BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25227_g1_i1 len=369 path=[294:0-134 429:135-218 513:219-289
1953:290-326 4815:327-345 4834:346-349 4838:350-352 3148:353-368]

Length=369
                                                                      Score     E

ref|XP_011092828.1|  PREDICTED: probable polygalacturonase              206   5e-61   
ref|XP_009599786.1|  PREDICTED: probable polygalacturonase isofor...    203   2e-60   
ref|XP_009599780.1|  PREDICTED: probable polygalacturonase isofor...    203   3e-60   
gb|EPS72197.1|  hypothetical protein M569_02558                         202   5e-60   
ref|XP_004240097.1|  PREDICTED: probable polygalacturonase              201   2e-59   
gb|EYU35105.1|  hypothetical protein MIMGU_mgv1a005694mg                200   3e-59   
ref|XP_009762711.1|  PREDICTED: probable polygalacturonase isofor...    200   4e-59   
ref|XP_002511903.1|  polygalacturonase, putative                        199   7e-59   Ricinus communis
ref|XP_009762710.1|  PREDICTED: probable polygalacturonase isofor...    199   7e-59   
ref|XP_009767883.1|  PREDICTED: probable polygalacturonase              199   1e-58   
ref|XP_009624373.1|  PREDICTED: probable polygalacturonase              199   1e-58   
gb|KDP28587.1|  hypothetical protein JCGZ_14358                         198   3e-58   
ref|XP_004510753.1|  PREDICTED: probable polygalacturonase-like         197   4e-58   
ref|XP_003548644.2|  PREDICTED: probable polygalacturonase-like i...    198   4e-58   
ref|XP_006598941.1|  PREDICTED: probable polygalacturonase-like i...    198   4e-58   
ref|XP_006345582.1|  PREDICTED: probable polygalacturonase-like i...    197   5e-58   
ref|XP_006345581.1|  PREDICTED: probable polygalacturonase-like i...    197   5e-58   
gb|KHN46704.1|  Putative polygalacturonase                              197   5e-58   
ref|XP_004492778.1|  PREDICTED: probable polygalacturonase-like         197   6e-58   
ref|XP_006491165.1|  PREDICTED: probable polygalacturonase-like         197   9e-58   
gb|KHN26935.1|  Putative polygalacturonase                              194   1e-57   
ref|XP_006444979.1|  hypothetical protein CICLE_v10019597mg             197   1e-57   
ref|XP_007139799.1|  hypothetical protein PHAVU_008G059700g             196   2e-57   
ref|XP_003533597.1|  PREDICTED: probable polygalacturonase-like         195   4e-57   
ref|XP_003529926.1|  PREDICTED: probable polygalacturonase-like         195   4e-57   
ref|XP_006339619.1|  PREDICTED: probable polygalacturonase-like         195   4e-57   
gb|KHN26934.1|  Putative polygalacturonase                              195   4e-57   
emb|CBI34379.3|  unnamed protein product                                194   5e-57   
ref|XP_003552411.1|  PREDICTED: probable polygalacturonase              194   7e-57   
ref|XP_010112958.1|  putative polygalacturonase                         194   7e-57   
ref|XP_004295492.1|  PREDICTED: probable polygalacturonase-like         194   1e-56   
ref|XP_003528838.1|  PREDICTED: probable polygalacturonase              194   1e-56   
ref|XP_004229920.2|  PREDICTED: probable polygalacturonase              193   2e-56   
ref|XP_002278930.1|  PREDICTED: probable polygalacturonase              193   2e-56   Vitis vinifera
gb|AAP33475.1|  polygalacturonase-like protein                          193   2e-56   Fragaria x ananassa
ref|XP_010089056.1|  putative polygalacturonase                         192   2e-56   
emb|CBI40426.3|  unnamed protein product                                190   3e-56   
ref|XP_004298828.1|  PREDICTED: probable polygalacturonase-like         193   3e-56   
ref|XP_007144550.1|  hypothetical protein PHAVU_007G165300g             192   3e-56   
ref|XP_007219266.1|  hypothetical protein PRUPE_ppa018224mg             192   4e-56   
ref|XP_004306749.1|  PREDICTED: probable polygalacturonase-like         192   5e-56   
gb|KHM99951.1|  Putative polygalacturonase                              191   6e-56   
gb|KEH21119.1|  polygalacturonase/glycoside hydrolase family protein    192   6e-56   
ref|XP_006386609.1|  hypothetical protein POPTR_0002s16390g             189   7e-56   
gb|KHF98838.1|  putative polygalacturonase                              186   8e-56   
ref|XP_010055093.1|  PREDICTED: probable polygalacturonase              191   8e-56   
ref|XP_006580552.1|  PREDICTED: probable polygalacturonase-like i...    191   9e-56   
ref|XP_007209970.1|  hypothetical protein PRUPE_ppa004996mg             191   1e-55   
ref|XP_004172137.1|  PREDICTED: probable polygalacturonase-like         191   1e-55   
ref|XP_004133855.1|  PREDICTED: probable polygalacturonase-like         191   1e-55   
ref|XP_003525377.2|  PREDICTED: probable polygalacturonase-like i...    191   1e-55   
ref|XP_003633958.1|  PREDICTED: probable polygalacturonase              191   1e-55   
ref|XP_010255225.1|  PREDICTED: probable polygalacturonase isofor...    191   2e-55   
ref|XP_008438007.1|  PREDICTED: probable polygalacturonase              191   2e-55   
gb|KDP25392.1|  hypothetical protein JCGZ_20548                         191   2e-55   
sp|A7PZL3.1|PGLR_VITVI  RecName: Full=Probable polygalacturonase;...    191   2e-55   Vitis vinifera
ref|XP_010255224.1|  PREDICTED: probable polygalacturonase isofor...    191   2e-55   
ref|XP_010276903.1|  PREDICTED: probable polygalacturonase isofor...    189   3e-55   
gb|KHN16795.1|  Putative polygalacturonase                              189   3e-55   
ref|XP_011023292.1|  PREDICTED: probable polygalacturonase isofor...    190   3e-55   
ref|XP_011023291.1|  PREDICTED: probable polygalacturonase isofor...    190   3e-55   
ref|XP_010255223.1|  PREDICTED: probable polygalacturonase isofor...    191   3e-55   
ref|XP_008343414.1|  PREDICTED: probable polygalacturonase              190   3e-55   
ref|XP_002301370.1|  polygalacturonase-like family protein              189   3e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010276902.1|  PREDICTED: probable polygalacturonase isofor...    190   4e-55   
ref|XP_006476506.1|  PREDICTED: probable polygalacturonase-like         190   4e-55   
ref|XP_009349812.1|  PREDICTED: probable polygalacturonase              190   4e-55   
ref|XP_008238946.1|  PREDICTED: probable polygalacturonase              189   5e-55   
gb|ACU20792.1|  unknown                                                 183   5e-55   Glycine max [soybeans]
ref|XP_006439488.1|  hypothetical protein CICLE_v10019941mg             189   5e-55   
ref|XP_006343936.1|  PREDICTED: probable polygalacturonase-like         189   6e-55   
gb|KDO76318.1|  hypothetical protein CISIN_1g011659mg                   189   6e-55   
ref|XP_004245570.1|  PREDICTED: probable polygalacturonase              189   6e-55   
ref|XP_009793070.1|  PREDICTED: probable polygalacturonase              189   7e-55   
ref|XP_009395434.1|  PREDICTED: probable polygalacturonase isofor...    189   7e-55   
ref|XP_009395433.1|  PREDICTED: probable polygalacturonase isofor...    189   8e-55   
ref|XP_003532926.1|  PREDICTED: probable polygalacturonase-like i...    189   1e-54   
ref|XP_010469084.1|  PREDICTED: probable polygalacturonase              189   1e-54   
ref|XP_007051732.1|  Polygalacturonase, putative isoform 2              189   1e-54   
ref|XP_007051731.1|  Polygalacturonase, putative isoform 1              189   1e-54   
ref|XP_006584731.1|  PREDICTED: probable polygalacturonase-like i...    189   1e-54   
ref|XP_007160099.1|  hypothetical protein PHAVU_002G292300g             188   2e-54   
ref|XP_006402475.1|  hypothetical protein EUTSA_v10005939mg             187   2e-54   
ref|XP_010276899.1|  PREDICTED: probable polygalacturonase isofor...    188   2e-54   
ref|XP_004503680.1|  PREDICTED: probable polygalacturonase-like i...    187   2e-54   
gb|AAZ32910.1|  polygalacturonase-like protein                          180   3e-54   Medicago sativa [alfalfa]
gb|KHG15710.1|  hypothetical protein F383_10492                         187   3e-54   
gb|KHG15709.1|  hypothetical protein F383_10492                         187   5e-54   
ref|XP_010053221.1|  PREDICTED: probable polygalacturonase              187   5e-54   
ref|XP_010413390.1|  PREDICTED: probable polygalacturonase              187   5e-54   
ref|XP_009604283.1|  PREDICTED: probable polygalacturonase              187   6e-54   
ref|XP_010676424.1|  PREDICTED: probable polygalacturonase              186   7e-54   
ref|XP_006291035.1|  hypothetical protein CARUB_v10017147mg             186   1e-53   
gb|AFK37962.1|  unknown                                                 186   1e-53   
gb|EYU23462.1|  hypothetical protein MIMGU_mgv1a006147mg                185   1e-53   
gb|AFK44529.1|  unknown                                                 186   1e-53   
ref|NP_191708.1|  polygalacturonase-like protein                        186   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523770.1|  PREDICTED: probable polygalacturonase isofor...    185   2e-53   
ref|XP_010523769.1|  PREDICTED: probable polygalacturonase isofor...    185   2e-53   
ref|XP_008794781.1|  PREDICTED: probable polygalacturonase isofor...    185   3e-53   
ref|XP_010228133.1|  PREDICTED: probable polygalacturonase isofor...    185   3e-53   
ref|XP_010228132.1|  PREDICTED: probable polygalacturonase isofor...    185   3e-53   
ref|XP_010941157.1|  PREDICTED: probable polygalacturonase              185   3e-53   
ref|XP_008794778.1|  PREDICTED: probable polygalacturonase isofor...    185   3e-53   
dbj|BAJ90091.1|  predicted protein                                      185   3e-53   
ref|XP_008794779.1|  PREDICTED: probable polygalacturonase isofor...    185   4e-53   
ref|XP_002876618.1|  glycoside hydrolase family 28 protein              184   4e-53   
ref|XP_008794777.1|  PREDICTED: probable polygalacturonase isofor...    184   5e-53   
emb|CDP20376.1|  unnamed protein product                                184   5e-53   
ref|XP_009363435.1|  PREDICTED: probable polygalacturonase              184   8e-53   
ref|XP_004234221.1|  PREDICTED: probable polygalacturonase              183   9e-53   
gb|EMT00190.1|  Putative polygalacturonase                              182   9e-53   
ref|XP_004503678.1|  PREDICTED: probable polygalacturonase-like i...    184   1e-52   
ref|XP_007038809.1|  Pectin lyase-like superfamily protein isoform 2    183   1e-52   
gb|KHG23155.1|  putative polygalacturonase                              182   2e-52   
ref|XP_007038808.1|  Pectin lyase-like superfamily protein isoform 1    182   2e-52   
gb|ACL54166.1|  unknown                                                 182   2e-52   Zea mays [maize]
ref|XP_006372397.1|  glycoside hydrolase family 28 family protein       182   3e-52   
ref|XP_010436421.1|  PREDICTED: probable polygalacturonase              181   3e-52   
ref|XP_010436419.1|  PREDICTED: probable polygalacturonase              179   3e-52   
ref|XP_011046019.1|  PREDICTED: probable polygalacturonase              181   3e-52   
ref|XP_004496831.1|  PREDICTED: probable polygalacturonase-like         182   3e-52   
emb|CDY65355.1|  BnaC08g49000D                                          182   4e-52   
ref|XP_003622464.1|  Polygalacturonase-like protein                     182   4e-52   
emb|CDP12065.1|  unnamed protein product                                182   4e-52   
ref|XP_009345122.1|  PREDICTED: probable polygalacturonase              182   4e-52   
ref|XP_002509850.1|  polygalacturonase, putative                        181   6e-52   Ricinus communis
ref|XP_002299511.1|  hypothetical protein POPTR_0001s09790g             181   6e-52   Populus trichocarpa [western balsam poplar]
emb|CDY48913.1|  BnaA09g39240D                                          181   6e-52   
ref|XP_011029346.1|  PREDICTED: probable polygalacturonase              181   6e-52   
ref|XP_011022627.1|  PREDICTED: probable polygalacturonase              181   7e-52   
ref|XP_010541188.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    181   7e-52   
ref|XP_010055092.1|  PREDICTED: probable polygalacturonase isofor...    181   7e-52   
ref|XP_010055091.1|  PREDICTED: probable polygalacturonase isofor...    181   7e-52   
ref|XP_004496830.1|  PREDICTED: probable polygalacturonase-like         181   8e-52   
dbj|BAD67712.1|  putative polygalacturonase                             181   8e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004496829.1|  PREDICTED: probable polygalacturonase-like         181   8e-52   
ref|XP_003624874.1|  hypothetical protein MTR_7g088550                  181   9e-52   
ref|XP_004964295.1|  PREDICTED: probable polygalacturonase-like i...    181   1e-51   
ref|XP_002303605.2|  hypothetical protein POPTR_0003s13160g             181   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_002437680.1|  hypothetical protein SORBIDRAFT_10g000660          181   1e-51   Sorghum bicolor [broomcorn]
emb|CDY70893.1|  BnaCnng70190D                                          177   1e-51   
gb|KFK28901.1|  hypothetical protein AALP_AA7G062800                    181   1e-51   
ref|XP_006362679.1|  PREDICTED: probable polygalacturonase-like         181   2e-51   
emb|CDY69255.1|  BnaAnng29830D                                          178   2e-51   
ref|XP_010439166.1|  PREDICTED: probable polygalacturonase              180   2e-51   
ref|XP_010448699.1|  PREDICTED: probable polygalacturonase              180   2e-51   
gb|KHG19046.1|  putative polygalacturonase                              174   3e-51   
ref|XP_009116814.1|  PREDICTED: probable polygalacturonase              179   4e-51   
ref|XP_009772512.1|  PREDICTED: probable polygalacturonase              179   4e-51   
ref|NP_194081.1|  putative polygalacturonase                            179   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137356.1|  PREDICTED: probable polygalacturonase              179   6e-51   
ref|XP_010530415.1|  PREDICTED: probable polygalacturonase              178   7e-51   
ref|XP_009137085.1|  PREDICTED: probable polygalacturonase              178   1e-50   
ref|XP_006283603.1|  hypothetical protein CARUB_v10004660mg             178   1e-50   
ref|XP_010089055.1|  putative polygalacturonase                         178   1e-50   
gb|ACG41831.1|  glycoside hydrolase, family 28                          177   1e-50   Zea mays [maize]
gb|AFW04075.1|  polygalacturonase                                       178   1e-50   
emb|CDY44105.1|  BnaA01g13130D                                          177   1e-50   
ref|XP_010276919.1|  PREDICTED: probable polygalacturonase              179   1e-50   
ref|XP_009607671.1|  PREDICTED: probable polygalacturonase              177   1e-50   
ref|XP_007219377.1|  hypothetical protein PRUPE_ppa020086mg             178   2e-50   
gb|EPS58839.1|  hypothetical protein M569_15974                         168   2e-50   
ref|XP_003592202.1|  hypothetical protein MTR_1g100060                  177   2e-50   
ref|NP_001151164.1|  glycoside hydrolase, family 28 precursor           177   3e-50   Zea mays [maize]
ref|XP_003624048.1|  Polygalacturonase                                  177   3e-50   
gb|AFW75224.1|  glycoside hydrolase, family 28                          177   3e-50   
ref|XP_010317519.1|  PREDICTED: probable polygalacturonase              176   3e-50   
ref|XP_010934935.1|  PREDICTED: probable polygalacturonase              176   3e-50   
gb|KHN42438.1|  Putative polygalacturonase                              176   3e-50   
gb|AES62453.2|  pectin lyase superfamily protein                        177   3e-50   
ref|XP_003533980.1|  PREDICTED: probable polygalacturonase-like         177   3e-50   
ref|XP_006413548.1|  hypothetical protein EUTSA_v10025011mg             177   4e-50   
ref|XP_006422033.1|  hypothetical protein CICLE_v10004864mg             176   5e-50   
ref|XP_008796910.1|  PREDICTED: probable polygalacturonase              176   5e-50   
ref|XP_004298190.1|  PREDICTED: probable polygalacturonase-like         176   5e-50   
ref|XP_007040335.1|  Pectin lyase-like superfamily protein isoform 1    176   7e-50   
ref|XP_008229768.1|  PREDICTED: probable polygalacturonase              176   7e-50   
ref|XP_003592200.1|  Polygalacturonase-like protein                     176   8e-50   
ref|XP_002513653.1|  polygalacturonase, putative                        176   9e-50   Ricinus communis
gb|AFK43011.1|  unknown                                                 176   1e-49   
ref|XP_004964293.1|  PREDICTED: probable polygalacturonase-like i...    176   1e-49   
ref|XP_004964294.1|  PREDICTED: probable polygalacturonase-like i...    176   1e-49   
ref|NP_001240215.1|  uncharacterized protein LOC100785005 precursor     175   1e-49   
ref|XP_010519488.1|  PREDICTED: probable polygalacturonase isofor...    175   1e-49   
ref|XP_002869777.1|  glycoside hydrolase family 28 protein              175   1e-49   
ref|XP_010519487.1|  PREDICTED: probable polygalacturonase isofor...    175   2e-49   
ref|XP_007217591.1|  hypothetical protein PRUPE_ppa018901mg             173   2e-49   
gb|AES62452.2|  pectin lyase superfamily protein                        174   2e-49   
ref|XP_007152185.1|  hypothetical protein PHAVU_004G108800g             174   2e-49   
gb|KGN49922.1|  hypothetical protein Csa_5G140480                       174   2e-49   
ref|XP_004160401.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    174   2e-49   
gb|KDP22229.1|  hypothetical protein JCGZ_26060                         174   2e-49   
ref|XP_008376628.1|  PREDICTED: probable polygalacturonase              174   3e-49   
ref|XP_003592201.1|  Polygalacturonase-like protein                     174   3e-49   
ref|XP_004145976.1|  PREDICTED: probable polygalacturonase-like         174   3e-49   
ref|XP_008232996.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    174   4e-49   
ref|XP_008234837.1|  PREDICTED: probable polygalacturonase              174   4e-49   
ref|XP_010105745.1|  putative polygalacturonase                         173   5e-49   
ref|XP_010671628.1|  PREDICTED: probable polygalacturonase              174   5e-49   
ref|XP_007215325.1|  hypothetical protein PRUPE_ppa005185mg             173   7e-49   
ref|XP_007151453.1|  hypothetical protein PHAVU_004G047800g             173   7e-49   
ref|XP_009368731.1|  PREDICTED: probable polygalacturonase              173   8e-49   
ref|XP_010519492.1|  PREDICTED: probable polygalacturonase              172   9e-49   
ref|XP_006656549.1|  PREDICTED: probable polygalacturonase-like         172   1e-48   
ref|XP_009375527.1|  PREDICTED: probable polygalacturonase              172   1e-48   
ref|XP_003535598.1|  PREDICTED: probable polygalacturonase-like         172   1e-48   
ref|XP_003536450.1|  PREDICTED: probable polygalacturonase-like         172   1e-48   
ref|XP_009377556.1|  PREDICTED: probable polygalacturonase              172   1e-48   
ref|XP_008380132.1|  PREDICTED: probable polygalacturonase              172   1e-48   
gb|KHN21785.1|  Putative polygalacturonase                              172   1e-48   
gb|KHN21784.1|  Putative polygalacturonase                              172   1e-48   
ref|XP_006829063.1|  hypothetical protein AMTR_s00001p00258260          172   2e-48   
ref|XP_008234902.1|  PREDICTED: probable polygalacturonase              171   3e-48   
gb|KHG19694.1|  putative polygalacturonase                              171   3e-48   
ref|XP_009382257.1|  PREDICTED: probable polygalacturonase isofor...    171   5e-48   
ref|XP_008437531.1|  PREDICTED: probable polygalacturonase              171   5e-48   
gb|KDP22228.1|  hypothetical protein JCGZ_26059                         171   5e-48   
gb|KHN21786.1|  Putative polygalacturonase                              170   5e-48   
ref|XP_003535597.1|  PREDICTED: probable polygalacturonase-like i...    170   8e-48   
ref|XP_010550764.1|  PREDICTED: probable polygalacturonase              170   1e-47   
ref|XP_007151452.1|  hypothetical protein PHAVU_004G047700g             169   2e-47   
ref|XP_002273143.3|  PREDICTED: probable polygalacturonase              168   3e-47   Vitis vinifera
gb|EYU25143.1|  hypothetical protein MIMGU_mgv1a005601mg                168   4e-47   
ref|XP_003592197.1|  Endo-polygalacturonase-like protein                168   5e-47   
ref|XP_011076107.1|  PREDICTED: probable polygalacturonase              168   6e-47   
gb|ABR18040.1|  unknown                                                 168   6e-47   Picea sitchensis
ref|XP_009382256.1|  PREDICTED: probable polygalacturonase isofor...    168   6e-47   
ref|XP_004513187.1|  PREDICTED: probable polygalacturonase-like         168   7e-47   
ref|XP_002273177.2|  PREDICTED: probable polygalacturonase              167   1e-46   Vitis vinifera
ref|XP_006292567.1|  hypothetical protein CARUB_v10018803mg             167   1e-46   
gb|ABE66001.1|  glycoside hydrolase family 28 protein/polygalactu...    165   3e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CBI22657.3|  unnamed protein product                                163   4e-46   
ref|NP_190464.1|  pectin lyase-like superfamily protein                 166   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875935.1|  predicted protein                                  166   5e-46   
ref|XP_007143467.1|  hypothetical protein PHAVU_007G074300g             165   5e-46   
ref|XP_009383010.1|  PREDICTED: probable polygalacturonase              163   6e-46   
emb|CBI22656.3|  unnamed protein product                                166   8e-46   
emb|CDY10897.1|  BnaC01g15120D                                          159   9e-46   
ref|XP_008810120.1|  PREDICTED: probable polygalacturonase isofor...    164   1e-45   
ref|XP_010450744.1|  PREDICTED: probable polygalacturonase              164   2e-45   
gb|KFK27673.1|  hypothetical protein AALP_AA8G413900                    162   2e-45   
ref|XP_008810119.1|  PREDICTED: probable polygalacturonase isofor...    164   2e-45   
ref|XP_002468601.1|  hypothetical protein SORBIDRAFT_01g048880          163   3e-45   Sorghum bicolor [broomcorn]
ref|XP_002305262.1|  glycoside hydrolase family 28 family protein       162   4e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011035342.1|  PREDICTED: probable polygalacturonase              163   4e-45   
ref|XP_002273669.1|  PREDICTED: probable polygalacturonase              162   6e-45   Vitis vinifera
ref|XP_009149779.1|  PREDICTED: probable polygalacturonase              162   7e-45   
ref|NP_001151102.1|  glycoside hydrolase, family 28 precursor           162   8e-45   Zea mays [maize]
gb|KCW46748.1|  hypothetical protein EUGRSUZ_K00562                     162   8e-45   
emb|CDY05885.1|  BnaC08g20620D                                          162   8e-45   
ref|XP_008657697.1|  PREDICTED: probable polygalacturonase              158   1e-44   
ref|XP_010035373.1|  PREDICTED: probable polygalacturonase              161   1e-44   
ref|XP_006404874.1|  hypothetical protein EUTSA_v10000145mg             162   2e-44   
gb|AFW82409.1|  hypothetical protein ZEAMMB73_244455                    158   2e-44   
gb|KDO86268.1|  hypothetical protein CISIN_1g0090752mg                  157   2e-44   
ref|XP_006650993.1|  PREDICTED: probable polygalacturonase-like         162   3e-44   
gb|KFK32698.1|  hypothetical protein AALP_AA6G277200                    160   3e-44   
ref|XP_010426397.1|  PREDICTED: probable polygalacturonase              160   4e-44   
gb|KCW90638.1|  hypothetical protein EUGRSUZ_A02742                     160   5e-44   
ref|XP_010024977.1|  PREDICTED: probable polygalacturonase              160   5e-44   
ref|XP_010503541.1|  PREDICTED: probable polygalacturonase              160   5e-44   
gb|KDP22227.1|  hypothetical protein JCGZ_26058                         160   5e-44   
ref|XP_002878707.1|  glycoside hydrolase family 28 protein              160   5e-44   
ref|XP_006404198.1|  hypothetical protein EUTSA_v10011050mg             160   6e-44   
ref|XP_010024966.1|  PREDICTED: probable polygalacturonase              159   7e-44   
emb|CDY08095.1|  BnaA06g16310D                                          159   1e-43   
ref|XP_006657587.1|  PREDICTED: probable polygalacturonase-like i...    158   1e-43   
ref|XP_006402409.1|  hypothetical protein EUTSA_v10005945mg             159   1e-43   
ref|XP_006657586.1|  PREDICTED: probable polygalacturonase-like i...    159   2e-43   
ref|XP_002876663.1|  glycoside hydrolase family 28 protein              158   2e-43   
ref|XP_002875985.1|  glycoside hydrolase family 28 protein              158   2e-43   
ref|XP_006386685.1|  hypothetical protein POPTR_0002s18800g             158   2e-43   
ref|XP_006291055.1|  hypothetical protein CARUB_v10017170mg             158   2e-43   
ref|XP_010472382.1|  PREDICTED: probable polygalacturonase              159   2e-43   
gb|AIU50445.1|  pectin lyase-like superfamily protein                   157   3e-43   
gb|AAC63679.1|  putative polygalacturonase                              158   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567126.1|  pectin lyase-like superfamily protein                 158   3e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CAB71871.1|  putative protein                                       158   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179968.2|  pectin lyase-like protein                             158   3e-43   
ref|NP_001059282.1|  Os07g0245200                                       157   3e-43   
gb|ABK28510.1|  unknown                                                 158   3e-43   
ref|XP_009116889.1|  PREDICTED: probable polygalacturonase              158   3e-43   
gb|KFK35395.1|  hypothetical protein AALP_AA5G279500                    158   4e-43   
gb|KFK35396.1|  hypothetical protein AALP_AA5G279500                    157   4e-43   
gb|EEE66877.1|  hypothetical protein OsJ_23693                          158   4e-43   
gb|EEC81792.1|  hypothetical protein OsI_25505                          158   4e-43   
dbj|BAJ94566.1|  predicted protein                                      157   4e-43   
gb|EPS71449.1|  hypothetical protein M569_03308                         157   4e-43   
ref|XP_002988771.1|  hypothetical protein SELMODRAFT_128450             157   4e-43   
dbj|BAJ96905.1|  predicted protein                                      157   5e-43   
gb|ABF99735.1|  glycoside hydrolase family 28 protein, putative, ...    157   5e-43   
ref|NP_001051812.1|  Os03g0833800                                       157   5e-43   
ref|XP_004985902.1|  PREDICTED: probable polygalacturonase-like         157   6e-43   
ref|XP_011005969.1|  PREDICTED: probable polygalacturonase              157   6e-43   
gb|AIU50401.1|  pectin lyase-like superfamily protein                   156   6e-43   
ref|XP_010468984.1|  PREDICTED: probable polygalacturonase              157   8e-43   
ref|XP_003563034.1|  PREDICTED: probable polygalacturonase              157   9e-43   
ref|XP_010933983.1|  PREDICTED: probable polygalacturonase isofor...    157   1e-42   
gb|KHN09300.1|  Putative polygalacturonase                              155   1e-42   
ref|XP_010512598.1|  PREDICTED: probable polygalacturonase isofor...    157   1e-42   
ref|XP_002986281.1|  hypothetical protein SELMODRAFT_124011             156   1e-42   
ref|XP_006295548.1|  hypothetical protein CARUB_v10024654mg             157   1e-42   
ref|XP_010933982.1|  PREDICTED: probable polygalacturonase isofor...    157   1e-42   
ref|XP_007163248.1|  hypothetical protein PHAVU_001G218400g             156   1e-42   
ref|NP_001048813.1|  Os03g0124900                                       156   1e-42   
ref|XP_002320934.2|  hypothetical protein POPTR_0014s10770g             156   1e-42   
ref|XP_010429342.1|  PREDICTED: probable polygalacturonase              156   1e-42   
ref|XP_006402410.1|  hypothetical protein EUTSA_v10005945mg             156   2e-42   
ref|XP_010512597.1|  PREDICTED: probable polygalacturonase isofor...    157   2e-42   
ref|XP_007145093.1|  hypothetical protein PHAVU_007G209200g             155   2e-42   
ref|XP_007051305.1|  Pectin lyase-like superfamily protein isoform 4    154   2e-42   
ref|XP_011040145.1|  PREDICTED: probable polygalacturonase              155   2e-42   
ref|XP_010417129.1|  PREDICTED: probable polygalacturonase              155   2e-42   
emb|CDY25090.1|  BnaC06g18320D                                          155   3e-42   
gb|EMT02659.1|  hypothetical protein F775_52404                         155   3e-42   
gb|AIU50406.1|  pectin lyase-like superfamily protein                   152   3e-42   
emb|CDX67875.1|  BnaA07g19150D                                          155   3e-42   
dbj|BAK02492.1|  predicted protein                                      154   3e-42   
ref|XP_002463589.1|  hypothetical protein SORBIDRAFT_01g002550          155   3e-42   
emb|CDY20264.1|  BnaC04g36920D                                          155   3e-42   
ref|XP_009104364.1|  PREDICTED: probable polygalacturonase              155   3e-42   
gb|AGZ62594.1|  pollen-specific polygalacturonase                       155   3e-42   
ref|XP_009140503.1|  PREDICTED: probable polygalacturonase              155   4e-42   
ref|XP_010230291.1|  PREDICTED: probable polygalacturonase              154   4e-42   
emb|CDY39678.1|  BnaA04g13950D                                          155   4e-42   
ref|XP_010413306.1|  PREDICTED: probable polygalacturonase              155   4e-42   
gb|AIN44009.1|  polygalacturonase-like protein                          154   4e-42   
ref|XP_002513652.1|  Exopolygalacturonase precursor, putative           154   5e-42   
ref|XP_009363066.1|  PREDICTED: probable polygalacturonase isofor...    155   5e-42   
ref|XP_002273855.2|  PREDICTED: probable polygalacturonase              154   5e-42   
gb|AIU50447.1|  pectin lyase-like superfamily protein                   153   5e-42   
ref|XP_009396562.1|  PREDICTED: probable polygalacturonase              154   6e-42   
ref|XP_008381624.1|  PREDICTED: probable polygalacturonase              154   6e-42   
gb|KDP28345.1|  hypothetical protein JCGZ_14116                         154   6e-42   
ref|XP_009363065.1|  PREDICTED: probable polygalacturonase isofor...    154   6e-42   
ref|NP_001183080.1|  hypothetical protein precursor                     154   7e-42   
ref|XP_010909275.1|  PREDICTED: probable polygalacturonase isofor...    154   7e-42   
ref|XP_008660018.1|  PREDICTED: probable polygalacturonase              151   7e-42   
ref|XP_008239046.1|  PREDICTED: probable polygalacturonase              154   7e-42   
ref|XP_007051304.1|  Pectin lyase-like superfamily protein isoform 3    153   8e-42   
ref|NP_001151479.1|  polygalacturonase precursor                        154   8e-42   
ref|XP_006650856.1|  PREDICTED: probable polygalacturonase-like i...    154   8e-42   
ref|XP_003557344.1|  PREDICTED: probable polygalacturonase              154   9e-42   
emb|CDY03516.1|  BnaC01g15660D                                          154   9e-42   
ref|XP_007051302.1|  Pectin lyase-like superfamily protein isoform 1    154   9e-42   
gb|AIU50418.1|  pectin lyase-like superfamily protein                   153   9e-42   
emb|CDY47619.1|  BnaA01g13460D                                          154   1e-41   
ref|XP_010909269.1|  PREDICTED: probable polygalacturonase isofor...    154   1e-41   
gb|KFK32989.1|  hypothetical protein AALP_AA6G314900                    153   1e-41   
ref|XP_002459610.1|  hypothetical protein SORBIDRAFT_02g007470          154   1e-41   
gb|AIU50431.1|  pectin lyase-like superfamily protein                   153   1e-41   
ref|XP_009137402.1|  PREDICTED: probable polygalacturonase              153   1e-41   
ref|XP_004955888.1|  PREDICTED: probable polygalacturonase-like i...    154   1e-41   
gb|AIU50399.1|  pectin lyase-like superfamily protein                   152   1e-41   
ref|XP_004494475.1|  PREDICTED: probable polygalacturonase-like i...    154   1e-41   
gb|AIU50400.1|  pectin lyase-like superfamily protein                   152   1e-41   
gb|AIU50421.1|  pectin lyase-like superfamily protein                   152   1e-41   
ref|XP_010544928.1|  PREDICTED: probable polygalacturonase              154   1e-41   
ref|XP_004494474.1|  PREDICTED: probable polygalacturonase-like i...    153   1e-41   
gb|EYU25144.1|  hypothetical protein MIMGU_mgv1a023393mg                153   2e-41   
ref|XP_007209143.1|  hypothetical protein PRUPE_ppa005818mg             153   2e-41   
ref|NP_001170283.1|  uncharacterized protein LOC100384246 precursor     153   2e-41   
ref|XP_002867688.1|  glycoside hydrolase family 28 protein              153   2e-41   
gb|AIU50407.1|  pectin lyase-like superfamily protein                   152   2e-41   
ref|NP_194113.1|  glycoside hydrolase family 28 protein / polygal...    153   2e-41   
gb|KFK28938.1|  hypothetical protein AALP_AA7G068200                    152   2e-41   
ref|XP_006574520.1|  PREDICTED: probable polygalacturonase-like i...    149   2e-41   
emb|CDX94222.1|  BnaC07g38560D                                          153   2e-41   
ref|XP_006840361.1|  hypothetical protein AMTR_s00045p00118570          153   2e-41   
gb|AIU50416.1|  pectin lyase-like superfamily protein                   152   2e-41   
gb|ACN35154.1|  unknown                                                 152   2e-41   
ref|XP_003626072.1|  Polygalacturonase                                  153   2e-41   
gb|AIU50449.1|  pectin lyase-like superfamily protein                   152   3e-41   
ref|XP_003519731.2|  PREDICTED: probable polygalacturonase-like i...    152   3e-41   
gb|EMS62381.1|  putative polygalacturonase                              149   3e-41   
ref|XP_004499965.1|  PREDICTED: probable polygalacturonase-like         152   3e-41   
gb|KHN00242.1|  Putative polygalacturonase                              152   3e-41   
ref|XP_010261531.1|  PREDICTED: probable polygalacturonase              152   3e-41   
ref|XP_002967400.1|  hypothetical protein SELMODRAFT_87398              152   3e-41   
gb|KEH24447.1|  polygalacturonase/glycoside hydrolase family protein    152   3e-41   
ref|XP_010679489.1|  PREDICTED: probable polygalacturonase isofor...    152   3e-41   
emb|CDP12145.1|  unnamed protein product                                152   3e-41   
ref|XP_010679488.1|  PREDICTED: probable polygalacturonase isofor...    152   3e-41   
ref|XP_002960312.1|  hypothetical protein SELMODRAFT_74934              152   3e-41   
gb|AIU50425.1|  pectin lyase-like superfamily protein                   151   4e-41   
gb|KEH43186.1|  polygalacturonase/glycoside hydrolase family protein    151   4e-41   
gb|ACN28107.1|  unknown                                                 152   4e-41   
ref|XP_008679595.1|  PREDICTED: polygalacturonase isoform X1            152   4e-41   
gb|AIU50405.1|  pectin lyase-like superfamily protein                   151   4e-41   
ref|XP_010271039.1|  PREDICTED: probable polygalacturonase isofor...    152   4e-41   
ref|XP_008366373.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    150   4e-41   
ref|XP_010271038.1|  PREDICTED: probable polygalacturonase isofor...    152   5e-41   
ref|XP_009404468.1|  PREDICTED: probable polygalacturonase              152   5e-41   
ref|XP_003535296.2|  PREDICTED: probable polygalacturonase-like         152   5e-41   
gb|ACN36471.1|  unknown                                                 150   5e-41   
ref|XP_007040496.1|  Pectin lyase-like superfamily protein              151   6e-41   
ref|XP_006444619.1|  hypothetical protein CICLE_v10020035mg             152   6e-41   
gb|KEH33635.1|  polygalacturonase/glycoside hydrolase family protein    151   6e-41   
gb|AIU50438.1|  pectin lyase-like superfamily protein                   150   6e-41   
ref|XP_006586032.1|  PREDICTED: probable polygalacturonase-like         151   6e-41   
gb|KHM99685.1|  Putative polygalacturonase                              151   6e-41   
gb|EMS49882.1|  putative polygalacturonase                              150   7e-41   
ref|XP_010523877.1|  PREDICTED: probable polygalacturonase isofor...    152   7e-41   
ref|XP_007146299.1|  hypothetical protein PHAVU_006G028800g             151   7e-41   
ref|XP_011073737.1|  PREDICTED: probable polygalacturonase              151   7e-41   
ref|XP_010241442.1|  PREDICTED: probable polygalacturonase isofor...    150   7e-41   
ref|XP_004951285.1|  PREDICTED: probable polygalacturonase-like         151   7e-41   
ref|XP_008810829.1|  PREDICTED: probable polygalacturonase              151   8e-41   
gb|KHN28527.1|  Putative polygalacturonase                              151   8e-41   
ref|XP_009395761.1|  PREDICTED: probable polygalacturonase              151   8e-41   
gb|KFK34204.1|  hypothetical protein AALP_AA5G114700                    155   9e-41   
ref|XP_010523874.1|  PREDICTED: probable polygalacturonase isofor...    151   9e-41   
ref|XP_009137393.1|  PREDICTED: probable polygalacturonase              151   1e-40   
gb|KFK34205.1|  hypothetical protein AALP_AA5G114700                    155   1e-40   
emb|CDY10970.1|  BnaA03g46290D                                          151   1e-40   
ref|XP_010448653.1|  PREDICTED: probable polygalacturonase              150   1e-40   
ref|XP_007221479.1|  hypothetical protein PRUPE_ppa005310mg             151   1e-40   
gb|AIU50402.1|  pectin lyase-like superfamily protein                   150   1e-40   
gb|ACC91250.1|  glycoside hydrolase family 28 protein                   150   1e-40   
ref|XP_010433858.1|  PREDICTED: probable polygalacturonase              150   1e-40   
gb|AES61557.2|  polygalacturonase/glycoside hydrolase family protein    151   1e-40   
ref|XP_003551949.1|  PREDICTED: probable polygalacturonase-like         150   1e-40   
ref|XP_010241441.1|  PREDICTED: probable polygalacturonase isofor...    150   1e-40   
ref|XP_010439131.1|  PREDICTED: probable polygalacturonase              150   2e-40   
gb|AIU50403.1|  pectin lyase-like superfamily protein                   149   2e-40   
ref|XP_008227776.1|  PREDICTED: probable polygalacturonase              150   2e-40   
ref|XP_009413832.1|  PREDICTED: probable polygalacturonase              150   2e-40   
ref|XP_004288344.1|  PREDICTED: probable polygalacturonase-like         150   2e-40   
ref|XP_003591306.1|  Polygalacturonase-like protein                     151   2e-40   
ref|XP_010913844.1|  PREDICTED: probable polygalacturonase isofor...    148   2e-40   
ref|XP_009380525.1|  PREDICTED: probable polygalacturonase              150   2e-40   
gb|AIU50423.1|  pectin lyase-like superfamily protein                   149   2e-40   
ref|XP_003571296.1|  PREDICTED: probable polygalacturonase              150   2e-40   
gb|AIU50440.1|  pectin lyase-like superfamily protein                   149   3e-40   
gb|AIU50429.1|  pectin lyase-like superfamily protein                   149   3e-40   
ref|XP_010266478.1|  PREDICTED: probable polygalacturonase              149   3e-40   
emb|CDM83426.1|  unnamed protein product                                150   3e-40   
gb|AIU50419.1|  pectin lyase-like superfamily protein                   148   3e-40   
dbj|BAJ89948.1|  predicted protein                                      149   3e-40   
gb|AIU50422.1|  pectin lyase-like superfamily protein                   149   3e-40   
dbj|BAJ94644.1|  predicted protein                                      149   3e-40   
ref|XP_004972433.1|  PREDICTED: probable polygalacturonase-like         150   3e-40   
gb|EMT32528.1|  Putative polygalacturonase                              149   3e-40   
gb|AIU50433.1|  pectin lyase-like superfamily protein                   149   4e-40   
ref|XP_010541559.1|  PREDICTED: probable polygalacturonase isofor...    149   4e-40   
ref|XP_006343870.1|  PREDICTED: probable polygalacturonase-like         149   4e-40   
ref|XP_006604763.1|  PREDICTED: probable polygalacturonase-like i...    149   5e-40   
ref|XP_007141479.1|  hypothetical protein PHAVU_008G199400g             149   5e-40   
gb|AIU50432.1|  pectin lyase-like superfamily protein                   148   5e-40   
ref|XP_002451891.1|  hypothetical protein SORBIDRAFT_04g009310          149   5e-40   
ref|XP_003554577.1|  PREDICTED: probable polygalacturonase-like i...    149   5e-40   
ref|XP_009412155.1|  PREDICTED: probable polygalacturonase              149   5e-40   
ref|XP_010913831.1|  PREDICTED: probable polygalacturonase isofor...    149   6e-40   
gb|AIU50439.1|  pectin lyase-like superfamily protein                   148   6e-40   
gb|AIU50444.1|  pectin lyase-like superfamily protein                   148   6e-40   
ref|NP_001148255.1|  polygalacturonase                                  149   7e-40   
gb|AIU50442.1|  pectin lyase-like superfamily protein                   148   7e-40   
gb|AIU50437.1|  pectin lyase-like superfamily protein                   148   8e-40   
ref|XP_006576262.1|  PREDICTED: uncharacterized protein LOC100817...    149   8e-40   
ref|XP_006576263.1|  PREDICTED: uncharacterized protein LOC100817...    149   8e-40   
gb|AIU50450.1|  pectin lyase-like superfamily protein                   147   9e-40   
ref|NP_001241086.1|  uncharacterized protein LOC100817309 precursor     149   9e-40   
ref|XP_008790157.1|  PREDICTED: probable polygalacturonase              148   1e-39   
ref|XP_010924850.1|  PREDICTED: probable polygalacturonase              148   1e-39   
ref|XP_010659126.1|  PREDICTED: probable polygalacturonase              148   1e-39   
gb|KHN14175.1|  Putative polygalacturonase                              149   1e-39   
gb|KHN43408.1|  Putative polygalacturonase                              149   1e-39   
ref|XP_008807914.1|  PREDICTED: probable polygalacturonase              148   1e-39   
ref|XP_004245522.1|  PREDICTED: probable polygalacturonase isofor...    148   1e-39   
ref|NP_001060796.1|  Os08g0107300                                       148   1e-39   
gb|EAZ05322.1|  hypothetical protein OsI_27527                          148   1e-39   
gb|EAZ41253.1|  hypothetical protein OsJ_25761                          148   1e-39   
ref|XP_010325363.1|  PREDICTED: probable polygalacturonase isofor...    148   1e-39   
ref|XP_010911559.1|  PREDICTED: probable polygalacturonase              148   1e-39   
gb|AIU50441.1|  pectin lyase-like superfamily protein                   147   2e-39   
ref|XP_001775589.1|  predicted protein                                  148   2e-39   
ref|NP_199002.1|  pectin lyase-like superfamily protein                 147   2e-39   
ref|XP_008788175.1|  PREDICTED: probable polygalacturonase              148   2e-39   
gb|EAY85246.1|  hypothetical protein OsI_06620                          147   2e-39   
ref|XP_006413510.1|  hypothetical protein EUTSA_v10025189mg             147   2e-39   
ref|XP_002535132.1|  Polygalacturonase precursor, putative              148   2e-39   
gb|AIU50415.1|  pectin lyase-like superfamily protein                   146   2e-39   
ref|XP_008810903.1|  PREDICTED: probable polygalacturonase              147   2e-39   
ref|NP_001046468.1|  Os02g0256100                                       147   2e-39   
dbj|BAJ97036.1|  predicted protein                                      147   2e-39   
ref|XP_004969187.1|  PREDICTED: probable polygalacturonase-like         147   2e-39   
gb|KDO76501.1|  hypothetical protein CISIN_1g0134022mg                  145   3e-39   
ref|XP_010914786.1|  PREDICTED: probable polygalacturonase              147   4e-39   
ref|XP_003569374.1|  PREDICTED: probable polygalacturonase              146   4e-39   
gb|EMS56566.1|  putative polygalacturonase                              143   5e-39   
ref|XP_002455965.1|  hypothetical protein SORBIDRAFT_03g028140          146   5e-39   
gb|AIU50397.1|  pectin lyase-like superfamily protein                   145   6e-39   
ref|XP_006589526.1|  PREDICTED: probable polygalacturonase-like i...    146   6e-39   
ref|XP_010925748.1|  PREDICTED: probable polygalacturonase              146   6e-39   
ref|NP_001141464.1|  uncharacterized protein LOC100273574 precursor     146   7e-39   
gb|AIU50408.1|  pectin lyase-like superfamily protein                   145   7e-39   
ref|XP_006439367.1|  hypothetical protein CICLE_v10020162mg             145   9e-39   
gb|AIU50411.1|  pectin lyase-like superfamily protein                   145   1e-38   
ref|XP_006476397.1|  PREDICTED: probable polygalacturonase-like         145   1e-38   



>ref|XP_011092828.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=505

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN+WP++ PLPSYG+G+D +  RYIS IFG+NL DVV+TG NGTIDGQGA WWQQF  KK
Sbjct  149  INSWPVVDPLPSYGHGRDAAGGRYISLIFGTNLTDVVVTGENGTIDGQGALWWQQFHRKK  208

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIMH++N+QISNLTL+NSPSWNVHPVYSSN+I+QGLTILAPV S NTDGIN
Sbjct  209  LKYTRPYLIEIMHSENVQISNLTLVNSPSWNVHPVYSSNVIVQGLTILAPVTSPNTDGIN  268

Query  9    PDS  1
            PDS
Sbjct  269  PDS  271



>ref|XP_009599786.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana tomentosiformis]
Length=474

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN W +I PLPSYG+G+D +  RYIS +FG+NL DV+ITG NGTIDGQGA WWQ+F SKK
Sbjct  119  INEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVIITGENGTIDGQGALWWQKFHSKK  178

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+MH+DN+QISNLTL+NSPSWN+HPVYSSNIIIQG+TILAPVKS NTDGIN
Sbjct  179  LKYTRPYLIELMHSDNIQISNLTLVNSPSWNIHPVYSSNIIIQGITILAPVKSPNTDGIN  238

Query  9    PDS  1
            PDS
Sbjct  239  PDS  241



>ref|XP_009599780.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana tomentosiformis]
Length=486

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN W +I PLPSYG+G+D +  RYIS +FG+NL DV+ITG NGTIDGQGA WWQ+F SKK
Sbjct  131  INEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVIITGENGTIDGQGALWWQKFHSKK  190

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+MH+DN+QISNLTL+NSPSWN+HPVYSSNIIIQG+TILAPVKS NTDGIN
Sbjct  191  LKYTRPYLIELMHSDNIQISNLTLVNSPSWNIHPVYSSNIIIQGITILAPVKSPNTDGIN  250

Query  9    PDS  1
            PDS
Sbjct  251  PDS  253



>gb|EPS72197.1| hypothetical protein M569_02558, partial [Genlisea aurea]
Length=458

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I +WPL+ PLPSYG+G+D    RY S IFG+NL DVVITG NGTIDGQG  WW+QFR KK
Sbjct  110  IESWPLVDPLPSYGHGRDAPGGRYASLIFGTNLTDVVITGGNGTIDGQGEVWWEQFRGKK  169

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIMH+DN+QISNLTL+NSPSWNVHPVYSSN+IIQGLTILAPV S NTDGIN
Sbjct  170  LKYTRPYLIEIMHSDNIQISNLTLVNSPSWNVHPVYSSNVIIQGLTILAPVTSPNTDGIN  229

Query  9    PDS  1
            PDS
Sbjct  230  PDS  232



>ref|XP_004240097.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=486

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN W +I PLPSYG+G+DTS  RYIS +FG+NL DV+ITG NGTIDGQG  WWQ+F SKK
Sbjct  131  INEWAVIDPLPSYGHGRDTSGGRYISLLFGTNLTDVIITGENGTIDGQGEIWWQKFHSKK  190

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIMH+DN+QIS++TL+NSPSWN+HPVYSSNII+QG+TILAPVKS NTDGIN
Sbjct  191  LKYTRPYLIEIMHSDNIQISHITLVNSPSWNIHPVYSSNIIVQGITILAPVKSPNTDGIN  250

Query  9    PDS  1
            PDS
Sbjct  251  PDS  253



>gb|EYU35105.1| hypothetical protein MIMGU_mgv1a005694mg [Erythranthe guttata]
Length=474

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            INTW +I PLPSYG+G+D +  RYIS IFG+NL DVVITG NGT+DGQG  WWQQF+ KK
Sbjct  117  INTWAVIDPLPSYGHGRDAAGGRYISLIFGTNLTDVVITGENGTVDGQGLVWWQQFKKKK  176

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP L+EIMH+DN+QISNLT LNSPSWN+HPVY+SNIIIQG+TILAP+ S NTDGIN
Sbjct  177  LKYTRPYLLEIMHSDNIQISNLTFLNSPSWNIHPVYTSNIIIQGITILAPITSPNTDGIN  236

Query  9    PDS  1
            PDS
Sbjct  237  PDS  239



>ref|XP_009762711.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana sylvestris]
Length=479

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN W +I PLPSYG+G+D +  RYIS +FG+NL DV+ITG NGTIDGQG  WWQ+F SKK
Sbjct  124  INEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVIITGENGTIDGQGELWWQKFHSKK  183

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+MH+DN+QIS+LTL+NSPSWN+HPVYSSNIIIQG+TILAPVKS NTDGIN
Sbjct  184  LKYTRPYLIELMHSDNIQISDLTLVNSPSWNIHPVYSSNIIIQGITILAPVKSPNTDGIN  243

Query  9    PDS  1
            PDS
Sbjct  244  PDS  246



>ref|XP_002511903.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF50572.1| polygalacturonase, putative [Ricinus communis]
Length=472

 Score =   199 bits (507),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WPL+ PLPSYG G+D +  RY S IFG+NL D+++TGNNGTIDGQGAFWWQQF+  K
Sbjct  125  LKEWPLLKPLPSYGRGRDAAAGRYSSLIFGTNLTDIIVTGNNGTIDGQGAFWWQQFKKGK  184

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM++DN+QISNLTLLNSPSWNVHPVYSSNI+IQG+TI+APV S NTDGIN
Sbjct  185  LKYTRPYLIEIMYSDNIQISNLTLLNSPSWNVHPVYSSNILIQGITIIAPVTSPNTDGIN  244

Query  9    PDS  1
            PD 
Sbjct  245  PDC  247



>ref|XP_009762710.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana sylvestris]
Length=486

 Score =   199 bits (507),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN W +I PLPSYG+G+D +  RYIS +FG+NL DV+ITG NGTIDGQG  WWQ+F SKK
Sbjct  131  INEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVIITGENGTIDGQGELWWQKFHSKK  190

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+MH+DN+QIS+LTL+NSPSWN+HPVYSSNIIIQG+TILAPVKS NTDGIN
Sbjct  191  LKYTRPYLIELMHSDNIQISDLTLVNSPSWNIHPVYSSNIIIQGITILAPVKSPNTDGIN  250

Query  9    PDS  1
            PDS
Sbjct  251  PDS  253



>ref|XP_009767883.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=476

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WPLI PLPSYG+G+D    RYIS IFG+NL DV+ITG NGTIDGQGA WWQQF  KK
Sbjct  121  INQWPLIDPLPSYGHGRDAPGGRYISLIFGTNLTDVIITGENGTIDGQGALWWQQFHRKK  180

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+MH++ +QISNLTL+NSPSWN+HPVYSSNIIIQGLTILAPV S NTDGI+
Sbjct  181  LKYTRPYLIELMHSNKIQISNLTLVNSPSWNIHPVYSSNIIIQGLTILAPVTSPNTDGID  240

Query  9    PDS  1
            PDS
Sbjct  241  PDS  243



>ref|XP_009624373.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=470

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WPLI PLPSYG+G+D    RYIS IFG+NL DV+ITG NGTIDGQGA WWQQF  KK
Sbjct  114  INQWPLIDPLPSYGHGRDAPGGRYISLIFGTNLTDVIITGENGTIDGQGAVWWQQFHRKK  173

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+MH++ +QISNLTL+NSPSWN+HPVYSSNIIIQGLTILAPV S NTDGI+
Sbjct  174  LKYTRPYLIELMHSNKIQISNLTLVNSPSWNIHPVYSSNIIIQGLTILAPVTSPNTDGID  233

Query  9    PDS  1
            PDS
Sbjct  234  PDS  236



>gb|KDP28587.1| hypothetical protein JCGZ_14358 [Jatropha curcas]
Length=479

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WPL+ PLPSYG G+D +  RY S IFG+NL DVV+TG NGTIDGQGAFWWQQF   K
Sbjct  125  LKEWPLLKPLPSYGRGRDAAAGRYASLIFGTNLTDVVVTGKNGTIDGQGAFWWQQFHKGK  184

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM ++N+QISNLTLLNSPSWNVHPVYSSNI++QG+TILAPV S NTDGIN
Sbjct  185  LKYTRPYLIEIMFSENIQISNLTLLNSPSWNVHPVYSSNILVQGITILAPVSSPNTDGIN  244

Query  9    PDS  1
            PDS
Sbjct  245  PDS  247



>ref|XP_004510753.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=481

 Score =   197 bits (502),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP+I PLPSYG G+DT+  RY S IFG+NL DV++TG+NGTIDGQG+FWWQQF  KK
Sbjct  128  MNEWPVIKPLPSYGRGRDTAGGRYTSLIFGTNLTDVIVTGDNGTIDGQGSFWWQQFHMKK  187

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D++QISNLTLLNSPSWN+HPVYSSNII++G+TI+APV+S NTDGIN
Sbjct  188  LKYTRPYLIELMFSDSIQISNLTLLNSPSWNIHPVYSSNIIVKGITIIAPVRSPNTDGIN  247

Query  9    PDS  1
            PDS
Sbjct  248  PDS  250



>ref|XP_003548644.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=491

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I  WP+I PLPSYG G+D +  RY S IFG+NL DV++TG+NGTIDGQGAFWWQ+F+ KK
Sbjct  138  IREWPVIEPLPSYGRGRDAAAGRYTSLIFGTNLTDVIVTGDNGTIDGQGAFWWQKFQKKK  197

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLTLLNSPSWNVHPVYSSNIII+GLTI+APV S NTDGIN
Sbjct  198  LKYTRPYLIELMFSDKIQISNLTLLNSPSWNVHPVYSSNIIIKGLTIIAPVPSPNTDGIN  257

Query  9    PDS  1
            PDS
Sbjct  258  PDS  260



>ref|XP_006598941.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=489

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I  WP+I PLPSYG G+D +  RY S IFG+NL DV++TG+NGTIDGQGAFWWQ+F+ KK
Sbjct  136  IREWPVIEPLPSYGRGRDAAAGRYTSLIFGTNLTDVIVTGDNGTIDGQGAFWWQKFQKKK  195

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLTLLNSPSWNVHPVYSSNIII+GLTI+APV S NTDGIN
Sbjct  196  LKYTRPYLIELMFSDKIQISNLTLLNSPSWNVHPVYSSNIIIKGLTIIAPVPSPNTDGIN  255

Query  9    PDS  1
            PDS
Sbjct  256  PDS  258



>ref|XP_006345582.1| PREDICTED: probable polygalacturonase-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006345583.1| PREDICTED: probable polygalacturonase-like isoform X3 [Solanum 
tuberosum]
Length=477

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN W +I PLPSYG+G+D +  RYIS +FG+NL DV+ITG NGTIDGQG  WWQ+F SKK
Sbjct  122  INEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVIITGENGTIDGQGEIWWQKFHSKK  181

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIMH+DN+QIS++TL+NSPSWN+HPVYSSNII++G+TILAPVKS NTDGIN
Sbjct  182  LKYTRPYLIEIMHSDNIQISDITLVNSPSWNIHPVYSSNIIVKGITILAPVKSPNTDGIN  241

Query  9    PDS  1
            PDS
Sbjct  242  PDS  244



>ref|XP_006345581.1| PREDICTED: probable polygalacturonase-like isoform X1 [Solanum 
tuberosum]
Length=481

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN W +I PLPSYG+G+D +  RYIS +FG+NL DV+ITG NGTIDGQG  WWQ+F SKK
Sbjct  126  INEWAVIDPLPSYGHGRDAAGGRYISLLFGTNLTDVIITGENGTIDGQGEIWWQKFHSKK  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIMH+DN+QIS++TL+NSPSWN+HPVYSSNII++G+TILAPVKS NTDGIN
Sbjct  186  LKYTRPYLIEIMHSDNIQISDITLVNSPSWNIHPVYSSNIIVKGITILAPVKSPNTDGIN  245

Query  9    PDS  1
            PDS
Sbjct  246  PDS  248



>gb|KHN46704.1| Putative polygalacturonase [Glycine soja]
Length=477

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I  WP+I PLPSYG G+D +  RY S IFG+NL DV++TG+NGTIDGQGAFWWQ+F  KK
Sbjct  124  IREWPVIEPLPSYGRGRDAAAGRYTSLIFGTNLTDVIVTGDNGTIDGQGAFWWQKFHKKK  183

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLTLLNSPSWNVHPVYSSNIII+GLTI+APV S NTDGIN
Sbjct  184  LKYTRPYLIELMFSDKIQISNLTLLNSPSWNVHPVYSSNIIIKGLTIIAPVPSPNTDGIN  243

Query  9    PDS  1
            PDS
Sbjct  244  PDS  246



>ref|XP_004492778.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=483

 Score =   197 bits (501),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I  WP+I PLPSYG G+D    RY S IFG+NL DV++TG NGTIDGQGAFWWQQF  KK
Sbjct  124  ITEWPVIEPLPSYGRGRDAPAGRYTSLIFGTNLTDVIVTGENGTIDGQGAFWWQQFHRKK  183

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLTLLNSPSWN+HPVYSSNII+QG+TI+APV S NTDGIN
Sbjct  184  LKYTRPYLIELMFSDTIQISNLTLLNSPSWNIHPVYSSNIIVQGITIIAPVSSPNTDGIN  243

Query  9    PDS  1
            PDS
Sbjct  244  PDS  246



>ref|XP_006491165.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=481

 Score =   197 bits (500),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP+I PLPSYG G+D +  RY S IFG+NL DV++TG+NGTIDGQGA WWQQF   K
Sbjct  125  LNEWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVIVTGDNGTIDGQGALWWQQFHKGK  184

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE M+TDN+QIS+LTLLNSPSWNVHPVYSSNI++QG+TI+APV S NTDGIN
Sbjct  185  LKYTRPYLIEFMYTDNIQISSLTLLNSPSWNVHPVYSSNILVQGITIIAPVTSPNTDGIN  244

Query  9    PDS  1
            PDS
Sbjct  245  PDS  247



>gb|KHN26935.1| Putative polygalacturonase [Glycine soja]
Length=378

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP+I PLPSYG G+D    RY SFIFG+NL DV++TG+NGTIDGQGAFWWQQF +K+
Sbjct  21   MNEWPVIKPLPSYGRGRDAPAGRYTSFIFGTNLTDVIVTGDNGTIDGQGAFWWQQFYNKR  80

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            L   RP LIE+M +D +QISNLT LNSPSWNVHPVYSSNIII+GLTI+APV S NTDGIN
Sbjct  81   LNYTRPYLIELMFSDKIQISNLTFLNSPSWNVHPVYSSNIIIKGLTIIAPVPSPNTDGIN  140

Query  9    PDS  1
            PDS
Sbjct  141  PDS  143



>ref|XP_006444979.1| hypothetical protein CICLE_v10019597mg [Citrus clementina]
 gb|ESR58219.1| hypothetical protein CICLE_v10019597mg [Citrus clementina]
Length=544

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP+I PLPSYG G+D +  RY S IFG+NL DV++TG+NGTIDGQGA WWQQF   K
Sbjct  188  LNEWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVIVTGDNGTIDGQGALWWQQFHKGK  247

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE M+TDN+QIS+LTLLNSPSWNVHPVYSSNI++QG+TI+APV S NTDGIN
Sbjct  248  LKYTRPYLIEFMYTDNIQISSLTLLNSPSWNVHPVYSSNILVQGITIIAPVTSPNTDGIN  307

Query  9    PDS  1
            PDS
Sbjct  308  PDS  310



>ref|XP_007139799.1| hypothetical protein PHAVU_008G059700g [Phaseolus vulgaris]
 gb|ESW11793.1| hypothetical protein PHAVU_008G059700g [Phaseolus vulgaris]
Length=486

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I  WP++ PLPSYG G+D +  R+ S IFG+NL DV++TG NGTIDGQG FWWQQF  KK
Sbjct  124  ITEWPVLEPLPSYGRGRDAAAGRFASLIFGTNLTDVIVTGENGTIDGQGEFWWQQFHRKK  183

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +DN+QISNLTLLNSPSWNVHPVYSSNII+QG+TI AP+ S NTDGIN
Sbjct  184  LKYTRPYLIELMFSDNIQISNLTLLNSPSWNVHPVYSSNIIVQGITIFAPITSPNTDGIN  243

Query  9    PDS  1
            PDS
Sbjct  244  PDS  246



>ref|XP_003533597.1| PREDICTED: probable polygalacturonase-like [Glycine max]
 gb|KHN29325.1| Putative polygalacturonase [Glycine soja]
Length=484

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I  WP++ PLPSYG G+D    R+ S IFG+NL DV++TG NGTIDGQG FWWQQF  KK
Sbjct  126  ITEWPVLEPLPSYGRGRDAPAGRFTSLIFGTNLTDVIVTGENGTIDGQGEFWWQQFHRKK  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +DN+QISNLTLLNSPSWNVHPVYSSNII+QG+TI APV S NTDGIN
Sbjct  186  LKYTRPYLIELMFSDNIQISNLTLLNSPSWNVHPVYSSNIIVQGITIFAPVTSPNTDGIN  245

Query  9    PDS  1
            PDS
Sbjct  246  PDS  248



>ref|XP_003529926.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=498

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP+I PLPSYG G+D    RY SFIFG+NL DV++TG+NGTIDGQGAFWWQQF +K+
Sbjct  141  MNEWPVIKPLPSYGRGRDAPAGRYTSFIFGTNLTDVIVTGDNGTIDGQGAFWWQQFYNKR  200

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            L   RP LIE+M +D +QISNLT LNSPSWNVHPVYSSNIII+GLTI+APV S NTDGIN
Sbjct  201  LNYTRPYLIELMFSDKIQISNLTFLNSPSWNVHPVYSSNIIIKGLTIIAPVPSPNTDGIN  260

Query  9    PDS  1
            PDS
Sbjct  261  PDS  263



>ref|XP_006339619.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=476

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WP+I PLPSYG+G+D    RYIS IFG+NL DV+ITG NGTIDGQGA WWQQF   K
Sbjct  121  INQWPVIDPLPSYGHGRDAPGGRYISLIFGTNLTDVIITGENGTIDGQGALWWQQFHMNK  180

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+MH++ +QISNLTLLNSPSWN+HPVYSS+IIIQG+TILAPV S NTDGIN
Sbjct  181  LKYTRPYLIELMHSNKIQISNLTLLNSPSWNIHPVYSSDIIIQGITILAPVTSPNTDGIN  240

Query  9    PDS  1
            PDS
Sbjct  241  PDS  243



>gb|KHN26934.1| Putative polygalacturonase [Glycine soja]
Length=482

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP I PLPSYG G+D    RY S IFG+NL DV++TG NGTIDGQGAFWWQ+F  KK
Sbjct  126  ISEWPAIEPLPSYGRGRDAPAGRYTSLIFGTNLTDVIVTGGNGTIDGQGAFWWQKFHKKK  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLTLLNSPSWNVHPVYSSNIII+GLTI+APV S NTDGIN
Sbjct  186  LKYTRPYLIELMFSDQIQISNLTLLNSPSWNVHPVYSSNIIIKGLTIIAPVPSPNTDGIN  245

Query  9    PDS  1
            PDS
Sbjct  246  PDS  248



>emb|CBI34379.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP+I PLPSYG G+DT   RYIS IFG+NL DVVITG NGTIDGQGA WW +F   +L
Sbjct  125  HEWPVIDPLPSYGRGRDTQGGRYISLIFGTNLTDVVITGENGTIDGQGALWWAKFHKGEL  184

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIMH+DN+QIS+LTL+NSPSWNVHPVYSSN+IIQGLTI APV S NTDGINP
Sbjct  185  KYTRPYLIEIMHSDNVQISSLTLVNSPSWNVHPVYSSNVIIQGLTITAPVTSPNTDGINP  244

Query  6    DS  1
            DS
Sbjct  245  DS  246



>ref|XP_003552411.1| PREDICTED: probable polygalacturonase [Glycine max]
 gb|KHM99339.1| Putative polygalacturonase [Glycine soja]
Length=484

 Score =   194 bits (494),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I  WP++ PLPSYG G+D    R+ S IFG+NL DV++TG NGTIDGQG FWWQQF  KK
Sbjct  126  ITEWPVLEPLPSYGRGRDAPAGRFTSLIFGTNLTDVIVTGENGTIDGQGEFWWQQFHRKK  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +DN+QISNLTLLNSPSWNVHPVYSSNII+QG+TI APV S NTDGIN
Sbjct  186  LKYTRPYLIELMFSDNIQISNLTLLNSPSWNVHPVYSSNIIVQGITIYAPVTSPNTDGIN  245

Query  9    PDS  1
            PDS
Sbjct  246  PDS  248



>ref|XP_010112958.1| putative polygalacturonase [Morus notabilis]
 gb|EXC35117.1| putative polygalacturonase [Morus notabilis]
Length=454

 Score =   194 bits (492),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WP++ PLPSYG G+D +  R+ S IFG+NL D+V+TG NGTIDGQG+FWWQQF   K
Sbjct  124  INEWPVLKPLPSYGRGRDAAGGRFTSLIFGTNLTDIVVTGENGTIDGQGSFWWQQFHKGK  183

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM +D++QISNLTLLN+PSWNVHPVYSSNI+IQG+TI+APV S NTDGIN
Sbjct  184  LKYTRPYLIEIMFSDSIQISNLTLLNAPSWNVHPVYSSNILIQGITIIAPVTSPNTDGIN  243

Query  9    PDS  1
            PDS
Sbjct  244  PDS  246



>ref|XP_004295492.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   194 bits (494),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP++ PLPSYG G+D    RY S +FG+NL DVVITG+NGTIDGQG FWW +F SKKL+ 
Sbjct  124  WPVLKPLPSYGRGRDAPEGRYASLLFGTNLTDVVITGDNGTIDGQGEFWWNKFHSKKLQY  183

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE+M + N+QISNLTL+NSPSWNVHP+YSS+I++QGLTILAPV S NTDG+NPDS
Sbjct  184  TRPYLIEVMFSSNVQISNLTLINSPSWNVHPIYSSDILVQGLTILAPVSSPNTDGVNPDS  243



>ref|XP_003528838.1| PREDICTED: probable polygalacturonase [Glycine max]
Length=482

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP I PLPSYG G+D    RY S IFG+NL DV++TG NGTIDGQGAFWWQ+F  KK
Sbjct  126  ISEWPAIEPLPSYGRGRDAPAGRYTSLIFGTNLTDVIVTGGNGTIDGQGAFWWQKFHKKK  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLTLLNSPSWN+HPVYSSNIII+GLTI+APV S NTDGIN
Sbjct  186  LKYTRPYLIELMFSDQIQISNLTLLNSPSWNLHPVYSSNIIIKGLTIIAPVPSPNTDGIN  245

Query  9    PDS  1
            PDS
Sbjct  246  PDS  248



>ref|XP_004229920.2| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=476

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WPLI PLPSYG+G+D    RYIS IFG+NL DV+ITG NGTIDGQGA WWQQF   K
Sbjct  121  INQWPLIDPLPSYGHGRDAPGGRYISLIFGTNLTDVIITGENGTIDGQGALWWQQFHLNK  180

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+MH++ +QISNLTLLNSPSWN+HPVYSSNIII G+TILAPV S NTDGI+
Sbjct  181  LKYTRPYLIELMHSNKIQISNLTLLNSPSWNIHPVYSSNIIINGITILAPVTSPNTDGID  240

Query  9    PDS  1
            PDS
Sbjct  241  PDS  243



>ref|XP_002278930.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=480

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP+I PLPSYG G+DT   RYIS IFG+NL DVVITG NGTIDGQGA WW +F   +L
Sbjct  125  HEWPVIDPLPSYGRGRDTQGGRYISLIFGTNLTDVVITGENGTIDGQGALWWAKFHKGEL  184

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIMH+DN+QIS+LTL+NSPSWNVHPVYSSN+IIQGLTI APV S NTDGINP
Sbjct  185  KYTRPYLIEIMHSDNVQISSLTLVNSPSWNVHPVYSSNVIIQGLTITAPVTSPNTDGINP  244

Query  6    DS  1
            DS
Sbjct  245  DS  246



>gb|AAP33475.1| polygalacturonase-like protein [Fragaria x ananassa]
Length=474

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP++  LPSYG G+D +  RY S IFG+NL DV++TG NGTIDGQG FWWQQF  KK
Sbjct  119  LNEWPVLKALPSYGRGRDAAAGRYSSLIFGTNLTDVIVTGENGTIDGQGEFWWQQFHKKK  178

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM + ++QISNLTLLNSPSWNVHPVYSSNII+QG+TI+AP+ S NTDGIN
Sbjct  179  LKYTRPYLIEIMFSSDIQISNLTLLNSPSWNVHPVYSSNIIVQGITIIAPISSPNTDGIN  238

Query  9    PDS  1
            PDS
Sbjct  239  PDS  241



>ref|XP_010089056.1| putative polygalacturonase [Morus notabilis]
 gb|EXB37303.1| putative polygalacturonase [Morus notabilis]
Length=466

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG+NL DV+ITG+NGTIDGQG  WWQ+FRSK+L
Sbjct  111  NEWPVIEPLPSYGRGRDTEGGRFSSLIFGTNLTDVIITGDNGTIDGQGELWWQKFRSKQL  170

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP LIE+MH++N+QISNLTL+NSPSWN+HPVY SN+I+QG+TILAPV S NTDGINP
Sbjct  171  LYTRPYLIELMHSENIQISNLTLVNSPSWNIHPVYCSNVIVQGITILAPVTSPNTDGINP  230

Query  6    DS  1
            DS
Sbjct  231  DS  232



>emb|CBI40426.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D +  RY S IFG+NL DV+ITG+NGTIDGQG  WWQ+F   K
Sbjct  120  ISQWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVIITGDNGTIDGQGGLWWQRFHGGK  179

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M++ ++QISNLTLLNSPSWNVHPVYS NI+IQG+TILAPV+S NTDGIN
Sbjct  180  LKYTRPYLIELMYSADIQISNLTLLNSPSWNVHPVYSRNILIQGITILAPVRSPNTDGIN  239

Query  9    PDS  1
            PDS
Sbjct  240  PDS  242



>ref|XP_004298828.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=503

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT+  R+IS IFG+NL DVV+TG NGTIDGQG  WWQ+FR  +L
Sbjct  148  NEWPVIDPLPSYGRGRDTAGGRFISLIFGTNLTDVVVTGENGTIDGQGELWWQKFRKGEL  207

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIM ++N+QISNLT +NSPSWNVHPVYSSN+++QGLTILAPV S NTDGINP
Sbjct  208  KYTRPYLIEIMFSENIQISNLTFINSPSWNVHPVYSSNVLVQGLTILAPVTSPNTDGINP  267

Query  6    DS  1
            DS
Sbjct  268  DS  269



>ref|XP_007144550.1| hypothetical protein PHAVU_007G165300g [Phaseolus vulgaris]
 gb|ESW16544.1| hypothetical protein PHAVU_007G165300g [Phaseolus vulgaris]
Length=474

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D +  RY S IFG+NL DV++TG+NGTIDGQGAFWWQ+F  K+
Sbjct  118  ISEWPVIEPLPSYGRGRDAAAGRYTSLIFGTNLTDVIVTGDNGTIDGQGAFWWQKFHKKQ  177

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLTLLNSPSWNVHPVYSSNIII+GLTI+A + S NTDGIN
Sbjct  178  LKYTRPYLIELMFSDKIQISNLTLLNSPSWNVHPVYSSNIIIKGLTIIATLPSPNTDGIN  237

Query  9    PDS  1
            PDS
Sbjct  238  PDS  240



>ref|XP_007219266.1| hypothetical protein PRUPE_ppa018224mg, partial [Prunus persica]
 gb|EMJ20465.1| hypothetical protein PRUPE_ppa018224mg, partial [Prunus persica]
Length=463

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP++ PLPSYG G+D +  R+ S IFG+NL DV++TG+NGTIDGQG FWWQQF  KK
Sbjct  120  MNEWPVLKPLPSYGRGRDAAAGRFSSLIFGTNLTDVIVTGDNGTIDGQGEFWWQQFHKKK  179

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM + ++QISNLTLL+SPSWNVHPVYSSNI++QG+TI+AP+ S NTDGIN
Sbjct  180  LKYTRPYLIEIMFSTDIQISNLTLLDSPSWNVHPVYSSNILVQGITIIAPITSPNTDGIN  239

Query  9    PDS  1
            PDS
Sbjct  240  PDS  242



>ref|XP_004306749.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP++  LPSYG G+D +  RY S IFG+NL DV++TG NGTIDGQG FWWQQF  KK
Sbjct  119  LNEWPVLKALPSYGRGRDAAAGRYSSLIFGTNLTDVIVTGENGTIDGQGEFWWQQFHKKK  178

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM + ++QISNLTLLNSPSWNVHPVYSSNI++QG+TI+AP+ S NTDGIN
Sbjct  179  LKYTRPYLIEIMFSSDIQISNLTLLNSPSWNVHPVYSSNILVQGITIIAPISSPNTDGIN  238

Query  9    PDS  1
            PDS
Sbjct  239  PDS  241



>gb|KHM99951.1| Putative polygalacturonase [Glycine soja]
Length=434

 Score =   191 bits (485),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG+NL DV+ITG+NGTIDGQG  WWQ+FR  +L
Sbjct  80   NDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVIITGDNGTIDGQGDLWWQKFRKGEL  139

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIM++DN+QISNLTL+NSPSWNVHP+YSSN+++QG+TILAPV S NTDGINP
Sbjct  140  KYTRPYLIEIMYSDNVQISNLTLVNSPSWNVHPIYSSNLVVQGITILAPVTSPNTDGINP  199

Query  6    DS  1
            DS
Sbjct  200  DS  201



>gb|KEH21119.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=470

 Score =   192 bits (487),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP+I PLPSYG G+DT   RY S IFG+NL DVVITGNNGT+DGQG  WWQ+F   KL  
Sbjct  118  WPVIDPLPSYGRGRDTQGGRYSSLIFGTNLTDVVITGNNGTLDGQGELWWQKFHKGKLTY  177

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM++DN+QISNLTL+NSPSWNVHPVYSSNII+QG+TILAPV S NTDGINPDS
Sbjct  178  TRPYLIEIMYSDNIQISNLTLVNSPSWNVHPVYSSNIIVQGITILAPVNSPNTDGINPDS  237



>ref|XP_006386609.1| hypothetical protein POPTR_0002s16390g [Populus trichocarpa]
 gb|ERP64406.1| hypothetical protein POPTR_0002s16390g [Populus trichocarpa]
Length=357

 Score =   189 bits (479),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP++ PLPSYG G+D +  RY S IFG+NL DV+ITGNNGTIDGQGAFWWQ F   K
Sbjct  1    MQEWPVMKPLPSYGRGRDAAAGRYSSLIFGTNLTDVIITGNNGTIDGQGAFWWQNFHKGK  60

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM +D +QISNLTLLNSPSWNVHPVYS +I++QG+TI+AP+ S NTDGIN
Sbjct  61   LKYTRPYLIEIMFSDTIQISNLTLLNSPSWNVHPVYSRDILVQGITIIAPISSPNTDGIN  120

Query  9    PDS  1
            PDS
Sbjct  121  PDS  123



>gb|KHF98838.1| putative polygalacturonase [Gossypium arboreum]
Length=267

 Score =   186 bits (472),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP++ PLPSYG G+D +  R+ S I+G+NL DV++TG NGTIDGQG+FWWQ+F   K
Sbjct  126  MKEWPVLKPLPSYGRGRDAAGGRFTSLIYGTNLTDVIVTGANGTIDGQGSFWWQKFHKGK  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE M++D +QISNLTLLNSPSWNVHPVYSSNI+IQG+TILAPVKS NTDGIN
Sbjct  186  LKYTRPYLIEFMYSDTIQISNLTLLNSPSWNVHPVYSSNILIQGITILAPVKSPNTDGIN  245

Query  9    P  7
            P
Sbjct  246  P  246



>ref|XP_010055093.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW71569.1| hypothetical protein EUGRSUZ_E00105 [Eucalyptus grandis]
Length=472

 Score =   191 bits (486),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP + PLPSYG G+D +  RY S IFG+NL DV++TG+NGTIDGQGAFWWQ+F   K
Sbjct  116  MTEWPALKPLPSYGRGRDAAAGRYQSLIFGTNLTDVIVTGDNGTIDGQGAFWWQKFHGGK  175

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE M +D +QISNLTLLNSPSWNVHPVYSSNI++Q +TILAPVKS NTDGIN
Sbjct  176  LKYTRPYLIEFMFSDTIQISNLTLLNSPSWNVHPVYSSNILVQRITILAPVKSPNTDGIN  235

Query  9    PDS  1
            PDS
Sbjct  236  PDS  238



>ref|XP_006580552.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=469

 Score =   191 bits (485),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG+NL DV+ITG+NGTIDGQG  WWQ+FR  +L
Sbjct  115  NDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVIITGDNGTIDGQGDLWWQKFRKGEL  174

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIM++DN+QISNLTL+NSPSWNVHP+YSSN+++QG+TILAPV S NTDGINP
Sbjct  175  KYTRPYLIEIMYSDNVQISNLTLVNSPSWNVHPIYSSNLVVQGITILAPVTSPNTDGINP  234

Query  6    DS  1
            DS
Sbjct  235  DS  236



>ref|XP_007209970.1| hypothetical protein PRUPE_ppa004996mg [Prunus persica]
 gb|EMJ11169.1| hypothetical protein PRUPE_ppa004996mg [Prunus persica]
Length=482

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP+I PLPSYG G+DT   R+IS IFG+NL DVV+TG+NGTIDGQG  WWQ+F+  +L
Sbjct  127  SEWPVIEPLPSYGRGRDTDGGRFISLIFGTNLTDVVVTGDNGTIDGQGELWWQKFKKGEL  186

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIM+++N+QISNLTL+NSPSWNVHPVYSSN+++QG+TILAPV S NTDGINP
Sbjct  187  KYTRPYLIEIMYSENIQISNLTLINSPSWNVHPVYSSNVLVQGITILAPVTSPNTDGINP  246

Query  6    DS  1
            DS
Sbjct  247  DS  248



>ref|XP_004172137.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
Length=493

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP++ PLPSYG+G+DTS  RYIS IFG+NL DVVITGNNGTIDGQG  WWQ F   KL
Sbjct  138  NEWPVVEPLPSYGHGRDTSGGRYISLIFGTNLTDVVITGNNGTIDGQGDRWWQLFHQGKL  197

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIE+M++ ++QIS+LTLLNSP+WNVHPVYSSNI+IQG+TI+APV+S NTDGINP
Sbjct  198  KYTRPYLIELMYSSDIQISSLTLLNSPAWNVHPVYSSNILIQGITIIAPVRSPNTDGINP  257

Query  6    DS  1
            DS
Sbjct  258  DS  259



>ref|XP_004133855.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
 gb|KGN56496.1| hypothetical protein Csa_3G121720 [Cucumis sativus]
Length=493

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP++ PLPSYG+G+DTS  RYIS IFG+NL DVVITGNNGTIDGQG  WWQ F   KL
Sbjct  138  NEWPVVEPLPSYGHGRDTSGGRYISLIFGTNLTDVVITGNNGTIDGQGDRWWQLFHQGKL  197

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIE+M++ ++QIS+LTLLNSP+WNVHPVYSSNI+IQG+TI+APV+S NTDGINP
Sbjct  198  KYTRPYLIELMYSSDIQISSLTLLNSPAWNVHPVYSSNILIQGITIIAPVRSPNTDGINP  257

Query  6    DS  1
            DS
Sbjct  258  DS  259



>ref|XP_003525377.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=492

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG+NL DV+ITG+NGTIDGQG  WWQ+FR  +L
Sbjct  138  NDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVIITGDNGTIDGQGDLWWQKFRKGEL  197

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIM++DN+QISNLTL+NSPSWNVHP+YSSN+++QG+TILAPV S NTDGINP
Sbjct  198  KYTRPYLIEIMYSDNVQISNLTLVNSPSWNVHPIYSSNLVVQGITILAPVTSPNTDGINP  257

Query  6    DS  1
            DS
Sbjct  258  DS  259



>ref|XP_003633958.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=479

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D +  RY S IFG+NL DV+ITG+NGTIDGQG  WWQ+F   K
Sbjct  122  ISQWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVIITGDNGTIDGQGGLWWQRFHGGK  181

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M++ ++QISNLTLLNSPSWNVHPVYS NI+IQG+TILAPV+S NTDGIN
Sbjct  182  LKYTRPYLIELMYSADIQISNLTLLNSPSWNVHPVYSRNILIQGITILAPVRSPNTDGIN  241

Query  9    PDS  1
            PDS
Sbjct  242  PDS  244



>ref|XP_010255225.1| PREDICTED: probable polygalacturonase isoform X3 [Nelumbo nucifera]
Length=468

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP+I PLPSYG G+DT+  RY+S IFG+NL DVVITG+NGTIDGQGA WWQ+F   +
Sbjct  112  VSQWPVIEPLPSYGRGRDTAGGRYVSLIFGTNLTDVVITGDNGTIDGQGALWWQKFHKGQ  171

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM +D +QISNL L+NSPSWNVHPVYSSN+++QG+TI+APV S NTDGIN
Sbjct  172  LKYTRPYLIEIMFSDQVQISNLMLVNSPSWNVHPVYSSNVLVQGITIIAPVTSPNTDGIN  231

Query  9    PDS  1
            PDS
Sbjct  232  PDS  234



>ref|XP_008438007.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=493

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP++ PLPSYG+G+DTS  RYIS IFG+NL DVVITGNNGTIDGQG  WWQ F   KL
Sbjct  138  NEWPVVEPLPSYGHGRDTSGGRYISLIFGTNLTDVVITGNNGTIDGQGDRWWQLFHQGKL  197

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIE+M++ ++QIS+LTLLNSP+WNVHPVYSSNI+IQG+TI+APV+S NTDGINP
Sbjct  198  KYTRPYLIELMYSRDIQISSLTLLNSPAWNVHPVYSSNILIQGITIIAPVRSPNTDGINP  257

Query  6    DS  1
            DS
Sbjct  258  DS  259



>gb|KDP25392.1| hypothetical protein JCGZ_20548 [Jatropha curcas]
Length=480

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP+I PLPSYG G+D    RYIS IFG+NL DV+ITG NGTIDGQG  WWQ+FR+K+L  
Sbjct  127  WPVIEPLPSYGRGRDADGGRYISLIFGTNLTDVIITGANGTIDGQGDIWWQKFRNKELNY  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE+M++ N+QISNLTL+NSPSWNVHPVYSSNI++QG+TILAPV+S NTDGINPDS
Sbjct  187  TRPYLIELMYSSNIQISNLTLMNSPSWNVHPVYSSNIVVQGITILAPVRSPNTDGINPDS  246



>sp|A7PZL3.1|PGLR_VITVI RecName: Full=Probable polygalacturonase; Short=PG; AltName: 
Full=Pectinase [Vitis vinifera]
Length=491

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D +  RY S IFG+NL DV+ITG+NGTIDGQG  WWQ+F   K
Sbjct  134  ISQWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVIITGDNGTIDGQGGLWWQRFHGGK  193

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M++ ++QISNLTLLNSPSWNVHPVYS NI+IQG+TILAPV+S NTDGIN
Sbjct  194  LKYTRPYLIELMYSADIQISNLTLLNSPSWNVHPVYSRNILIQGITILAPVRSPNTDGIN  253

Query  9    PDS  1
            PDS
Sbjct  254  PDS  256



>ref|XP_010255224.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=489

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP+I PLPSYG G+DT+  RY+S IFG+NL DVVITG+NGTIDGQGA WWQ+F   +
Sbjct  133  VSQWPVIEPLPSYGRGRDTAGGRYVSLIFGTNLTDVVITGDNGTIDGQGALWWQKFHKGQ  192

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM +D +QISNL L+NSPSWNVHPVYSSN+++QG+TI+APV S NTDGIN
Sbjct  193  LKYTRPYLIEIMFSDQVQISNLMLVNSPSWNVHPVYSSNVLVQGITIIAPVTSPNTDGIN  252

Query  9    PDS  1
            PDS
Sbjct  253  PDS  255



>ref|XP_010276903.1| PREDICTED: probable polygalacturonase isoform X3 [Nelumbo nucifera]
Length=434

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WPLI PLPSYG G+D    RYIS IFG+NL DVVITG+NGTIDGQG  WWQ++RS +
Sbjct  76   VSEWPLIEPLPSYGRGRDAPGGRYISLIFGTNLTDVVITGDNGTIDGQGDLWWQKYRSGQ  135

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            L   RP LIEIM++D +QISNL L+NSPSWNVHPVYSSN+I+QGLTI APV S NTDGIN
Sbjct  136  LNYTRPYLIEIMYSDQVQISNLALVNSPSWNVHPVYSSNVIVQGLTITAPVTSPNTDGIN  195

Query  9    PDS  1
            PDS
Sbjct  196  PDS  198



>gb|KHN16795.1| Putative polygalacturonase [Glycine soja]
Length=434

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG+NL DV+ITG+NGTIDGQG  WWQ+F   +L
Sbjct  80   NDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVIITGDNGTIDGQGDLWWQKFHKGEL  139

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP L+EIM++DN+QISNLTL+NSPSWNVHP+YSSN+++QG+TILAPV S NTDGINP
Sbjct  140  KYTRPYLVEIMYSDNVQISNLTLVNSPSWNVHPIYSSNVVVQGITILAPVTSPNTDGINP  199

Query  6    DS  1
            DS
Sbjct  200  DS  201



>ref|XP_011023292.1| PREDICTED: probable polygalacturonase isoform X2 [Populus euphratica]
Length=470

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP++ PLPSYG G+D +  RY S IFG+NL DV+ITGNNGTIDGQGAFWWQ F   K
Sbjct  114  MQEWPVMKPLPSYGRGRDAAAGRYSSLIFGTNLTDVIITGNNGTIDGQGAFWWQNFHKGK  173

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM +D +QISNLTLLNSPSWNVHPVYS +I++QG+TI+AP+ S NTDGIN
Sbjct  174  LKYTRPYLIEIMFSDTIQISNLTLLNSPSWNVHPVYSRDILVQGITIIAPITSPNTDGIN  233

Query  9    PDS  1
            PDS
Sbjct  234  PDS  236



>ref|XP_011023291.1| PREDICTED: probable polygalacturonase isoform X1 [Populus euphratica]
Length=473

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP++ PLPSYG G+D +  RY S IFG+NL DV+ITGNNGTIDGQGAFWWQ F   K
Sbjct  117  MQEWPVMKPLPSYGRGRDAAAGRYSSLIFGTNLTDVIITGNNGTIDGQGAFWWQNFHKGK  176

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM +D +QISNLTLLNSPSWNVHPVYS +I++QG+TI+AP+ S NTDGIN
Sbjct  177  LKYTRPYLIEIMFSDTIQISNLTLLNSPSWNVHPVYSRDILVQGITIIAPITSPNTDGIN  236

Query  9    PDS  1
            PDS
Sbjct  237  PDS  239



>ref|XP_010255223.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=508

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP+I PLPSYG G+DT+  RY+S IFG+NL DVVITG+NGTIDGQGA WWQ+F   +
Sbjct  152  VSQWPVIEPLPSYGRGRDTAGGRYVSLIFGTNLTDVVITGDNGTIDGQGALWWQKFHKGQ  211

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM +D +QISNL L+NSPSWNVHPVYSSN+++QG+TI+APV S NTDGIN
Sbjct  212  LKYTRPYLIEIMFSDQVQISNLMLVNSPSWNVHPVYSSNVLVQGITIIAPVTSPNTDGIN  271

Query  9    PDS  1
            PDS
Sbjct  272  PDS  274



>ref|XP_008343414.1| PREDICTED: probable polygalacturonase [Malus domestica]
 ref|XP_008354013.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=483

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WP++  LPSYG G+D +  RY S I+G+NL DVV+TG+NGTIDGQG FWWQQF  KK
Sbjct  127  INEWPVLKALPSYGRGRDAAAGRYTSLIWGTNLTDVVVTGDNGTIDGQGEFWWQQFHKKK  186

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM + ++QISNLTLLNSPSWNVHPVYSSNI+++G+TI+AP+ S NTDGIN
Sbjct  187  LKYTRPYLIEIMFSTDVQISNLTLLNSPSWNVHPVYSSNILVKGITIIAPISSPNTDGIN  246

Query  9    PDS  1
            PDS
Sbjct  247  PDS  249



>ref|XP_002301370.1| polygalacturonase-like family protein [Populus trichocarpa]
 gb|EEE80643.1| polygalacturonase-like family protein [Populus trichocarpa]
Length=470

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP++ PLPSYG G+D +  RY S IFG+NL DV+ITGNNGTIDGQGAFWWQ F   K
Sbjct  114  MQEWPVMKPLPSYGRGRDAAAGRYSSLIFGTNLTDVIITGNNGTIDGQGAFWWQNFHKGK  173

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM +D +QISNLTLLNSPSWNVHPVYS +I++QG+TI+AP+ S NTDGIN
Sbjct  174  LKYTRPYLIEIMFSDTIQISNLTLLNSPSWNVHPVYSRDILVQGITIIAPISSPNTDGIN  233

Query  9    PDS  1
            PDS
Sbjct  234  PDS  236



>ref|XP_010276902.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=482

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WPLI PLPSYG G+D    RYIS IFG+NL DVVITG+NGTIDGQG  WWQ++RS +
Sbjct  124  VSEWPLIEPLPSYGRGRDAPGGRYISLIFGTNLTDVVITGDNGTIDGQGDLWWQKYRSGQ  183

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            L   RP LIEIM++D +QISNL L+NSPSWNVHPVYSSN+I+QGLTI APV S NTDGIN
Sbjct  184  LNYTRPYLIEIMYSDQVQISNLALVNSPSWNVHPVYSSNVIVQGLTITAPVTSPNTDGIN  243

Query  9    PDS  1
            PDS
Sbjct  244  PDS  246



>ref|XP_006476506.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=480

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP+I PLPSYG G+DT   RY S IFG+NL DVVITG+NGTIDGQG  WW++FR+ +LK 
Sbjct  127  WPVIEPLPSYGRGRDTEGGRYSSLIFGTNLTDVVITGDNGTIDGQGEPWWRKFRAGELKY  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+ N+QISNLTL+NSPSWNVHPVYSS++I+QG+TILAPV S NTDGINPDS
Sbjct  187  TRPYLIEIMHSQNIQISNLTLINSPSWNVHPVYSSSVIVQGITILAPVTSPNTDGINPDS  246



>ref|XP_009349812.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=483

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WP++  LPSYG G+D +  RY S I+G+NL DVV+TG+NGTIDGQG FWWQQF  KK
Sbjct  127  INEWPVLKALPSYGRGRDAAAGRYTSLIWGTNLTDVVVTGDNGTIDGQGEFWWQQFHKKK  186

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M + ++QISNLTLLNSPSWNVHPVYSSNI+++G+TI+AP+ S NTDGIN
Sbjct  187  LKYTRPYLIEVMFSTDVQISNLTLLNSPSWNVHPVYSSNILVKGITIIAPISSPNTDGIN  246

Query  9    PDS  1
            PDS
Sbjct  247  PDS  249



>ref|XP_008238946.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=482

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP+I PLPSYG G+DT   R+IS IFG+NL DVVITG+NGTIDGQG  WWQ+F+  +L
Sbjct  127  SEWPVIQPLPSYGRGRDTDGGRFISLIFGTNLTDVVITGHNGTIDGQGELWWQKFKKGEL  186

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIM+++N+QISNLTL+NSPSWNVHPVYSS++++QG+TILAPV S NTDGINP
Sbjct  187  KYTRPYLIEIMYSENIQISNLTLINSPSWNVHPVYSSHVLVQGITILAPVTSPNTDGINP  246

Query  6    DS  1
            DS
Sbjct  247  DS  248



>gb|ACU20792.1| unknown [Glycine max]
Length=243

 Score =   183 bits (465),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP I PLPSYG G+D    RY S IFG+NL DV++TG NGTIDGQGAFWWQ+F  KK
Sbjct  126  ISEWPAIEPLPSYGRGRDAPAGRYTSLIFGTNLTDVIVTGGNGTIDGQGAFWWQKFHKKK  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDG  16
            LK  RP LIE+M +D +QISNLTLLNSPSWN+HPVYSSNIII+GLTI+APV S NTDG
Sbjct  186  LKYTRPYLIELMFSDQIQISNLTLLNSPSWNLHPVYSSNIIIKGLTIIAPVPSPNTDG  243



>ref|XP_006439488.1| hypothetical protein CICLE_v10019941mg [Citrus clementina]
 gb|ESR52728.1| hypothetical protein CICLE_v10019941mg [Citrus clementina]
Length=480

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP+I PLPSYG G+DT   RY S IFG+NL DVVITG+NGTIDGQG  WW++FR+ +LK 
Sbjct  127  WPVIEPLPSYGRGRDTEGGRYSSLIFGTNLTDVVITGDNGTIDGQGELWWRKFRAGELKY  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM++ N+QISNLTL+NSPSWNVHPVYSS++I+QG+TILAPV S NTDGINPDS
Sbjct  187  TRPYLIEIMYSQNIQISNLTLINSPSWNVHPVYSSSVIVQGITILAPVTSPNTDGINPDS  246



>ref|XP_006343936.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=483

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N +P+I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F + +L
Sbjct  127  NDYPVIAPLPSYGRGRDTDGGRFISLVFGSNLTDVVITGENGTIDGQGQLWWDKFHNGEL  186

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIM++DN+QIS+LTL+NSPSWNVHPVY SNIIIQG+TILAPV+S NTDGINP
Sbjct  187  KFTRPYLIEIMYSDNIQISSLTLINSPSWNVHPVYCSNIIIQGITILAPVRSPNTDGINP  246

Query  6    DS  1
            DS
Sbjct  247  DS  248



>gb|KDO76318.1| hypothetical protein CISIN_1g011659mg [Citrus sinensis]
Length=480

 Score =   189 bits (480),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP+I PLPSYG G+DT   RY S IFG+NL DVVITG+NGTIDGQG  WW++FR+ +LK 
Sbjct  127  WPVIEPLPSYGRGRDTEGGRYSSLIFGTNLTDVVITGDNGTIDGQGELWWRKFRAGELKY  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM++ N+QISNLTL+NSPSWNVHPVYSS++I+QG+TILAPV S NTDGINPDS
Sbjct  187  TRPYLIEIMYSQNIQISNLTLINSPSWNVHPVYSSSVIVQGITILAPVTSPNTDGINPDS  246



>ref|XP_004245570.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=483

 Score =   189 bits (480),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N +P+I PLPSYG G+DT   R+IS IFGSNL DVVITG NGTIDGQG  WW +F + +L
Sbjct  127  NDYPVIAPLPSYGRGRDTEGGRFISLIFGSNLTDVVITGENGTIDGQGQLWWDKFHNGEL  186

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIM++DN+QIS+LTL+NSPSWNVHPVY SN+IIQG+TILAPV+S NTDGINP
Sbjct  187  KFTRPYLIEIMYSDNIQISSLTLVNSPSWNVHPVYCSNVIIQGITILAPVRSPNTDGINP  246

Query  6    DS  1
            DS
Sbjct  247  DS  248



>ref|XP_009793070.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=482

 Score =   189 bits (480),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N +P+I PLPSYG G+DT   R+IS IFG+NL DVVITG NGTIDGQG  WW +F  K+L
Sbjct  127  NDYPVIAPLPSYGRGRDTDGGRFISLIFGTNLTDVVITGENGTIDGQGQLWWDKFHKKEL  186

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            +  RP LIEIM++DN+QIS+LTL+NSPSWNVHPVY SNIIIQG+TILAPV+S NTDGINP
Sbjct  187  QYTRPYLIEIMYSDNIQISSLTLVNSPSWNVHPVYCSNIIIQGITILAPVRSPNTDGINP  246

Query  6    DS  1
            DS
Sbjct  247  DS  248



>ref|XP_009395434.1| PREDICTED: probable polygalacturonase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=491

 Score =   189 bits (480),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 86/123 (70%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP+I PLPSYG G+D +  RY S I GSNL DV+ITG+NGTIDGQGAFWW +F   K
Sbjct  136  MNAWPIIDPLPSYGRGRDAAGGRYSSLIGGSNLTDVIITGDNGTIDGQGAFWWSKFHGHK  195

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+MH+D + ISNLTLLNSPSWN+HPVYSSNI++ G+TILAPV S NTDGIN
Sbjct  196  LKYTRGYLIELMHSDQIFISNLTLLNSPSWNIHPVYSSNIVVSGITILAPVHSPNTDGIN  255

Query  9    PDS  1
            PDS
Sbjct  256  PDS  258



>ref|XP_009395433.1| PREDICTED: probable polygalacturonase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score =   189 bits (480),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 86/123 (70%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP+I PLPSYG G+D +  RY S I GSNL DV+ITG+NGTIDGQGAFWW +F   K
Sbjct  142  MNAWPIIDPLPSYGRGRDAAGGRYSSLIGGSNLTDVIITGDNGTIDGQGAFWWSKFHGHK  201

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+MH+D + ISNLTLLNSPSWN+HPVYSSNI++ G+TILAPV S NTDGIN
Sbjct  202  LKYTRGYLIELMHSDQIFISNLTLLNSPSWNIHPVYSSNIVVSGITILAPVHSPNTDGIN  261

Query  9    PDS  1
            PDS
Sbjct  262  PDS  264



>ref|XP_003532926.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=494

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG+NL DV+ITG+NGTIDGQG  WWQ+F   +L
Sbjct  140  NDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVIITGDNGTIDGQGDLWWQKFHKGEL  199

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP L+EIM++DN+QISNLTL+NSPSWNVHP+YSSN+++QG+TILAPV S NTDGINP
Sbjct  200  KYTRPYLVEIMYSDNVQISNLTLVNSPSWNVHPIYSSNVVVQGITILAPVTSPNTDGINP  259

Query  6    DS  1
            DS
Sbjct  260  DS  261



>ref|XP_010469084.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=476

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N +P++  LPSYG G+DT+  R+ S IFG+NL DV+ITGNNGTIDGQG+FWWQ+F   K
Sbjct  116  LNEYPILKALPSYGRGRDTAGGRFASLIFGTNLSDVIITGNNGTIDGQGSFWWQKFHGGK  175

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM +D +QISNLT L+SPSWN+HPVYSSNII++G+TI+APVKS NTDGIN
Sbjct  176  LKYTRPYLIEIMFSDTIQISNLTFLDSPSWNIHPVYSSNIIVKGVTIIAPVKSPNTDGIN  235

Query  9    PDS  1
            PDS
Sbjct  236  PDS  238



>ref|XP_007051732.1| Polygalacturonase, putative isoform 2 [Theobroma cacao]
 gb|EOX95889.1| Polygalacturonase, putative isoform 2 [Theobroma cacao]
Length=481

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP++ PLPSYG G+D +  R+ S IFG+NL DV++TG NGTIDGQGAFWWQ F   K
Sbjct  125  MSEWPVLKPLPSYGRGRDAAAGRFTSLIFGTNLTDVIVTGANGTIDGQGAFWWQNFHKGK  184

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE M++D +QISNLTLLN+PSWNVHPVYSSNI++QG+TI+AP+ S NTDGIN
Sbjct  185  LKYTRPYLIEFMYSDTIQISNLTLLNAPSWNVHPVYSSNILVQGITIIAPITSPNTDGIN  244

Query  9    PDS  1
            PDS
Sbjct  245  PDS  247



>ref|XP_007051731.1| Polygalacturonase, putative isoform 1 [Theobroma cacao]
 gb|EOX95888.1| Polygalacturonase, putative isoform 1 [Theobroma cacao]
Length=484

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP++ PLPSYG G+D +  R+ S IFG+NL DV++TG NGTIDGQGAFWWQ F   K
Sbjct  128  MSEWPVLKPLPSYGRGRDAAAGRFTSLIFGTNLTDVIVTGANGTIDGQGAFWWQNFHKGK  187

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE M++D +QISNLTLLN+PSWNVHPVYSSNI++QG+TI+AP+ S NTDGIN
Sbjct  188  LKYTRPYLIEFMYSDTIQISNLTLLNAPSWNVHPVYSSNILVQGITIIAPITSPNTDGIN  247

Query  9    PDS  1
            PDS
Sbjct  248  PDS  250



>ref|XP_006584731.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=506

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG+NL DV+ITG+NGTIDGQG  WWQ+F   +L
Sbjct  152  NDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVIITGDNGTIDGQGDLWWQKFHKGEL  211

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP L+EIM++DN+QISNLTL+NSPSWNVHP+YSSN+++QG+TILAPV S NTDGINP
Sbjct  212  KYTRPYLVEIMYSDNVQISNLTLVNSPSWNVHPIYSSNVVVQGITILAPVTSPNTDGINP  271

Query  6    DS  1
            DS
Sbjct  272  DS  273



>ref|XP_007160099.1| hypothetical protein PHAVU_002G292300g [Phaseolus vulgaris]
 gb|ESW32093.1| hypothetical protein PHAVU_002G292300g [Phaseolus vulgaris]
Length=469

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG+NL DV+ITG NGT+DGQG  WWQ+F   +L
Sbjct  115  NDWPVIDPLPSYGRGRDTQGGRFSSLIFGTNLTDVIITGANGTLDGQGDLWWQKFHKGEL  174

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEIM++DN+QISNLTL+NSPSWNVHPVYSSN+++QG+TILAPV S NTDGINP
Sbjct  175  KYTRPYLIEIMYSDNVQISNLTLVNSPSWNVHPVYSSNVVVQGVTILAPVTSPNTDGINP  234

Query  6    DS  1
            DS
Sbjct  235  DS  236



>ref|XP_006402475.1| hypothetical protein EUTSA_v10005939mg [Eutrema salsugineum]
 gb|ESQ43928.1| hypothetical protein EUTSA_v10005939mg [Eutrema salsugineum]
Length=475

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN +P++  LPSYG G+D +  R+ S +FG+NL DVVITGNNGTIDGQG+FWWQ+F   K
Sbjct  117  INEYPILKALPSYGRGRDAAGGRFASLLFGTNLSDVVITGNNGTIDGQGSFWWQKFHGGK  176

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLTLL+SPSWN+HPVYSSNII++G+TI+APVKS NTDGIN
Sbjct  177  LKYTRPYLIELMFSDTIQISNLTLLDSPSWNIHPVYSSNIIVKGVTIIAPVKSPNTDGIN  236

Query  9    PDS  1
            PDS
Sbjct  237  PDS  239



>ref|XP_010276899.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=483

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WPLI PLPSYG G+D    RYIS IFG+NL DVVITG+NGTIDGQG  WWQ++RS +
Sbjct  125  VSEWPLIEPLPSYGRGRDAPGGRYISLIFGTNLTDVVITGDNGTIDGQGDLWWQKYRSGQ  184

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            L   RP LIEIM++D +QISNL L+NSPSWNVHPVYSSN+I+QGLTI APV S NTDGIN
Sbjct  185  LNYTRPYLIEIMYSDQVQISNLALVNSPSWNVHPVYSSNVIVQGLTITAPVTSPNTDGIN  244

Query  9    PDS  1
            PDS
Sbjct  245  PDS  247



>ref|XP_004503680.1| PREDICTED: probable polygalacturonase-like isoform X3 [Cicer 
arietinum]
Length=470

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG+NL DV+ITG+NGT+DGQG  WWQ+F   +L
Sbjct  115  NDWPVIDPLPSYGRGRDTQGGRFRSLIFGTNLTDVIITGDNGTLDGQGELWWQKFHHGQL  174

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP LIEIM++DN+QISNLTL+NSPSWNVHPVYSSN+I+QG+TILAPV S NTDGINP
Sbjct  175  SYTRPYLIEIMYSDNIQISNLTLVNSPSWNVHPVYSSNVIVQGITILAPVNSPNTDGINP  234

Query  6    DS  1
            DS
Sbjct  235  DS  236



>gb|AAZ32910.1| polygalacturonase-like protein [Medicago sativa]
Length=206

 Score =   180 bits (456),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WP+I PLPSYG G+D +  R+ S IFG+NL DV++TG+NGTIDGQG+FWWQQF +KK
Sbjct  82   INEWPVIKPLPSYGRGRDAAAGRHTSLIFGTNLTDVIVTGDNGTIDGQGSFWWQQFHNKK  141

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +DN+QISNLTLL+SPSWN+HPVYSSNIII+G+TI+AP++S NTDGIN
Sbjct  142  LKYTRPYLIELMFSDNIQISNLTLLDSPSWNIHPVYSSNIIIKGITIIAPIRSPNTDGIN  201

Query  9    PDS  1
            PDS
Sbjct  202  PDS  204



>gb|KHG15710.1| hypothetical protein F383_10492 [Gossypium arboreum]
Length=481

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP++  LPSYG G+D +  R+ S IFG+NL DVV+TG NGTIDGQGAFWWQ F   K
Sbjct  125  MSEWPVLKALPSYGRGRDAAGGRFASLIFGTNLTDVVVTGANGTIDGQGAFWWQNFHKGK  184

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE M++DN+QISNLT LNSPSWNVHPVYSSNI++QG+TI+AP+ S NTDGIN
Sbjct  185  LKYTRPYLIEFMYSDNIQISNLTFLNSPSWNVHPVYSSNILVQGITIIAPITSPNTDGIN  244

Query  9    PDS  1
            PDS
Sbjct  245  PDS  247



>gb|KHG15709.1| hypothetical protein F383_10492 [Gossypium arboreum]
Length=482

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP++  LPSYG G+D +  R+ S IFG+NL DVV+TG NGTIDGQGAFWWQ F   K
Sbjct  126  MSEWPVLKALPSYGRGRDAAGGRFASLIFGTNLTDVVVTGANGTIDGQGAFWWQNFHKGK  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE M++DN+QISNLT LNSPSWNVHPVYSSNI++QG+TI+AP+ S NTDGIN
Sbjct  186  LKYTRPYLIEFMYSDNIQISNLTFLNSPSWNVHPVYSSNILVQGITIIAPITSPNTDGIN  245

Query  9    PDS  1
            PDS
Sbjct  246  PDS  248



>ref|XP_010053221.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW77483.1| hypothetical protein EUGRSUZ_D01821 [Eucalyptus grandis]
Length=482

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPLI PLPSYG G+D    RY S +FG+NL D+VITG+NGTIDGQG  WWQ+FR  KL  
Sbjct  129  WPLIDPLPSYGRGRDAVGGRYGSLLFGTNLTDIVITGDNGTIDGQGELWWQKFRGGKLNY  188

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM++D +QISNLTLLNSPSWNVHPVYSSN+I+QG+TILAP  S NTDGINPDS
Sbjct  189  TRPYLIEIMYSDKVQISNLTLLNSPSWNVHPVYSSNVIVQGITILAPTNSPNTDGINPDS  248



>ref|XP_010413390.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010413391.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010413392.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=476

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N +P++  LPSYG G+D +  R+ S IFG+NL DV+ITGNNGTIDGQG+FWWQ+F   K
Sbjct  116  LNEYPILKALPSYGRGRDAAGGRFASLIFGTNLSDVIITGNNGTIDGQGSFWWQKFHGGK  175

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM +D +QISNLT L+SPSWN+HPVYSSNII++G+TI+APVKS NTDGIN
Sbjct  176  LKYTRPYLIEIMFSDTIQISNLTFLDSPSWNIHPVYSSNIIVKGVTIIAPVKSPNTDGIN  235

Query  9    PDS  1
            PDS
Sbjct  236  PDS  238



>ref|XP_009604283.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=482

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N +P+I PLPSYG G+D    R+IS IFG+NL DVVITG NGTIDGQG  WW +F  K+L
Sbjct  127  NDYPVIAPLPSYGRGRDNDGGRFISLIFGANLTDVVITGENGTIDGQGQLWWDKFHKKEL  186

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            +  RP LIEIM++DN+QIS+LTL+NSPSWNVHPVY SNIIIQG+TILAPV+S NTDGINP
Sbjct  187  QYTRPYLIEIMYSDNIQISSLTLVNSPSWNVHPVYCSNIIIQGITILAPVRSPNTDGINP  246

Query  6    DS  1
            DS
Sbjct  247  DS  248



>ref|XP_010676424.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WPLI PLPSYG G+D    RY S IFG+NL DV+ITG NGTIDGQG  WWQ+F  K+
Sbjct  129  MNEWPLIDPLPSYGRGRDAPGGRYASLIFGTNLTDVIITGENGTIDGQGEMWWQKFHHKQ  188

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M++D++QIS+LTL+NSPSWNVHP+YSSNI+IQG+TI APV S NTDGIN
Sbjct  189  LKHTRPYLIELMYSDSIQISHLTLINSPSWNVHPIYSSNILIQGITISAPVNSPNTDGIN  248

Query  9    PDS  1
            PDS
Sbjct  249  PDS  251



>ref|XP_006291035.1| hypothetical protein CARUB_v10017147mg [Capsella rubella]
 gb|EOA23933.1| hypothetical protein CARUB_v10017147mg [Capsella rubella]
Length=475

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N +P++  LPSYG G+D +  R+ S IFG+NL DV+ITGNNGTIDGQG+FWWQ+F   K
Sbjct  116  LNEYPILKALPSYGRGRDAAGGRFASLIFGTNLSDVIITGNNGTIDGQGSFWWQKFHGGK  175

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLT L+SPSWN+HPVYSSNII++G+TI+APVKS NTDGIN
Sbjct  176  LKYTRPYLIELMFSDTIQISNLTFLDSPSWNIHPVYSSNIIVKGVTIIAPVKSPNTDGIN  235

Query  9    PDS  1
            PDS
Sbjct  236  PDS  238



>gb|AFK37962.1| unknown [Lotus japonicus]
Length=469

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG++L DV+ITG+NGT+DGQG  WW++F +K+L
Sbjct  115  NEWPVIDPLPSYGRGRDTQGGRFSSLIFGTHLTDVIITGDNGTLDGQGDLWWKKFHNKQL  174

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            +  RP LIEIM++DN+QISNLTL+NSPSWN+HPVY SN+I+QG+TILAPV S NTDGINP
Sbjct  175  QYTRPYLIEIMYSDNVQISNLTLVNSPSWNIHPVYCSNVIVQGITILAPVTSPNTDGINP  234

Query  6    DS  1
            DS
Sbjct  235  DS  236



>gb|EYU23462.1| hypothetical protein MIMGU_mgv1a006147mg [Erythranthe guttata]
Length=455

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N W +I PLPSYG G+DT   RYIS IFG+NL DV+ITG+NGTIDGQG  WW +F   +L
Sbjct  92   NEWAVIEPLPSYGRGRDTEGGRYISLIFGTNLTDVIITGDNGTIDGQGETWWNKFHKGEL  151

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP LIEIM+++N+QISNLTL+NSPSWNVHPVY SN+I+QGLTILAPV S NTDGINP
Sbjct  152  SYTRPYLIEIMYSENVQISNLTLVNSPSWNVHPVYCSNVIVQGLTILAPVTSPNTDGINP  211

Query  6    DS  1
            DS
Sbjct  212  DS  213



>gb|AFK44529.1| unknown [Lotus japonicus]
Length=469

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG++L DV+ITG+NGT+DGQG  WW++F +K+L
Sbjct  115  NEWPVIDPLPSYGRGRDTQGGRFSSLIFGTHLTDVIITGDNGTLDGQGDLWWKKFHNKQL  174

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            +  RP LIEIM++DN+QISNLTL+NSPSWN+HPVY SN+I+QG+TILAPV S NTDGINP
Sbjct  175  QYTRPYLIEIMYSDNVQISNLTLVNSPSWNIHPVYCSNVIVQGITILAPVTSPNTDGINP  234

Query  6    DS  1
            DS
Sbjct  235  DS  236



>ref|NP_191708.1| polygalacturonase-like protein [Arabidopsis thaliana]
 ref|NP_974473.1| polygalacturonase-like protein [Arabidopsis thaliana]
 ref|NP_001190154.1| polygalacturonase-like protein [Arabidopsis thaliana]
 emb|CAB71079.1| putative protein [Arabidopsis thaliana]
 gb|AEE80211.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AEE80212.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AEE80213.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=476

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N +P++  LPSYG G+D +  R+ S IFG+NL DV+ITGNNGTIDGQG+FWWQ+F   K
Sbjct  116  LNEYPILKALPSYGRGRDAAGGRFASLIFGTNLSDVIITGNNGTIDGQGSFWWQKFHGGK  175

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLT L+SPSWN+HPVYSSNII++G+TI+APVKS NTDGIN
Sbjct  176  LKYTRPYLIELMFSDTIQISNLTFLDSPSWNIHPVYSSNIIVKGVTIIAPVKSPNTDGIN  235

Query  9    PDS  1
            PDS
Sbjct  236  PDS  238



>ref|XP_010523770.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=472

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN +P++  LPSYG G+D +  R+ S IFG+NL DVV+TGNNGTIDGQG+FWWQ F   K
Sbjct  118  INEFPVLKALPSYGRGRDAAGGRFASLIFGTNLTDVVVTGNNGTIDGQGSFWWQSFHKGK  177

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE M +D++QISNLTLL+SPSWN+HPVYSSNII++G+TI+APV S NTDGIN
Sbjct  178  LKYTRPYLIEFMFSDSIQISNLTLLDSPSWNIHPVYSSNIIVKGITIIAPVTSPNTDGIN  237

Query  9    PDS  1
            PDS
Sbjct  238  PDS  240



>ref|XP_010523769.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN +P++  LPSYG G+D +  R+ S IFG+NL DVV+TGNNGTIDGQG+FWWQ F   K
Sbjct  118  INEFPVLKALPSYGRGRDAAGGRFASLIFGTNLTDVVVTGNNGTIDGQGSFWWQSFHKGK  177

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE M +D++QISNLTLL+SPSWN+HPVYSSNII++G+TI+APV S NTDGIN
Sbjct  178  LKYTRPYLIEFMFSDSIQISNLTLLDSPSWNIHPVYSSNIIVKGITIIAPVTSPNTDGIN  237

Query  9    PDS  1
            PDS
Sbjct  238  PDS  240



>ref|XP_008794781.1| PREDICTED: probable polygalacturonase isoform X4 [Phoenix dactylifera]
Length=477

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP+I PLPSYG G+D +  RY S I GSNL DV+ITG+NGTIDGQGAFWWQ+F   K
Sbjct  125  MSEWPVIDPLPSYGRGRDHAGGRYSSLIGGSNLTDVIITGDNGTIDGQGAFWWQKFHGGK  184

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE++HTD + ISNLTLLNSP+WN+HPVYSSNI+I G+TILAPV+S NTDGIN
Sbjct  185  LKYTRGYLIELLHTDQIFISNLTLLNSPAWNIHPVYSSNIVISGITILAPVRSPNTDGIN  244

Query  9    PDS  1
            PDS
Sbjct  245  PDS  247



>ref|XP_010228133.1| PREDICTED: probable polygalacturonase isoform X2 [Brachypodium 
distachyon]
Length=495

 Score =   185 bits (470),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 84/123 (68%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D +  RY S I GSNL DVVITGNNGTIDGQGA WW +++S K
Sbjct  129  ISEWPVIAPLPSYGRGRDHAGGRYTSLISGSNLTDVVITGNNGTIDGQGATWWSKYKSGK  188

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+M +D + ISN+TLLNSP+WN+HPVYS NI+IQG+TILAP +S NTDGIN
Sbjct  189  LKYTRGYLIELMSSDTIFISNVTLLNSPAWNIHPVYSKNIVIQGVTILAPTRSPNTDGIN  248

Query  9    PDS  1
            PDS
Sbjct  249  PDS  251



>ref|XP_010228132.1| PREDICTED: probable polygalacturonase isoform X1 [Brachypodium 
distachyon]
Length=496

 Score =   185 bits (470),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 84/123 (68%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D +  RY S I GSNL DVVITGNNGTIDGQGA WW +++S K
Sbjct  130  ISEWPVIAPLPSYGRGRDHAGGRYTSLISGSNLTDVVITGNNGTIDGQGATWWSKYKSGK  189

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+M +D + ISN+TLLNSP+WN+HPVYS NI+IQG+TILAP +S NTDGIN
Sbjct  190  LKYTRGYLIELMSSDTIFISNVTLLNSPAWNIHPVYSKNIVIQGVTILAPTRSPNTDGIN  249

Query  9    PDS  1
            PDS
Sbjct  250  PDS  252



>ref|XP_010941157.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=486

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D +  RY S I GSNL DV+ITG+NGTIDGQGAFWWQQF   K
Sbjct  134  ISEWPVIDPLPSYGRGRDHAGGRYSSLIGGSNLTDVIITGDNGTIDGQGAFWWQQFHGGK  193

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE++H+D + ISNLTLLNSP+WNVHPVYSSNIII G+TILAP+ S NTDGIN
Sbjct  194  LKYTRGYLIELLHSDQIFISNLTLLNSPAWNVHPVYSSNIIISGITILAPLHSPNTDGIN  253

Query  9    PDS  1
            PDS
Sbjct  254  PDS  256



>ref|XP_008794778.1| PREDICTED: probable polygalacturonase isoform X2 [Phoenix dactylifera]
Length=486

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP+I PLPSYG G+D +  RY S I GSNL DV+ITG+NGTIDGQGAFWWQ+F   K
Sbjct  134  MSEWPVIDPLPSYGRGRDHAGGRYSSLIGGSNLTDVIITGDNGTIDGQGAFWWQKFHGGK  193

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE++HTD + ISNLTLLNSP+WN+HPVYSSNI+I G+TILAPV+S NTDGIN
Sbjct  194  LKYTRGYLIELLHTDQIFISNLTLLNSPAWNIHPVYSSNIVISGITILAPVRSPNTDGIN  253

Query  9    PDS  1
            PDS
Sbjct  254  PDS  256



>dbj|BAJ90091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   185 bits (469),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP+I PLPSYG G+D +  RY S + GSNL DVVITGNNGTIDGQGA WW +++S K
Sbjct  121  VAQWPVIDPLPSYGRGRDHAGGRYASLVSGSNLTDVVITGNNGTIDGQGATWWSKYKSGK  180

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+MHTD + ISN+TL+NSP+WN+HPVYS NI++ G+TILAPVKS NTDGIN
Sbjct  181  LKYTRGYLIELMHTDGVFISNVTLVNSPAWNIHPVYSRNIVVSGVTILAPVKSPNTDGIN  240

Query  9    PDS  1
            PDS
Sbjct  241  PDS  243



>ref|XP_008794779.1| PREDICTED: probable polygalacturonase isoform X3 [Phoenix dactylifera]
Length=486

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP+I PLPSYG G+D +  RY S I GSNL DV+ITG+NGTIDGQGAFWWQ+F   K
Sbjct  134  MSEWPVIDPLPSYGRGRDHAGGRYSSLIGGSNLTDVIITGDNGTIDGQGAFWWQKFHGGK  193

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE++HTD + ISNLTLLNSP+WN+HPVYSSNI+I G+TILAPV+S NTDGIN
Sbjct  194  LKYTRGYLIELLHTDQIFISNLTLLNSPAWNIHPVYSSNIVISGITILAPVRSPNTDGIN  253

Query  9    PDS  1
            PDS
Sbjct  254  PDS  256



>ref|XP_002876618.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52877.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N +P++  LPSYG G+D +  R+ S  FG+NL DV+ITGNNGTIDGQG+FWWQ+F   K
Sbjct  116  LNEYPILKALPSYGRGRDAAGGRFASLFFGTNLSDVIITGNNGTIDGQGSFWWQKFHGGK  175

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISNLT L+SPSWN+HPVYSSNII++G+TI+APVKS NTDGIN
Sbjct  176  LKYTRPYLIELMFSDTIQISNLTFLDSPSWNIHPVYSSNIIVKGVTIIAPVKSPNTDGIN  235

Query  9    PDS  1
            PDS
Sbjct  236  PDS  238



>ref|XP_008794777.1| PREDICTED: probable polygalacturonase isoform X1 [Phoenix dactylifera]
Length=495

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP+I PLPSYG G+D +  RY S I GSNL DV+ITG+NGTIDGQGAFWWQ+F   K
Sbjct  143  MSEWPVIDPLPSYGRGRDHAGGRYSSLIGGSNLTDVIITGDNGTIDGQGAFWWQKFHGGK  202

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE++HTD + ISNLTLLNSP+WN+HPVYSSNI+I G+TILAPV+S NTDGIN
Sbjct  203  LKYTRGYLIELLHTDQIFISNLTLLNSPAWNIHPVYSSNIVISGITILAPVRSPNTDGIN  262

Query  9    PDS  1
            PDS
Sbjct  263  PDS  265



>emb|CDP20376.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I +WP++ PLPSYG+G+D +  RYIS +FG+NL DVVITG+NGTIDGQGA WWQQF  KK
Sbjct  129  IGSWPVVDPLPSYGHGRDAAGGRYISLLFGTNLTDVVITGDNGTIDGQGALWWQQFHKKK  188

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIMH+D +QISNLTL+NSPSWNVHPVYSSNIIIQG+TI+AP+ S NTDGIN
Sbjct  189  LKFTRPYLIEIMHSDTVQISNLTLVNSPSWNVHPVYSSNIIIQGITIIAPITSPNTDGIN  248

Query  9    PDS  1
            PDS
Sbjct  249  PDS  251



>ref|XP_009363435.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=473

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKD-TSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
            WP+I PLPSYG G+D T   R+IS IFG+NL DVVITG+NGTIDGQG  WWQ+F+  +L 
Sbjct  118  WPVIEPLPSYGRGRDNTDGGRFISLIFGTNLTDVVITGDNGTIDGQGEVWWQKFKRGQLN  177

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPD  4
              RP LIEIM+++N+QISNLTL+NSPSWNVHP+YSSN+++QG+TILAPV S NTDGINPD
Sbjct  178  YTRPYLIEIMYSENIQISNLTLVNSPSWNVHPIYSSNVLVQGITILAPVTSPNTDGINPD  237

Query  3    S  1
            S
Sbjct  238  S  238



>ref|XP_004234221.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=467

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            W LIPPLPSYG G+DT   R+ISFIFG+NL DVVITG NGTIDGQG  WW +FR  +LK 
Sbjct  118  WDLIPPLPSYGVGRDTPGPRFISFIFGTNLTDVVITGGNGTIDGQGQPWWTKFRQGQLKN  177

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM +D++QISNLTL+NSPSWNVHPVYSS ++I+GLTILAPV S NTDGINPDS
Sbjct  178  TRPYLIEIMFSDHVQISNLTLINSPSWNVHPVYSSVVVIKGLTILAPVDSPNTDGINPDS  237



>gb|EMT00190.1| Putative polygalacturonase [Aegilops tauschii]
Length=398

 Score =   182 bits (461),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP+I PLPSYG G+D +  RY S + GSNL DVVITGNNGTIDGQGA WW +++S K
Sbjct  36   VTQWPVIDPLPSYGRGRDHAGGRYASLVSGSNLTDVVITGNNGTIDGQGATWWSKYKSGK  95

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+MHTD + ISN+TL+NSP+WN+HPVYS NI++ G+TILAP KS NTDGIN
Sbjct  96   LKYTRGYLIELMHTDGVFISNVTLVNSPAWNIHPVYSRNIVVSGVTILAPTKSPNTDGIN  155

Query  9    PDS  1
            PDS
Sbjct  156  PDS  158



>ref|XP_004503678.1| PREDICTED: probable polygalacturonase-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503679.1| PREDICTED: probable polygalacturonase-like isoform X2 [Cicer 
arietinum]
Length=500

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N WP+I PLPSYG G+DT   R+ S IFG+NL DV+ITG+NGT+DGQG  WWQ+F   +L
Sbjct  115  NDWPVIDPLPSYGRGRDTQGGRFRSLIFGTNLTDVIITGDNGTLDGQGELWWQKFHHGQL  174

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP LIEIM++DN+QISNLTL+NSPSWNVHPVYSSN+I+QG+TILAPV S NTDGINP
Sbjct  175  SYTRPYLIEIMYSDNIQISNLTLVNSPSWNVHPVYSSNVIVQGITILAPVNSPNTDGINP  234



>ref|XP_007038809.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY23310.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
Length=473

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPL+P LPSYG G+D    R+ S IFG+NL DVVITGNNGTIDGQGA+WW++F+  KL  
Sbjct  125  WPLLPVLPSYGRGRDAPDGRFSSLIFGTNLTDVVITGNNGTIDGQGAYWWKKFKEDKLNE  184

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM+++ +QISNLTL+NSPSWNVHP+YSS++IIQ LTILAPV S NTDGINPDS
Sbjct  185  TRPYLIEIMYSNQIQISNLTLINSPSWNVHPIYSSDVIIQHLTILAPVDSPNTDGINPDS  244



>gb|KHG23155.1| putative polygalacturonase [Gossypium arboreum]
Length=449

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            W +I PLPSYG G+D    RYIS IFG+NL DVVITG+NGTIDGQG  WW +F   +LK 
Sbjct  110  WAVIDPLPSYGRGRDADGGRYISLIFGTNLTDVVITGDNGTIDGQGVTWWNKFHKGELKY  169

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM+++ +QISNLTL+NSPSWNVHPVYSSN+++QGLTILAPV S NTDGINPDS
Sbjct  170  TRPYLIEIMYSNEVQISNLTLMNSPSWNVHPVYSSNVVVQGLTILAPVTSPNTDGINPDS  229



>ref|XP_007038808.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY23309.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=469

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPL+P LPSYG G+D    R+ S IFG+NL DVVITGNNGTIDGQGA+WW++F+  KL  
Sbjct  121  WPLLPVLPSYGRGRDAPDGRFSSLIFGTNLTDVVITGNNGTIDGQGAYWWKKFKEDKLNE  180

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM+++ +QISNLTL+NSPSWNVHP+YSS++IIQ LTILAPV S NTDGINPDS
Sbjct  181  TRPYLIEIMYSNQIQISNLTLINSPSWNVHPIYSSDVIIQHLTILAPVDSPNTDGINPDS  240



>gb|ACL54166.1| unknown [Zea mays]
Length=463

 Score =   182 bits (463),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP++ PLPSYG G+D    R+ S I GSNL DVVITG+NGTIDGQGA WW +F   +
Sbjct  125  VGEWPIVDPLPSYGRGRDKVGGRFASLIGGSNLTDVVITGSNGTIDGQGAMWWSKFHKNQ  184

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+MH+D + ISNLTLLNSP+WN+HPVYSSNI++QG+TILAP  S NTDGIN
Sbjct  185  LKYTRGYLIELMHSDTIYISNLTLLNSPAWNIHPVYSSNIVVQGITILAPTNSPNTDGIN  244

Query  9    PDS  1
            PDS
Sbjct  245  PDS  247



>ref|XP_006372397.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|ERP50194.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=452

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP  PPLPSYG G+D    R+ S IFG++L DVV+TGNNGTIDGQGA WW +F  KKLK+
Sbjct  106  WPAFPPLPSYGVGRDEHAGRFSSLIFGTHLTDVVVTGNNGTIDGQGAVWWDKFHQKKLKL  165

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE +++D +QISNLTL+NSPSWNVHP Y SN++IQ LTILAPV S NTDGINPDS
Sbjct  166  TRPYLIEFLYSDQVQISNLTLINSPSWNVHPTYCSNVLIQWLTILAPVDSPNTDGINPDS  225



>ref|XP_010436421.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=417

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  144  YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  203

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NTDGINPDS
Sbjct  204  TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSSNILIQGLTILAPVTVPNTDGINPDS  263



>ref|XP_010436419.1| PREDICTED: probable polygalacturonase, partial [Camelina sativa]
Length=358

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  5    YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  64

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NTDGINPDS
Sbjct  65   TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSSNILIQGLTILAPVTVPNTDGINPDS  124



>ref|XP_011046019.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=452

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP  PPLPSYG G+D    R+ S IFG++L DVV+TGNNGTIDGQGA WW +F  KKLK+
Sbjct  106  WPAFPPLPSYGVGRDEHAGRFSSLIFGTHLTDVVVTGNNGTIDGQGAVWWDKFHQKKLKL  165

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE +++D +QISNLTL+NSPSWNVHP Y SN++IQ LTILAPV S NTDGINPDS
Sbjct  166  TRPYLIEFLYSDQVQISNLTLINSPSWNVHPTYCSNVLIQWLTILAPVDSPNTDGINPDS  225



>ref|XP_004496831.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=481

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R+ S IFG++L DV+ITGNNGTIDGQG++WW +F+ K++K+
Sbjct  129  WPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVIITGNNGTIDGQGSYWWGKFKKKQMKL  188

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSPSW VHP+YSSNII+QGLTILAPV S NTDGINPDS
Sbjct  189  TRPYMIEIMYSDQIQISNLTLINSPSWFVHPIYSSNIIVQGLTILAPVTSPNTDGINPDS  248



>emb|CDY65355.1| BnaC08g49000D [Brassica napus]
Length=472

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  +P++  LPSYG G+D +  R+ S +FG+NL DV+ITGNNGTIDGQG+FWWQ+F   K
Sbjct  116  LEEYPVLKALPSYGRGRDAAGGRFASLVFGTNLSDVIITGNNGTIDGQGSFWWQKFHGGK  175

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISN+TL++SPSWN+HPVYSSNI+++G+TI+APVKS NTDGIN
Sbjct  176  LKYTRPYLIELMFSDTIQISNITLIDSPSWNIHPVYSSNILVKGVTIIAPVKSPNTDGIN  235

Query  9    PDS  1
            PDS
Sbjct  236  PDS  238



>ref|XP_003622464.1| Polygalacturonase-like protein [Medicago truncatula]
 gb|KEH18815.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=479

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WP+I PLPSYG G+D +  R+ S IFG+NL DV++TG+NGTIDGQG+FWWQQF +KK
Sbjct  126  INEWPVIKPLPSYGRGRDAAAGRHTSLIFGTNLTDVIVTGDNGTIDGQGSFWWQQFHNKK  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +DN+QISNLTLL+SPSWN+HPVYSSNIII+G+TI+AP++S NTDGIN
Sbjct  186  LKYTRPYLIELMFSDNIQISNLTLLDSPSWNIHPVYSSNIIIKGITIIAPIRSPNTDGIN  245

Query  9    PDS  1
            PDS
Sbjct  246  PDS  248



>emb|CDP12065.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            W +I PLPSYG G+DT   RYISFIFG+NL DVVITG+NGTIDGQG  WW +F   +L+ 
Sbjct  129  WTVIEPLPSYGRGRDTEGGRYISFIFGTNLTDVVITGDNGTIDGQGEPWWDKFHKGELQY  188

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE++++DN+QISNLTL+NSPSWN+HP YSSN+I+QG+TI APV S NTDGINPDS
Sbjct  189  TRPYLIELLYSDNIQISNLTLVNSPSWNIHPTYSSNVIVQGVTITAPVTSPNTDGINPDS  248



>ref|XP_009345122.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=485

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKD-TSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
            WP+I PLPSYG G+D T   R+IS IFG+NL DVVITG+NGTIDGQG  WWQ+F+  +L 
Sbjct  131  WPVIEPLPSYGRGRDNTDGGRFISLIFGTNLTDVVITGDNGTIDGQGEVWWQKFKKGQLN  190

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPD  4
              RP LIEIM+++ +QISNLTL+NSPSWNVHP+YSSN+++QG+TILAPV S NTDGINPD
Sbjct  191  YTRPYLIEIMYSEKIQISNLTLVNSPSWNVHPIYSSNVLVQGITILAPVTSPNTDGINPD  250

Query  3    S  1
            S
Sbjct  251  S  251



>ref|XP_002509850.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF51237.1| polygalacturonase, putative [Ricinus communis]
Length=480

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP+I PLPSYG G+DT   RY S IFG+NL DVVITG NGTIDGQG  WW++F + ++  
Sbjct  127  WPVIEPLPSYGRGRDTEGGRYSSLIFGTNLTDVVITGANGTIDGQGDLWWKKFHNGEINY  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM+++N+QISNLTL+NSPSWN+HP YSSN+++QG+TILAPV S NTDGINPDS
Sbjct  187  TRPYLIEIMYSNNIQISNLTLMNSPSWNIHPTYSSNVVVQGITILAPVNSPNTDGINPDS  246



>ref|XP_002299511.1| hypothetical protein POPTR_0001s09790g [Populus trichocarpa]
 gb|EEE84316.1| hypothetical protein POPTR_0001s09790g [Populus trichocarpa]
Length=481

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            +PLI PLPSYG G+D    RY S IFG+NL DV+ITG NGTIDGQG  WW +FR+ +L  
Sbjct  127  YPLIEPLPSYGRGRDADGARYSSLIFGNNLTDVIITGANGTIDGQGELWWTKFRAGELNY  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM + N+QISNLTL+NSPSWNVHPVY SN+++QGLTILAPV+S NTDGINPDS
Sbjct  187  TRPYLIEIMFSTNIQISNLTLINSPSWNVHPVYCSNVVVQGLTILAPVRSPNTDGINPDS  246



>emb|CDY48913.1| BnaA09g39240D [Brassica napus]
Length=471

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  +P++  LPSYG G+D +  R+ S +FG+NL DV+ITGNNGTIDG+G+FWWQ+F   K
Sbjct  116  LEEYPVLKALPSYGRGRDAAGGRFASLVFGTNLSDVIITGNNGTIDGRGSFWWQKFHGGK  175

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISN+TL++SPSWN+HPVYSSNII++G+TI+APVKS NTDGIN
Sbjct  176  LKYTRPYLIELMFSDTIQISNITLIDSPSWNIHPVYSSNIIVKGVTIIAPVKSPNTDGIN  235

Query  9    PDS  1
            PDS
Sbjct  236  PDS  238



>ref|XP_011029346.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=481

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            +PLI PLPSYG G+D    RY S IFG+NL DV++TG NGTIDGQG  WW +FR+ +L  
Sbjct  127  YPLIEPLPSYGRGRDADGARYSSLIFGNNLTDVIVTGANGTIDGQGELWWTKFRAGELNY  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM + N+QISNLTL+NSPSWNVHPVY SN+++QGLTILAPV+S NTDGINPDS
Sbjct  187  TRPYLIEIMFSTNIQISNLTLINSPSWNVHPVYCSNVVVQGLTILAPVRSPNTDGINPDS  246



>ref|XP_011022627.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=479

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            N +PLI PLPSYG G+D    R+ S IFG+NL DVVITG NGTIDGQG  WW +FR+ +L
Sbjct  125  NEYPLIEPLPSYGRGRDADGARFGSLIFGNNLTDVVITGANGTIDGQGELWWTKFRAGEL  184

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP LIEIM + N+QISNLTL++SPSWNVHPVY SN+++QGLTILAPV+S NTDGINP
Sbjct  185  NYTRPYLIEIMFSTNIQISNLTLIDSPSWNVHPVYCSNVVVQGLTILAPVRSPNTDGINP  244

Query  6    DS  1
            DS
Sbjct  245  DS  246



>ref|XP_010541188.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase [Tarenaya 
hassleriana]
Length=479

 Score =   181 bits (459),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 84/120 (70%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   RYIS IFG+NL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  133  YEVIEPLPSYGRGRDTEGGRYISLIFGTNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  192

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QIS+LT LNSPSW++HPVYSSNI+IQ LTILAPV   NTDGINPDS
Sbjct  193  TRPYLIEIMHSDGIQISSLTFLNSPSWHIHPVYSSNILIQSLTILAPVTVPNTDGINPDS  252



>ref|XP_010055092.1| PREDICTED: probable polygalacturonase isoform X2 [Eucalyptus 
grandis]
Length=479

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I +WPL  PLPSYG+G++    RY+SFIFG+NL DV+ITG+NG IDGQG  WW +F    
Sbjct  127  IKSWPLSDPLPSYGHGREAPGGRYMSFIFGTNLTDVIITGDNGKIDGQGGVWWNKFHKGS  186

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP+LIEI+H+ ++QISNLTLLNSP W VHPVYSS+I+IQG+TILAPVKS NTDGI+
Sbjct  187  LKYTRPHLIEILHSRSIQISNLTLLNSPFWTVHPVYSSDIVIQGVTILAPVKSPNTDGID  246

Query  9    PDS  1
            PDS
Sbjct  247  PDS  249



>ref|XP_010055091.1| PREDICTED: probable polygalacturonase isoform X1 [Eucalyptus 
grandis]
 gb|KCW71568.1| hypothetical protein EUGRSUZ_E00104 [Eucalyptus grandis]
Length=481

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I +WPL  PLPSYG+G++    RY+SFIFG+NL DV+ITG+NG IDGQG  WW +F    
Sbjct  129  IKSWPLSDPLPSYGHGREAPGGRYMSFIFGTNLTDVIITGDNGKIDGQGGVWWNKFHKGS  188

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP+LIEI+H+ ++QISNLTLLNSP W VHPVYSS+I+IQG+TILAPVKS NTDGI+
Sbjct  189  LKYTRPHLIEILHSRSIQISNLTLLNSPFWTVHPVYSSDIVIQGVTILAPVKSPNTDGID  248

Query  9    PDS  1
            PDS
Sbjct  249  PDS  251



>ref|XP_004496830.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=469

 Score =   181 bits (459),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R+ S IFG++L DV+ITGNNGTIDGQG++WW +F+  K+K+
Sbjct  123  WPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVIITGNNGTIDGQGSYWWSKFKKDKMKL  182

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSPSW VHP+YSSNIIIQGLTILAPV S NTDGI+PDS
Sbjct  183  TRPYMIEIMYSDQIQISNLTLINSPSWFVHPIYSSNIIIQGLTILAPVTSPNTDGIDPDS  242



>dbj|BAD67712.1| putative polygalacturonase [Oryza sativa Japonica Group]
 gb|EAY99340.1| hypothetical protein OsI_21311 [Oryza sativa Indica Group]
 gb|EAZ35554.1| hypothetical protein OsJ_19837 [Oryza sativa Japonica Group]
Length=485

 Score =   181 bits (459),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP+I PLPSYG G+D +  RY S I GSNL DVVITG NGTIDGQGA WW +F S KLK 
Sbjct  134  WPIIDPLPSYGRGRDKAGGRYASLIGGSNLTDVVITGANGTIDGQGAMWWSKFHSNKLKY  193

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             R  LIE+MH+D + ISN+TL+NSP+WN+HPVYSSNI++QG+TILAP  S NTDGINPDS
Sbjct  194  TRGYLIEVMHSDTVVISNVTLVNSPAWNIHPVYSSNIVVQGVTILAPTHSPNTDGINPDS  253



>ref|XP_004496829.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=475

 Score =   181 bits (459),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R+ S IFG++L DV+ITGNNGTIDGQG++WW +F+ K++K+
Sbjct  123  WPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVIITGNNGTIDGQGSYWWGKFKKKQMKL  182

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSPSW VHP+YSSNII+QGLTILAPV S NTDGI+PDS
Sbjct  183  TRPYMIEIMYSDQIQISNLTLINSPSWFVHPIYSSNIIVQGLTILAPVTSPNTDGIDPDS  242



>ref|XP_003624874.1| hypothetical protein MTR_7g088550 [Medicago truncatula]
 gb|AES81092.1| pectin lyase superfamily protein [Medicago truncatula]
Length=476

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +PPLPSYG G+D    R+ S IFG++L DV+ITGNNGTIDGQG++WW +F +K+LKI
Sbjct  124  WPQLPPLPSYGRGRDAPGPRFSSLIFGTHLTDVIITGNNGTIDGQGSYWWDKFHNKQLKI  183

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEI+++D +QISNLTL+NSPSW VHP YSSNIII+GLTILAPV S NTDGI+PDS
Sbjct  184  TRPYMIEILYSDQIQISNLTLINSPSWFVHPTYSSNIIIKGLTILAPVDSPNTDGIDPDS  243



>ref|XP_004964295.1| PREDICTED: probable polygalacturonase-like isoform X3 [Setaria 
italica]
Length=507

 Score =   181 bits (460),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 82/123 (67%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D    RY S I GSNL DVVITGNNGTIDGQGA WW +F   K
Sbjct  149  ISEWPVIAPLPSYGRGRDKIGGRYASLIGGSNLTDVVITGNNGTIDGQGAMWWSKFHQNK  208

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  L+E+M +D + ISN+TL+NSP+WN+HPVYSSNI++QG+TILAP +S NTDGIN
Sbjct  209  LKYTRGYLVELMWSDTIFISNVTLVNSPAWNIHPVYSSNIVVQGVTILAPTRSPNTDGIN  268

Query  9    PDS  1
            PDS
Sbjct  269  PDS  271



>ref|XP_002303605.2| hypothetical protein POPTR_0003s13160g [Populus trichocarpa]
 gb|EEE78584.2| hypothetical protein POPTR_0003s13160g [Populus trichocarpa]
Length=479

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            +PLI PLPSYG G+D    R+ S IFG+NL DVVITG NGTIDGQG  WW +FR+ +L  
Sbjct  127  YPLIEPLPSYGRGRDADGARFSSLIFGNNLTDVVITGANGTIDGQGELWWTKFRAGELNH  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM + N+QISNLTL+NSPSWNVHPVY SN+++QGLTILAPV+S NTDGINPDS
Sbjct  187  TRPYLIEIMFSTNIQISNLTLINSPSWNVHPVYCSNVVVQGLTILAPVRSPNTDGINPDS  246



>ref|XP_002437680.1| hypothetical protein SORBIDRAFT_10g000660 [Sorghum bicolor]
 gb|EER89047.1| hypothetical protein SORBIDRAFT_10g000660 [Sorghum bicolor]
Length=495

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WP+I PLPSYG G+D    R+ S + GSNL DVVITGNNGTIDGQGA WW +F   +
Sbjct  134  INEWPIIDPLPSYGRGRDKIGGRFASLVGGSNLTDVVITGNNGTIDGQGAMWWSKFHKNQ  193

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+MH+D + ISNLTLLNSP+WN+HPVYSSNI++QG+TILAP  S NTDGIN
Sbjct  194  LKYTRGYLIELMHSDTIYISNLTLLNSPAWNIHPVYSSNIVVQGITILAPTNSPNTDGIN  253

Query  9    PDS  1
            PDS
Sbjct  254  PDS  256



>emb|CDY70893.1| BnaCnng70190D, partial [Brassica napus]
Length=358

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  5    YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  64

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH++ +QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NTDGINPDS
Sbjct  65   TRPYLIEIMHSNGIQISNLTFLNSPSWHIHPVYSSNIVIQGLTILAPVTVPNTDGINPDS  124



>gb|KFK28901.1| hypothetical protein AALP_AA7G062800 [Arabis alpina]
Length=494

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  141  YEVIAPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  200

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP L+EIMH+D++QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NTDGINPDS
Sbjct  201  TRPYLVEIMHSDSIQISNLTFLNSPSWHIHPVYSSNIVIQGLTILAPVTVPNTDGINPDS  260



>ref|XP_006362679.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=527

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            W LIPPLPSYG G+D    R+ISFIFG+NL DVVITG NGTIDGQG  WW +FR  ++K 
Sbjct  178  WDLIPPLPSYGIGRDNPGPRFISFIFGTNLTDVVITGGNGTIDGQGQLWWTKFRQGQMKN  237

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM +D++QISNLTL+NSPSWNVHPVYSS ++I+GLTILAPV S NTDGI+PDS
Sbjct  238  TRPYLIEIMFSDHIQISNLTLINSPSWNVHPVYSSFVVIKGLTILAPVDSPNTDGIDPDS  297



>emb|CDY69255.1| BnaAnng29830D, partial [Brassica napus]
Length=376

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  23   YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  82

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH++ +QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NTDGINPDS
Sbjct  83   TRPYLIEIMHSNGIQISNLTFLNSPSWHIHPVYSSNIVIQGLTILAPVTVPNTDGINPDS  142



>ref|XP_010439166.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=497

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  144  YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  203

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NTDGINPDS
Sbjct  204  TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSSNILIQGLTILAPVTVPNTDGINPDS  263



>ref|XP_010448699.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=490

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  144  YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  203

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NTDGINPDS
Sbjct  204  TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSSNILIQGLTILAPVTVPNTDGINPDS  263



>gb|KHG19046.1| putative polygalacturonase [Gossypium arboreum]
Length=253

 Score =   174 bits (440),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            W +I PLPSYG G+D    RYIS IFG+NL DVVITG+NGT+DGQG  WW +F   +LK 
Sbjct  127  WAVIDPLPSYGRGRDADGGRYISLIFGTNLTDVVITGDNGTVDGQGVTWWDKFHKGELKY  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
             RP LIEI ++  +QISNLTL+NSPSWNVHPVYSSN+++QG+TILAPV S NTDGINP
Sbjct  187  TRPYLIEIRYSQGVQISNLTLMNSPSWNVHPVYSSNVVVQGITILAPVTSPNTDGINP  244



>ref|XP_009116814.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=470

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  + ++  LPSYG G+D +  R+ S +FG+NL DV+ITGNNGTIDGQG+FWWQ+F   K
Sbjct  116  LEEYLVLKALPSYGRGRDAAGGRFASLVFGTNLSDVIITGNNGTIDGQGSFWWQKFHGGK  175

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D +QISN+TL++SPSWN+HPVYSSNII++G+TI+APVKS NTDGIN
Sbjct  176  LKYTRPYLIELMFSDTIQISNITLIDSPSWNIHPVYSSNIIVKGVTIIAPVKSPNTDGIN  235

Query  9    PDS  1
            PDS
Sbjct  236  PDS  238



>ref|XP_009772512.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=473

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            W LIPPLPSYG G+D +  R+IS IFG+NL DVVITG NGTIDGQG  WW +FR  +L  
Sbjct  125  WDLIPPLPSYGRGRDAAGPRFISLIFGTNLTDVVITGGNGTIDGQGQQWWTKFRQGQLTY  184

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM +D++QISNLTL+NSPSWNVHPVYSS ++I+GLTILAP  S NTDGI+PDS
Sbjct  185  TRPYLIEIMFSDHVQISNLTLINSPSWNVHPVYSSFVVIKGLTILAPTDSPNTDGIDPDS  244



>ref|NP_194081.1| putative polygalacturonase [Arabidopsis thaliana]
 emb|CAA20471.1| putative protein [Arabidopsis thaliana]
 emb|CAB79305.1| putative protein [Arabidopsis thaliana]
 gb|AAN13048.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD95012.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84768.1| putative polygalacturonase [Arabidopsis thaliana]
Length=495

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  142  YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  201

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYSSNI IQGLTILAPV   NTDGINPDS
Sbjct  202  TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSSNIYIQGLTILAPVTVPNTDGINPDS  261



>ref|XP_009137356.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=493

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  140  YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  199

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH++ +QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NTDGINPDS
Sbjct  200  TRPYLIEIMHSNGIQISNLTFLNSPSWHIHPVYSSNIVIQGLTILAPVTVPNTDGINPDS  259



>ref|XP_010530415.1| PREDICTED: probable polygalacturonase, partial [Tarenaya hassleriana]
Length=445

 Score =   178 bits (451),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   RYIS IFG+NL D +ITG NGT+DGQG  WW +F+  +L+ 
Sbjct  92   YEVIEPLPSYGRGRDTEGGRYISLIFGTNLTDAIITGENGTVDGQGEPWWGKFKRGELEY  151

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NTDGINPDS
Sbjct  152  TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSSNILIQGLTILAPVTVPNTDGINPDS  211



>ref|XP_009137085.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=493

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  140  YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  199

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYSSNI+IQ LTILAPV   NTDGINPDS
Sbjct  200  TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSSNIVIQDLTILAPVTVPNTDGINPDS  259



>ref|XP_006283603.1| hypothetical protein CARUB_v10004660mg [Capsella rubella]
 gb|ACC91278.1| glycoside hydrolase family 28 protein [Capsella rubella]
 gb|EOA16501.1| hypothetical protein CARUB_v10004660mg [Capsella rubella]
Length=494

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  141  YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  200

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYS NI IQGLTILAPV   NTDGINPDS
Sbjct  201  TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSRNIFIQGLTILAPVTVPNTDGINPDS  260



>ref|XP_010089055.1| putative polygalacturonase [Morus notabilis]
 gb|EXB37302.1| putative polygalacturonase [Morus notabilis]
Length=471

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP+I  LPSYG GKDT  RR+ S IFG+NL +VVITG+NGTIDGQG  WWQ+FR+++LK 
Sbjct  119  WPVIEGLPSYGPGKDTD-RRFSSLIFGTNLTNVVITGDNGTIDGQGELWWQKFRNRELKF  177

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEI +++N+QISNLTL+NS +WN+HPVY SN+I+QG+TILAPV S NTDGINPDS
Sbjct  178  TRPFLIEISYSENVQISNLTLVNSANWNIHPVYCSNVIVQGITILAPVTSPNTDGINPDS  237



>gb|ACG41831.1| glycoside hydrolase, family 28 [Zea mays]
Length=439

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP++ PLPSYG G+D    R+ S I GSNL DVVITG+NGTIDGQGA WW +F   +
Sbjct  85   VGEWPIVDPLPSYGRGRDKVGGRFASLIGGSNLTDVVITGSNGTIDGQGAMWWSKFHKNQ  144

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+MH+D + ISNLTLLNSP+WN+HPVYSSNI++QG+TILAP  S NTDGIN
Sbjct  145  LKYTRGYLIELMHSDTIYISNLTLLNSPAWNIHPVYSSNIVVQGITILAPTNSPNTDGIN  204

Query  9    PDS  1
            PDS
Sbjct  205  PDS  207



>gb|AFW04075.1| polygalacturonase [Litchi chinensis]
Length=481

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +P LPSYG G+D +  R  S IFG+NL DVV+TG NGTIDGQGA+WW +F+  +L
Sbjct  128  SEWPRLPVLPSYGRGRDAAGGRLSSLIFGTNLTDVVVTGANGTIDGQGAYWWGKFKKNQL  187

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
             + RP LIEIM+++ +QISNLT +NSPSWNVHP+YSSN+IIQGLTILAPV S NTDGI+P
Sbjct  188  DVTRPYLIEIMYSNQVQISNLTFVNSPSWNVHPIYSSNVIIQGLTILAPVDSPNTDGIDP  247

Query  6    DS  1
            DS
Sbjct  248  DS  249



>emb|CDY44105.1| BnaA01g13130D [Brassica napus]
Length=452

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FG NL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  99   YEVIEPLPSYGRGRDTDGGRFISLLFGFNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  158

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NTDGINPDS
Sbjct  159  TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSSNIVIQGLTILAPVTVPNTDGINPDS  218



>ref|XP_010276919.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=607

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + +P+I PLPSYG G+D    RYIS IFG+NL DVVITG+NGTIDGQG  WW +F  KK+
Sbjct  114  SEYPIIDPLPSYGRGRDAPGGRYISLIFGTNLTDVVITGDNGTIDGQGEHWWGKFHQKKI  173

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K  RP LIEI+++D +QISNLTL+NSPSWNVHP Y SN+IIQG+TILAPV S NTDGI+P
Sbjct  174  KNTRPYLIEILYSDQVQISNLTLVNSPSWNVHPTYCSNVIIQGITILAPVNSPNTDGIDP  233

Query  6    DS  1
            DS
Sbjct  234  DS  235



>ref|XP_009607671.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=472

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            W LIPPLPSYG G+D +  R+IS IFG+NL DVVITG NGTIDGQG  WW +FR  +L  
Sbjct  124  WDLIPPLPSYGRGRDAAGPRFISLIFGTNLTDVVITGGNGTIDGQGQQWWTKFRQGQLNY  183

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM +D++QISNLTL+NSPSWNVHPVYSS ++++GLTILAP  S NTDGI+PDS
Sbjct  184  TRPYLIEIMFSDHVQISNLTLINSPSWNVHPVYSSFVVMKGLTILAPTDSPNTDGIDPDS  243



>ref|XP_007219377.1| hypothetical protein PRUPE_ppa020086mg [Prunus persica]
 gb|EMJ20576.1| hypothetical protein PRUPE_ppa020086mg [Prunus persica]
Length=517

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPL+P LPSYG G+D    R+ SFIFG+NL DVVITGNNGTIDGQGA WW++F++ +L  
Sbjct  123  WPLVPALPSYGRGRDAPGGRFSSFIFGTNLTDVVITGNNGTIDGQGASWWKKFKAGQLNE  182

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM+++ +QISN+TL+NSPSW VHP YSSNI I GLTILAP+ S NTDGINPDS
Sbjct  183  TRPYMIEIMYSNQIQISNITLVNSPSWFVHPTYSSNITIHGLTILAPIDSPNTDGINPDS  242



>gb|EPS58839.1| hypothetical protein M569_15974, partial [Genlisea aurea]
Length=139

 Score =   168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            +PLI PLPSYG G+D   +R+ S I+G+NL DV ITG NGTIDGQG  WW++F+S KLK 
Sbjct  5    YPLIDPLPSYGRGRDAPGKRFSSLIWGTNLTDVAITGGNGTIDGQGEIWWKKFKSHKLKN  64

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE++H+ ++QI+NLTL+NSPSW+VHP Y SN+II+ +T++APV+S NTDGINPDS
Sbjct  65   TRPYLIELLHSQDVQITNLTLINSPSWHVHPTYCSNVIIEHITVVAPVESPNTDGINPDS  124



>ref|XP_003592202.1| hypothetical protein MTR_1g100060 [Medicago truncatula]
Length=487

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G++    R+ S IFG+NL+DV+ITGNNGTIDGQG+ WW +F+ K+LKI
Sbjct  138  WPQLPALPSYGRGREKPGGRFSSLIFGTNLIDVIITGNNGTIDGQGSTWWDKFQKKQLKI  197

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSPSW VHPVYSSNIII GLTILAPV   NTDGI+PDS
Sbjct  198  TRPYMIEIMYSDQIQISNLTLVNSPSWFVHPVYSSNIIINGLTILAPVDVPNTDGIDPDS  257



>ref|NP_001151164.1| glycoside hydrolase, family 28 precursor [Zea mays]
 gb|ACF87988.1| unknown [Zea mays]
 gb|AFW75223.1| glycoside hydrolase, family 28 [Zea mays]
Length=486

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP++ PLPSYG G+D    R+ S I GSNL DVVITG+NGTIDGQGA WW +F   +
Sbjct  132  VGEWPIVDPLPSYGRGRDKVGGRFASLIGGSNLTDVVITGSNGTIDGQGAMWWSKFHKNQ  191

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+MH+D + ISNLTLLNSP+WN+HPVYSSNI++QG+TILAP  S NTDGIN
Sbjct  192  LKYTRGYLIELMHSDTIYISNLTLLNSPAWNIHPVYSSNIVVQGITILAPTNSPNTDGIN  251

Query  9    PDS  1
            PDS
Sbjct  252  PDS  254



>ref|XP_003624048.1| Polygalacturonase [Medicago truncatula]
 gb|AES80266.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=483

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I  WP++ PLPSYG G+D    R+ S IFG+NL DV++TG NGTIDGQGAFWWQQF  KK
Sbjct  126  ITEWPVLEPLPSYGRGRDAPAGRFRSLIFGTNLTDVIVTGGNGTIDGQGAFWWQQFHRKK  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D++QISNLTLLNSPSWNVHPVYSSNIIIQG+TI+AP+ S NTDGIN
Sbjct  186  LKYTRPYLIELMFSDSIQISNLTLLNSPSWNVHPVYSSNIIIQGITIIAPISSPNTDGIN  245

Query  9    PDS  1
            PDS
Sbjct  246  PDS  248



>gb|AFW75224.1| glycoside hydrolase, family 28 [Zea mays]
Length=506

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WP++ PLPSYG G+D    R+ S I GSNL DVVITG+NGTIDGQGA WW +F   +
Sbjct  152  VGEWPIVDPLPSYGRGRDKVGGRFASLIGGSNLTDVVITGSNGTIDGQGAMWWSKFHKNQ  211

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+MH+D + ISNLTLLNSP+WN+HPVYSSNI++QG+TILAP  S NTDGIN
Sbjct  212  LKYTRGYLIELMHSDTIYISNLTLLNSPAWNIHPVYSSNIVVQGITILAPTNSPNTDGIN  271

Query  9    PDS  1
            PDS
Sbjct  272  PDS  274



>ref|XP_010317519.1| PREDICTED: probable polygalacturonase, partial [Solanum lycopersicum]
Length=464

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            W LIPPLPSYG G+D    R+ISFIFG+NL DVVITG NGTIDGQG  WW +FR  ++K 
Sbjct  115  WDLIPPLPSYGIGRDNPGPRFISFIFGTNLTDVVITGGNGTIDGQGQLWWTKFRQGQMKN  174

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM +D++QISNLTL+NSPSWNVHP+YSS +II GLTILAP  + NTDGI+PDS
Sbjct  175  TRPYMIEIMFSDHVQISNLTLINSPSWNVHPIYSSFVIINGLTILAPFHAPNTDGIDPDS  234



>ref|XP_010934935.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=469

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP+I PLPSYG G+D S  RY S I GS+L DVVI G+NGTIDGQGAFWW+ F   KLK 
Sbjct  132  WPVIDPLPSYGRGRDHSGGRYSSLIGGSHLTDVVIAGDNGTIDGQGAFWWKNFHEGKLKY  191

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             R  LIE+MH+D + ISNLTLLNSP+WN+HPVYSSNI+I  +TILAPV S NTDGINPDS
Sbjct  192  TRGYLIELMHSDQILISNLTLLNSPTWNIHPVYSSNIVISQITILAPVHSPNTDGINPDS  251



>gb|KHN42438.1| Putative polygalacturonase, partial [Glycine soja]
Length=462

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +P LPSYG G+D    R+ S IFG+NL DVVITG NGTIDGQG++WW +F   +L
Sbjct  111  SEWPTLPVLPSYGRGRDAPDGRFSSLIFGTNLTDVVITGYNGTIDGQGSYWWDKFHKGEL  170

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K+ RP +IEIM +D++QISNLTL++SPSW VHP+YSS+IIIQGLTILAPV S NTDGINP
Sbjct  171  KLTRPYMIEIMFSDHIQISNLTLIDSPSWFVHPIYSSDIIIQGLTILAPVDSPNTDGINP  230

Query  6    DS  1
            DS
Sbjct  231  DS  232



>gb|AES62453.2| pectin lyase superfamily protein [Medicago truncatula]
Length=516

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G++    R+ S IFG+NL+DV+ITGNNGTIDGQG+ WW +F+ K+LKI
Sbjct  167  WPQLPALPSYGRGREKPGGRFSSLIFGTNLIDVIITGNNGTIDGQGSTWWDKFQKKQLKI  226

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSPSW VHPVYSSNIII GLTILAPV   NTDGI+PDS
Sbjct  227  TRPYMIEIMYSDQIQISNLTLVNSPSWFVHPVYSSNIIINGLTILAPVDVPNTDGIDPDS  286



>ref|XP_003533980.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=476

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +P LPSYG G+D    R+ S IFG+NL DVVITG NGTIDGQG++WW +F   +L
Sbjct  125  SEWPTLPVLPSYGRGRDAPDGRFSSLIFGTNLTDVVITGYNGTIDGQGSYWWDKFHKGEL  184

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K+ RP +IEIM +D++QISNLTL++SPSW VHP+YSS+IIIQGLTILAPV S NTDGINP
Sbjct  185  KLTRPYMIEIMFSDHIQISNLTLIDSPSWFVHPIYSSDIIIQGLTILAPVDSPNTDGINP  244

Query  6    DS  1
            DS
Sbjct  245  DS  246



>ref|XP_006413548.1| hypothetical protein EUTSA_v10025011mg [Eutrema salsugineum]
 gb|ESQ55001.1| hypothetical protein EUTSA_v10025011mg [Eutrema salsugineum]
Length=493

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FG NL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  140  YEVIEPLPSYGRGRDTDGGRFISLLFGLNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  199

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYS NI+IQGLTILAPV   NTDGINPDS
Sbjct  200  TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSRNIVIQGLTILAPVTVPNTDGINPDS  259



>ref|XP_006422033.1| hypothetical protein CICLE_v10004864mg [Citrus clementina]
 ref|XP_006490634.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
 gb|ESR35273.1| hypothetical protein CICLE_v10004864mg [Citrus clementina]
 gb|KDO56791.1| hypothetical protein CISIN_1g011615mg [Citrus sinensis]
Length=481

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPL+PPLPSYG G+D    R+ S IFG+NL DVV+TG N TI+GQG  WW ++R K+  +
Sbjct  131  WPLLPPLPSYGRGRDEPGGRFSSLIFGTNLTDVVVTGGNATINGQGEPWWIKYRKKQFNV  190

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE+M +DN+QISNLTL++SPSWNVHPVYSSN++IQGLTI AP+ S NTDGINPDS
Sbjct  191  TRPYLIEVMFSDNVQISNLTLIDSPSWNVHPVYSSNVLIQGLTIRAPIDSPNTDGINPDS  250



>ref|XP_008796910.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=466

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            ++ WP+I PLPSYG G+D    RY S I GS+L DVVITG+NGTIDGQGAFWW++F   K
Sbjct  128  MSEWPVIDPLPSYGRGRDHPGGRYSSLIGGSHLTDVVITGDNGTIDGQGAFWWKKFHEGK  187

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIE+MH+D + ISNLTLLNSP+WN+HPVYSS+I+I  +TILAPV S NTDGIN
Sbjct  188  LKYTRGYLIELMHSDQIFISNLTLLNSPAWNIHPVYSSDIVISQITILAPVHSPNTDGIN  247

Query  9    PDS  1
            PDS
Sbjct  248  PDS  250



>ref|XP_004298190.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=462

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPL+PPLPSYG G+D    R+ S IFG+NL DVVITGNNGTIDGQGA WW +F    L +
Sbjct  113  WPLLPPLPSYGQGRDAPGGRFSSLIFGTNLTDVVITGNNGTIDGQGAPWWDKFEKGLLNV  172

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP L+EIM ++ +QISNLT  NSPSW++HPVYSSNI IQG+TILAPV+  NTDGINPDS
Sbjct  173  TRPYLLEIMFSNQIQISNLTFTNSPSWHIHPVYSSNITIQGITILAPVEVPNTDGINPDS  232



>ref|XP_007040335.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007040336.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY24836.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY24837.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=467

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            W +I PLPSYG G+D    RYIS IFG+NL DVV+TG+NGTI GQG  WW +F   +LK 
Sbjct  128  WAVIDPLPSYGRGRDAVGGRYISLIFGTNLTDVVVTGDNGTIHGQGTTWWDKFHKGELKY  187

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM++D +QIS+LTL++SPSWNVHP+YSSN+++QGLTI+APV S NTDGINPDS
Sbjct  188  TRPYLIEIMYSDQVQISSLTLMDSPSWNVHPIYSSNVVVQGLTIVAPVTSPNTDGINPDS  247



>ref|XP_008229768.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPL+P LPSYG G+D    R+ S IFG+NL DVVITGNNGTIDGQGA WW++F++  L  
Sbjct  123  WPLVPVLPSYGRGRDAPGGRFSSLIFGTNLTDVVITGNNGTIDGQGASWWKKFKAGLLNE  182

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM+++ +QISNLTL+NSPSW VHP+YSSNI IQGLTILAP+ S NTDGI+PDS
Sbjct  183  TRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSSNITIQGLTILAPIDSPNTDGIDPDS  242



>ref|XP_003592200.1| Polygalacturonase-like protein [Medicago truncatula]
 gb|AES62451.1| pectin lyase superfamily protein [Medicago truncatula]
Length=481

 Score =   176 bits (445),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP  P LPSYG+G++ S  R+ S +FG+NL DV+ITGNNGTIDGQG++WW +F   ++KI
Sbjct  130  WPQFPVLPSYGSGRNASDGRFSSLVFGTNLTDVIITGNNGTIDGQGSYWWDKFHKGQMKI  189

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSPSW VHPVYSSNIII GLTILAPV   NTDGI+PDS
Sbjct  190  TRPYMIEIMYSDQIQISNLTLINSPSWFVHPVYSSNIIINGLTILAPVDIPNTDGIDPDS  249



>ref|XP_002513653.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF49056.1| polygalacturonase, putative [Ricinus communis]
Length=473

 Score =   176 bits (445),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP++PPLPSYG G+D +  R+ S IFG+NL DVVITGNNGTIDGQGA WW +F    L  
Sbjct  127  WPILPPLPSYGRGRDATGGRFSSLIFGTNLKDVVITGNNGTIDGQGATWWNKFHKGLLNQ  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE++++  +QISNL L+NSPSWNVHP YSSN++IQGLTILAPV S NTDGINPDS
Sbjct  187  TRPYLIELLYSHKIQISNLILINSPSWNVHPTYSSNVLIQGLTILAPVDSPNTDGINPDS  246



>gb|AFK43011.1| unknown [Medicago truncatula]
Length=483

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I  WP++ PLPSYG G+D    R+ S IFG+NL DV++TG NGTIDGQGAFWWQQF  K+
Sbjct  126  ITEWPVLEPLPSYGRGRDAPAGRFRSLIFGTNLTDVIVTGGNGTIDGQGAFWWQQFHRKE  185

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIE+M +D++QISNLTLLNSPSWNVHPVYSSNIIIQG+TI+AP+ S NTDGIN
Sbjct  186  LKYTRPYLIELMFSDSIQISNLTLLNSPSWNVHPVYSSNIIIQGITIIAPISSPNTDGIN  245

Query  9    PDS  1
            PDS
Sbjct  246  PDS  248



>ref|XP_004964293.1| PREDICTED: probable polygalacturonase-like isoform X1 [Setaria 
italica]
Length=486

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D    RY S I GSNL DVVITGNNGTIDGQGA WW +F   K
Sbjct  128  ISEWPVIAPLPSYGRGRDKIGGRYASLIGGSNLTDVVITGNNGTIDGQGAMWWSKFHQNK  187

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  L+E+M +D + ISN+TL+NSP+WN+HPVYSSNI++QG+TILAP +S NTDGIN
Sbjct  188  LKYTRGYLVELMWSDTIFISNVTLVNSPAWNIHPVYSSNIVVQGVTILAPTRSPNTDGIN  247

Query  9    PDS  1
            PDS
Sbjct  248  PDS  250



>ref|XP_004964294.1| PREDICTED: probable polygalacturonase-like isoform X2 [Setaria 
italica]
Length=485

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D    RY S I GSNL DVVITGNNGTIDGQGA WW +F   K
Sbjct  127  ISEWPVIAPLPSYGRGRDKIGGRYASLIGGSNLTDVVITGNNGTIDGQGAMWWSKFHQNK  186

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  L+E+M +D + ISN+TL+NSP+WN+HPVYSSNI++QG+TILAP +S NTDGIN
Sbjct  187  LKYTRGYLVELMWSDTIFISNVTLVNSPAWNIHPVYSSNIVVQGVTILAPTRSPNTDGIN  246

Query  9    PDS  1
            PDS
Sbjct  247  PDS  249



>ref|NP_001240215.1| uncharacterized protein LOC100785005 precursor [Glycine max]
 gb|ACU17976.1| unknown [Glycine max]
Length=477

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +P LPSYG G+D    R+ S IFG+NL DV+ITG NGTIDGQG +WW +F   +L
Sbjct  125  SEWPTLPVLPSYGRGRDAPDGRFSSLIFGTNLTDVIITGYNGTIDGQGCYWWDKFHKGEL  184

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K+ RP +IEIM +D++QISNLTL+NSPSW VHP+Y+S+IIIQGLTILAPV S NTDGI+P
Sbjct  185  KLTRPYMIEIMFSDHIQISNLTLINSPSWFVHPIYTSDIIIQGLTILAPVDSPNTDGIDP  244

Query  6    DS  1
            DS
Sbjct  245  DS  246



>ref|XP_010519488.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
 ref|XP_010519489.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
 ref|XP_010519491.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=468

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP++ PLPSYG G+D    R+ S IFG+NL DVVITGNNGTIDGQG +WW ++R  + 
Sbjct  120  SEWPVVAPLPSYGRGRDAPGPRFSSLIFGTNLTDVVITGNNGTIDGQGKYWWVKYRKGEF  179

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K+ RP +IE++ +DN+QIS++TL++SPSWNVHPVY  N+I++GLTILAP+ S NTDGI+P
Sbjct  180  KLTRPYMIEVLFSDNVQISDITLIDSPSWNVHPVYCKNVIVKGLTILAPIDSPNTDGIDP  239

Query  6    DS  1
            DS
Sbjct  240  DS  241



>ref|XP_002869777.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46036.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            + +I PLPSYG G+DT   R+IS +FGSNL DVVITG NGTIDGQG  WW +F+  +LK 
Sbjct  141  YEVIEPLPSYGRGRDTDGGRFISLLFGSNLTDVVITGENGTIDGQGEPWWGKFKRGELKY  200

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIMH+D +QISNLT LNSPSW++HPVYS NI IQ LTILAPV   NTDGINPDS
Sbjct  201  TRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSRNIFIQSLTILAPVTVPNTDGINPDS  260



>ref|XP_010519487.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=475

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP++ PLPSYG G+D    R+ S IFG+NL DVVITGNNGTIDGQG +WW ++R  + 
Sbjct  127  SEWPVVAPLPSYGRGRDAPGPRFSSLIFGTNLTDVVITGNNGTIDGQGKYWWVKYRKGEF  186

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K+ RP +IE++ +DN+QIS++TL++SPSWNVHPVY  N+I++GLTILAP+ S NTDGI+P
Sbjct  187  KLTRPYMIEVLFSDNVQISDITLIDSPSWNVHPVYCKNVIVKGLTILAPIDSPNTDGIDP  246

Query  6    DS  1
            DS
Sbjct  247  DS  248



>ref|XP_007217591.1| hypothetical protein PRUPE_ppa018901mg, partial [Prunus persica]
 gb|EMJ18790.1| hypothetical protein PRUPE_ppa018901mg, partial [Prunus persica]
Length=391

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WPL+P LPSYG G+D    R+ S IFG+NL D+VITGNNGTIDGQG  WW+++++ +L
Sbjct  105  SEWPLVPVLPSYGRGRDAPGGRFSSLIFGTNLTDIVITGNNGTIDGQGTSWWKKYKAGQL  164

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP +IEIM+++ +QISNLTL+NSPSW VHP+YSSNI IQGLTILAP+ S NTDGI+P
Sbjct  165  NETRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSSNITIQGLTILAPIDSPNTDGIDP  224

Query  6    DS  1
            DS
Sbjct  225  DS  226



>gb|AES62452.2| pectin lyase superfamily protein [Medicago truncatula]
Length=473

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +  LPSYG G+D    R+ S IFG+NL DV+ITG+NGTIDGQG++WW +F  K+L +
Sbjct  124  WPQLLVLPSYGRGRDAPAGRFSSLIFGTNLTDVIITGDNGTIDGQGSYWWDKFHKKQLTL  183

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSP+W VHP+YSSNIII GLTILAPV S NTDGINPDS
Sbjct  184  TRPYMIEIMYSDQIQISNLTLINSPTWFVHPIYSSNIIINGLTILAPVDSPNTDGINPDS  243



>ref|XP_007152185.1| hypothetical protein PHAVU_004G108800g [Phaseolus vulgaris]
 gb|ESW24179.1| hypothetical protein PHAVU_004G108800g [Phaseolus vulgaris]
Length=477

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP++  LPSYG G+D    R+ S IFG+NL DVVITG NGTIDGQG++WW +F   +L
Sbjct  125  SEWPILSVLPSYGRGRDAPDGRFSSLIFGTNLTDVVITGYNGTIDGQGSYWWDKFHKDEL  184

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
            K+ RP LIEIM ++++QISNLTL+NSPSW VHP+YSS+IIIQGLTILAPV S NTDGINP
Sbjct  185  KLTRPYLIEIMFSNHIQISNLTLVNSPSWFVHPIYSSDIIIQGLTILAPVDSPNTDGINP  244

Query  6    DS  1
            DS
Sbjct  245  DS  246



>gb|KGN49922.1| hypothetical protein Csa_5G140480 [Cucumis sativus]
Length=482

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +  LPSYG G+D    RY S IFG+NL DVVITGNNGTIDGQGA+WW +F   +L
Sbjct  128  SEWPQVALLPSYGVGRDAPGGRYSSLIFGTNLTDVVITGNNGTIDGQGAYWWDKFHKGEL  187

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
             + RP LIEIM++D +QIS+LTL+NSPSW VHP+YS N+IIQGLTILAP+ S NTDGI+P
Sbjct  188  NLTRPYLIEIMYSDQIQISDLTLVNSPSWFVHPIYSKNVIIQGLTILAPIDSPNTDGIDP  247

Query  6    DS  1
            DS
Sbjct  248  DS  249



>ref|XP_004160401.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase-like 
[Cucumis sativus]
Length=480

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +  LPSYG G+D    RY S IFG+NL DVVITGNNGTIDGQGA+WW +F   +L +
Sbjct  128  WPQVALLPSYGVGRDAPGGRYSSLIFGTNLTDVVITGNNGTIDGQGAYWWDKFHKGELNL  187

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM++D +QIS+LTL+NSPSW VHP+YS N+IIQGLTILAP+ S NTDGI+PDS
Sbjct  188  TRPYLIEIMYSDQIQISDLTLVNSPSWFVHPIYSKNVIIQGLTILAPIDSPNTDGIDPDS  247



>gb|KDP22229.1| hypothetical protein JCGZ_26060 [Jatropha curcas]
Length=467

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP++ PLPSYG G+D    R+ S IFG++L DVVITGNNGTIDGQGA WW++F   +LKI
Sbjct  122  WPVLAPLPSYGRGRDKPGGRFSSLIFGTHLTDVVITGNNGTIDGQGATWWKKFHKGQLKI  181

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE ++++ +QIS++TL+NSPSWNVHP YSSN++IQ LTILAPV S NTDGINPDS
Sbjct  182  TRPYLIEFLYSNQIQISHITLINSPSWNVHPTYSSNVLIQRLTILAPVDSPNTDGINPDS  241



>ref|XP_008376628.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=475

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +P LPSYG G+D    R+ S +FG+NL DVVITGNNGTIDGQGA WW +F+   L
Sbjct  119  SEWPHLPVLPSYGRGRDAPGGRFSSLVFGTNLTDVVITGNNGTIDGQGASWWAKFKQGHL  178

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
             + RP +IEIM+++ +QISNLTL+NSPSW VHP+YSSNI IQGLTILAPV S NTDGI+P
Sbjct  179  TLTRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSSNITIQGLTILAPVDSPNTDGIDP  238

Query  6    DS  1
            DS
Sbjct  239  DS  240



>ref|XP_003592201.1| Polygalacturonase-like protein [Medicago truncatula]
Length=478

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +  LPSYG G+D    R+ S IFG+NL DV+ITG+NGTIDGQG++WW +F  K+L +
Sbjct  129  WPQLLVLPSYGRGRDAPAGRFSSLIFGTNLTDVIITGDNGTIDGQGSYWWDKFHKKQLTL  188

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSP+W VHP+YSSNIII GLTILAPV S NTDGINPDS
Sbjct  189  TRPYMIEIMYSDQIQISNLTLINSPTWFVHPIYSSNIIINGLTILAPVDSPNTDGINPDS  248



>ref|XP_004145976.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
Length=480

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +  LPSYG G+D    RY S IFG+NL DVVITGNNGTIDGQGA+WW +F   +L +
Sbjct  128  WPQVALLPSYGVGRDAPGGRYSSLIFGTNLTDVVITGNNGTIDGQGAYWWDKFHKGELNL  187

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM++D +QIS+LTL+NSPSW VHP+YS N+IIQGLTILAP+ S NTDGI+PDS
Sbjct  188  TRPYLIEIMYSDQIQISDLTLVNSPSWFVHPIYSKNVIIQGLTILAPIDSPNTDGIDPDS  247



>ref|XP_008232996.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase [Prunus 
mume]
Length=476

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP++ PLPSYG G+D +           N  D++I+G+NGTIDGQG FWWQQF  KK
Sbjct  120  VNEWPVLKPLPSYGRGRDAAAXXXXGCFVXFNFQDLIISGDNGTIDGQGEFWWQQFHKKK  179

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  RP LIEIM + ++QISNLTLL+SPSWNVHPVYSSNI++QG+TI+AP+ S NTDGIN
Sbjct  180  LKYTRPYLIEIMFSTDIQISNLTLLDSPSWNVHPVYSSNILVQGITIIAPITSPNTDGIN  239

Query  9    PDS  1
            PDS
Sbjct  240  PDS  242



>ref|XP_008234837.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPLI  LPSYG G+D    R+ S IFG+NL DVVITGNNGTIDGQGA WW++F++ +L  
Sbjct  123  WPLISVLPSYGRGRDAPGGRFSSLIFGTNLTDVVITGNNGTIDGQGASWWKKFKAGQLNE  182

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM+++ +QISNLTL+NSPSW VHP+YSSNI IQGLTILAP+ S NTDGI+PDS
Sbjct  183  TRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSSNITIQGLTILAPMNSPNTDGIDPDS  242



>ref|XP_010105745.1| putative polygalacturonase [Morus notabilis]
 gb|EXC05965.1| putative polygalacturonase [Morus notabilis]
Length=459

 Score =   173 bits (439),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPL+  LPSYG G+D    R+ S I+G+NL DVVITGNNGTIDGQGA WW +FR+ +L  
Sbjct  112  WPLVALLPSYGKGRDAPNARFSSLIYGTNLTDVVITGNNGTIDGQGAPWWTKFRAGQLNA  171

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEI+H+D +QI NLTL+NSPSW VHP+YSSNII++GLTI+APV S NTDGI+PDS
Sbjct  172  TRPYMIEILHSDQIQIFNLTLINSPSWFVHPIYSSNIIVKGLTIVAPVTSPNTDGIDPDS  231



>ref|XP_010671628.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=488

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP++ PLPSYG G+D    RY S IFG+NL DV+ITG NGTIDGQGA WW+++R+ +L  
Sbjct  138  WPILAPLPSYGKGRDAPAGRYQSLIFGTNLTDVIITGTNGTIDGQGAIWWKKYRNNELNE  197

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IE+M ++ +QIS+LTLLNSP+WNVHP+Y  ++IIQGLTILAP  SANTDGI+PDS
Sbjct  198  TRPYMIELMFSNGVQISDLTLLNSPNWNVHPIYCRDVIIQGLTILAPTHSANTDGIDPDS  257



>ref|XP_007215325.1| hypothetical protein PRUPE_ppa005185mg [Prunus persica]
 gb|EMJ16524.1| hypothetical protein PRUPE_ppa005185mg [Prunus persica]
Length=473

 Score =   173 bits (438),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WPL+P LPSYG G+D    R+ S IFG+NL DVVITGNNGTIDGQG  WW+++++ +L
Sbjct  115  SEWPLVPVLPSYGRGRDAPGGRFSSLIFGTNLTDVVITGNNGTIDGQGISWWKKYKAGQL  174

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP +IEIM+++ +QISNLTL+NSPSW VHP+YSSNI IQGLTILAP+ S NTDGI+P
Sbjct  175  NETRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSSNITIQGLTILAPIDSPNTDGIDP  234

Query  6    DS  1
            DS
Sbjct  235  DS  236



>ref|XP_007151453.1| hypothetical protein PHAVU_004G047800g [Phaseolus vulgaris]
 gb|ESW23447.1| hypothetical protein PHAVU_004G047800g [Phaseolus vulgaris]
Length=476

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +  LPSYG G+D    R+ S IFG+NL DVVITG NGTIDGQG++WW +F  K+L +
Sbjct  131  WPHLAILPSYGRGRDAPGGRFSSLIFGTNLTDVVITGQNGTIDGQGSYWWDKFHKKQLTL  190

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSP+W VHP+YSSNII+ GLTILAPV S NTDG+NPDS
Sbjct  191  TRPYMIEIMYSDQIQISNLTLVNSPTWFVHPIYSSNIIVSGLTILAPVDSPNTDGVNPDS  250



>ref|XP_009368731.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=472

 Score =   173 bits (438),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R  S +FG+NL DVVITGNNGTIDGQGA WW +F+   L +
Sbjct  121  WPHLPVLPSYGRGRDAPGGRCSSLVFGTNLTDVVITGNNGTIDGQGASWWAKFKQGHLTL  180

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM+++ +QISNLTL+NSPSW VHP+YSSNI IQGLTILAPV S NTDGI+PDS
Sbjct  181  TRPYMIEIMYSNQIQISNLTLVNSPSWFVHPIYSSNITIQGLTILAPVDSPNTDGIDPDS  240



>ref|XP_010519492.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=468

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP++ PLPSYG G+DT   R+ S I GSNL DVVITGNNGTIDGQG +WW++F+  ++K 
Sbjct  122  WPIVAPLPSYGRGRDTPGPRFGSLISGSNLTDVVITGNNGTIDGQGQYWWKKFKQGEMKE  181

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE+M ++++QIS++TL+N+P+WN+HPVY  N+I++G+T+LAPV S NTDGINPDS
Sbjct  182  TRPYLIELMSSEDIQISDITLINAPTWNIHPVYCKNVIVKGVTVLAPVDSPNTDGINPDS  241



>ref|XP_006656549.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=479

 Score =   172 bits (437),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/120 (66%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP+I PLPSYG G+D    R  S I GSNL DVVITG NGTIDGQGA WW +F   KLK 
Sbjct  130  WPIIDPLPSYGRGRDKIGGRDASLIGGSNLTDVVITGANGTIDGQGAMWWSKFHQNKLKY  189

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             R  LIE+MH+D + I+N+TL+NSP+WN+HPVYSSN+++QG+TILAP  S NTDGINPDS
Sbjct  190  TRGYLIEVMHSDTVVIANVTLVNSPAWNIHPVYSSNVVVQGVTILAPTHSPNTDGINPDS  249



>ref|XP_009375527.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=471

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +P LPSYG G+D    R+ S IFG+NL DVVITG+NGTIDGQGA WW +F+   L
Sbjct  118  SEWPHLPALPSYGKGRDGPGERFSSLIFGTNLTDVVITGHNGTIDGQGASWWAKFKQGLL  177

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP +IE+M++D +QISNLTL+NSPSW VHP+YSSNI IQGLTILAP++  NTDGINP
Sbjct  178  NSTRPYVIELMYSDQIQISNLTLVNSPSWFVHPIYSSNITIQGLTILAPIEVPNTDGINP  237

Query  6    DS  1
            DS
Sbjct  238  DS  239



>ref|XP_003535598.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=475

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R+ S IFG++L DVVITG+NGTIDGQG++WW +F   +L +
Sbjct  126  WPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVITGHNGTIDGQGSYWWDKFHKNQLNL  185

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSPSW VHP+YSSNI I+GLTILAPV S NTDGI+PDS
Sbjct  186  TRPYMIEIMYSDQIQISNLTLVNSPSWFVHPIYSSNITIKGLTILAPVDSPNTDGIDPDS  245



>ref|XP_003536450.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=476

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R+ S IFG++L DVVITG+NGTIDGQG++WW +F   +L +
Sbjct  127  WPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVITGHNGTIDGQGSYWWDKFHKNQLNL  186

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSPSW VHP+YSSNI I+GLTILAPV S NTDGI+PDS
Sbjct  187  TRPYMIEIMYSDQIQISNLTLVNSPSWFVHPIYSSNITIKGLTILAPVDSPNTDGIDPDS  246



>ref|XP_009377556.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
 ref|XP_009377601.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=471

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +P LPSYG G+D    R+ S IFG+NL DVVITG+NGTIDGQGA WW +F+   L
Sbjct  118  SEWPHLPALPSYGKGRDGPGERFSSLIFGTNLTDVVITGHNGTIDGQGASWWAKFKQGLL  177

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP +IE+M++D +QISNLTL+NSPSW VHP+YSSNI IQGLTILAP++  NTDGINP
Sbjct  178  NSTRPYVIELMYSDQIQISNLTLVNSPSWFVHPIYSSNITIQGLTILAPIEVPNTDGINP  237

Query  6    DS  1
            DS
Sbjct  238  DS  239



>ref|XP_008380132.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=474

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +P LPSYG G+D    R+ S IFG+NL DVVITG+NGTIDGQGA WW +F+   L
Sbjct  118  SEWPHLPALPSYGKGRDGPGERFSSLIFGTNLTDVVITGHNGTIDGQGASWWAKFKQGLL  177

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP +IE+M++D +QISNLTL+NSPSW VHP+YSSNI IQGLTILAP++  NTDGINP
Sbjct  178  NSTRPYVIELMYSDQIQISNLTLVNSPSWFVHPIYSSNITIQGLTILAPIEVPNTDGINP  237

Query  6    DS  1
            DS
Sbjct  238  DS  239



>gb|KHN21785.1| Putative polygalacturonase [Glycine soja]
Length=456

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R+ S IFG++L DVVITG NGTIDGQG++WW +F   +L +
Sbjct  107  WPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVITGQNGTIDGQGSYWWDKFHKNQLNL  166

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSPSW VHP+YSSNI I+GLTILAPV S NTDGI+PDS
Sbjct  167  TRPYMIEIMYSDQIQISNLTLVNSPSWFVHPIYSSNITIKGLTILAPVDSPNTDGIDPDS  226



>gb|KHN21784.1| Putative polygalacturonase [Glycine soja]
Length=472

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R+ S IFG++L DVVITG+NGTIDGQG++WW +F   +L +
Sbjct  123  WPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVITGHNGTIDGQGSYWWDKFHKNQLNL  182

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSPSW VHP+YSSNI I+GLTILAPV S NTDGI+PDS
Sbjct  183  TRPYMIEIMYSDQIQISNLTLVNSPSWFVHPIYSSNITIKGLTILAPVDSPNTDGIDPDS  242



>ref|XP_006829063.1| hypothetical protein AMTR_s00001p00258260 [Amborella trichopoda]
 gb|ERM96479.1| hypothetical protein AMTR_s00001p00258260 [Amborella trichopoda]
Length=487

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WP+IPPLPSYG G+DT   RY S I G NL DVVITG+NGTIDGQG  WWQ+FR   
Sbjct  124  MNEWPIIPPLPSYGVGRDTPGPRYSSLISGFNLTDVVITGDNGTIDGQGQMWWQKFRQGA  183

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  LIEI+ +D + IS+LTL+NSPSWNVHPVYSSN+I++G+TI APV S NTDGIN
Sbjct  184  LKHTRGYLIEILFSDQVIISSLTLINSPSWNVHPVYSSNVIVKGITISAPVTSPNTDGIN  243

Query  9    PDS  1
            PDS
Sbjct  244  PDS  246



>ref|XP_008234902.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPL+  LPSYG G+D    R+ S IFG+NL DVVITGNNGTIDGQGA WW++F++ +L  
Sbjct  123  WPLVSALPSYGRGRDAPGGRFSSLIFGTNLTDVVITGNNGTIDGQGASWWKKFKAGRLNE  182

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM+++ +QISNLTL+NSPSW VHP YSSNI I GLTI AP+ S NTDGINPDS
Sbjct  183  TRPYMIEIMYSNQIQISNLTLVNSPSWFVHPTYSSNITIHGLTIHAPIDSPNTDGINPDS  242



>gb|KHG19694.1| putative polygalacturonase [Gossypium arboreum]
Length=474

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +  LPSYG G+D    R  S IFG+NL DVVITGNNGTIDGQG++WW+ FR  K+ +
Sbjct  126  WPPVALLPSYGRGRDAPSGRLSSLIFGTNLTDVVITGNNGTIDGQGSYWWKLFRDNKMTV  185

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++  +QISNLTL+NSPSWNVHP+YSS+IIIQ LT+ APV S NTDGI+PDS
Sbjct  186  TRPYMIEIMYSKQVQISNLTLVNSPSWNVHPIYSSDIIIQHLTVFAPVDSPNTDGIDPDS  245



>ref|XP_009382257.1| PREDICTED: probable polygalacturonase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WP+I PLPSYG G+D +  RY + I G NL DVVITGNNGTIDGQG  WW+ FR+K+
Sbjct  132  INEWPIIDPLPSYGRGRDAAGGRYSNLIMGYNLTDVVITGNNGTIDGQGETWWKMFRNKE  191

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            L   R  LIE+M+   + ISN+TL+NSPSWNVHPVYSS++I+ G+TILAPV S NTDGIN
Sbjct  192  LNYTRGYLIELMYCKQVLISNITLVNSPSWNVHPVYSSHVIVSGITILAPVNSPNTDGIN  251

Query  9    PDS  1
            PDS
Sbjct  252  PDS  254



>ref|XP_008437531.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=480

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +  LPSYG G+D    RY S I+G+NL DVVITGNNGTIDGQG++WW +F   +L
Sbjct  126  SEWPQVAILPSYGVGRDAPGGRYSSLIYGTNLTDVVITGNNGTIDGQGSYWWDKFHKGEL  185

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
             + RP +IEI+++D +QISNLTL+NSPSW VHP+YS N+IIQGLTILAP+ S NTDGI+P
Sbjct  186  NLTRPYMIEILYSDQIQISNLTLVNSPSWFVHPIYSKNVIIQGLTILAPIDSPNTDGIDP  245

Query  6    DS  1
            DS
Sbjct  246  DS  247



>gb|KDP22228.1| hypothetical protein JCGZ_26059 [Jatropha curcas]
Length=470

 Score =   171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP++ PLPSYG G+D    R+ SFIFG+NL DVVITGNNGTIDGQGA WW +FRS  LKI
Sbjct  118  WPVLAPLPSYGRGRDGPGGRFSSFIFGTNLTDVVITGNNGTIDGQGATWWTKFRSGLLKI  177

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIE +++D +QISNLTL+NSPSWNVHP YSSN++IQ LTILAPV S NTDGI+PDS
Sbjct  178  TRPYLIEFLYSDQIQISNLTLINSPSWNVHPTYSSNVLIQWLTILAPVDSPNTDGIDPDS  237



>gb|KHN21786.1| Putative polygalacturonase, partial [Glycine soja]
Length=434

 Score =   170 bits (430),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R+ S IFG++L DVVITGNNG IDGQGA+WW +F   +L +
Sbjct  90   WPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVITGNNGLIDGQGAYWWNKFHQGQLTL  149

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM++D +QIS LTL+NSP+W VHPVYSSNIII+GLTI APV S NTDGINPDS
Sbjct  150  TRPYLIEIMYSDQIQISFLTLVNSPTWFVHPVYSSNIIIKGLTIKAPVDSPNTDGINPDS  209



>ref|XP_003535597.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=466

 Score =   170 bits (431),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R+ S IFG++L DVVITGNNG IDGQGA+WW +F   +L +
Sbjct  122  WPQLPVLPSYGRGRDAPGGRFSSLIFGTHLTDVVITGNNGLIDGQGAYWWNKFHQGQLTL  181

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM++D +QIS LTL+NSP+W VHPVYSSNIII+GLTI APV S NTDGINPDS
Sbjct  182  TRPYLIEIMYSDQIQISFLTLVNSPTWFVHPVYSSNIIIKGLTIKAPVDSPNTDGINPDS  241



>ref|XP_010550764.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=477

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP++ PLPSYG G+D    R+ S I+G+NL DVVITGNNGTIDGQG  WW +FR+ + 
Sbjct  128  SEWPVVAPLPSYGRGRDAPGPRFSSLIYGTNLTDVVITGNNGTIDGQGKSWWVKFRNGEY  187

Query  186  K-IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            K I RP LIEI+ +DN+QIS++TL++SPSWNVHPVY +N+I++GLTILAP+ S NTDGI+
Sbjct  188  KSITRPYLIEILFSDNVQISDITLIDSPSWNVHPVYCNNVIVKGLTILAPIDSPNTDGID  247

Query  9    PDS  1
            PDS
Sbjct  248  PDS  250



>ref|XP_007151452.1| hypothetical protein PHAVU_004G047700g [Phaseolus vulgaris]
 gb|ESW23446.1| hypothetical protein PHAVU_004G047700g [Phaseolus vulgaris]
Length=455

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +  LPSYG G+D    R+ S IFG NL DVVITG NGT+DGQG++WW +F+ K+  +
Sbjct  130  WPSVALLPSYGKGRDAPDGRFSSLIFGYNLTDVVITGQNGTLDGQGSYWWVKFKKKEFTL  189

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM +D +QISN+TL+NSPSW VHP+YSSNII+ GLTILAP+ S NTDG+NPDS
Sbjct  190  TRPYMIEIMFSDQIQISNITLINSPSWFVHPIYSSNIIVSGLTILAPIDSPNTDGVNPDS  249



>ref|XP_002273143.3| PREDICTED: probable polygalacturonase, partial [Vitis vinifera]
Length=434

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            +P IPPLPSYG G+D    R+ S IFG+NL DVVI G NGTI+GQG  WW +F+ KKL  
Sbjct  82   YPHIPPLPSYGKGRDGG-GRFSSLIFGTNLTDVVIIGGNGTINGQGRVWWDKFKQKKLVD  140

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM +D +QISNLTL++SPSWNVHPVY S++IIQG+TILAPV   NTDGINPDS
Sbjct  141  TRPYLIEIMFSDQVQISNLTLIDSPSWNVHPVYCSDVIIQGMTILAPVDVPNTDGINPDS  200



>gb|EYU25143.1| hypothetical protein MIMGU_mgv1a005601mg [Erythranthe guttata]
Length=477

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            +PLI PLPSYG G+D   +R+IS IFG+NL DVV+TG NGTIDGQG  WW+ F+S KLK 
Sbjct  121  YPLIDPLPSYGVGRDGG-KRFISLIFGTNLTDVVVTGGNGTIDGQGESWWKDFKSGKLKN  179

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEI+++ N+QIS+LTL+NSPSW+VHP Y  ++II+ LTILAP+ S NTDGINPDS
Sbjct  180  TRPYLIEILYSRNVQISHLTLINSPSWHVHPTYCRDVIIESLTILAPIDSPNTDGINPDS  239



>ref|XP_003592197.1| Endo-polygalacturonase-like protein [Medicago truncatula]
 gb|AES62448.1| pectin lyase superfamily protein [Medicago truncatula]
Length=475

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +  LPSYG  KD    R+ S IFG+NL DVVITGNNGTIDGQG+ WW +F+ K+LKI
Sbjct  129  WPKLSFLPSYGREKDAPDGRFSSLIFGTNLTDVVITGNNGTIDGQGSTWWDKFQKKQLKI  188

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IEIM++D +QISNLTL+NSP+W VHP+YSSNIII  LTILAPV   NTDGI+PDS
Sbjct  189  TRPYMIEIMYSDQIQISNLTLINSPNWFVHPIYSSNIIINRLTILAPVDVPNTDGIDPDS  248



>ref|XP_011076107.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=500

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            +PLI PLPSYG G+D   +R+ S IFG+NL DVVITG NGTI+GQG  WW++F++ +LK 
Sbjct  145  YPLIDPLPSYGVGRDAPGKRFASLIFGTNLTDVVITGGNGTINGQGVTWWKKFKAHQLKN  204

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEI+++D +QIS LTL+NSPSW+VHP Y SN+II+ LTI+AP+ S NTDGINPDS
Sbjct  205  TRPYLIEILYSDQVQISYLTLINSPSWHVHPTYCSNVIIENLTIIAPIDSPNTDGINPDS  264



>gb|ABR18040.1| unknown [Picea sitchensis]
Length=472

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +  WPLIPPLPSYG G+D    RY S I G NL DVVITG+NGTIDGQGA WWQ+F  K 
Sbjct  117  LEDWPLIPPLPSYGMGRDAPGPRYSSLINGYNLTDVVITGDNGTIDGQGAIWWQKFHKKI  176

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R  L+E+M++ ++ ISNLT LNSP+WN+HPVYSSNI+IQ +TILAP+ S NTDGI+
Sbjct  177  LKNTRGYLVELMYSKDIIISNLTFLNSPAWNLHPVYSSNILIQYVTILAPLDSPNTDGID  236

Query  9    PDS  1
            PDS
Sbjct  237  PDS  239



>ref|XP_009382256.1| PREDICTED: probable polygalacturonase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN WP+I PLPSYG G+DT+  RY + I G NL DVVITG+NGT+DGQG  WW+ F +K+
Sbjct  132  INEWPIIDPLPSYGRGRDTAGGRYSNLIMGYNLTDVVITGHNGTVDGQGETWWEMFNNKE  191

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            L   R  LIE+M+   + ISN+TL+NSPSWNVHPVYSS +I+ G+TILAPV S NTDGIN
Sbjct  192  LNYTRGYLIELMYCRQVLISNITLVNSPSWNVHPVYSSQVIVSGITILAPVNSPNTDGIN  251

Query  9    PDS  1
            PDS
Sbjct  252  PDS  254



>ref|XP_004513187.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=479

 Score =   168 bits (425),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + WP +P LPSYG G+D    R+ S IFG+NL DVVITG NGTIDGQG++WW +F   +L
Sbjct  127  SEWPSLPVLPSYGRGRDAPNGRFSSLIFGTNLTDVVITGCNGTIDGQGSYWWDKFHKDEL  186

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
             + RP LIEIM ++ +QISNLTL+NSPSW VHP+YSS+IIIQGL I+AP+ S NTDGI+P
Sbjct  187  NLTRPYLIEIMFSNQIQISNLTLINSPSWFVHPIYSSDIIIQGLNIIAPIDSPNTDGIDP  246

Query  6    DS  1
            DS
Sbjct  247  DS  248



>ref|XP_002273177.2| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=465

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = -1

Query  363  TWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
             +PLI  LPSYG G+D    R+ S IFG+NL DVVITG NGTI GQG +WW +FR+ KLK
Sbjct  119  AYPLIEILPSYGAGRDGG-GRHASLIFGTNLTDVVITGGNGTIHGQGQYWWDKFRADKLK  177

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPD  4
              RP LIEIM++D +QISNL L++SPSWNVHP YSSN+IIQ LTI+APV S NTDGINPD
Sbjct  178  DTRPYLIEIMYSDQVQISNLILIDSPSWNVHPTYSSNVIIQWLTIIAPVGSPNTDGINPD  237

Query  3    S  1
            S
Sbjct  238  S  238



>ref|XP_006292567.1| hypothetical protein CARUB_v10018803mg [Capsella rubella]
 gb|EOA25465.1| hypothetical protein CARUB_v10018803mg [Capsella rubella]
Length=471

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKD-TSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
            WP+I PLPSYG G+D T   R+ S I GSNL DVVITGNNGTI+GQG +WW +F+ K+ K
Sbjct  120  WPVIAPLPSYGKGRDGTGAGRFNSLISGSNLTDVVITGNNGTINGQGQYWWDKFKKKQFK  179

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPD  4
            + RP LIE++ + N+QISN+TL++SPSWN+HPVY  N+II+ +T+LAPV   NTDGINPD
Sbjct  180  LTRPYLIELLFSKNIQISNITLIDSPSWNIHPVYCKNVIIKSVTVLAPVTVPNTDGINPD  239

Query  3    S  1
            S
Sbjct  240  S  240



>gb|ABE66001.1| glycoside hydrolase family 28 protein/polygalacturonase family 
protein [Arabidopsis thaliana]
Length=416

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKD-TSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
            WP+I PLPSYG G+D T   R+ S I G+NL DVVITGNNGTI+GQG +WW +F+ K+ K
Sbjct  119  WPVIAPLPSYGKGRDGTGTGRFNSLISGTNLTDVVITGNNGTINGQGQYWWDKFKKKQFK  178

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPD  4
            I RP LIEI+ + N+QISN+TL++SPSWN+HPVY +++I++ +T+LAPV   NTDGINPD
Sbjct  179  ITRPYLIEILFSKNIQISNITLIDSPSWNIHPVYCNSVIVKSVTVLAPVTVPNTDGINPD  238

Query  3    S  1
            S
Sbjct  239  S  239



>emb|CBI22657.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + +PLI  LPSYG G+D    R+ S IFG+NL DVVITG NGT++GQG +WW +FR+KK 
Sbjct  125  SAYPLIEVLPSYGVGRDGG-GRHSSLIFGTNLTDVVITGGNGTLNGQGKYWWDKFRAKKY  183

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP LIEIM+++++QISNLTL++SPSWNVHPVYS N++++ LTILAP+ S NTDGINP
Sbjct  184  NDTRPYLIEIMYSNHVQISNLTLIDSPSWNVHPVYSRNVLVKDLTILAPIDSPNTDGINP  243

Query  6    DS  1
            DS
Sbjct  244  DS  245



>ref|NP_190464.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 emb|CAB62015.1| endo-polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAY78763.1| glycoside hydrolase family 28 protein [Arabidopsis thaliana]
 gb|AEE78476.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=469

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKD-TSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
            WP+I PLPSYG G+D T   R+ S I G+NL DVVITGNNGTI+GQG +WW +F+ K+ K
Sbjct  119  WPVIAPLPSYGKGRDGTGTGRFNSLISGTNLTDVVITGNNGTINGQGQYWWDKFKKKQFK  178

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPD  4
            I RP LIEI+ + N+QISN+TL++SPSWN+HPVY +++I++ +T+LAPV   NTDGINPD
Sbjct  179  ITRPYLIEILFSKNIQISNITLIDSPSWNIHPVYCNSVIVKSVTVLAPVTVPNTDGINPD  238

Query  3    S  1
            S
Sbjct  239  S  239



>ref|XP_002875935.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52194.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKD-TSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
            WP+I PLPSYG G+D T   R+ S I G+NL DVVITGNNGTI+GQG +WW +F+ K+ K
Sbjct  119  WPVIAPLPSYGKGRDGTGTGRFNSLISGTNLTDVVITGNNGTINGQGQYWWDKFKKKQFK  178

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPD  4
            + RP LIE++ + N+QISN+TL++SPSWN+HPVY +N+I++ +T+LAPV   NTDGINPD
Sbjct  179  LTRPYLIELLFSKNIQISNITLIDSPSWNIHPVYCNNVIVKSVTVLAPVTVPNTDGINPD  238

Query  3    S  1
            S
Sbjct  239  S  239



>ref|XP_007143467.1| hypothetical protein PHAVU_007G074300g [Phaseolus vulgaris]
 gb|ESW15461.1| hypothetical protein PHAVU_007G074300g [Phaseolus vulgaris]
Length=458

 Score =   165 bits (418),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP +P LPSYG G+D    R+ S I G++L DVVITG+NG IDGQGA+WW++F  K+L +
Sbjct  120  WPHLPALPSYGRGRDAPAGRFSSLISGTHLTDVVITGDNGKIDGQGAYWWEKFHKKQLNL  179

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP +IE+M++D +QIS+LTLLNSPS+ +HP+YSSNII+QGLTI AP  S NTDGI+PDS
Sbjct  180  TRPYMIELMYSDQIQISSLTLLNSPSYFIHPIYSSNIIMQGLTINAPRGSPNTDGIDPDS  239



>ref|XP_009383010.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=360

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            IN W +I  LPSYG G+DT+  RY +FI G NL DVVITGNNGTIDGQG  WW+ FR+K+
Sbjct  6    INEWSIIDSLPSYGRGRDTTGGRYSNFIMGYNLTDVVITGNNGTIDGQGETWWKMFRNKE  65

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            L   R  LIE+++   + ISN+TL+++PSWN+HPVYSS +I+ G+TILAPV S NTDGIN
Sbjct  66   LNYTRGYLIELVYCMQVLISNITLVDAPSWNIHPVYSSQVIVSGITILAPVNSPNTDGIN  125

Query  9    PDS  1
            PDS
Sbjct  126  PDS  128



>emb|CBI22656.3| unnamed protein product [Vitis vinifera]
Length=621

 Score =   166 bits (421),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            +P IPPLPSYG G+D    R+ S IFG+NL DVVI G NGTI+GQG  WW +F+ KKL  
Sbjct  123  YPHIPPLPSYGKGRDGG-GRFSSLIFGTNLTDVVIIGGNGTINGQGRVWWDKFKQKKLVD  181

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP LIEIM +D +QISNLTL++SPSWNVHPVY S++IIQG+TILAPV   NTDGINPDS
Sbjct  182  TRPYLIEIMFSDQVQISNLTLIDSPSWNVHPVYCSDVIIQGMTILAPVDVPNTDGINPDS  241


 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = -1

Query  363  TWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
             +PLI  LPSYG G+D    R+ S IFG+NL DVVITG NGTI GQG +WW +FR+ KLK
Sbjct  374  AYPLIEILPSYGAGRDGG-GRHASLIFGTNLTDVVITGGNGTIHGQGQYWWDKFRADKLK  432

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPD  4
              RP LIEIM++D +QISNL L++SPSWNVHP YSSN+IIQ LTI+APV S NTDGINPD
Sbjct  433  DTRPYLIEIMYSDQVQISNLILIDSPSWNVHPTYSSNVIIQWLTIIAPVGSPNTDGINPD  492

Query  3    S  1
            S
Sbjct  493  S  493



>emb|CDY10897.1| BnaC01g15120D [Brassica napus]
Length=239

 Score =   159 bits (402),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 91/116 (78%), Gaps = 1/116 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDT-SLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
            + +I PLPSYG G++T   RR+IS  FGSNL DVVIT  NGTIDGQG  WW +F+  +LK
Sbjct  100  YEVIEPLPSYGRGRETDGGRRFISLRFGSNLTDVVITSENGTIDGQGEPWWGKFKGGELK  159

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDG  16
              RP LIEIMH+D +QISNLT LNSPSW++HPVYSSNI+IQGLTILAPV   NT G
Sbjct  160  YTRPYLIEIMHSDGIQISNLTFLNSPSWHIHPVYSSNIVIQGLTILAPVTVPNTTG  215



>ref|XP_008810120.1| PREDICTED: probable polygalacturonase isoform X2 [Phoenix dactylifera]
Length=441

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D    RY +FI GSNL DVVITG+NGTI+GQG  WW +F   K
Sbjct  87   IDEWPIIDPLPSYGRGRDLPGGRYSNFIMGSNLTDVVITGDNGTINGQGKIWWDKFHDDK  146

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            L+  R  L+EIM++D++ ISNLT  +SP+WN+HPVYSSN+++  +TILAPV S NTDGIN
Sbjct  147  LEYTRGYLLEIMYSDHILISNLTFKHSPAWNLHPVYSSNVLVSNVTILAPVDSPNTDGIN  206

Query  9    PDS  1
            PDS
Sbjct  207  PDS  209



>ref|XP_010450744.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=459

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKD-TSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
            WP+I PLPSYG G+D T   R+ S I G+NL DVVITGNNGTI+GQG +WW +F  K+ K
Sbjct  114  WPVIGPLPSYGMGRDGTGAGRFNSLISGTNLTDVVITGNNGTINGQGQYWWDKFEKKQFK  173

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPD  4
            + RP LIE++ + N+QISN+TL++SPSWN+HPVY  N+II+ +TILAPV   NTDGINPD
Sbjct  174  LTRPYLIELLFSTNIQISNITLIDSPSWNIHPVYCENVIIKSVTILAPVTVPNTDGINPD  233

Query  3    S  1
            S
Sbjct  234  S  234



>gb|KFK27673.1| hypothetical protein AALP_AA8G413900 [Arabis alpina]
Length=404

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + +P++ PLPSYG G+D    R+ S I GSNL DV+ITGNNGTIDGQG +WW +F+S   
Sbjct  129  SEYPVVAPLPSYGRGRDAPGPRFASLISGSNLTDVIITGNNGTIDGQGKYWWVKFKSGGF  188

Query  186  K-IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            K I RP LIEI+ + N+QIS++TL++SPSWN+HPVY  N+I++G+TILAP+ S NTDGI+
Sbjct  189  KSITRPYLIEIIFSQNVQISDVTLIDSPSWNIHPVYCENVIVKGVTILAPIDSPNTDGID  248

Query  9    PDS  1
            PDS
Sbjct  249  PDS  251



>ref|XP_008810119.1| PREDICTED: probable polygalacturonase isoform X1 [Phoenix dactylifera]
Length=493

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            I+ WP+I PLPSYG G+D    RY +FI GSNL DVVITG+NGTI+GQG  WW +F   K
Sbjct  139  IDEWPIIDPLPSYGRGRDLPGGRYSNFIMGSNLTDVVITGDNGTINGQGKIWWDKFHDDK  198

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            L+  R  L+EIM++D++ ISNLT  +SP+WN+HPVYSSN+++  +TILAPV S NTDGIN
Sbjct  199  LEYTRGYLLEIMYSDHILISNLTFKHSPAWNLHPVYSSNVLVSNVTILAPVDSPNTDGIN  258

Query  9    PDS  1
            PDS
Sbjct  259  PDS  261



>ref|XP_002468601.1| hypothetical protein SORBIDRAFT_01g048880 [Sorghum bicolor]
 gb|EER95599.1| hypothetical protein SORBIDRAFT_01g048880 [Sorghum bicolor]
Length=463

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -1

Query  369  INTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            +N WPLI PLPSYG G+D    RYI+FI GSNL DV+ITG NGTI+GQG  WW +F +K+
Sbjct  116  MNHWPLIAPLPSYGRGRDEPGPRYINFIGGSNLTDVIITGKNGTINGQGQVWWDKFHAKE  175

Query  189  LKIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGIN  10
            LK  R +L+E++H+DN+ ISN+T +++P WN+HP Y +N+ I G+TILAP+ S NTDGI+
Sbjct  176  LKSTRGHLLELLHSDNIIISNVTFVDAPYWNLHPTYCTNVTISGVTILAPLNSPNTDGID  235

Query  9    PDS  1
            PDS
Sbjct  236  PDS  238



>ref|XP_002305262.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|EEE85773.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=437

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSL-RRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            + WPL+ PLPSYG  ++ ++  R    IF SN+ DV+ITGNNGT+DGQGA WW++F  KK
Sbjct  86   DEWPLLTPLPSYGGVRENAVFGRPGGLIFASNVTDVIITGNNGTVDGQGAVWWEKFNEKK  145

Query  189  LKII-RPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGI  13
            LK + RP LIEIM++D +QISN+TL+NSP W+VHP+YSSN+ IQG+TILAPV   NTDGI
Sbjct  146  LKKLERPYLIEIMYSDQVQISNITLINSPQWHVHPIYSSNLWIQGVTILAPVDVPNTDGI  205

Query  12   NPDS  1
            NPDS
Sbjct  206  NPDS  209



>ref|XP_011035342.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=475

 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 98/124 (79%), Gaps = 2/124 (2%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKD-TSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKK  190
            + WPL+ PLPSYG  ++  +  R    IF SN+ DV+ITGNNGT+DGQGA WW++F  KK
Sbjct  124  DEWPLLTPLPSYGGVRENAAFGRPGGLIFASNVTDVIITGNNGTVDGQGAVWWEKFTEKK  183

Query  189  LKII-RPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGI  13
            LK + RP LIEIM++D +QISN+TL+NSP W+VHP+YSSN+ IQG+TILAPV   NTDGI
Sbjct  184  LKKLERPYLIEIMYSDQVQISNITLINSPQWHVHPIYSSNLWIQGVTILAPVDVPNTDGI  243

Query  12   NPDS  1
            NPDS
Sbjct  244  NPDS  247



>ref|XP_002273669.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=478

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = -1

Query  366  NTWPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKL  187
            + +PLI  LPSYG G+D    R+ S IFG+NL DVVITG NGT++GQG +WW +FR+KK 
Sbjct  125  SAYPLIEVLPSYGVGRDGG-GRHSSLIFGTNLTDVVITGGNGTLNGQGKYWWDKFRAKKY  183

Query  186  KIIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINP  7
               RP LIEIM+++++QISNLTL++SPSWNVHPVYS N++++ LTILAP+ S NTDGINP
Sbjct  184  NDTRPYLIEIMYSNHVQISNLTLIDSPSWNVHPVYSRNVLVKDLTILAPIDSPNTDGINP  243

Query  6    DS  1
            DS
Sbjct  244  DS  245



>ref|XP_009149779.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=469

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKD-TSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLK  184
            WP++PPLPSYG G+D T   R+ S I G+NL DVVITGNNGTI+GQG +WW +F+ K+  
Sbjct  119  WPVVPPLPSYGKGRDGTGTGRFNSLISGTNLTDVVITGNNGTINGQGQYWWDKFKKKQFN  178

Query  183  IIRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPD  4
            + RP +IE++ + N+QISN+TL++SPSW++HPVY +N+I++ +TI+APV   NTDGINPD
Sbjct  179  LTRPYMIELLFSQNIQISNITLVDSPSWHIHPVYCNNVIVKSITIIAPVDVPNTDGINPD  238

Query  3    S  1
            S
Sbjct  239  S  239



>ref|NP_001151102.1| glycoside hydrolase, family 28 precursor [Zea mays]
 gb|ACG41634.1| glycoside hydrolase, family 28 [Zea mays]
 gb|ACL53776.1| unknown [Zea mays]
 tpg|DAA43050.1| TPA: glycoside hydrolase, family 28 [Zea mays]
Length=463

 Score =   162 bits (410),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WPLI PLPSYG G+D    RY +FI GSNL DV+ITG NGTI+GQG  WW +F +K+LK 
Sbjct  119  WPLIAPLPSYGRGRDEPGPRYSNFIGGSNLTDVIITGKNGTINGQGQVWWDKFHAKELKF  178

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             R +L+E++++DN+ ISN+T +++P WN+HP Y +N+ I G+TILAPV S NTDGI+PDS
Sbjct  179  TRGHLLELLYSDNIIISNVTFVDAPYWNLHPTYCTNVTISGVTILAPVNSPNTDGIDPDS  238



>gb|KCW46748.1| hypothetical protein EUGRSUZ_K00562 [Eucalyptus grandis]
Length=444

 Score =   162 bits (409),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  360  WPLIPPLPSYGNGKDTSLRRYISFIFGSNLVDVVITGNNGTIDGQGAFWWQQFRSKKLKI  181
            WP++ PLPSYG G++   RR+ S IFG NL DVVITG NGTIDGQG+ WW++FR+K L  
Sbjct  93   WPIVDPLPSYGRGRELPGRRHRSLIFGRNLTDVVITGENGTIDGQGSMWWERFRNKTLDY  152

Query  180  IRPNLIEIMHTDNLQISNLTLLNSPSWNVHPVYSSNIIIQGLTILAPVKSANTDGINPDS  1
             RP+L+E+M++  + ISNLT LNSP W +HPVY S++I+Q +TI AP+ S NTDGI+PDS
Sbjct  153  TRPHLVELMNSTGVVISNLTFLNSPFWTIHPVYCSHVIVQNVTIRAPLDSPNTDGIDPDS  212



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512602628472