNIIIQGLTILAPVKSANTDGINPDS  1
            SSN+ IQG+TILAPV   NTDGINPDS
Sbjct  221  SSNLWIQGVTILAPVDVPNTDGINPDS  247



>gb|KHG23155.1| putative polygalacturonase [Gossypium arboreum]
Length=449

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  609  SAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFN  430
            + + +R +SAS+ DFGGVGDG T NTKAF+ A+ NLS+Y++ GG+ L VP GKWLTG+FN
Sbjct  27   NGVESRKYSASLIDFGGVGDGVTSNTKAFQAAIFNLSQYASDGGSLLFVPPGKWLTGNFN  86

Query  429  LTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITG  250
            LTSHFTL +HKDA LLASQD + W ++ PLPSYG GRD  GGR ISLIFG+NL DVVITG
Sbjct  87   LTSHFTLHIHKDATLLASQDQSEWAVIDPLPSYGRGRDADGGRYISLIFGTNLTDVVITG  146

Query  249  NNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNI  70
            +NGTIDGQG  WW +F   +LKYTRPYLIEIM+S+++QISNLTL+NSPSWNVHPVYSSN+
Sbjct  147  DNGTIDGQGVTWWNKFHKGELKYTRPYLIEIMYSNEVQISNLTLMNSPSWNVHPVYSSNV  206

Query  69   IIQGLTILAPVKSANTDGINPDS  1
            ++QGLTILAPV S NTDGINPDS
Sbjct  207  VVQGLTILAPVTSPNTDGINPDS  229



>dbj|BAD67712.1| putative polygalacturonase [Oryza sativa Japonica Group]
 gb|EAY99340.1| hypothetical protein OsI_21311 [Oryza sativa Indica Group]
 gb|EAZ35554.1| hypothetical protein OsJ_19837 [Oryza sativa Japonica Group]
Length=485

 Score =   309 bits (791),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 170/206 (83%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGG--AKLIVPAGKWLTG  439
            Y A S RAH+AS+ DFGGVGDG T NT AF+ A+++LS+YS  GG  A L VPAGKWLTG
Sbjct  48   YLAPSCRAHTASLTDFGGVGDGTTSNTAAFKSAVDHLSQYSGEGGGGAMLYVPAGKWLTG  107

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTLFLH DAV+L SQD+  WP++ PLPSYG GRD +GGR  SLI GSNL DVV
Sbjct  108  PFNLTSHFTLFLHSDAVILGSQDMGEWPIIDPLPSYGRGRDKAGGRYASLIGGSNLTDVV  167

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG NGTIDGQGA+WW +F S KLKYTR YLIE+MHSD + ISN+TL+NSP+WN+HPVYS
Sbjct  168  ITGANGTIDGQGAMWWSKFHSNKLKYTRGYLIEVMHSDTVVISNVTLVNSPAWNIHPVYS  227

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI++QG+TILAP  S NTDGINPDS
Sbjct  228  SNIVVQGVTILAPTHSPNTDGINPDS  253



>gb|KDO86268.1| hypothetical protein CISIN_1g0090752mg, partial [Citrus sinensis]
Length=284

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY+AIS RAHSASI DFGGVGDGKT NTKAF++A+N LS+YS+ GGA+L VPAGKWLTGS
Sbjct  106  EYNAISCRAHSASITDFGGVGDGKTSNTKAFKDAINQLSQYSSDGGAQLYVPAGKWLTGS  165

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNL SHFTL+LHKDA LLASQD+N WP++ PLPSYG GRD + GR  SLIFG+NL DV++
Sbjct  166  FNLISHFTLYLHKDAFLLASQDLNEWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVIV  225

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            TG+NGTIDGQGALWWQQF   KLKYTRPYL+E M++D IQIS+LTLLNSPSWNVHPVYS
Sbjct  226  TGDNGTIDGQGALWWQQFHKGKLKYTRPYLMEFMYTDNIQISSLTLLNSPSWNVHPVYS  284



>ref|XP_003624874.1| hypothetical protein MTR_7g088550 [Medicago truncatula]
 gb|AES81092.1| pectin lyase superfamily protein [Medicago truncatula]
Length=476

 Score =   308 bits (789),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSA + DFGGVGDGKT NTKAF  A+  LS+Y+  GGA+LIVP GKWLTGS
Sbjct  39   DYLAINCRKHSAVLTDFGGVGDGKTSNTKAFNTAITKLSQYANDGGAQLIVPPGKWLTGS  98

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL K AV+L SQD + WP +PPLPSYG GRD  G R  SLIFG++L DV+I
Sbjct  99   FNLTSHFTLFLQKGAVILGSQDESQWPQLPPLPSYGRGRDAPGPRFSSLIFGTHLTDVII  158

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WW +F +K+LK TRPY+IEI++SDQIQISNLTL+NSPSW VHP YSS
Sbjct  159  TGNNGTIDGQGSYWWDKFHNKQLKITRPYMIEILYSDQIQISNLTLINSPSWFVHPTYSS  218

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII+GLTILAPV S NTDGI+PDS
Sbjct  219  NIIIKGLTILAPVDSPNTDGIDPDS  243



>ref|XP_003624048.1| Polygalacturonase [Medicago truncatula]
 gb|AES80266.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=483

 Score =   308 bits (789),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            Y+ I+ RAHSAS+ DFGGVGDG T NTKAF+ A+++LS+Y + GG++L VPAGKWLTGSF
Sbjct  45   YNGINCRAHSASLTDFGGVGDGNTSNTKAFQSAISHLSQYGSQGGSQLYVPAGKWLTGSF  104

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            +LTSHFTL+L +DAVLLASQDI  WP++ PLPSYG GRD   GR  SLIFG+NL DV++T
Sbjct  105  SLTSHFTLYLDRDAVLLASQDITEWPVLEPLPSYGRGRDAPAGRFRSLIFGTNLTDVIVT  164

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G NGTIDGQGA WWQQF  KKLKYTRPYLIE+M SD IQISNLTLLNSPSWNVHPVYSSN
Sbjct  165  GGNGTIDGQGAFWWQQFHRKKLKYTRPYLIELMFSDSIQISNLTLLNSPSWNVHPVYSSN  224

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            IIIQG+TI+AP+ S NTDGINPDS
Sbjct  225  IIIQGITIIAPISSPNTDGINPDS  248



>ref|XP_002305262.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|EEE85773.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=437

 Score =   306 bits (785),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 172/207 (83%), Gaps = 2/207 (1%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSA + DFG VGDGKT NTKAF EA+  LSKY+  GGA+LIVPAGKWLTGS
Sbjct  3    EYKAINCRKHSAVLTDFGAVGDGKTSNTKAFAEAIKKLSKYAPDGGAQLIVPAGKWLTGS  62

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNLVDVV  259
            FNLTSHFTLFLHKDAVLLASQD + WPL+ PLPSYG  R+ +  GR   LIF SN+ DV+
Sbjct  63   FNLTSHFTLFLHKDAVLLASQDEDEWPLLTPLPSYGGVRENAVFGRPGGLIFASNVTDVI  122

Query  258  ITGNNGTIDGQGALWWQQFRSKKL-KYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVY  82
            ITGNNGT+DGQGA+WW++F  KKL K  RPYLIEIM+SDQ+QISN+TL+NSP W+VHP+Y
Sbjct  123  ITGNNGTVDGQGAVWWEKFNEKKLKKLERPYLIEIMYSDQVQISNITLINSPQWHVHPIY  182

Query  81   SSNIIIQGLTILAPVKSANTDGINPDS  1
            SSN+ IQG+TILAPV   NTDGINPDS
Sbjct  183  SSNLWIQGVTILAPVDVPNTDGINPDS  209



>gb|KDP22229.1| hypothetical protein JCGZ_26060 [Jatropha curcas]
Length=467

 Score =   307 bits (786),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  624  SGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWL  445
            S   Y AIS R HSA + DFGGVGDGKT NTKAF  A+ NLS+Y++ GGA+LIVP GKWL
Sbjct  34   SNNHYLAISCRKHSALLTDFGGVGDGKTSNTKAFHSAIANLSQYASDGGAQLIVPPGKWL  93

Query  444  TGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVD  265
            TG+FN+TSHFTL+L K+A+LLASQD   WP++ PLPSYG GRD  GGR  SLIFG++L D
Sbjct  94   TGAFNVTSHFTLYLQKNALLLASQDEAEWPVLAPLPSYGRGRDKPGGRFSSLIFGTHLTD  153

Query  264  VVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPV  85
            VVITGNNGTIDGQGA WW++F   +LK TRPYLIE ++S+QIQIS++TL+NSPSWNVHP 
Sbjct  154  VVITGNNGTIDGQGATWWKKFHKGQLKITRPYLIEFLYSNQIQISHITLINSPSWNVHPT  213

Query  84   YSSNIIIQGLTILAPVKSANTDGINPDS  1
            YSSN++IQ LTILAPV S NTDGINPDS
Sbjct  214  YSSNVLIQRLTILAPVDSPNTDGINPDS  241



>ref|XP_003535598.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=475

 Score =   307 bits (787),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSA + DFGGVGDGKT NTKAF+ A+  L +Y++ GGA+LIVP GKWLTG 
Sbjct  41   EYYAINCRKHSAVLTDFGGVGDGKTSNTKAFQSAIRKLGQYASDGGAQLIVPPGKWLTGP  100

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LASQ  + WP +P LPSYG GRD  GGR  SLIFG++L DVVI
Sbjct  101  FNLTSHFTLFLHKDAVILASQVESEWPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVI  160

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG+ WW +F   +L  TRPY+IEIM+SDQIQISNLTL+NSPSW VHP+YSS
Sbjct  161  TGHNGTIDGQGSYWWDKFHKNQLNLTRPYMIEIMYSDQIQISNLTLVNSPSWFVHPIYSS  220

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI I+GLTILAPV S NTDGI+PDS
Sbjct  221  NITIKGLTILAPVDSPNTDGIDPDS  245



>gb|KHN21784.1| Putative polygalacturonase [Glycine soja]
Length=472

 Score =   306 bits (785),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSA + DFGGVGDGKT NTKAF+ A+  L +Y++ GGA+LIVP GKWLTG 
Sbjct  38   EYYAINCRKHSAVLTDFGGVGDGKTSNTKAFQSAIRKLGQYASDGGAQLIVPPGKWLTGP  97

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LASQ  + WP +P LPSYG GRD  GGR  SLIFG++L DVVI
Sbjct  98   FNLTSHFTLFLHKDAVILASQVESEWPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVI  157

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG+ WW +F   +L  TRPY+IEIM+SDQIQISNLTL+NSPSW VHP+YSS
Sbjct  158  TGHNGTIDGQGSYWWDKFHKNQLNLTRPYMIEIMYSDQIQISNLTLVNSPSWFVHPIYSS  217

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI I+GLTILAPV S NTDGI+PDS
Sbjct  218  NITIKGLTILAPVDSPNTDGIDPDS  242



>gb|AFK43011.1| unknown [Medicago truncatula]
Length=483

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            Y+ I+ RAHSAS+ DFGGVGDG T NTKAF+ A+++LS+Y + GG++L VPAGKWLTGSF
Sbjct  45   YNGINCRAHSASLTDFGGVGDGNTSNTKAFQSAISHLSQYGSQGGSQLYVPAGKWLTGSF  104

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            +LTSHFTL+L +DAVLLASQDI  WP++ PLPSYG GRD   GR  SLIFG+NL DV++T
Sbjct  105  SLTSHFTLYLDRDAVLLASQDITEWPVLEPLPSYGRGRDAPAGRFRSLIFGTNLTDVIVT  164

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G NGTIDGQGA WWQQF  K+LKYTRPYLIE+M SD IQISNLTLLNSPSWNVHPVYSSN
Sbjct  165  GGNGTIDGQGAFWWQQFHRKELKYTRPYLIELMFSDSIQISNLTLLNSPSWNVHPVYSSN  224

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            IIIQG+TI+AP+ S NTDGINPDS
Sbjct  225  IIIQGITIIAPISSPNTDGINPDS  248



>ref|XP_007040335.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007040336.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY24836.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY24837.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=467

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = -1

Query  600  SNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLTS  421
             +R +SAS+ DFGGVGDG + NTKAF+ A++NLS+Y++ GG+ L VP GKWLTGSFNLTS
Sbjct  48   CSRKYSASLADFGGVGDGVSSNTKAFQAAIDNLSQYASDGGSLLFVPPGKWLTGSFNLTS  107

Query  420  HFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNNG  241
            HFTL+LHKDA LLASQD + W ++ PLPSYG GRD  GGR ISLIFG+NL DVV+TG+NG
Sbjct  108  HFTLYLHKDATLLASQDESEWAVIDPLPSYGRGRDAVGGRYISLIFGTNLTDVVVTGDNG  167

Query  240  TIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIIIQ  61
            TI GQG  WW +F   +LKYTRPYLIEIM+SDQ+QIS+LTL++SPSWNVHP+YSSN+++Q
Sbjct  168  TIHGQGTTWWDKFHKGELKYTRPYLIEIMYSDQVQISSLTLMDSPSWNVHPIYSSNVVVQ  227

Query  60   GLTILAPVKSANTDGINPDS  1
            GLTI+APV S NTDGINPDS
Sbjct  228  GLTIVAPVTSPNTDGINPDS  247



>ref|XP_003533980.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=476

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS R HSA + DFGGVGDGKT NTKAF+ A++NLS Y++ GGA L+VP GKWLTGS
Sbjct  42   EYPAISCRKHSAVLTDFGGVGDGKTSNTKAFQYAISNLSHYASDGGALLVVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL K+A +L SQD + WP +P LPSYG GRD   GR  SLIFG+NL DVVI
Sbjct  102  FNLTSHFTLFLQKEATILGSQDESEWPTLPVLPSYGRGRDAPDGRFSSLIFGTNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG+ WW +F   +LK TRPY+IEIM SD IQISNLTL++SPSW VHP+YSS
Sbjct  162  TGYNGTIDGQGSYWWDKFHKGELKLTRPYMIEIMFSDHIQISNLTLIDSPSWFVHPIYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            +IIIQGLTILAPV S NTDGINPDS
Sbjct  222  DIIIQGLTILAPVDSPNTDGINPDS  246



>gb|KHN42438.1| Putative polygalacturonase, partial [Glycine soja]
Length=462

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS R HSA + DFGGVGDGKT NTKAF+ A++NLS Y++ GGA L+VP GKWLTGS
Sbjct  28   EYPAISCRKHSAVLTDFGGVGDGKTSNTKAFQYAISNLSHYASDGGALLVVPPGKWLTGS  87

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL K+A +L SQD + WP +P LPSYG GRD   GR  SLIFG+NL DVVI
Sbjct  88   FNLTSHFTLFLQKEATILGSQDESEWPTLPVLPSYGRGRDAPDGRFSSLIFGTNLTDVVI  147

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG+ WW +F   +LK TRPY+IEIM SD IQISNLTL++SPSW VHP+YSS
Sbjct  148  TGYNGTIDGQGSYWWDKFHKGELKLTRPYMIEIMFSDHIQISNLTLIDSPSWFVHPIYSS  207

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            +IIIQGLTILAPV S NTDGINPDS
Sbjct  208  DIIIQGLTILAPVDSPNTDGINPDS  232



>ref|XP_009772512.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=473

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R H+A + DFGG GDG T NT+AFR A++ LSK++  GGA+LIVP GKWLTG 
Sbjct  40   DYEAINCRKHTAFLTDFGGKGDGYTSNTEAFRRAISELSKFATDGGAQLIVPPGKWLTGP  99

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTS+FTL++H+DAV+LASQD   W L+PPLPSYG GRD +G R ISLIFG+NL DVVI
Sbjct  100  FNLTSNFTLYIHQDAVILASQDEAEWDLIPPLPSYGRGRDAAGPRFISLIFGTNLTDVVI  159

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +FR  +L YTRPYLIEIM SD +QISNLTL+NSPSWNVHPVYSS
Sbjct  160  TGGNGTIDGQGQQWWTKFRQGQLTYTRPYLIEIMFSDHVQISNLTLINSPSWNVHPVYSS  219

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
             ++I+GLTILAP  S NTDGI+PDS
Sbjct  220  FVVIKGLTILAPTDSPNTDGIDPDS  244



>ref|XP_009377556.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
 ref|XP_009377601.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=471

 Score =   306 bits (783),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSAI+ R HSA + DFG VGDG+T NTKAF+EA+ +LS+ +  GGA+LIVP G+WLTGS
Sbjct  35   KYSAINCRKHSALLTDFGAVGDGETSNTKAFKEAVGHLSQLAYDGGAQLIVPPGRWLTGS  94

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LA+QD + WP +P LPSYG GRD  G R  SLIFG+NL DVVI
Sbjct  95   FNLTSHFTLFLHKDAVILATQDESEWPHLPALPSYGKGRDGPGERFSSLIFGTNLTDVVI  154

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGA WW +F+   L  TRPY+IE+M+SDQIQISNLTL+NSPSW VHP+YSS
Sbjct  155  TGHNGTIDGQGASWWAKFKQGLLNSTRPYVIELMYSDQIQISNLTLVNSPSWFVHPIYSS  214

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQGLTILAP++  NTDGINPDS
Sbjct  215  NITIQGLTILAPIEVPNTDGINPDS  239



>ref|XP_010105745.1| putative polygalacturonase [Morus notabilis]
 gb|EXC05965.1| putative polygalacturonase [Morus notabilis]
Length=459

 Score =   305 bits (780),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = -1

Query  606  AISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNL  427
            A   R HSA + DFGGVGDGKT NTKAF+ A+++LS++++ GGA+LIVP GKWLTGSFNL
Sbjct  30   AKCGRKHSAVLTDFGGVGDGKTSNTKAFKAAIDHLSQFASDGGAELIVPPGKWLTGSFNL  89

Query  426  TSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGN  247
            TSHFTLFLHKDAV+L SQD + WPLV  LPSYG GRD    R  SLI+G+NL DVVITGN
Sbjct  90   TSHFTLFLHKDAVILGSQDESEWPLVALLPSYGKGRDAPNARFSSLIYGTNLTDVVITGN  149

Query  246  NGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNII  67
            NGTIDGQGA WW +FR+ +L  TRPY+IEI+HSDQIQI NLTL+NSPSW VHP+YSSNII
Sbjct  150  NGTIDGQGAPWWTKFRAGQLNATRPYMIEILHSDQIQIFNLTLINSPSWFVHPIYSSNII  209

Query  66   IQGLTILAPVKSANTDGINPDS  1
            ++GLTI+APV S NTDGI+PDS
Sbjct  210  VKGLTIVAPVTSPNTDGIDPDS  231



>ref|NP_001240215.1| uncharacterized protein LOC100785005 precursor [Glycine max]
 gb|ACU17976.1| unknown [Glycine max]
Length=477

 Score =   305 bits (780),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS R HSA + DFGGVGDGKT NTKAF+ A++NLS Y++ GGA L+VP GKWLTGS
Sbjct  42   EYPAISCRKHSAVLTDFGGVGDGKTSNTKAFQYAISNLSHYASDGGALLVVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL K+A +L SQD + WP +P LPSYG GRD   GR  SLIFG+NL DV+I
Sbjct  102  FNLTSHFTLFLQKEATILGSQDESEWPTLPVLPSYGRGRDAPDGRFSSLIFGTNLTDVII  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +F   +LK TRPY+IEIM SD IQISNLTL+NSPSW VHP+Y+S
Sbjct  162  TGYNGTIDGQGCYWWDKFHKGELKLTRPYMIEIMFSDHIQISNLTLINSPSWFVHPIYTS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            +IIIQGLTILAPV S NTDGI+PDS
Sbjct  222  DIIIQGLTILAPVDSPNTDGIDPDS  246



>ref|XP_004964293.1| PREDICTED: probable polygalacturonase-like isoform X1 [Setaria 
italica]
Length=486

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 170/206 (83%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGG--AKLIVPAGKWLTG  439
            Y A S RAH+AS+ DFGGVGDG T NT AFR A+++LS+YS  GG  A L VPAGKWLTG
Sbjct  45   YLAPSCRAHTASLADFGGVGDGTTSNTAAFRSAVDHLSQYSGEGGGGAMLYVPAGKWLTG  104

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTLFLH DAV+L SQ+I+ WP++ PLPSYG GRD  GGR  SLI GSNL DVV
Sbjct  105  PFNLTSHFTLFLHSDAVILGSQNISEWPVIAPLPSYGRGRDKIGGRYASLIGGSNLTDVV  164

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITGNNGTIDGQGA+WW +F   KLKYTR YL+E+M SD I ISN+TL+NSP+WN+HPVYS
Sbjct  165  ITGNNGTIDGQGAMWWSKFHQNKLKYTRGYLVELMWSDTIFISNVTLVNSPAWNIHPVYS  224

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI++QG+TILAP +S NTDGINPDS
Sbjct  225  SNIVVQGVTILAPTRSPNTDGINPDS  250



>ref|XP_008380132.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=474

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSAI+ R HSA + DFG VGDG+T NTKAF+ A+ +LS+ ++ GGA+LIVP G+WLTGS
Sbjct  35   KYSAINCRKHSALLTDFGAVGDGETSNTKAFKAAVGHLSQLASDGGAQLIVPPGRWLTGS  94

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LA+QD + WP +P LPSYG GRD  G R  SLIFG+NL DVVI
Sbjct  95   FNLTSHFTLFLHKDAVILATQDESEWPHLPALPSYGKGRDGPGERFSSLIFGTNLTDVVI  154

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGA WW +F+   L  TRPY+IE+M+SDQIQISNLTL+NSPSW VHP+YSS
Sbjct  155  TGHNGTIDGQGASWWAKFKQGLLNSTRPYVIELMYSDQIQISNLTLVNSPSWFVHPIYSS  214

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQGLTILAP++  NTDGINPDS
Sbjct  215  NITIQGLTILAPIEVPNTDGINPDS  239



>ref|XP_004964294.1| PREDICTED: probable polygalacturonase-like isoform X2 [Setaria 
italica]
Length=485

 Score =   305 bits (780),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 170/206 (83%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGG--AKLIVPAGKWLTG  439
            Y A S RAH+AS+ DFGGVGDG T NT AFR A+++LS+YS  GG  A L VPAGKWLTG
Sbjct  44   YLAPSCRAHTASLADFGGVGDGTTSNTAAFRSAVDHLSQYSGEGGGGAMLYVPAGKWLTG  103

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTLFLH DAV+L SQ+I+ WP++ PLPSYG GRD  GGR  SLI GSNL DVV
Sbjct  104  PFNLTSHFTLFLHSDAVILGSQNISEWPVIAPLPSYGRGRDKIGGRYASLIGGSNLTDVV  163

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITGNNGTIDGQGA+WW +F   KLKYTR YL+E+M SD I ISN+TL+NSP+WN+HPVYS
Sbjct  164  ITGNNGTIDGQGAMWWSKFHQNKLKYTRGYLVELMWSDTIFISNVTLVNSPAWNIHPVYS  223

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI++QG+TILAP +S NTDGINPDS
Sbjct  224  SNIVVQGVTILAPTRSPNTDGINPDS  249



>ref|XP_009607671.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=472

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R H+A + DFGG GDG T NT+AFR A++ LSK++  GGA+LIVP GKWLTG 
Sbjct  39   DYEAINCRKHTAFLTDFGGKGDGYTSNTEAFRRAISELSKFATDGGAQLIVPPGKWLTGP  98

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTS FTL++H+DAV+LASQD   W L+PPLPSYG GRD +G R ISLIFG+NL DVVI
Sbjct  99   FNLTSSFTLYIHQDAVILASQDEAEWDLIPPLPSYGRGRDAAGPRFISLIFGTNLTDVVI  158

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW +FR  +L YTRPYLIEIM SD +QISNLTL+NSPSWNVHPVYSS
Sbjct  159  TGGNGTIDGQGQQWWTKFRQGQLNYTRPYLIEIMFSDHVQISNLTLINSPSWNVHPVYSS  218

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
             ++++GLTILAP  S NTDGI+PDS
Sbjct  219  FVVMKGLTILAPTDSPNTDGIDPDS  243



>ref|XP_004964295.1| PREDICTED: probable polygalacturonase-like isoform X3 [Setaria 
italica]
Length=507

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 170/206 (83%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGG--AKLIVPAGKWLTG  439
            Y A S RAH+AS+ DFGGVGDG T NT AFR A+++LS+YS  GG  A L VPAGKWLTG
Sbjct  66   YLAPSCRAHTASLADFGGVGDGTTSNTAAFRSAVDHLSQYSGEGGGGAMLYVPAGKWLTG  125

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTLFLH DAV+L SQ+I+ WP++ PLPSYG GRD  GGR  SLI GSNL DVV
Sbjct  126  PFNLTSHFTLFLHSDAVILGSQNISEWPVIAPLPSYGRGRDKIGGRYASLIGGSNLTDVV  185

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITGNNGTIDGQGA+WW +F   KLKYTR YL+E+M SD I ISN+TL+NSP+WN+HPVYS
Sbjct  186  ITGNNGTIDGQGAMWWSKFHQNKLKYTRGYLVELMWSDTIFISNVTLVNSPAWNIHPVYS  245

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI++QG+TILAP +S NTDGINPDS
Sbjct  246  SNIVVQGVTILAPTRSPNTDGINPDS  271



>ref|XP_009375527.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=471

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSAI+ R HSA + DFG VGDG+T NTKAF+ A+ +LS+ +  GGA+LIVP G+WLTGS
Sbjct  35   KYSAINCRKHSALLTDFGAVGDGETSNTKAFKAAVGHLSQLAYDGGAQLIVPPGRWLTGS  94

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+LA+QD + WP +P LPSYG GRD  G R  SLIFG+NL DVVI
Sbjct  95   FNLTSHFTLFLHKDAVILATQDESEWPHLPALPSYGKGRDGPGERFSSLIFGTNLTDVVI  154

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQGA WW +F+   L  TRPY+IE+M+SDQIQISNLTL+NSPSW VHP+YSS
Sbjct  155  TGHNGTIDGQGASWWAKFKQGLLNSTRPYVIELMYSDQIQISNLTLVNSPSWFVHPIYSS  214

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NI IQGLTILAP++  NTDGINPDS
Sbjct  215  NITIQGLTILAPIEVPNTDGINPDS  239



>gb|KHG19694.1| putative polygalacturonase [Gossypium arboreum]
Length=474

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            + A++ R HSA + DFGG+GDGKT NTKAF  A+ NLS+ +  GGA+LIVP GKWLTGSF
Sbjct  42   FRALNCRKHSAVLTDFGGIGDGKTSNTKAFEAAIMNLSQVAPDGGAQLIVPPGKWLTGSF  101

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLF+HKDAV+L SQD + WP V  LPSYG GRD   GR  SLIFG+NL DVVIT
Sbjct  102  NLTSHFTLFVHKDAVILGSQDESEWPPVALLPSYGRGRDAPSGRLSSLIFGTNLTDVVIT  161

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            GNNGTIDGQG+ WW+ FR  K+  TRPY+IEIM+S Q+QISNLTL+NSPSWNVHP+YSS+
Sbjct  162  GNNGTIDGQGSYWWKLFRDNKMTVTRPYMIEIMYSKQVQISNLTLVNSPSWNVHPIYSSD  221

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            IIIQ LT+ APV S NTDGI+PDS
Sbjct  222  IIIQHLTVFAPVDSPNTDGIDPDS  245



>ref|XP_007151452.1| hypothetical protein PHAVU_004G047700g [Phaseolus vulgaris]
 gb|ESW23446.1| hypothetical protein PHAVU_004G047700g [Phaseolus vulgaris]
Length=455

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAI+ R HSA++ DFGGVGDGKT NTK F  A+ NL+++++ GGA LIVP+GKWLTG 
Sbjct  45   EYSAINCRKHSATLTDFGGVGDGKTSNTKIFATAIANLTQHASDGGATLIVPSGKWLTGP  104

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL KDAV+LASQD   WP V  LPSYG GRD   GR  SLIFG NL DVVI
Sbjct  105  FNLTSHFTLFLQKDAVILASQDEKEWPSVALLPSYGKGRDAPDGRFSSLIFGYNLTDVVI  164

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGT+DGQG+ WW +F+ K+   TRPY+IEIM SDQIQISN+TL+NSPSW VHP+YSS
Sbjct  165  TGQNGTLDGQGSYWWVKFKKKEFTLTRPYMIEIMFSDQIQISNITLINSPSWFVHPIYSS  224

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+ GLTILAP+ S NTDG+NPDS
Sbjct  225  NIIVSGLTILAPIDSPNTDGVNPDS  249



>ref|XP_006656549.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=479

 Score =   303 bits (777),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGG--AKLIVPAGKWLTG  439
            Y A S RAH+AS+ DFGGVGDG T NT AF+ A+++LS+YS  GG  A L VPAGKWLTG
Sbjct  44   YLAPSCRAHTASLTDFGGVGDGTTSNTAAFKSAVDHLSQYSGEGGGGAMLYVPAGKWLTG  103

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTLFLH DAV+L SQD+  WP++ PLPSYG GRD  GGR  SLI GSNL DVV
Sbjct  104  PFNLTSHFTLFLHSDAVILGSQDMAEWPIIDPLPSYGRGRDKIGGRDASLIGGSNLTDVV  163

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG NGTIDGQGA+WW +F   KLKYTR YLIE+MHSD + I+N+TL+NSP+WN+HPVYS
Sbjct  164  ITGANGTIDGQGAMWWSKFHQNKLKYTRGYLIEVMHSDTVVIANVTLVNSPAWNIHPVYS  223

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SN+++QG+TILAP  S NTDGINPDS
Sbjct  224  SNVVVQGVTILAPTHSPNTDGINPDS  249



>ref|XP_007151453.1| hypothetical protein PHAVU_004G047800g [Phaseolus vulgaris]
 gb|ESW23447.1| hypothetical protein PHAVU_004G047800g [Phaseolus vulgaris]
Length=476

 Score =   303 bits (776),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSAS+ DFGGVGDGKT NTKAF+ A+  LS++++ GGA LIVP GKWLTG 
Sbjct  46   EYPAINCRKHSASLTDFGGVGDGKTSNTKAFQSAITKLSQHASDGGATLIVPPGKWLTGP  105

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL K AV+LASQ+   WP +  LPSYG GRD  GGR  SLIFG+NL DVVI
Sbjct  106  FNLTSHFTLFLQKGAVILASQNELEWPHLAILPSYGRGRDAPGGRFSSLIFGTNLTDVVI  165

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG+ WW +F  K+L  TRPY+IEIM+SDQIQISNLTL+NSP+W VHP+YSS
Sbjct  166  TGQNGTIDGQGSYWWDKFHKKQLTLTRPYMIEIMYSDQIQISNLTLVNSPTWFVHPIYSS  225

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NII+ GLTILAPV S NTDG+NPDS
Sbjct  226  NIIVSGLTILAPVDSPNTDGVNPDS  250



>ref|XP_010519488.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
 ref|XP_010519489.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
 ref|XP_010519491.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=468

 Score =   302 bits (774),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 171/209 (82%), Gaps = 0/209 (0%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKW  448
            ++G EYSA++ R H+A I DFG VGDGKT NTKAFREA++ L + +A GG++L++P GKW
Sbjct  33   TAGVEYSALNCRKHTAVITDFGAVGDGKTSNTKAFREAISKLGQRAADGGSQLVIPQGKW  92

Query  447  LTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLV  268
            LTGSFNLTSHFTLF+ K A +LASQD + WP+V PLPSYG GRD  G R  SLIFG+NL 
Sbjct  93   LTGSFNLTSHFTLFIQKGATILASQDESEWPVVAPLPSYGRGRDAPGPRFSSLIFGTNLT  152

Query  267  DVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHP  88
            DVVITGNNGTIDGQG  WW ++R  + K TRPY+IE++ SD +QIS++TL++SPSWNVHP
Sbjct  153  DVVITGNNGTIDGQGKYWWVKYRKGEFKLTRPYMIEVLFSDNVQISDITLIDSPSWNVHP  212

Query  87   VYSSNIIIQGLTILAPVKSANTDGINPDS  1
            VY  N+I++GLTILAP+ S NTDGI+PDS
Sbjct  213  VYCKNVIVKGLTILAPIDSPNTDGIDPDS  241



>gb|ACL54166.1| unknown [Zea mays]
Length=463

 Score =   302 bits (773),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 169/206 (82%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAK--LIVPAGKWLTG  439
            Y A + RAH+AS+ DFGGVGDG T NT AFR A+++LS+YS  GG    L VPAGKWLTG
Sbjct  42   YLAPACRAHTASVADFGGVGDGTTSNTAAFRSAVDHLSQYSGEGGGGGMLYVPAGKWLTG  101

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTL+LH+DAV+L SQD+  WP+V PLPSYG GRD  GGR  SLI GSNL DVV
Sbjct  102  PFNLTSHFTLYLHQDAVILGSQDVGEWPIVDPLPSYGRGRDKVGGRFASLIGGSNLTDVV  161

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQGA+WW +F   +LKYTR YLIE+MHSD I ISNLTLLNSP+WN+HPVYS
Sbjct  162  ITGSNGTIDGQGAMWWSKFHKNQLKYTRGYLIELMHSDTIYISNLTLLNSPAWNIHPVYS  221

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI++QG+TILAP  S NTDGINPDS
Sbjct  222  SNIVVQGITILAPTNSPNTDGINPDS  247



>gb|ACG41831.1| glycoside hydrolase, family 28 [Zea mays]
Length=439

 Score =   301 bits (771),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 169/206 (82%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAK--LIVPAGKWLTG  439
            Y A + RAH+AS+ DFGGVGDG T NT AFR A+++LS+YS  GG    L VPAGKWLTG
Sbjct  2    YLAPACRAHTASVADFGGVGDGTTSNTAAFRSAVDHLSQYSGEGGGGGMLYVPAGKWLTG  61

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTL+LH+DAV+L SQD+  WP+V PLPSYG GRD  GGR  SLI GSNL DVV
Sbjct  62   PFNLTSHFTLYLHQDAVILGSQDVGEWPIVDPLPSYGRGRDKVGGRFASLIGGSNLTDVV  121

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQGA+WW +F   +LKYTR YLIE+MHSD I ISNLTLLNSP+WN+HPVYS
Sbjct  122  ITGSNGTIDGQGAMWWSKFHKNQLKYTRGYLIELMHSDTIYISNLTLLNSPAWNIHPVYS  181

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI++QG+TILAP  S NTDGINPDS
Sbjct  182  SNIVVQGITILAPTNSPNTDGINPDS  207



>ref|XP_010317519.1| PREDICTED: probable polygalacturonase, partial [Solanum lycopersicum]
Length=464

 Score =   302 bits (773),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY A+S R H+A + DFGG GDGKT NT+AFR+A++ LSK++  GGA+LIVP GKWLTG 
Sbjct  30   EYEALSCRKHTALLTDFGGKGDGKTSNTEAFRKAIHELSKFATDGGAQLIVPPGKWLTGP  89

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTS FTL++H+DAVLL SQD   W L+PPLPSYG GRD  G R IS IFG+NL DVVI
Sbjct  90   FNLTSKFTLYIHQDAVLLVSQDEAEWDLIPPLPSYGIGRDNPGPRFISFIFGTNLTDVVI  149

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG LWW +FR  ++K TRPY+IEIM SD +QISNLTL+NSPSWNVHP+YSS
Sbjct  150  TGGNGTIDGQGQLWWTKFRQGQMKNTRPYMIEIMFSDHVQISNLTLINSPSWNVHPIYSS  209

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
             +II GLTILAP  + NTDGI+PDS
Sbjct  210  FVIINGLTILAPFHAPNTDGIDPDS  234



>ref|XP_007152185.1| hypothetical protein PHAVU_004G108800g [Phaseolus vulgaris]
 gb|ESW24179.1| hypothetical protein PHAVU_004G108800g [Phaseolus vulgaris]
Length=477

 Score =   302 bits (774),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AIS R H+A + DFGGVGDGKT NTKAF+ A++NLS Y++ GGA L+VP GKWLTGS
Sbjct  42   EYPAISCRKHTAVLTDFGGVGDGKTSNTKAFQYAISNLSHYASDGGAILLVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL  +A +LASQD + WP++  LPSYG GRD   GR  SLIFG+NL DVVI
Sbjct  102  FNLTSHFTLFLQNEATILASQDESEWPILSVLPSYGRGRDAPDGRFSSLIFGTNLTDVVI  161

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG+ WW +F   +LK TRPYLIEIM S+ IQISNLTL+NSPSW VHP+YSS
Sbjct  162  TGYNGTIDGQGSYWWDKFHKDELKLTRPYLIEIMFSNHIQISNLTLVNSPSWFVHPIYSS  221

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            +IIIQGLTILAPV S NTDGINPDS
Sbjct  222  DIIIQGLTILAPVDSPNTDGINPDS  246



>ref|XP_010519487.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=475

 Score =   302 bits (773),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 171/209 (82%), Gaps = 0/209 (0%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKW  448
            ++G EYSA++ R H+A I DFG VGDGKT NTKAFREA++ L + +A GG++L++P GKW
Sbjct  40   TAGVEYSALNCRKHTAVITDFGAVGDGKTSNTKAFREAISKLGQRAADGGSQLVIPQGKW  99

Query  447  LTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLV  268
            LTGSFNLTSHFTLF+ K A +LASQD + WP+V PLPSYG GRD  G R  SLIFG+NL 
Sbjct  100  LTGSFNLTSHFTLFIQKGATILASQDESEWPVVAPLPSYGRGRDAPGPRFSSLIFGTNLT  159

Query  267  DVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHP  88
            DVVITGNNGTIDGQG  WW ++R  + K TRPY+IE++ SD +QIS++TL++SPSWNVHP
Sbjct  160  DVVITGNNGTIDGQGKYWWVKYRKGEFKLTRPYMIEVLFSDNVQISDITLIDSPSWNVHP  219

Query  87   VYSSNIIIQGLTILAPVKSANTDGINPDS  1
            VY  N+I++GLTILAP+ S NTDGI+PDS
Sbjct  220  VYCKNVIVKGLTILAPIDSPNTDGIDPDS  248



>ref|NP_001151164.1| glycoside hydrolase, family 28 precursor [Zea mays]
 gb|ACF87988.1| unknown [Zea mays]
 gb|AFW75223.1| glycoside hydrolase, family 28 [Zea mays]
Length=486

 Score =   302 bits (773),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 169/206 (82%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAK--LIVPAGKWLTG  439
            Y A + RAH+AS+ DFGGVGDG T NT AFR A+++LS+YS  GG    L VPAGKWLTG
Sbjct  49   YLAPACRAHTASVADFGGVGDGTTSNTAAFRSAVDHLSQYSGEGGGGGMLYVPAGKWLTG  108

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTL+LH+DAV+L SQD+  WP+V PLPSYG GRD  GGR  SLI GSNL DVV
Sbjct  109  PFNLTSHFTLYLHQDAVILGSQDVGEWPIVDPLPSYGRGRDKVGGRFASLIGGSNLTDVV  168

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQGA+WW +F   +LKYTR YLIE+MHSD I ISNLTLLNSP+WN+HPVYS
Sbjct  169  ITGSNGTIDGQGAMWWSKFHKNQLKYTRGYLIELMHSDTIYISNLTLLNSPAWNIHPVYS  228

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI++QG+TILAP  S NTDGINPDS
Sbjct  229  SNIVVQGITILAPTNSPNTDGINPDS  254



>gb|AFW75224.1| glycoside hydrolase, family 28 [Zea mays]
Length=506

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 169/206 (82%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAK--LIVPAGKWLTG  439
            Y A + RAH+AS+ DFGGVGDG T NT AFR A+++LS+YS  GG    L VPAGKWLTG
Sbjct  69   YLAPACRAHTASVADFGGVGDGTTSNTAAFRSAVDHLSQYSGEGGGGGMLYVPAGKWLTG  128

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTL+LH+DAV+L SQD+  WP+V PLPSYG GRD  GGR  SLI GSNL DVV
Sbjct  129  PFNLTSHFTLYLHQDAVILGSQDVGEWPIVDPLPSYGRGRDKVGGRFASLIGGSNLTDVV  188

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQGA+WW +F   +LKYTR YLIE+MHSD I ISNLTLLNSP+WN+HPVYS
Sbjct  189  ITGSNGTIDGQGAMWWSKFHKNQLKYTRGYLIELMHSDTIYISNLTLLNSPAWNIHPVYS  248

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI++QG+TILAP  S NTDGINPDS
Sbjct  249  SNIVVQGITILAPTNSPNTDGINPDS  274



>ref|XP_010089055.1| putative polygalacturonase [Morus notabilis]
 gb|EXB37302.1| putative polygalacturonase [Morus notabilis]
Length=471

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA++ R HSAS+ DFGGVGDG T NTKAF+ A+N+LS++S+ GG+ L VP GKWLT S
Sbjct  34   EYSAMNCRDHSASLADFGGVGDGITSNTKAFQAAINHLSRFSSDGGSLLFVPPGKWLTAS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAV+L SQD + WP++  LPSYG G+DT   R  SLIFG+NL +VVI
Sbjct  94   FNLTSHFTLFLHKDAVILGSQDESEWPVIEGLPSYGPGKDTDR-RFSSLIFGTNLTNVVI  152

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG+NGTIDGQG LWWQ+FR+++LK+TRP+LIEI +S+ +QISNLTL+NS +WN+HPVY S
Sbjct  153  TGDNGTIDGQGELWWQKFRNRELKFTRPFLIEISYSENVQISNLTLVNSANWNIHPVYCS  212

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+I+QG+TILAPV S NTDGINPDS
Sbjct  213  NVIVQGITILAPVTSPNTDGINPDS  237



>ref|XP_003592197.1| Endo-polygalacturonase-like protein [Medicago truncatula]
 gb|AES62448.1| pectin lyase superfamily protein [Medicago truncatula]
Length=475

 Score =   301 bits (771),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R H+A + DFG VGDGKTLNTKAF  A+ NLS+Y+  GGA+LIVP GKWLTGS
Sbjct  44   DYHAINCRKHNAVLTDFGAVGDGKTLNTKAFNSAITNLSQYANDGGAQLIVPPGKWLTGS  103

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFL K AV+LASQD + WP +  LPSYG  +D   GR  SLIFG+NL DVVI
Sbjct  104  FNLTSHFTLFLQKGAVILASQDESEWPKLSFLPSYGREKDAPDGRFSSLIFGTNLTDVVI  163

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WW +F+ K+LK TRPY+IEIM+SDQIQISNLTL+NSP+W VHP+YSS
Sbjct  164  TGNNGTIDGQGSTWWDKFQKKQLKITRPYMIEIMYSDQIQISNLTLINSPNWFVHPIYSS  223

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            NIII  LTILAPV   NTDGI+PDS
Sbjct  224  NIIINRLTILAPVDVPNTDGIDPDS  248



>ref|XP_008437531.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=480

 Score =   300 bits (769),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +  AI+ R H+A + DFGGVGDG T NT+AFR A+ +LS  +A+GGA+LIVP GKWLTGS
Sbjct  43   QVPAINCRQHTAVLTDFGGVGDGVTSNTQAFRRAIEHLSPLAANGGAQLIVPPGKWLTGS  102

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLF+HKDA +LASQD + WP V  LPSYG GRD  GGR  SLI+G+NL DVVI
Sbjct  103  FNLTSHFTLFVHKDATILASQDESEWPQVAILPSYGVGRDAPGGRYSSLIYGTNLTDVVI  162

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQG+ WW +F   +L  TRPY+IEI++SDQIQISNLTL+NSPSW VHP+YS 
Sbjct  163  TGNNGTIDGQGSYWWDKFHKGELNLTRPYMIEILYSDQIQISNLTLVNSPSWFVHPIYSK  222

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+IIQGLTILAP+ S NTDGI+PDS
Sbjct  223  NVIIQGLTILAPIDSPNTDGIDPDS  247



>ref|XP_002273177.2| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=465

 Score =   300 bits (768),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = -1

Query  618  REYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTG  439
             EY AI+ R HSA + DFG  GDGKT+NTKAF+ A+ NLS+ +  GGA+LIVP GKWLTG
Sbjct  34   EEYRAINCRKHSAVLTDFGAKGDGKTMNTKAFKSAIANLSQVAGDGGAQLIVPPGKWLTG  93

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
            SFNLTSHFTLF+HKDAV+L +QD   +PL+  LPSYG GRD  GGR  SLIFG+NL DVV
Sbjct  94   SFNLTSHFTLFVHKDAVILGAQDEAAYPLIEILPSYGAGRD-GGGRHASLIFGTNLTDVV  152

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG NGTI GQG  WW +FR+ KLK TRPYLIEIM+SDQ+QISNL L++SPSWNVHP YS
Sbjct  153  ITGGNGTIHGQGQYWWDKFRADKLKDTRPYLIEIMYSDQVQISNLILIDSPSWNVHPTYS  212

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SN+IIQ LTI+APV S NTDGINPDS
Sbjct  213  SNVIIQWLTIIAPVGSPNTDGINPDS  238



>ref|XP_010550764.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=477

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 172/210 (82%), Gaps = 1/210 (0%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKW  448
            ++G EYSA++ R H+A I DFG VGDGKT NTKAFREA+  L + +A GGA+L++P GKW
Sbjct  41   AAGIEYSALNCRKHTAVITDFGAVGDGKTSNTKAFREAITKLGQSAADGGAQLVIPPGKW  100

Query  447  LTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLV  268
            LTGSFNLTSHFTLF+ K A +LASQD + WP+V PLPSYG GRD  G R  SLI+G+NL 
Sbjct  101  LTGSFNLTSHFTLFIQKGATILASQDESEWPVVAPLPSYGRGRDAPGPRFSSLIYGTNLT  160

Query  267  DVVITGNNGTIDGQGALWWQQFRSKKLK-YTRPYLIEIMHSDQIQISNLTLLNSPSWNVH  91
            DVVITGNNGTIDGQG  WW +FR+ + K  TRPYLIEI+ SD +QIS++TL++SPSWNVH
Sbjct  161  DVVITGNNGTIDGQGKSWWVKFRNGEYKSITRPYLIEILFSDNVQISDITLIDSPSWNVH  220

Query  90   PVYSSNIIIQGLTILAPVKSANTDGINPDS  1
            PVY +N+I++GLTILAP+ S NTDGI+PDS
Sbjct  221  PVYCNNVIVKGLTILAPIDSPNTDGIDPDS  250



>ref|XP_008794781.1| PREDICTED: probable polygalacturonase isoform X4 [Phoenix dactylifera]
Length=477

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLI-VPAGKWLTG  439
            +Y+A S RA +AS+ DFGGVGDGKT NTKAF+ A+ +L++++  GG  ++ VPAG+WLTG
Sbjct  42   KYAATSCRAKTASLTDFGGVGDGKTSNTKAFQAAVAHLAQFAGGGGGGMLYVPAGRWLTG  101

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLT+ FTLFLH+DAV+LA+QD++ WP++ PLPSYG GRD +GGR  SLI GSNL DV+
Sbjct  102  PFNLTNSFTLFLHRDAVILATQDMSEWPVIDPLPSYGRGRDHAGGRYSSLIGGSNLTDVI  161

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQGA WWQ+F   KLKYTR YLIE++H+DQI ISNLTLLNSP+WN+HPVYS
Sbjct  162  ITGDNGTIDGQGAFWWQKFHGGKLKYTRGYLIELLHTDQIFISNLTLLNSPAWNIHPVYS  221

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI+I G+TILAPV+S NTDGINPDS
Sbjct  222  SNIVISGITILAPVRSPNTDGINPDS  247



>ref|XP_004160401.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase-like 
[Cucumis sativus]
Length=480

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +  AIS R H+A I DFGGVGDG T NT+AFR A+ +LS  +A GGA+L VP GKWLTGS
Sbjct  43   QVPAISCRKHTALITDFGGVGDGVTSNTQAFRRAIEHLSSLAADGGAQLTVPXGKWLTGS  102

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLF+HKDA +L SQ+ + WP V  LPSYG GRD  GGR  SLIFG+NL DVVI
Sbjct  103  FNLTSHFTLFVHKDAKILGSQNESEWPQVALLPSYGVGRDAPGGRYSSLIFGTNLTDVVI  162

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW +F   +L  TRPYLIEIM+SDQIQIS+LTL+NSPSW VHP+YS 
Sbjct  163  TGNNGTIDGQGAYWWDKFHKGELNLTRPYLIEIMYSDQIQISDLTLVNSPSWFVHPIYSK  222

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+IIQGLTILAP+ S NTDGI+PDS
Sbjct  223  NVIIQGLTILAPIDSPNTDGIDPDS  247



>ref|XP_004145976.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
Length=480

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +  AIS R H+A I DFGGVGDG T NT+AFR A+ +LS  +A GGA+L VP GKWLTGS
Sbjct  43   QVPAISCRKHTALITDFGGVGDGVTSNTQAFRRAIEHLSSLAADGGAQLTVPPGKWLTGS  102

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLF+HKDA +L SQ+ + WP V  LPSYG GRD  GGR  SLIFG+NL DVVI
Sbjct  103  FNLTSHFTLFVHKDAKILGSQNESEWPQVALLPSYGVGRDAPGGRYSSLIFGTNLTDVVI  162

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW +F   +L  TRPYLIEIM+SDQIQIS+LTL+NSPSW VHP+YS 
Sbjct  163  TGNNGTIDGQGAYWWDKFHKGELNLTRPYLIEIMYSDQIQISDLTLVNSPSWFVHPIYSK  222

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+IIQGLTILAP+ S NTDGI+PDS
Sbjct  223  NVIIQGLTILAPIDSPNTDGIDPDS  247



>ref|XP_008794779.1| PREDICTED: probable polygalacturonase isoform X3 [Phoenix dactylifera]
Length=486

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLI-VPAGKWLTG  439
            +Y+A S RA +AS+ DFGGVGDGKT NTKAF+ A+ +L++++  GG  ++ VPAG+WLTG
Sbjct  51   KYAATSCRAKTASLTDFGGVGDGKTSNTKAFQAAVAHLAQFAGGGGGGMLYVPAGRWLTG  110

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLT+ FTLFLH+DAV+LA+QD++ WP++ PLPSYG GRD +GGR  SLI GSNL DV+
Sbjct  111  PFNLTNSFTLFLHRDAVILATQDMSEWPVIDPLPSYGRGRDHAGGRYSSLIGGSNLTDVI  170

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQGA WWQ+F   KLKYTR YLIE++H+DQI ISNLTLLNSP+WN+HPVYS
Sbjct  171  ITGDNGTIDGQGAFWWQKFHGGKLKYTRGYLIELLHTDQIFISNLTLLNSPAWNIHPVYS  230

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI+I G+TILAPV+S NTDGINPDS
Sbjct  231  SNIVISGITILAPVRSPNTDGINPDS  256



>ref|XP_010934935.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=469

 Score =   298 bits (763),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = -1

Query  606  AISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNL  427
            A+  R H+AS+KDFGGVGDG T NTKAF  A+ +L++++  GG  L VPAG+WLTG FNL
Sbjct  50   AVRQRTHTASLKDFGGVGDGITSNTKAFHAAVAHLAQFAGGGGGMLFVPAGRWLTGPFNL  109

Query  426  TSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGN  247
            T+ FTLFLH+DAV+LA+QD+  WP++ PLPSYG GRD SGGR  SLI GS+L DVVI G+
Sbjct  110  TNSFTLFLHRDAVILATQDMIEWPVIDPLPSYGRGRDHSGGRYSSLIGGSHLTDVVIAGD  169

Query  246  NGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNII  67
            NGTIDGQGA WW+ F   KLKYTR YLIE+MHSDQI ISNLTLLNSP+WN+HPVYSSNI+
Sbjct  170  NGTIDGQGAFWWKNFHEGKLKYTRGYLIELMHSDQILISNLTLLNSPTWNIHPVYSSNIV  229

Query  66   IQGLTILAPVKSANTDGINPDS  1
            I  +TILAPV S NTDGINPDS
Sbjct  230  ISQITILAPVHSPNTDGINPDS  251



>ref|XP_008794778.1| PREDICTED: probable polygalacturonase isoform X2 [Phoenix dactylifera]
Length=486

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLI-VPAGKWLTG  439
            +Y+A S RA +AS+ DFGGVGDGKT NTKAF+ A+ +L++++  GG  ++ VPAG+WLTG
Sbjct  51   KYAATSCRAKTASLTDFGGVGDGKTSNTKAFQAAVAHLAQFAGGGGGGMLYVPAGRWLTG  110

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLT+ FTLFLH+DAV+LA+QD++ WP++ PLPSYG GRD +GGR  SLI GSNL DV+
Sbjct  111  PFNLTNSFTLFLHRDAVILATQDMSEWPVIDPLPSYGRGRDHAGGRYSSLIGGSNLTDVI  170

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQGA WWQ+F   KLKYTR YLIE++H+DQI ISNLTLLNSP+WN+HPVYS
Sbjct  171  ITGDNGTIDGQGAFWWQKFHGGKLKYTRGYLIELLHTDQIFISNLTLLNSPAWNIHPVYS  230

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI+I G+TILAPV+S NTDGINPDS
Sbjct  231  SNIVISGITILAPVRSPNTDGINPDS  256



>ref|XP_007143467.1| hypothetical protein PHAVU_007G074300g [Phaseolus vulgaris]
 gb|ESW15461.1| hypothetical protein PHAVU_007G074300g [Phaseolus vulgaris]
Length=458

 Score =   297 bits (761),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 170/207 (82%), Gaps = 0/207 (0%)
 Frame = -1

Query  621  GREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLT  442
            G EY AI+ R HSA + DFGGVGDG   NTKAFR A+ NLS++++ GGA+LIVP GKWLT
Sbjct  33   GSEYEAINCRKHSAVLTDFGGVGDGVKSNTKAFRNAIRNLSQHASDGGAQLIVPPGKWLT  92

Query  441  GSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDV  262
            G FNLTSHFTLFLHK+A++LASQD + WP +P LPSYG GRD   GR  SLI G++L DV
Sbjct  93   GPFNLTSHFTLFLHKNAIILASQDESEWPHLPALPSYGRGRDAPAGRFSSLISGTHLTDV  152

Query  261  VITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVY  82
            VITG+NG IDGQGA WW++F  K+L  TRPY+IE+M+SDQIQIS+LTLLNSPS+ +HP+Y
Sbjct  153  VITGDNGKIDGQGAYWWEKFHKKQLNLTRPYMIELMYSDQIQISSLTLLNSPSYFIHPIY  212

Query  81   SSNIIIQGLTILAPVKSANTDGINPDS  1
            SSNII+QGLTI AP  S NTDGI+PDS
Sbjct  213  SSNIIMQGLTINAPRGSPNTDGIDPDS  239



>ref|XP_008794777.1| PREDICTED: probable polygalacturonase isoform X1 [Phoenix dactylifera]
Length=495

 Score =   298 bits (764),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLI-VPAGKWLTG  439
            +Y+A S RA +AS+ DFGGVGDGKT NTKAF+ A+ +L++++  GG  ++ VPAG+WLTG
Sbjct  60   KYAATSCRAKTASLTDFGGVGDGKTSNTKAFQAAVAHLAQFAGGGGGGMLYVPAGRWLTG  119

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLT+ FTLFLH+DAV+LA+QD++ WP++ PLPSYG GRD +GGR  SLI GSNL DV+
Sbjct  120  PFNLTNSFTLFLHRDAVILATQDMSEWPVIDPLPSYGRGRDHAGGRYSSLIGGSNLTDVI  179

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG+NGTIDGQGA WWQ+F   KLKYTR YLIE++H+DQI ISNLTLLNSP+WN+HPVYS
Sbjct  180  ITGDNGTIDGQGAFWWQKFHGGKLKYTRGYLIELLHTDQIFISNLTLLNSPAWNIHPVYS  239

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SNI+I G+TILAPV+S NTDGINPDS
Sbjct  240  SNIVISGITILAPVRSPNTDGINPDS  265



>ref|XP_011076107.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=500

 Score =   298 bits (764),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSAI+ R H+A + DFGG+GDGKTLNT  F+ A+ NLS  ++ GGA+L+VP G+WLTGS
Sbjct  60   QYSAINCRKHTALLTDFGGIGDGKTLNTAVFKAAIANLSSVASDGGAQLVVPPGRWLTGS  119

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            F+LTSHFTL++HKDAVLLASQ+ + +PL+ PLPSYG GRD  G R  SLIFG+NL DVVI
Sbjct  120  FDLTSHFTLYIHKDAVLLASQEESDYPLIDPLPSYGVGRDAPGKRFASLIFGTNLTDVVI  179

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTI+GQG  WW++F++ +LK TRPYLIEI++SDQ+QIS LTL+NSPSW+VHP Y S
Sbjct  180  TGGNGTINGQGVTWWKKFKAHQLKNTRPYLIEILYSDQVQISYLTLINSPSWHVHPTYCS  239

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+II+ LTI+AP+ S NTDGINPDS
Sbjct  240  NVIIENLTIIAPIDSPNTDGINPDS  264



>gb|KDP22227.1| hypothetical protein JCGZ_26058 [Jatropha curcas]
Length=477

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSA + D+GGVGDGKTLNTKAF++A+ NLSKY++ GG +LIVP G+WLTGS
Sbjct  45   EYPAINCRKHSAFLTDYGGVGDGKTLNTKAFQDAIANLSKYTSDGGVELIVPPGRWLTGS  104

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLFLHKDAVLL SQ+   WP++ PLPSYG  ++   GR  SL+ G NL DVVI
Sbjct  105  FNLTSHFTLFLHKDAVLLGSQNEEDWPIIAPLPSYGVEKEFPEGRFASLLSGMNLTDVVI  164

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW++++ +++K TRPYLIE+M+S Q+QI+N+T +NSPSW++HP+Y S
Sbjct  165  TGNNGTIDGQGAPWWEKYKKREIKATRPYLIELMYSSQLQITNITFINSPSWHIHPIYCS  224

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N+ I+ +TILAP++  NTDGINPDS
Sbjct  225  NVYIKQVTILAPIEVPNTDGINPDS  249



>ref|XP_010519492.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=468

 Score =   297 bits (760),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 171/210 (81%), Gaps = 2/210 (1%)
 Frame = -1

Query  624  SGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAH--GGAKLIVPAGK  451
            +G EYSA++ R +SA I +FG VGDGKT NTKAFREA+  L + SA   GGA+L+VP GK
Sbjct  32   AGIEYSALNCRKYSAVITEFGAVGDGKTSNTKAFREAIEKLGQRSAADGGGAQLVVPPGK  91

Query  450  WLTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNL  271
            WLTGSFNLTSHFTLF+ + A LLASQD + WP+V PLPSYG GRDT G R  SLI GSNL
Sbjct  92   WLTGSFNLTSHFTLFIQQGATLLASQDESEWPIVAPLPSYGRGRDTPGPRFGSLISGSNL  151

Query  270  VDVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVH  91
             DVVITGNNGTIDGQG  WW++F+  ++K TRPYLIE+M S+ IQIS++TL+N+P+WN+H
Sbjct  152  TDVVITGNNGTIDGQGQYWWKKFKQGEMKETRPYLIELMSSEDIQISDITLINAPTWNIH  211

Query  90   PVYSSNIIIQGLTILAPVKSANTDGINPDS  1
            PVY  N+I++G+T+LAPV S NTDGINPDS
Sbjct  212  PVYCKNVIVKGVTVLAPVDSPNTDGINPDS  241



>ref|XP_002273143.3| PREDICTED: probable polygalacturonase, partial [Vitis vinifera]
Length=434

 Score =   296 bits (757),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 169/201 (84%), Gaps = 1/201 (0%)
 Frame = -1

Query  603  ISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLT  424
            I+ R HSA + +FGG+GDGKT NTKAF+ A+++L +++  GGA+LIVP GKWLTGSFNLT
Sbjct  1    INCRKHSALLTEFGGIGDGKTSNTKAFKTAIDHLKQFATDGGAELIVPPGKWLTGSFNLT  60

Query  423  SHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNN  244
            SHFTL++HKDAV+L SQ+ + +P +PPLPSYG GRD  GGR  SLIFG+NL DVVI G N
Sbjct  61   SHFTLYIHKDAVILGSQEESDYPHIPPLPSYGKGRD-GGGRFSSLIFGTNLTDVVIIGGN  119

Query  243  GTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIII  64
            GTI+GQG +WW +F+ KKL  TRPYLIEIM SDQ+QISNLTL++SPSWNVHPVY S++II
Sbjct  120  GTINGQGRVWWDKFKQKKLVDTRPYLIEIMFSDQVQISNLTLIDSPSWNVHPVYCSDVII  179

Query  63   QGLTILAPVKSANTDGINPDS  1
            QG+TILAPV   NTDGINPDS
Sbjct  180  QGMTILAPVDVPNTDGINPDS  200



>ref|XP_010671628.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=488

 Score =   297 bits (761),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            Y A++ R HSA + +FG  GDGKTLNTKAF+ A+ +LSK +  GGA+LI+P G+WLTGSF
Sbjct  54   YRAVNCRKHSAIVTEFGAKGDGKTLNTKAFKSAIRHLSKIAPDGGAQLIIPRGRWLTGSF  113

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            +L SHFTL+LHKDAVLLASQD   WP++ PLPSYG GRD   GR  SLIFG+NL DV+IT
Sbjct  114  SLISHFTLYLHKDAVLLASQDEKDWPILAPLPSYGKGRDAPAGRYQSLIFGTNLTDVIIT  173

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G NGTIDGQGA+WW+++R+ +L  TRPY+IE+M S+ +QIS+LTLLNSP+WNVHP+Y  +
Sbjct  174  GTNGTIDGQGAIWWKKYRNNELNETRPYMIELMFSNGVQISDLTLLNSPNWNVHPIYCRD  233

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            +IIQGLTILAP  SANTDGI+PDS
Sbjct  234  VIIQGLTILAPTHSANTDGIDPDS  257



>ref|XP_008796910.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=466

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  606  AISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGA-KLIVPAGKWLTGSFN  430
            A+  RAH+AS+ DFGGVGDG T NTKAFR A+ +L++++ +GG   L VPAG+WLTG FN
Sbjct  48   AVRRRAHTASLTDFGGVGDGTTSNTKAFRTAVAHLAQFAGNGGGGMLFVPAGRWLTGPFN  107

Query  429  LTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITG  250
            LT+ FTLFLH+DAV+LA+QD++ WP++ PLPSYG GRD  GGR  SLI GS+L DVVITG
Sbjct  108  LTNSFTLFLHRDAVILATQDMSEWPVIDPLPSYGRGRDHPGGRYSSLIGGSHLTDVVITG  167

Query  249  NNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNI  70
            +NGTIDGQGA WW++F   KLKYTR YLIE+MHSDQI ISNLTLLNSP+WN+HPVYSS+I
Sbjct  168  DNGTIDGQGAFWWKKFHEGKLKYTRGYLIELMHSDQIFISNLTLLNSPAWNIHPVYSSDI  227

Query  69   IIQGLTILAPVKSANTDGINPDS  1
            +I  +TILAPV S NTDGINPDS
Sbjct  228  VISQITILAPVHSPNTDGINPDS  250



>ref|XP_004513187.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=479

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            YSAI  R HSA + DFG VGDGKT NTK F  A+ NLS+Y   GG+ L+VP GKWLTGSF
Sbjct  45   YSAIDCRKHSAFLTDFGAVGDGKTSNTKVFEYAIRNLSQYGNDGGSLLVVPPGKWLTGSF  104

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFL  DAV+LASQD + WP +P LPSYG GRD   GR  SLIFG+NL DVVIT
Sbjct  105  NLTSHFTLFLQNDAVILASQDESEWPSLPVLPSYGRGRDAPNGRFSSLIFGTNLTDVVIT  164

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G NGTIDGQG+ WW +F   +L  TRPYLIEIM S+QIQISNLTL+NSPSW VHP+YSS+
Sbjct  165  GCNGTIDGQGSYWWDKFHKDELNLTRPYLIEIMFSNQIQISNLTLINSPSWFVHPIYSSD  224

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            IIIQGL I+AP+ S NTDGI+PDS
Sbjct  225  IIIQGLNIIAPIDSPNTDGIDPDS  248



>gb|KHN21786.1| Putative polygalacturonase, partial [Glycine soja]
Length=434

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            Y AI+ R HSA + DFGGVGDG T NTKAF+ A++ LS+Y++ GGA L+VP GKWLTG F
Sbjct  6    YYAINCRKHSAVLTDFGGVGDGITSNTKAFQSAISKLSQYASDGGAMLVVPPGKWLTGPF  65

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFL   AV+LASQD + WP +P LPSYG GRD  GGR  SLIFG++L DVVIT
Sbjct  66   NLTSHFTLFLDFGAVILASQDESEWPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVIT  125

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            GNNG IDGQGA WW +F   +L  TRPYLIEIM+SDQIQIS LTL+NSP+W VHPVYSSN
Sbjct  126  GNNGLIDGQGAYWWNKFHQGQLTLTRPYLIEIMYSDQIQISFLTLVNSPTWFVHPVYSSN  185

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            III+GLTI APV S NTDGINPDS
Sbjct  186  IIIKGLTIKAPVDSPNTDGINPDS  209



>ref|XP_010228132.1| PREDICTED: probable polygalacturonase isoform X1 [Brachypodium 
distachyon]
Length=496

 Score =   296 bits (757),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAK--LIVPAGKWLTG  439
            Y A + R H+AS+ +FGGVGDG T NT AFR A+ +LS+YS  GG    L VPAG+WLT 
Sbjct  47   YLAPACREHTASLAEFGGVGDGTTSNTAAFRAAVEHLSQYSGDGGGGGMLYVPAGRWLTA  106

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTLFLH DAV+LASQ+I+ WP++ PLPSYG GRD +GGR  SLI GSNL DVV
Sbjct  107  PFNLTSHFTLFLHSDAVILASQNISEWPVIAPLPSYGRGRDHAGGRYTSLISGSNLTDVV  166

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITGNNGTIDGQGA WW +++S KLKYTR YLIE+M SD I ISN+TLLNSP+WN+HPVYS
Sbjct  167  ITGNNGTIDGQGATWWSKYKSGKLKYTRGYLIELMSSDTIFISNVTLLNSPAWNIHPVYS  226

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
             NI+IQG+TILAP +S NTDGINPDS
Sbjct  227  KNIVIQGVTILAPTRSPNTDGINPDS  252



>ref|XP_010228133.1| PREDICTED: probable polygalacturonase isoform X2 [Brachypodium 
distachyon]
Length=495

 Score =   296 bits (757),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAK--LIVPAGKWLTG  439
            Y A + R H+AS+ +FGGVGDG T NT AFR A+ +LS+YS  GG    L VPAG+WLT 
Sbjct  46   YLAPACREHTASLAEFGGVGDGTTSNTAAFRAAVEHLSQYSGDGGGGGMLYVPAGRWLTA  105

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTLFLH DAV+LASQ+I+ WP++ PLPSYG GRD +GGR  SLI GSNL DVV
Sbjct  106  PFNLTSHFTLFLHSDAVILASQNISEWPVIAPLPSYGRGRDHAGGRYTSLISGSNLTDVV  165

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITGNNGTIDGQGA WW +++S KLKYTR YLIE+M SD I ISN+TLLNSP+WN+HPVYS
Sbjct  166  ITGNNGTIDGQGATWWSKYKSGKLKYTRGYLIELMSSDTIFISNVTLLNSPAWNIHPVYS  225

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
             NI+IQG+TILAP +S NTDGINPDS
Sbjct  226  KNIVIQGVTILAPTRSPNTDGINPDS  251



>gb|KCW90638.1| hypothetical protein EUGRSUZ_A02742 [Eucalyptus grandis]
Length=464

 Score =   294 bits (753),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 168/207 (81%), Gaps = 0/207 (0%)
 Frame = -1

Query  621  GREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLT  442
            G  Y+AIS R H+ S+ DFGGVGDGKT NT+AFR A+ NLS Y+  GGA+L+VPAGKWLT
Sbjct  25   GESYAAISCRKHTKSLVDFGGVGDGKTSNTEAFRRAIANLSGYATDGGAQLVVPAGKWLT  84

Query  441  GSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDV  262
            GSFNLTSHFTL+L  +A +LASQD + WP V  L SYG GRD  GGR  SLI G+NL DV
Sbjct  85   GSFNLTSHFTLYLDGNATILASQDESEWPQVAILLSYGRGRDAPGGRFSSLISGTNLTDV  144

Query  261  VITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVY  82
            VITGNNGTIDGQGA WW +F+ ++L  TRPYLIE ++SDQ+QI+ +TL++SPSW VHP+Y
Sbjct  145  VITGNNGTIDGQGAYWWDKFKKEELNLTRPYLIEFLYSDQVQIAYITLVDSPSWFVHPIY  204

Query  81   SSNIIIQGLTILAPVKSANTDGINPDS  1
            SS+I +QG+TILAP+ S NTDGINPDS
Sbjct  205  SSDIFVQGVTILAPIDSPNTDGINPDS  231



>ref|XP_003535597.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=466

 Score =   295 bits (754),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            Y AI+ R HSA + DFGGVGDG T NTKAF+ A++ LS+Y++ GGA L+VP GKWLTG F
Sbjct  38   YYAINCRKHSAVLTDFGGVGDGITSNTKAFQSAISKLSQYASDGGAMLVVPPGKWLTGPF  97

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFL   AV+LASQD + WP +P LPSYG GRD  GGR  SLIFG++L DVVIT
Sbjct  98   NLTSHFTLFLDFGAVILASQDESEWPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVIT  157

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            GNNG IDGQGA WW +F   +L  TRPYLIEIM+SDQIQIS LTL+NSP+W VHPVYSSN
Sbjct  158  GNNGLIDGQGAYWWNKFHQGQLTLTRPYLIEIMYSDQIQISFLTLVNSPTWFVHPVYSSN  217

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            III+GLTI APV S NTDGINPDS
Sbjct  218  IIIKGLTIKAPVDSPNTDGINPDS  241



>gb|KDP22228.1| hypothetical protein JCGZ_26059 [Jatropha curcas]
Length=470

 Score =   294 bits (753),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +YSAI+ R H+A + DFGGVGDGKT NTKAF  A+ NLS+Y++ GGA+LIV  GKWLTG+
Sbjct  33   QYSAITCRKHTAVLTDFGGVGDGKTSNTKAFHSAIANLSQYASDGGAQLIVQPGKWLTGA  92

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FN+TSHFTL+L KDA+LLASQD   WP++ PLPSYG GRD  GGR  S IFG+NL DVVI
Sbjct  93   FNVTSHFTLYLQKDAILLASQDEAEWPVLAPLPSYGRGRDGPGGRFSSFIFGTNLTDVVI  152

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TGNNGTIDGQGA WW +FRS  LK TRPYLIE ++SDQIQISNLTL+NSPSWNVHP YSS
Sbjct  153  TGNNGTIDGQGATWWTKFRSGLLKITRPYLIEFLYSDQIQISNLTLINSPSWNVHPTYSS  212

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N++IQ LTILAPV S NTDGI+PDS
Sbjct  213  NVLIQWLTILAPVDSPNTDGIDPDS  237



>ref|XP_010024977.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
Length=462

 Score =   294 bits (752),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 168/207 (81%), Gaps = 0/207 (0%)
 Frame = -1

Query  621  GREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLT  442
            G  Y+AIS R H+ S+ DFGGVGDGKT NT+AFR A+ NLS Y+  GGA+L+VPAGKWLT
Sbjct  23   GESYAAISCRKHTKSLVDFGGVGDGKTSNTEAFRRAIANLSGYATDGGAQLVVPAGKWLT  82

Query  441  GSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDV  262
            GSFNLTSHFTL+L  +A +LASQD + WP V  L SYG GRD  GGR  SLI G+NL DV
Sbjct  83   GSFNLTSHFTLYLDGNATILASQDESEWPQVAILLSYGRGRDAPGGRFSSLISGTNLTDV  142

Query  261  VITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVY  82
            VITGNNGTIDGQGA WW +F+ ++L  TRPYLIE ++SDQ+QI+ +TL++SPSW VHP+Y
Sbjct  143  VITGNNGTIDGQGAYWWDKFKKEELNLTRPYLIEFLYSDQVQIAYITLVDSPSWFVHPIY  202

Query  81   SSNIIIQGLTILAPVKSANTDGINPDS  1
            SS+I +QG+TILAP+ S NTDGINPDS
Sbjct  203  SSDIFVQGVTILAPIDSPNTDGINPDS  229



>gb|KGN49922.1| hypothetical protein Csa_5G140480 [Cucumis sativus]
Length=482

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 165/207 (80%), Gaps = 2/207 (1%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +  AIS R H+A I DFGGVGDG T NT+AFR A+ +LS  +A GGA+L VP GKWLTGS
Sbjct  43   QVPAISCRKHTALITDFGGVGDGVTSNTQAFRRAIEHLSSLAADGGAQLTVPPGKWLTGS  102

Query  435  FNLTSHFTLFLHKDAVLLASQDINT--WPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDV  262
            FNLTSHFTLF+HKDA +L SQ  N   WP V  LPSYG GRD  GGR  SLIFG+NL DV
Sbjct  103  FNLTSHFTLFVHKDAKILGSQVENESEWPQVALLPSYGVGRDAPGGRYSSLIFGTNLTDV  162

Query  261  VITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVY  82
            VITGNNGTIDGQGA WW +F   +L  TRPYLIEIM+SDQIQIS+LTL+NSPSW VHP+Y
Sbjct  163  VITGNNGTIDGQGAYWWDKFHKGELNLTRPYLIEIMYSDQIQISDLTLVNSPSWFVHPIY  222

Query  81   SSNIIIQGLTILAPVKSANTDGINPDS  1
            S N+IIQGLTILAP+ S NTDGI+PDS
Sbjct  223  SKNVIIQGLTILAPIDSPNTDGIDPDS  249



>emb|CBI22656.3| unnamed protein product [Vitis vinifera]
Length=621

 Score =   298 bits (763),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = -1

Query  618  REYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTG  439
             EY AI+ R HSA + DFG  GDGKT+NTKAF+ A+ NLS+ +  GGA+LIVP GKWLTG
Sbjct  289  EEYRAINCRKHSAVLTDFGAKGDGKTMNTKAFKSAIANLSQVAGDGGAQLIVPPGKWLTG  348

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
            SFNLTSHFTLF+HKDAV+L +QD   +PL+  LPSYG GRD  GGR  SLIFG+NL DVV
Sbjct  349  SFNLTSHFTLFVHKDAVILGAQDEAAYPLIEILPSYGAGRD-GGGRHASLIFGTNLTDVV  407

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITG NGTI GQG  WW +FR+ KLK TRPYLIEIM+SDQ+QISNL L++SPSWNVHP YS
Sbjct  408  ITGGNGTIHGQGQYWWDKFRADKLKDTRPYLIEIMYSDQVQISNLILIDSPSWNVHPTYS  467

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            SN+IIQ LTI+APV S NTDGINPDS
Sbjct  468  SNVIIQWLTIIAPVGSPNTDGINPDS  493


 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 169/201 (84%), Gaps = 1/201 (0%)
 Frame = -1

Query  603  ISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLT  424
            I+ R HSA + +FGG+GDGKT NTKAF+ A+++L +++  GGA+LIVP GKWLTGSFNLT
Sbjct  42   INCRKHSALLTEFGGIGDGKTSNTKAFKTAIDHLKQFATDGGAELIVPPGKWLTGSFNLT  101

Query  423  SHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNN  244
            SHFTL++HKDAV+L SQ+ + +P +PPLPSYG GRD  GGR  SLIFG+NL DVVI G N
Sbjct  102  SHFTLYIHKDAVILGSQEESDYPHIPPLPSYGKGRD-GGGRFSSLIFGTNLTDVVIIGGN  160

Query  243  GTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIII  64
            GTI+GQG +WW +F+ KKL  TRPYLIEIM SDQ+QISNLTL++SPSWNVHPVY S++II
Sbjct  161  GTINGQGRVWWDKFKQKKLVDTRPYLIEIMFSDQVQISNLTLIDSPSWNVHPVYCSDVII  220

Query  63   QGLTILAPVKSANTDGINPDS  1
            QG+TILAPV   NTDGINPDS
Sbjct  221  QGMTILAPVDVPNTDGINPDS  241



>dbj|BAJ90091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAK--LIVPAGKWLTG  439
            Y A + R H+AS+ DFGGVGDG T NT AFR+A+ +LS+YS  GG    L VPAG+WLT 
Sbjct  38   YMAPNCREHTASLTDFGGVGDGNTSNTAAFRKAVEHLSQYSGEGGGGGMLYVPAGRWLTA  97

Query  438  SFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVV  259
             FNLTSHFTLFLH DAV+L +QD+  WP++ PLPSYG GRD +GGR  SL+ GSNL DVV
Sbjct  98   PFNLTSHFTLFLHADAVILGTQDVAQWPVIDPLPSYGRGRDHAGGRYASLVSGSNLTDVV  157

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITGNNGTIDGQGA WW +++S KLKYTR YLIE+MH+D + ISN+TL+NSP+WN+HPVYS
Sbjct  158  ITGNNGTIDGQGATWWSKYKSGKLKYTRGYLIELMHTDGVFISNVTLVNSPAWNIHPVYS  217

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
             NI++ G+TILAPVKS NTDGINPDS
Sbjct  218  RNIVVSGVTILAPVKSPNTDGINPDS  243



>gb|EYU25143.1| hypothetical protein MIMGU_mgv1a005601mg [Erythranthe guttata]
Length=477

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 167/205 (81%), Gaps = 1/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSAI+ R HSA + DFGG GDG T NT AF+ A+ NLSK ++ GGA+LIVP GKWLTGS
Sbjct  36   EYSAINCRKHSALLTDFGGKGDGVTSNTAAFKAAIANLSKVASDGGAQLIVPPGKWLTGS  95

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL++ KDAVLLASQD   +PL+ PLPSYG GRD  G R ISLIFG+NL DVV+
Sbjct  96   FNLTSHFTLYISKDAVLLASQDETEYPLIDPLPSYGVGRD-GGKRFISLIFGTNLTDVVV  154

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGTIDGQG  WW+ F+S KLK TRPYLIEI++S  +QIS+LTL+NSPSW+VHP Y  
Sbjct  155  TGGNGTIDGQGESWWKDFKSGKLKNTRPYLIEILYSRNVQISHLTLINSPSWHVHPTYCR  214

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            ++II+ LTILAP+ S NTDGINPDS
Sbjct  215  DVIIESLTILAPIDSPNTDGINPDS  239



>gb|ABR18040.1| unknown [Picea sitchensis]
Length=472

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            Y A S RA S SI +FGGVGDG T+NT+AFR+A+ +LS++S  GG +L +P G+WLTGSF
Sbjct  36   YVAPSCRAQSVSIAEFGGVGDGTTVNTEAFRKAIEHLSEFSETGGGQLYIPPGRWLTGSF  95

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLT HFTL+LHK+AV+L SQD+  WPL+PPLPSYG GRD  G R  SLI G NL DVVIT
Sbjct  96   NLTDHFTLYLHKEAVILGSQDLEDWPLIPPLPSYGMGRDAPGPRYSSLINGYNLTDVVIT  155

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            G+NGTIDGQGA+WWQ+F  K LK TR YL+E+M+S  I ISNLT LNSP+WN+HPVYSSN
Sbjct  156  GDNGTIDGQGAIWWQKFHKKILKNTRGYLVELMYSKDIIISNLTFLNSPAWNLHPVYSSN  215

Query  72   IIIQGLTILAPVKSANTDGINPDS  1
            I+IQ +TILAP+ S NTDGI+PDS
Sbjct  216  ILIQYVTILAPLDSPNTDGIDPDS  239



>emb|CBI22657.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 169/205 (82%), Gaps = 1/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y A+  R HSA + DFG  GDGKT+NTKAF+ A+++LS+++  GGA+LIVP GKWLTGS
Sbjct  42   KYKALRCRKHSAVLTDFGATGDGKTINTKAFKSAIDHLSQFADDGGAELIVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL++ KDAV+L +QD + +PL+  LPSYG GRD  GGR  SLIFG+NL DVVI
Sbjct  102  FNLTSHFTLYIDKDAVILGAQDESAYPLIEVLPSYGVGRD-GGGRHSSLIFGTNLTDVVI  160

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGT++GQG  WW +FR+KK   TRPYLIEIM+S+ +QISNLTL++SPSWNVHPVYS 
Sbjct  161  TGGNGTLNGQGKYWWDKFRAKKYNDTRPYLIEIMYSNHVQISNLTLIDSPSWNVHPVYSR  220

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N++++ LTILAP+ S NTDGINPDS
Sbjct  221  NVLVKDLTILAPIDSPNTDGINPDS  245



>emb|CDY05885.1| BnaC08g20620D [Brassica napus]
Length=464

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 171/209 (82%), Gaps = 1/209 (0%)
 Frame = -1

Query  624  SGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWL  445
            SG E+SA++ R H A I DFGGVGDGKT NTKAF+ A++NLS  +++GGA+L+VP GKWL
Sbjct  31   SGIEFSALNCRKHKAVITDFGGVGDGKTSNTKAFKTAISNLSHLASYGGAQLVVPPGKWL  90

Query  444  TGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNLV  268
            TGSFNLTSHFTLF+ K A +LASQD + WP+V PLPSYG GRD +G GR  SLI G+NL 
Sbjct  91   TGSFNLTSHFTLFIQKGATILASQDESEWPVVAPLPSYGKGRDGTGTGRFNSLISGTNLT  150

Query  267  DVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHP  88
            DVVITGNNGTI+GQG  WW +F+ K+ K TRPY+IE++ S  IQISN+TL++SPSW++HP
Sbjct  151  DVVITGNNGTINGQGQYWWDKFKKKQFKVTRPYMIELLFSKNIQISNITLVDSPSWHIHP  210

Query  87   VYSSNIIIQGLTILAPVKSANTDGINPDS  1
            VY +N+I++ +TI+APV   NTDGINPDS
Sbjct  211  VYCNNVIVKSITIVAPVDVPNTDGINPDS  239



>ref|XP_006829063.1| hypothetical protein AMTR_s00001p00258260 [Amborella trichopoda]
 gb|ERM96479.1| hypothetical protein AMTR_s00001p00258260 [Amborella trichopoda]
Length=487

 Score =   290 bits (743),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 168/207 (81%), Gaps = 0/207 (0%)
 Frame = -1

Query  621  GREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLT  442
            G  Y     R H AS+ DFGGVGDG T NT AF+ A+++LS++++ GGA L VP GKWLT
Sbjct  40   GFTYFQPRCRTHVASLTDFGGVGDGVTSNTNAFQAAVSHLSQFASDGGALLYVPPGKWLT  99

Query  441  GSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDV  262
            G FN+TS FTL+L+KDAV+LASQD+N WP++PPLPSYG GRDT G R  SLI G NL DV
Sbjct  100  GCFNITSFFTLYLNKDAVILASQDMNEWPIIPPLPSYGVGRDTPGPRYSSLISGFNLTDV  159

Query  261  VITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVY  82
            VITG+NGTIDGQG +WWQ+FR   LK+TR YLIEI+ SDQ+ IS+LTL+NSPSWNVHPVY
Sbjct  160  VITGDNGTIDGQGQMWWQKFRQGALKHTRGYLIEILFSDQVIISSLTLINSPSWNVHPVY  219

Query  81   SSNIIIQGLTILAPVKSANTDGINPDS  1
            SSN+I++G+TI APV S NTDGINPDS
Sbjct  220  SSNVIVKGITISAPVTSPNTDGINPDS  246



>ref|XP_006362679.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=527

 Score =   290 bits (743),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -1

Query  567  FGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLTSHFTLFLHKDAV  388
            FGG GDGKT NT+AFR+A++ LSK++  GGA+LIVP GKWLTG FNLTS FTL++H+DAV
Sbjct  109  FGGKGDGKTSNTEAFRKAIDELSKFATDGGAQLIVPPGKWLTGPFNLTSKFTLYIHQDAV  168

Query  387  LLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNNGTIDGQGALWWQ  208
            +L SQD   W L+PPLPSYG GRD  G R IS IFG+NL DVVITG NGTIDGQG LWW 
Sbjct  169  ILVSQDEAEWDLIPPLPSYGIGRDNPGPRFISFIFGTNLTDVVITGGNGTIDGQGQLWWT  228

Query  207  QFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSA  28
            +FR  ++K TRPYLIEIM SD IQISNLTL+NSPSWNVHPVYSS ++I+GLTILAPV S 
Sbjct  229  KFRQGQMKNTRPYLIEIMFSDHIQISNLTLINSPSWNVHPVYSSFVVIKGLTILAPVDSP  288

Query  27   NTDGINPDS  1
            NTDGI+PDS
Sbjct  289  NTDGIDPDS  297



>ref|XP_008810119.1| PREDICTED: probable polygalacturonase isoform X1 [Phoenix dactylifera]
Length=493

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 164/208 (79%), Gaps = 0/208 (0%)
 Frame = -1

Query  624  SGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWL  445
            +G    A   RA++AS+ DFG VGDG T NT+AF  A+ NLS Y+A GGA L+VP GKWL
Sbjct  54   AGEAAGAPGCRAYTASLTDFGAVGDGATSNTRAFAAAVANLSLYAADGGAMLVVPPGKWL  113

Query  444  TGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVD  265
            TG FNLTSHFTLFLH+DA +LASQDI+ WP++ PLPSYG GRD  GGR  + I GSNL D
Sbjct  114  TGPFNLTSHFTLFLHRDAEILASQDIDEWPIIDPLPSYGRGRDLPGGRYSNFIMGSNLTD  173

Query  264  VVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPV  85
            VVITG+NGTI+GQG +WW +F   KL+YTR YL+EIM+SD I ISNLT  +SP+WN+HPV
Sbjct  174  VVITGDNGTINGQGKIWWDKFHDDKLEYTRGYLLEIMYSDHILISNLTFKHSPAWNLHPV  233

Query  84   YSSNIIIQGLTILAPVKSANTDGINPDS  1
            YSSN+++  +TILAPV S NTDGINPDS
Sbjct  234  YSSNVLVSNVTILAPVDSPNTDGINPDS  261



>ref|XP_009149779.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=469

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = -1

Query  624  SGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWL  445
            SG E+ A++ R H A I DFGGVGDGKT NTKAFR A++ LS  ++ GGA+L+VP GKWL
Sbjct  31   SGIEFPALNCRKHKAVITDFGGVGDGKTSNTKAFRTALSKLSDLASDGGAQLLVPPGKWL  90

Query  444  TGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNLV  268
            TGSFNLTSHFTLF+ K A +LASQD + WP+VPPLPSYG GRD +G GR  SLI G+NL 
Sbjct  91   TGSFNLTSHFTLFIQKGATILASQDESEWPVVPPLPSYGKGRDGTGTGRFNSLISGTNLT  150

Query  267  DVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHP  88
            DVVITGNNGTI+GQG  WW +F+ K+   TRPY+IE++ S  IQISN+TL++SPSW++HP
Sbjct  151  DVVITGNNGTINGQGQYWWDKFKKKQFNLTRPYMIELLFSQNIQISNITLVDSPSWHIHP  210

Query  87   VYSSNIIIQGLTILAPVKSANTDGINPDS  1
            VY +N+I++ +TI+APV   NTDGINPDS
Sbjct  211  VYCNNVIVKSITIIAPVDVPNTDGINPDS  239



>gb|ABE66001.1| glycoside hydrolase family 28 protein/polygalacturonase family 
protein [Arabidopsis thaliana]
Length=416

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKW  448
            +S  E+SA++ R HSA + DFG VGDGKT NTKAFR A++ LS+ +  GGA+L+VP GKW
Sbjct  30   TSKIEFSALNCRKHSAILTDFGAVGDGKTSNTKAFRNAISKLSQMATDGGAQLVVPPGKW  89

Query  447  LTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNL  271
            LTGSFNLTSHFTLF+ + A +LASQD + WP++ PLPSYG GRD +G GR  SLI G+NL
Sbjct  90   LTGSFNLTSHFTLFIQRGATILASQDESEWPVIAPLPSYGKGRDGTGTGRFNSLISGTNL  149

Query  270  VDVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVH  91
             DVVITGNNGTI+GQG  WW +F+ K+ K TRPYLIEI+ S  IQISN+TL++SPSWN+H
Sbjct  150  TDVVITGNNGTINGQGQYWWDKFKKKQFKITRPYLIEILFSKNIQISNITLIDSPSWNIH  209

Query  90   PVYSSNIIIQGLTILAPVKSANTDGINPDS  1
            PVY +++I++ +T+LAPV   NTDGINPDS
Sbjct  210  PVYCNSVIVKSVTVLAPVTVPNTDGINPDS  239



>ref|NP_190464.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 emb|CAB62015.1| endo-polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAY78763.1| glycoside hydrolase family 28 protein [Arabidopsis thaliana]
 gb|AEE78476.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=469

 Score =   287 bits (735),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKW  448
            +S  E+SA++ R HSA + DFG VGDGKT NTKAFR A++ LS+ +  GGA+L+VP GKW
Sbjct  30   TSKIEFSALNCRKHSAILTDFGAVGDGKTSNTKAFRNAISKLSQMATDGGAQLVVPPGKW  89

Query  447  LTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNL  271
            LTGSFNLTSHFTLF+ + A +LASQD + WP++ PLPSYG GRD +G GR  SLI G+NL
Sbjct  90   LTGSFNLTSHFTLFIQRGATILASQDESEWPVIAPLPSYGKGRDGTGTGRFNSLISGTNL  149

Query  270  VDVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVH  91
             DVVITGNNGTI+GQG  WW +F+ K+ K TRPYLIEI+ S  IQISN+TL++SPSWN+H
Sbjct  150  TDVVITGNNGTINGQGQYWWDKFKKKQFKITRPYLIEILFSKNIQISNITLIDSPSWNIH  209

Query  90   PVYSSNIIIQGLTILAPVKSANTDGINPDS  1
            PVY +++I++ +T+LAPV   NTDGINPDS
Sbjct  210  PVYCNSVIVKSVTVLAPVTVPNTDGINPDS  239



>ref|XP_002875935.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52194.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   286 bits (733),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKW  448
            SSG  +SA++ R HSA + DFG VGDGKT NT AF++A++ LS+ +  GGA+L+VP GKW
Sbjct  30   SSGIRFSALNCRKHSAILTDFGAVGDGKTSNTNAFKKAISKLSQMATDGGAQLVVPPGKW  89

Query  447  LTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNL  271
            LTGSFNLTSHFTLF+ + A +LASQD + WP++ PLPSYG GRD +G GR  SLI G+NL
Sbjct  90   LTGSFNLTSHFTLFIQRGATILASQDESEWPVIAPLPSYGKGRDGTGTGRFNSLISGTNL  149

Query  270  VDVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVH  91
             DVVITGNNGTI+GQG  WW +F+ K+ K TRPYLIE++ S  IQISN+TL++SPSWN+H
Sbjct  150  TDVVITGNNGTINGQGQYWWDKFKKKQFKLTRPYLIELLFSKNIQISNITLIDSPSWNIH  209

Query  90   PVYSSNIIIQGLTILAPVKSANTDGINPDS  1
            PVY +N+I++ +T+LAPV   NTDGINPDS
Sbjct  210  PVYCNNVIVKSVTVLAPVTVPNTDGINPDS  239



>ref|XP_002273669.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=478

 Score =   287 bits (734),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 169/205 (82%), Gaps = 1/205 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y A+  R HSA + DFG  GDGKT+NTKAF+ A+++LS+++  GGA+LIVP GKWLTGS
Sbjct  42   KYKALRCRKHSAVLTDFGATGDGKTINTKAFKSAIDHLSQFADDGGAELIVPPGKWLTGS  101

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTL++ KDAV+L +QD + +PL+  LPSYG GRD  GGR  SLIFG+NL DVVI
Sbjct  102  FNLTSHFTLYIDKDAVILGAQDESAYPLIEVLPSYGVGRD-GGGRHSSLIFGTNLTDVVI  160

Query  255  TGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSS  76
            TG NGT++GQG  WW +FR+KK   TRPYLIEIM+S+ +QISNLTL++SPSWNVHPVYS 
Sbjct  161  TGGNGTLNGQGKYWWDKFRAKKYNDTRPYLIEIMYSNHVQISNLTLIDSPSWNVHPVYSR  220

Query  75   NIIIQGLTILAPVKSANTDGINPDS  1
            N++++ LTILAP+ S NTDGINPDS
Sbjct  221  NVLVKDLTILAPIDSPNTDGINPDS  245



>ref|XP_010024966.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW90637.1| hypothetical protein EUGRSUZ_A02740 [Eucalyptus grandis]
Length=458

 Score =   286 bits (732),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 169/207 (82%), Gaps = 0/207 (0%)
 Frame = -1

Query  621  GREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLT  442
            G  Y AI+ R H+AS+ DFGGVGDG+T NT+AFR A+ NLS+Y+  GGA+L+VPAGKWLT
Sbjct  24   GESYPAINCRKHAASLVDFGGVGDGRTSNTEAFRRAVANLSEYALDGGAQLVVPAGKWLT  83

Query  441  GSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDV  262
            GSFNLTSHFTL+L  +A +LASQ+ + WP V  LPSYG GR+  G R  SLIFG NL DV
Sbjct  84   GSFNLTSHFTLYLDGNATILASQNESEWPQVAILPSYGAGRNAHGRRFSSLIFGINLTDV  143

Query  261  VITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVY  82
            VITGNNGTI GQGA WW +FR ++L +T PYLIEIM+S+ +QISNLTL++SPSW VHP+Y
Sbjct  144  VITGNNGTIHGQGAYWWDKFRKEELNWTLPYLIEIMYSNWVQISNLTLVDSPSWFVHPIY  203

Query  81   SSNIIIQGLTILAPVKSANTDGINPDS  1
            SSNI++Q LTILAPV S +TDG++PDS
Sbjct  204  SSNILVQRLTILAPVDSPSTDGVDPDS  230



>ref|XP_010426397.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=464

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            E+ A+  R HSA + DFG VGDGKT NTKAFREA++ LS+ +  GGA+L+VP GKWLTGS
Sbjct  34   EFQALRCRKHSAILTDFGAVGDGKTSNTKAFREAISKLSQMATDGGAQLVVPPGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNLVDVV  259
            FNLTSHFTLF+   A +LASQD + WP++ PLPSYG GRD +G GR  SLI G+NL DVV
Sbjct  94   FNLTSHFTLFIQHGATILASQDESEWPVIGPLPSYGMGRDGNGAGRFNSLISGTNLTDVV  153

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITGNNGTI+GQG  WW +F+ K+ K TRPYLIE++ S +IQISN+TL++SPSWN+HPVY 
Sbjct  154  ITGNNGTINGQGQYWWDKFKKKQFKLTRPYLIELLFSKKIQISNITLIDSPSWNIHPVYC  213

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
             N+II+ +TILAPV   NTDGINPDS
Sbjct  214  KNVIIKHVTILAPVTVPNTDGINPDS  239



>emb|CDY08095.1| BnaA06g16310D [Brassica napus]
Length=495

 Score =   285 bits (730),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 167/209 (80%), Gaps = 1/209 (0%)
 Frame = -1

Query  624  SGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWL  445
            SG E+ A++ R H A I DFGGVGDGKT NTKAFR A++ LS  ++ GGA+L+VP GKWL
Sbjct  57   SGIEFPALNCRKHKAVITDFGGVGDGKTSNTKAFRTALSKLSDLASDGGAQLVVPPGKWL  116

Query  444  TGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNLV  268
            TGSFNLTSHFTLF+ K A +LASQD + WP+V PLPSYG GRD +G GR  SLI G+NL 
Sbjct  117  TGSFNLTSHFTLFIQKGATILASQDESEWPVVAPLPSYGKGRDGTGTGRFNSLISGTNLT  176

Query  267  DVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHP  88
            DVVITGNNGTI+GQG  WW +F+ K+   TRPY+IE++ S  IQISN+TL++SPSW++HP
Sbjct  177  DVVITGNNGTINGQGQYWWDKFKKKQFNLTRPYMIELLFSQNIQISNITLVDSPSWHIHP  236

Query  87   VYSSNIIIQGLTILAPVKSANTDGINPDS  1
            VY +N+I++ +TI+APV   NTDGINPDS
Sbjct  237  VYCNNVIVKSITIIAPVDVPNTDGINPDS  265



>gb|KFK27673.1| hypothetical protein AALP_AA8G413900 [Arabis alpina]
Length=404

 Score =   282 bits (722),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EYSA++ R H A + +FG VGDGKT NTKAFR+A++ L   +A GG +LIVP GKWLTGS
Sbjct  46   EYSALNCRKHRAVLTEFGAVGDGKTSNTKAFRDAISTLRPMAADGGVQLIVPPGKWLTGS  105

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLF+ K A LLASQD + +P+V PLPSYG GRD  G R  SLI GSNL DV+I
Sbjct  106  FNLTSHFTLFIQKGATLLASQDESEYPVVAPLPSYGRGRDAPGPRFASLISGSNLTDVII  165

Query  255  TGNNGTIDGQGALWWQQFRSKKLK-YTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            TGNNGTIDGQG  WW +F+S   K  TRPYLIEI+ S  +QIS++TL++SPSWN+HPVY 
Sbjct  166  TGNNGTIDGQGKYWWVKFKSGGFKSITRPYLIEIIFSQNVQISDVTLIDSPSWNIHPVYC  225

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
             N+I++G+TILAP+ S NTDGI+PDS
Sbjct  226  ENVIVKGVTILAPIDSPNTDGIDPDS  251



>ref|XP_006292567.1| hypothetical protein CARUB_v10018803mg [Capsella rubella]
 gb|EOA25465.1| hypothetical protein CARUB_v10018803mg [Capsella rubella]
Length=471

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 168/211 (80%), Gaps = 2/211 (1%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGG-AKLIVPAGK  451
            +S  E+SA+  R HSA + DFG VGDGKT NTKAF++A++ LS+ +  GG A+L+VP GK
Sbjct  30   TSKIEFSALRCRKHSAILTDFGAVGDGKTSNTKAFKKAISKLSQMATDGGGAQLVVPPGK  89

Query  450  WLTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSN  274
            WLTGSFNLTSHFTLF+ + A +LASQD + WP++ PLPSYG GRD +G GR  SLI GSN
Sbjct  90   WLTGSFNLTSHFTLFIQQGATILASQDESEWPVIAPLPSYGKGRDGTGAGRFNSLISGSN  149

Query  273  LVDVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNV  94
            L DVVITGNNGTI+GQG  WW +F+ K+ K TRPYLIE++ S  IQISN+TL++SPSWN+
Sbjct  150  LTDVVITGNNGTINGQGQYWWDKFKKKQFKLTRPYLIELLFSKNIQISNITLIDSPSWNI  209

Query  93   HPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
            HPVY  N+II+ +T+LAPV   NTDGINPDS
Sbjct  210  HPVYCKNVIIKSVTVLAPVTVPNTDGINPDS  240



>ref|XP_010503541.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=464

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            E+ A+  R HSA + DFG VGDGKT NTKAF++A++ LS+ +  GGA+L++P GKWLTGS
Sbjct  34   EFQALRCRKHSAILTDFGAVGDGKTSNTKAFKKAISKLSQMATDGGAQLVIPPGKWLTGS  93

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNLVDVV  259
            FNLTSHFTLF+ + A +LASQD + WP++ PLPSYG GRD +G GR  SLI G+NL DVV
Sbjct  94   FNLTSHFTLFIQQGATILASQDESEWPVIGPLPSYGMGRDGNGAGRFNSLISGTNLTDVV  153

Query  258  ITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            ITGNNGTI+GQG  WW +F  K+ K TRPYLIE++ S +IQISN+TL++SPSWN+HPVY 
Sbjct  154  ITGNNGTINGQGQYWWDKFEKKQFKVTRPYLIELLFSKKIQISNITLIDSPSWNIHPVYC  213

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
             N+II+ +TILAPV   NTDGINPDS
Sbjct  214  KNVIIKHVTILAPVTVPNTDGINPDS  239



>ref|XP_010450744.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=459

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 165/209 (79%), Gaps = 1/209 (0%)
 Frame = -1

Query  624  SGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWL  445
            S  ++ A+S R HSA + DFG VGDGKT NTKAF++A++ LS+ +  GGA+L+VP GKWL
Sbjct  26   SKVKFQALSCRKHSAILTDFGAVGDGKTSNTKAFKKAISKLSQMATDGGAQLVVPPGKWL  85

Query  444  TGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNLV  268
            TGSFNLTSHFTLF+   A +LASQD + WP++ PLPSYG GRD +G GR  SLI G+NL 
Sbjct  86   TGSFNLTSHFTLFIQHGATILASQDESEWPVIGPLPSYGMGRDGTGAGRFNSLISGTNLT  145

Query  267  DVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHP  88
            DVVITGNNGTI+GQG  WW +F  K+ K TRPYLIE++ S  IQISN+TL++SPSWN+HP
Sbjct  146  DVVITGNNGTINGQGQYWWDKFEKKQFKLTRPYLIELLFSTNIQISNITLIDSPSWNIHP  205

Query  87   VYSSNIIIQGLTILAPVKSANTDGINPDS  1
            VY  N+II+ +TILAPV   NTDGINPDS
Sbjct  206  VYCENVIIKSVTILAPVTVPNTDGINPDS  234



>ref|XP_006404198.1| hypothetical protein EUTSA_v10011050mg [Eutrema salsugineum]
 gb|ESQ45651.1| hypothetical protein EUTSA_v10011050mg [Eutrema salsugineum]
Length=465

 Score =   281 bits (720),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 167/208 (80%), Gaps = 1/208 (0%)
 Frame = -1

Query  627  SSGREYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKW  448
            +SG E SA++ R HSA + DFGGVGDGKT NTKAF  A++ LS+ ++ GGA+L+VP GKW
Sbjct  30   TSGIELSALNCRKHSALLTDFGGVGDGKTSNTKAFTNAISKLSQMASDGGAQLVVPPGKW  89

Query  447  LTGSFNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSG-GRCISLIFGSNL  271
            LTGSFNLTSHFTLF+ + A +LASQD + WP++ PLPSYG GRD +G GR  SLI GSNL
Sbjct  90   LTGSFNLTSHFTLFIQQGATILASQDESEWPVIGPLPSYGKGRDGTGTGRFNSLISGSNL  149

Query  270  VDVVITGNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVH  91
             DVVITGNNGTI+GQG  WW +F+ K+   TRPYLIE++ S  IQISN+TL++SPSWN+H
Sbjct  150  TDVVITGNNGTINGQGQYWWDKFKKKQFNVTRPYLIELLFSKNIQISNITLIDSPSWNIH  209

Query  90   PVYSSNIIIQGLTILAPVKSANTDGINP  7
            PVY +N+I++ +T+LAPV   NTDGINP
Sbjct  210  PVYCNNVIVKSVTVLAPVTVPNTDGINP  237



>ref|XP_002513652.1| Exopolygalacturonase precursor, putative [Ricinus communis]
 gb|EEF49055.1| Exopolygalacturonase precursor, putative [Ricinus communis]
Length=452

 Score =   281 bits (718),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -1

Query  612  YSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSF  433
            Y+AI+ R H+A + DFGGVGDGKTLNTKAF+ A+ NLS+Y+  GGA+LIVPAGKWLTGSF
Sbjct  48   YAAINCRKHTAFLTDFGGVGDGKTLNTKAFQAAIANLSQYADDGGAELIVPAGKWLTGSF  107

Query  432  NLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVIT  253
            NLTSHFTLFLH+ A +LASQ+   +P++  LPS+G  +D   GR  SLI G NL DVVIT
Sbjct  108  NLTSHFTLFLHRGATILASQNEADFPIIAALPSFGVEKDFPDGRFSSLIRGINLTDVVIT  167

Query  252  GNNGTIDGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSN  73
            GNNGTIDGQGA WW +F     K +RP LI+IM++DQ+QISN+TL+NSPSW+VHPVY SN
Sbjct  168  GNNGTIDGQGAPWWDKFEKGLFKASRPLLIDIMYTDQLQISNITLVNSPSWHVHPVYCSN  227

Query  72   IIIQGLTILAPVKSANTDGINP  7
            +++QG+TI+APV+  NTDGINP
Sbjct  228  VLVQGVTIIAPVEVPNTDGINP  249



>ref|XP_009382257.1| PREDICTED: probable polygalacturonase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 160/196 (82%), Gaps = 0/196 (0%)
 Frame = -1

Query  588  HSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLTSHFTL  409
            H AS+ DFGGVGDG T NT AF  A+ NLSK +  GGA L+VPAG+WLTG FNL +HFTL
Sbjct  59   HVASLTDFGGVGDGVTSNTAAFAAAVANLSKVAYDGGAMLVVPAGRWLTGPFNLANHFTL  118

Query  408  FLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNNGTIDG  229
            FL  DAV+LA+QDIN WP++ PLPSYG GRD +GGR  +LI G NL DVVITGNNGTIDG
Sbjct  119  FLDHDAVILATQDINEWPIIDPLPSYGRGRDAAGGRYSNLIMGYNLTDVVITGNNGTIDG  178

Query  228  QGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIIIQGLTI  49
            QG  WW+ FR+K+L YTR YLIE+M+  Q+ ISN+TL+NSPSWNVHPVYSS++I+ G+TI
Sbjct  179  QGETWWKMFRNKELNYTRGYLIELMYCKQVLISNITLVNSPSWNVHPVYSSHVIVSGITI  238

Query  48   LAPVKSANTDGINPDS  1
            LAPV S NTDGINPDS
Sbjct  239  LAPVNSPNTDGINPDS  254



>gb|KFK32698.1| hypothetical protein AALP_AA6G277200 [Arabis alpina]
Length=477

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            EY AI+ R HSA I +FG VGDGKT NTKAF+EA+  L+  +A GG +LIVP GKWLTGS
Sbjct  45   EYMAINCRKHSAVITEFGAVGDGKTSNTKAFKEAITKLAPKAADGGVQLIVPPGKWLTGS  104

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLF+ + A +LASQD + +P+V PLPSYG GRD +G    SLI G+NL DVVI
Sbjct  105  FNLTSHFTLFIQQGATILASQDESEYPVVAPLPSYGQGRDAAGPTFASLISGTNLTDVVI  164

Query  255  TGNNGTIDGQGALWWQQFRSKKLK-YTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            TGNNGTI+GQG  WW ++RS   K  TRPY IEIM S  +QISN+T+++SP+WNVHPVY 
Sbjct  165  TGNNGTINGQGKYWWVKYRSGGFKSITRPYTIEIMFSQNVQISNITIVDSPAWNVHPVYC  224

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            +N+I++G+TILAP+ S NTDGINPDS
Sbjct  225  NNVIVKGVTILAPIDSPNTDGINPDS  250



>ref|XP_010933983.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=492

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = -1

Query  594  RAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLTSHF  415
            RA+ AS+ DFG VGDG T NT AF  A+ NLS Y+AHGGA L VP GKWLTG FNLTSHF
Sbjct  63   RAYKASLTDFGAVGDGTTSNTHAFAAAVANLSLYAAHGGAMLFVPPGKWLTGPFNLTSHF  122

Query  414  TLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNNGTI  235
            TLFLH+DA +LASQDI+ WP++ PLPSYG GRD  GGR  + I GSNL DV+ITG+NGTI
Sbjct  123  TLFLHRDAEILASQDIDEWPIIDPLPSYGRGRDLPGGRYSNFIMGSNLTDVIITGDNGTI  182

Query  234  DGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIIIQGL  55
            +GQG +WW +F   KL+YTR Y +EIM+SD I ISNL   ++P+WN+HPVYSSN+++  +
Sbjct  183  NGQGKVWWDKFHDNKLEYTRGYFVEIMYSDHILISNLIFKDAPAWNLHPVYSSNVLVLNV  242

Query  54   TILAPVKSANTDGINPDS  1
            TILAPV S NTDGI+PDS
Sbjct  243  TILAPVTSPNTDGIDPDS  260



>emb|CDY20264.1| BnaC04g36920D [Brassica napus]
Length=478

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  615  EYSAISNRAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGS  436
            +Y AI+ R HSA I +FG VGDGKT NTKAF+EA+  L+  +A GG +LIVP GKWLTGS
Sbjct  47   QYDAINCRKHSAVITEFGAVGDGKTSNTKAFKEAITKLAPKAADGGVQLIVPPGKWLTGS  106

Query  435  FNLTSHFTLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVI  256
            FNLTSHFTLF+ KDA +LASQD + +P+V PLPSYG GRD +G    SLI G+NL DVVI
Sbjct  107  FNLTSHFTLFIQKDATILASQDESEYPVVAPLPSYGQGRDAAGPTFASLISGTNLTDVVI  166

Query  255  TGNNGTIDGQGALWWQQFRSKKLK-YTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYS  79
            TGNNGTI+GQG  WW ++RS   K  TRPY +E++ S  +QISN+T+++SP+WN+HPVY 
Sbjct  167  TGNNGTINGQGKYWWVKYRSGGFKNITRPYTLELVFSKDVQISNITIVDSPAWNIHPVYC  226

Query  78   SNIIIQGLTILAPVKSANTDGINPDS  1
            +N+I++G+TILAP+ S NTDGINPDS
Sbjct  227  TNVIVKGVTILAPIDSPNTDGINPDS  252



>ref|XP_010933982.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=501

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = -1

Query  594  RAHSASIKDFGGVGDGKTLNTKAFREAMNNLSKYSAHGGAKLIVPAGKWLTGSFNLTSHF  415
            RA+ AS+ DFG VGDG T NT AF  A+ NLS Y+AHGGA L VP GKWLTG FNLTSHF
Sbjct  72   RAYKASLTDFGAVGDGTTSNTHAFAAAVANLSLYAAHGGAMLFVPPGKWLTGPFNLTSHF  131

Query  414  TLFLHKDAVLLASQDINTWPLVPPLPSYGHGRDTSGGRCISLIFGSNLVDVVITGNNGTI  235
            TLFLH+DA +LASQDI+ WP++ PLPSYG GRD  GGR  + I GSNL DV+ITG+NGTI
Sbjct  132  TLFLHRDAEILASQDIDEWPIIDPLPSYGRGRDLPGGRYSNFIMGSNLTDVIITGDNGTI  191

Query  234  DGQGALWWQQFRSKKLKYTRPYLIEIMHSDQIQISNLTLLNSPSWNVHPVYSSNIIIQGL  55
            +GQG +WW +F   KL+YTR Y +EIM+SD I ISNL   ++P+WN+HPVYSSN+++  +
Sbjct  192  NGQGKVWWDKFHDNKLEYTRGYFVEIMYSDHILISNLIFKDAPAWNLHPVYSSNVLVLNV  251

Query  54   TILAPVKSANTDGINPDS  1
            TILAPV S NTDGI+PDS
Sbjct  252  TILAPVTSPNTDGIDPDS  269



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3249488224448