BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25226_g1_i2 len=1498 path=[1:0-108 110:109-208 210:209-224
226:225-259 4364:260-276 278:277-330 332:331-336 338:337-360
4855:361-366 368:367-434 436:435-516 518:517-621 5187:622-635
692:636-746 803:747-801 858:802-835 892:836-939 996:940-949
1006:950-997 1054:998-1073 1130:1074-1165 3428:1166-1176
1233:1177-1330 3939:1331-1497]

Length=1498
                                                                      Score     E

ref|XP_009776354.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    321   2e-156   
ref|XP_009803784.1|  PREDICTED: cytochrome P450 87A3-like               312   2e-155   
ref|XP_009611047.1|  PREDICTED: cytochrome P450 87A3-like               311   1e-154   
ref|XP_009616055.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    312   2e-153   
emb|CDP19727.1|  unnamed protein product                                317   3e-150   
ref|XP_011093255.1|  PREDICTED: cytochrome P450 87A3-like               309   4e-146   
ref|XP_007051922.1|  Cytochrome P450 87A3                               318   2e-145   
ref|XP_010661699.1|  PREDICTED: cytochrome P450 87A3-like               303   5e-144   
ref|XP_010112562.1|  Cytochrome P450 87A3                               298   6e-138   
emb|CBI38770.3|  unnamed protein product                                305   1e-137   
ref|XP_002529163.1|  cytochrome P450, putative                          303   9e-137   Ricinus communis
ref|XP_002303566.1|  cytochrome P450 family protein                     303   1e-136   Populus trichocarpa [western balsam poplar]
ref|XP_006573760.1|  PREDICTED: cytochrome P450 87A3-like               289   1e-136   
emb|CDP18909.1|  unnamed protein product                                276   2e-136   
ref|XP_011081025.1|  PREDICTED: cytochrome P450 87A3-like               288   6e-136   
ref|XP_003538708.1|  PREDICTED: cytochrome P450 87A3-like               289   1e-135   
ref|XP_006358916.1|  PREDICTED: cytochrome P450 87A3-like               293   3e-135   
ref|XP_007038615.1|  Cytochrome P450, family 87, subfamily A, pol...    295   3e-135   
ref|XP_011033792.1|  PREDICTED: cytochrome P450 87A3-like               298   4e-135   
ref|XP_008238815.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    291   4e-135   
ref|XP_002299557.1|  cytochrome P450 family protein                     292   9e-135   Populus trichocarpa [western balsam poplar]
ref|XP_006477592.1|  PREDICTED: cytochrome P450 87A3-like               288   3e-134   
ref|XP_002510826.1|  cytochrome P450, putative                          296   4e-134   Ricinus communis
ref|XP_006440550.1|  hypothetical protein CICLE_v10023269mg             287   1e-133   
ref|XP_007040135.1|  Cytochrome P450, family 87, subfamily A, pol...    293   1e-133   
ref|XP_011029202.1|  PREDICTED: cytochrome P450 87A3                    290   2e-133   
ref|XP_006857880.1|  hypothetical protein AMTR_s00069p00107680          276   2e-133   
ref|XP_007211052.1|  hypothetical protein PRUPE_ppa018745mg             287   3e-133   
ref|XP_008238814.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    291   4e-133   
ref|XP_009782612.1|  PREDICTED: cytochrome P450 87A3                    288   6e-133   
ref|XP_004246127.1|  PREDICTED: cytochrome P450 87A3-like               290   1e-132   
ref|XP_004511599.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    286   2e-132   
ref|XP_009627452.1|  PREDICTED: cytochrome P450 87A3                    288   2e-132   
ref|XP_004300758.1|  PREDICTED: cytochrome P450 87A3-like               285   3e-132   
ref|XP_011022914.1|  PREDICTED: cytochrome P450 87A3-like               292   3e-132   
emb|CBI34719.3|  unnamed protein product                                286   5e-132   
ref|XP_010248255.1|  PREDICTED: cytochrome P450 87A3                    276   5e-132   
ref|XP_007210081.1|  hypothetical protein PRUPE_ppa019666mg             288   9e-132   
ref|XP_009342629.1|  PREDICTED: cytochrome P450 87A3                    285   9e-132   
ref|XP_007158463.1|  hypothetical protein PHAVU_002G154400g             280   9e-132   
ref|XP_002283337.1|  PREDICTED: cytochrome P450 87A3                    285   1e-131   Vitis vinifera
ref|XP_011022911.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    296   2e-131   
ref|XP_011022912.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    295   6e-131   
ref|XP_010919431.1|  PREDICTED: cytochrome P450 87A3                    286   1e-130   
ref|XP_003611140.1|  Cytochrome P450                                    287   2e-130   
ref|XP_004298752.1|  PREDICTED: cytochrome P450 87A3-like               283   3e-130   
gb|KDP25498.1|  hypothetical protein JCGZ_20654                         290   3e-130   
ref|XP_008448963.1|  PREDICTED: cytochrome P450 87A3 isoform X1         287   4e-130   
ref|XP_010055602.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    285   1e-129   
ref|XP_004147972.1|  PREDICTED: cytochrome P450 87A3-like               286   2e-129   
gb|KDO40279.1|  hypothetical protein CISIN_1g012100mg                   283   2e-129   
ref|XP_008345352.1|  PREDICTED: cytochrome P450 87A3-like               281   4e-129   
ref|XP_010053329.1|  PREDICTED: cytochrome P450 87A3                    293   6e-129   
ref|XP_009400447.1|  PREDICTED: cytochrome P450 87A3-like               293   8e-129   
gb|EYU29834.1|  hypothetical protein MIMGU_mgv1a005289mg                281   1e-128   
ref|NP_172734.2|  cytochrome P450, family 87, subfamily A, polype...    281   3e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002509718.1|  cytochrome P450, putative                          268   5e-128   Ricinus communis
ref|XP_010545860.1|  PREDICTED: cytochrome P450 87A3-like               281   5e-128   
ref|XP_010533714.1|  PREDICTED: cytochrome P450 87A3                    287   6e-128   
emb|CBI31826.3|  unnamed protein product                                283   1e-127   
ref|XP_007149239.1|  hypothetical protein PHAVU_005G053400g             285   2e-127   
ref|XP_006417203.1|  hypothetical protein EUTSA_v10007534mg             283   3e-127   
ref|XP_009118059.1|  PREDICTED: cytochrome P450 87A3-like               283   4e-127   
ref|XP_006391779.1|  hypothetical protein EUTSA_v10023919mg             286   5e-127   
ref|XP_010494547.1|  PREDICTED: cytochrome P450 87A3-like               283   6e-127   
ref|XP_010676534.1|  PREDICTED: cytochrome P450 87A3                    281   7e-127   
ref|XP_010545904.1|  PREDICTED: cytochrome P450 87A3-like               283   7e-127   
ref|XP_010476246.1|  PREDICTED: cytochrome P450 87A3-like               282   1e-126   
ref|NP_001184974.1|  cytochrome P450, family 87, subfamily A, pol...    280   1e-126   
gb|AAF88087.1|AC025417_15  T12C24.27                                    274   4e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458707.1|  PREDICTED: cytochrome P450 87A3-like               279   4e-126   
emb|CDY16028.1|  BnaC08g40950D                                          279   1e-125   
emb|CDY60267.1|  BnaC05g49310D                                          275   3e-125   
ref|XP_002889964.1|  T12C24.27                                          273   3e-125   
ref|XP_009148571.1|  PREDICTED: cytochrome P450 87A3                    280   4e-125   
ref|XP_010055601.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    270   6e-125   
ref|XP_010545893.1|  PREDICTED: cytochrome P450 87A3-like               281   6e-125   
ref|XP_006442982.1|  hypothetical protein CICLE_v10019989mg             275   1e-124   
ref|XP_008799522.1|  PREDICTED: cytochrome P450 87A3                    280   2e-124   
ref|XP_010545882.1|  PREDICTED: cytochrome P450 87A3-like               273   2e-124   
ref|XP_011072203.1|  PREDICTED: cytochrome P450 87A3                    272   3e-124   
emb|CDY26591.1|  BnaA09g46860D                                          283   2e-123   
ref|XP_004511600.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    255   3e-123   
ref|XP_006352287.1|  PREDICTED: cytochrome P450 87A3-like               281   3e-123   
ref|XP_004244719.1|  PREDICTED: cytochrome P450 87A3-like               284   2e-122   
emb|CDY66605.1|  BnaA06g38070D                                          270   2e-122   
ref|XP_006652661.1|  PREDICTED: cytochrome P450 87A3-like               271   4e-121   
gb|KEH27443.1|  cytochrome P450 family protein                          255   5e-121   
ref|XP_008669007.1|  PREDICTED: cytochrome P450 87A3 isoform X1         267   2e-120   
ref|XP_006647678.1|  PREDICTED: cytochrome P450 87A3-like               271   4e-120   
ref|XP_010275621.1|  PREDICTED: cytochrome P450 87A3-like               267   5e-120   
ref|XP_008663476.1|  PREDICTED: cytochrome P450 87A3-like               266   5e-120   
ref|XP_006366247.1|  PREDICTED: cytochrome P450 87A3-like               283   6e-120   
ref|XP_004976534.1|  PREDICTED: cytochrome P450 87A3-like               268   6e-120   
ref|XP_002448362.1|  hypothetical protein SORBIDRAFT_06g025820          265   1e-119   Sorghum bicolor [broomcorn]
ref|XP_003580352.1|  PREDICTED: cytochrome P450 87A3                    263   1e-119   
emb|CAH67038.1|  OSIGBa0139P06.11                                       270   1e-118   Oryza sativa [red rice]
ref|XP_004953429.1|  PREDICTED: cytochrome P450 87A3-like               270   1e-118   
ref|NP_001053599.1|  Os04g0570000                                       270   2e-118   Oryza sativa Japonica Group [Japonica rice]
emb|CAD41584.3|  OSJNBa0088I22.16                                       270   2e-118   
ref|XP_008448964.1|  PREDICTED: cytochrome P450 87A3 isoform X2         288   4e-118   
ref|XP_008669008.1|  PREDICTED: cytochrome P450 87A3 isoform X2         258   2e-117   
ref|XP_002274332.3|  PREDICTED: cytochrome P450 87A3-like               283   6e-117   Vitis vinifera
gb|EEC73772.1|  hypothetical protein OsI_08447                          258   7e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_003570092.1|  PREDICTED: cytochrome P450 87A3-like               267   1e-116   
gb|EAZ31605.1|  hypothetical protein OsJ_15749                          258   2e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452760.1|  hypothetical protein SORBIDRAFT_04g032020          265   3e-116   Sorghum bicolor [broomcorn]
ref|XP_010473544.1|  PREDICTED: cytochrome P450 87A3-like               274   4e-116   
ref|XP_004298750.1|  PREDICTED: cytochrome P450 87A3-like               270   5e-115   
ref|XP_006302176.1|  hypothetical protein CARUB_v10020186mg             269   9e-115   
ref|XP_004171985.1|  PREDICTED: cytochrome P450 87A3-like               276   3e-114   
ref|XP_006300459.1|  hypothetical protein CARUB_v10020228mg             269   3e-114   
ref|XP_004141154.1|  PREDICTED: cytochrome P450 87A3-like               276   3e-114   
dbj|BAJ97484.1|  predicted protein                                      259   6e-114   
dbj|BAD29475.1|  putative cytochrome P450                               249   6e-114   Oryza sativa Japonica Group [Japonica rice]
gb|KFK43534.1|  hypothetical protein AALP_AA1G139200                    286   7e-114   
ref|NP_001053601.1|  Os04g0570600                                       252   8e-114   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67278.1|  OSIGBa0111L12.5                                        252   8e-114   Oryza sativa [red rice]
ref|XP_008646050.1|  PREDICTED: cytochrome P450 87A3-like               264   2e-113   
ref|XP_010662510.1|  PREDICTED: cytochrome P450 87A3-like               244   1e-112   
ref|XP_006653691.1|  PREDICTED: cytochrome P450 87A3-like               259   2e-112   
emb|CDP09801.1|  unnamed protein product                                275   7e-112   
emb|CAE04091.3|  OSJNBa0088I22.12                                       252   1e-111   Oryza sativa Japonica Group [Japonica rice]
gb|EMS46312.1|  Cytochrome P450 87A3                                    265   2e-111   
ref|NP_001288455.1|  cytochrome P450 87A3-like                          251   4e-111   
ref|XP_004976535.1|  PREDICTED: cytochrome P450 87A3-like               267   5e-111   
ref|XP_002465524.1|  hypothetical protein SORBIDRAFT_01g040500          230   7e-111   Sorghum bicolor [broomcorn]
ref|XP_003581538.1|  PREDICTED: cytochrome P450 87A3-like               239   8e-110   
gb|KFK40541.1|  hypothetical protein AALP_AA2G009100                    280   1e-109   
ref|XP_006650369.1|  PREDICTED: cytochrome P450 87A3-like               258   2e-109   
ref|XP_010480156.1|  PREDICTED: cytochrome P450 708A2-like              256   2e-109   
ref|NP_001050816.1|  Os03g0658800                                       257   4e-109   Oryza sativa Japonica Group [Japonica rice]
emb|CDP18915.1|  unnamed protein product                                276   4e-109   
gb|EMS59428.1|  Cytochrome P450 87A3                                    242   1e-108   
gb|EMT30405.1|  Cytochrome P450 87A3                                    238   5e-108   
ref|NP_001053600.1|  Os04g0570500                                       219   1e-107   Oryza sativa Japonica Group [Japonica rice]
emb|CBI18863.3|  unnamed protein product                                233   1e-107   
emb|CAH67277.1|  OSIGBa0111L12.4                                        219   2e-107   Oryza sativa [red rice]
ref|XP_002284844.1|  PREDICTED: cytochrome P450 87A3-like               233   2e-107   Vitis vinifera
ref|XP_002448363.1|  hypothetical protein SORBIDRAFT_06g025830          251   4e-107   Sorghum bicolor [broomcorn]
ref|XP_006657536.1|  PREDICTED: cytochrome P450 87A3-like               219   8e-107   
ref|XP_002510669.1|  cytochrome P450, putative                          234   2e-106   Ricinus communis
emb|CBI40704.3|  unnamed protein product                                234   3e-106   
ref|XP_008448965.1|  PREDICTED: cytochrome P450 87A3 isoform X3         288   4e-106   
ref|XP_002272031.1|  PREDICTED: cytochrome P450 87A3                    233   5e-106   Vitis vinifera
ref|XP_007158462.1|  hypothetical protein PHAVU_002G154400g             219   7e-106   
gb|EMT26562.1|  Cytochrome P450 87A3                                    244   1e-105   
gb|EMT05251.1|  Cytochrome P450 87A3                                    229   1e-105   
gb|EMS52130.1|  Cytochrome P450 87A3                                    232   1e-105   
gb|KFK35547.1|  hypothetical protein AALP_AA4G004900                    247   1e-105   
gb|EMT10534.1|  Cytochrome P450 87A3                                    260   2e-105   
emb|CDP18913.1|  unnamed protein product                                264   3e-105   
ref|XP_009400635.1|  PREDICTED: cytochrome P450 87A3-like               288   4e-105   
ref|XP_003572191.2|  PREDICTED: cytochrome P450 87A3-like isoform X1    246   1e-104   
gb|KDP43441.1|  hypothetical protein JCGZ_16728                         228   1e-104   
ref|XP_010227227.1|  PREDICTED: cytochrome P450 87A3-like               254   2e-104   
gb|AAL73972.1|AF466201_1  putative cytochrome P450-like protein         263   7e-104   Sorghum bicolor [broomcorn]
gb|EEE61527.1|  hypothetical protein OsJ_15830                          221   1e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002271954.1|  PREDICTED: cytochrome P450 87A3                    222   3e-103   Vitis vinifera
ref|XP_011046283.1|  PREDICTED: cytochrome P450 87A3-like               243   3e-103   
ref|XP_010472066.1|  PREDICTED: cytochrome P450 708A2-like              241   5e-103   
ref|XP_002514563.1|  cytochrome P450, putative                          227   1e-102   Ricinus communis
ref|XP_011022913.1|  PREDICTED: cytochrome P450 87A3-like isoform X3    201   2e-102   
gb|EEE68447.1|  hypothetical protein OsJ_26826                          207   4e-102   Oryza sativa Japonica Group [Japonica rice]
gb|AEM42983.1|  cytochrome P450                                         218   9e-102   
ref|XP_010428975.1|  PREDICTED: cytochrome P450 708A2-like              238   1e-101   
ref|XP_002272143.2|  PREDICTED: cytochrome P450 87A3                    221   1e-101   Vitis vinifera
ref|XP_008235946.1|  PREDICTED: cytochrome P450 87A3-like               221   2e-101   
ref|XP_004290050.1|  PREDICTED: cytochrome P450 87A3-like               215   3e-101   
ref|XP_004955876.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    223   3e-101   
gb|EMT22412.1|  Cytochrome P450 87A3                                    221   5e-101   
ref|XP_006653690.1|  PREDICTED: cytochrome P450 87A3-like               209   1e-100   
ref|NP_177970.1|  cytochrome P450, family 708, subfamily A, polyp...    227   6e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010111721.1|  Cytochrome P450 87A3                               211   1e-99    
ref|XP_006651656.1|  PREDICTED: cytochrome P450 87A3-like               251   3e-99    
ref|XP_008235945.1|  PREDICTED: cytochrome P450 87A3-like               211   3e-99    
ref|XP_008644631.1|  PREDICTED: cytochrome P450 87A3-like               252   5e-99    
gb|KDP43049.1|  hypothetical protein JCGZ_25235                         214   6e-99    
ref|XP_007016226.1|  Cytochrome P450, putative isoform 1                224   7e-99    
ref|XP_004974765.1|  PREDICTED: cytochrome P450 87A3-like               227   1e-98    
ref|XP_007016260.1|  Cytochrome P450, putative                          228   2e-98    
ref|XP_006369644.1|  hypothetical protein POPTR_0001s27730g             221   2e-98    
ref|XP_002299955.2|  hypothetical protein POPTR_0001s27750g             222   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_006369643.1|  hypothetical protein POPTR_0001s27720g             221   2e-98    
ref|XP_002526164.1|  cytochrome P450, putative                          206   4e-98    Ricinus communis
ref|XP_011101634.1|  PREDICTED: cytochrome P450 87A3-like               215   4e-98    
gb|EYU19885.1|  hypothetical protein MIMGU_mgv1a020752mg                209   5e-98    
gb|KFK26105.1|  hypothetical protein AALP_AA8G203400                    229   5e-98    
ref|XP_010425706.1|  PREDICTED: cytochrome P450 708A2-like              225   1e-97    
ref|XP_009588273.1|  PREDICTED: cytochrome P450 87A3-like               216   2e-97    
ref|XP_011025041.1|  PREDICTED: cytochrome P450 87A3-like               219   2e-97    
ref|XP_009125591.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    238   3e-97    
ref|XP_004292300.1|  PREDICTED: cytochrome P450 87A3-like               228   4e-97    
ref|XP_011025046.1|  PREDICTED: cytochrome P450 87A3-like               222   6e-97    
ref|XP_006290340.1|  hypothetical protein CARUB_v10017128mg             224   1e-96    
ref|XP_004974764.1|  PREDICTED: cytochrome P450 87A3-like               227   1e-96    
ref|XP_002313286.1|  hypothetical protein POPTR_0009s06920g             223   1e-96    Populus trichocarpa [western balsam poplar]
ref|XP_011007350.1|  PREDICTED: cytochrome P450 87A3-like               223   2e-96    
ref|XP_010502926.1|  PREDICTED: cytochrome P450 708A2-like              221   2e-96    
ref|XP_004237161.1|  PREDICTED: cytochrome P450 87A3-like               217   2e-96    
ref|XP_008459936.1|  PREDICTED: cytochrome P450 87A3-like               213   2e-96    
ref|NP_001067707.1|  Os11g0289700                                       201   3e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002464219.1|  hypothetical protein SORBIDRAFT_01g014350          251   3e-96    Sorghum bicolor [broomcorn]
gb|EEC68024.1|  hypothetical protein OsI_35831                          201   4e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_007199625.1|  hypothetical protein PRUPE_ppa016466mg             209   4e-96    
gb|KFK26103.1|  hypothetical protein AALP_AA8G203400                    222   5e-96    
ref|XP_002464218.1|  hypothetical protein SORBIDRAFT_01g014340          246   6e-96    Sorghum bicolor [broomcorn]
gb|KFK26104.1|  hypothetical protein AALP_AA8G203400                    222   6e-96    
ref|XP_009798348.1|  PREDICTED: cytochrome P450 87A3-like               216   7e-96    
ref|XP_002299957.1|  hypothetical protein POPTR_0001s27770g             220   8e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010495861.1|  PREDICTED: cytochrome P450 708A2-like              221   1e-95    
ref|XP_002299954.1|  hypothetical protein POPTR_0001s27710g             219   1e-95    Populus trichocarpa [western balsam poplar]
ref|XP_008235944.1|  PREDICTED: cytochrome P450 87A3-like               215   1e-95    
ref|XP_007041637.1|  Cytochrome P450, putative                          197   1e-95    
ref|NP_001140790.1|  uncharacterized protein LOC100272865               248   3e-95    Zea mays [maize]
ref|XP_002299956.1|  hypothetical protein POPTR_0001s27760g             218   7e-95    Populus trichocarpa [western balsam poplar]
ref|XP_011007291.1|  PREDICTED: cytochrome P450 87A3-like               214   9e-95    
dbj|BAK03801.1|  predicted protein                                      223   1e-94    
ref|XP_007016259.1|  Cytochrome P450, putative                          221   2e-94    
ref|XP_011007351.1|  PREDICTED: cytochrome P450 87A3-like               218   3e-94    
ref|XP_007201108.1|  hypothetical protein PRUPE_ppa024382mg             214   5e-94    
ref|XP_011025040.1|  PREDICTED: cytochrome P450 87A3-like               216   7e-94    
ref|XP_011025045.1|  PREDICTED: cytochrome P450 87A3-like               218   8e-94    
ref|XP_002865585.1|  predicted protein                                  229   2e-93    
ref|XP_008382414.1|  PREDICTED: cytochrome P450 87A3-like               211   3e-93    
ref|XP_008364406.1|  PREDICTED: cytochrome P450 87A3-like               201   3e-93    
ref|XP_009344155.1|  PREDICTED: cytochrome P450 87A3-like               210   3e-93    
emb|CDY38927.1|  BnaA04g13480D                                          216   4e-93    
gb|AIT72033.1|  cytochrome P450                                         202   4e-93    
ref|XP_009344797.1|  PREDICTED: cytochrome P450 87A3-like               211   5e-93    
ref|XP_010092748.1|  Cytochrome P450 87A3                               268   5e-93    
ref|XP_011025042.1|  PREDICTED: cytochrome P450 87A3-like               221   6e-93    
ref|XP_009140448.1|  PREDICTED: cytochrome P450 708A2-like              217   7e-93    
ref|XP_010237177.1|  PREDICTED: cytochrome P450 87A3-like               258   1e-92    
ref|XP_009140449.1|  PREDICTED: cytochrome P450 708A2-like              213   1e-92    
gb|AAO23096.1|  putative hydroxylase                                    257   2e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010027150.1|  PREDICTED: cytochrome P450 87A3-like               207   2e-92    
emb|CBI38409.3|  unnamed protein product                                206   3e-92    
ref|XP_008235974.1|  PREDICTED: cytochrome P450 87A3-like               207   4e-92    
ref|XP_002875500.1|  hypothetical protein ARALYDRAFT_905214             206   5e-92    
ref|XP_002265422.2|  PREDICTED: cytochrome P450 87A3-like               206   6e-92    Vitis vinifera
gb|AAV85744.1|  cytochrome P450                                         185   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|NP_190083.2|  cytochrome P450 family protein                        216   2e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CAD41581.3|  OSJNBa0088I22.13                                       200   3e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010462465.1|  PREDICTED: cytochrome P450 708A2-like              241   3e-91    
ref|XP_007051917.1|  Cytochrome P450 superfamily protein, putative      225   3e-91    
ref|XP_011016152.1|  PREDICTED: cytochrome P450 87A3-like               292   4e-91    
ref|NP_851153.1|  cytochrome P450 708A2                                 219   6e-91    Arabidopsis thaliana [mouse-ear cress]
ref|NP_851152.1|  cytochrome P450 708A2                                 219   8e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AAM96995.1|  cytochrome P450-like protein                            219   9e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AHF22090.1|  CYP87D16                                                207   9e-91    
ref|XP_009117327.1|  PREDICTED: cytochrome P450 708A2-like              215   3e-90    
dbj|BAH20010.1|  AT5G48000                                              220   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306227.2|  hypothetical protein POPTR_0004s19450g             201   5e-90    Populus trichocarpa [western balsam poplar]
emb|CDP18910.1|  unnamed protein product                                288   2e-89    
gb|KDP29666.1|  hypothetical protein JCGZ_18828                         209   2e-89    
ref|XP_010514627.1|  PREDICTED: cytochrome P450 708A2-like              202   3e-89    
gb|EMT25093.1|  Cytochrome P450 87A3                                    181   7e-89    
emb|CBI40703.3|  unnamed protein product                                223   1e-88    
ref|XP_006384829.1|  hypothetical protein POPTR_0004s21430g             196   1e-88    
ref|XP_006279091.1|  hypothetical protein CARUB_v10012710mg             204   1e-88    
ref|XP_008235976.1|  PREDICTED: cytochrome P450 87A3-like               194   3e-88    
ref|XP_002527850.1|  cytochrome P450, putative                          201   5e-88    Ricinus communis
ref|XP_008379006.1|  PREDICTED: cytochrome P450 87A3-like               204   9e-88    
ref|XP_010425700.1|  PREDICTED: cytochrome P450 708A2-like              197   1e-87    
gb|EMS54142.1|  Cytochrome P450 87A3                                    184   1e-87    
ref|XP_010502920.1|  PREDICTED: cytochrome P450 708A2-like              196   2e-87    
ref|XP_010690665.1|  PREDICTED: cytochrome P450 87A3-like               224   4e-87    
emb|CDX80949.1|  BnaC03g02030D                                          203   6e-87    
ref|XP_010528790.1|  PREDICTED: cytochrome P450 708A2-like              195   6e-87    
ref|XP_006414542.1|  hypothetical protein EUTSA_v10027495mg             191   7e-87    
ref|NP_001289636.1|  uncharacterized protein LOC101213710               195   7e-87    
ref|XP_006291047.1|  hypothetical protein CARUB_v10017161mg             194   1e-86    
ref|XP_010060164.1|  PREDICTED: cytochrome P450 87A3-like               190   1e-86    
ref|XP_010068615.1|  PREDICTED: cytochrome P450 87A3-like               189   3e-86    
ref|XP_006414544.1|  hypothetical protein EUTSA_v10025084mg             191   5e-86    
ref|XP_008437370.1|  PREDICTED: cytochrome P450 87A3-like               193   7e-86    
ref|XP_010514624.1|  PREDICTED: cytochrome P450 708A2-like              192   1e-85    
ref|XP_002459685.1|  hypothetical protein SORBIDRAFT_02g008740          176   1e-85    Sorghum bicolor [broomcorn]
ref|XP_010067803.1|  PREDICTED: cytochrome P450 87A3-like               178   1e-85    
gb|KCW66016.1|  hypothetical protein EUGRSUZ_G03307                     178   2e-85    
ref|XP_010060162.1|  PREDICTED: cytochrome P450 87A3-like isoform X1    192   2e-85    
ref|XP_010425702.1|  PREDICTED: cytochrome P450 708A2-like              191   2e-85    
ref|XP_010502914.1|  PREDICTED: cytochrome P450 708A2-like              192   2e-85    
ref|XP_010449949.1|  PREDICTED: cytochrome P450 708A2-like              195   3e-85    
gb|KCW64199.1|  hypothetical protein EUGRSUZ_G01853                     185   5e-85    
gb|KHG27614.1|  Cytochrome P450                                         217   6e-85    
ref|XP_010067804.1|  PREDICTED: cytochrome P450 87A3-like               178   8e-85    
ref|XP_010445404.1|  PREDICTED: cytochrome P450 708A2-like              193   1e-84    
ref|XP_008355587.1|  PREDICTED: cytochrome P450 87A3-like               192   1e-84    
emb|CDP16077.1|  unnamed protein product                                218   1e-84    
gb|EMT08489.1|  Cytochrome P450 87A3                                    221   4e-84    
dbj|BAJ97704.1|  predicted protein                                      272   5e-84    
gb|EMT20939.1|  Cytochrome P450 87A3                                    233   5e-84    
ref|XP_006290976.1|  hypothetical protein CARUB_v10017090mg             192   5e-84    
gb|EEE61528.1|  hypothetical protein OsJ_15832                          200   8e-84    
ref|XP_009134370.1|  PREDICTED: cytochrome P450 708A2-like              184   1e-83    
ref|XP_006291131.1|  hypothetical protein CARUB_v10017243mg             199   2e-83    
gb|AAD30586.1|AC007260_17  Similar to cytochrome P450                   172   2e-83    
ref|XP_006434376.1|  hypothetical protein CICLE_v10003322mg             182   2e-83    
gb|KCW61504.1|  hypothetical protein EUGRSUZ_H04232                     180   3e-83    
gb|AEM42986.1|  cytochrome P450                                         190   1e-82    
ref|XP_006285390.1|  hypothetical protein CARUB_v10006787mg             188   2e-82    
gb|AEM42985.1|  cytochrome P450                                         190   2e-82    
ref|XP_008346328.1|  PREDICTED: cytochrome P450 87A3-like               201   3e-82    
ref|XP_002269701.3|  PREDICTED: cytochrome P450 87A3-like               197   6e-82    
ref|NP_193265.1|  cytochrome P450, family 702, subfamily A, polyp...    197   1e-81    
gb|KCW64198.1|  hypothetical protein EUGRSUZ_G01852                     194   3e-81    
ref|XP_006404173.1|  hypothetical protein EUTSA_v10010943mg             194   3e-81    
ref|XP_010027149.1|  PREDICTED: cytochrome P450 87A3-like               173   4e-81    
dbj|BAC57807.1|  putative cytochrome P450                               202   2e-80    
emb|CDY49434.1|  BnaA09g42330D                                          183   2e-80    
ref|XP_006414537.1|  hypothetical protein EUTSA_v10027547mg             185   3e-80    
ref|XP_010242756.1|  PREDICTED: cytochrome P450 87A3-like               268   4e-80    
emb|CDP07623.1|  unnamed protein product                                244   4e-80    
ref|XP_006285630.1|  hypothetical protein CARUB_v10007083mg             187   5e-80    
gb|KCW66017.1|  hypothetical protein EUGRSUZ_G03309                     165   6e-80    
emb|CAN64251.1|  hypothetical protein VITISV_001277                     191   6e-80    
emb|CDX76894.1|  BnaC08g34800D                                          181   7e-80    
ref|XP_009136687.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    178   8e-80    
ref|XP_010068614.1|  PREDICTED: cytochrome P450 87A3-like               194   2e-79    
ref|XP_009147404.1|  PREDICTED: cytochrome P450 708A2-like              182   2e-79    
ref|NP_176744.1|  cytochrome P450, family 702, subfamily A, polyp...    179   2e-79    
gb|ABK28450.1|  unknown                                                 179   2e-79    
ref|XP_010111725.1|  Cytochrome P450 87A3                               213   3e-79    
gb|KCW64197.1|  hypothetical protein EUGRSUZ_G01850                     184   3e-79    
emb|CDY22926.1|  BnaA01g18640D                                          181   4e-79    
gb|KHG27613.1|  Cytochrome P450                                         196   1e-78    
gb|AAP50989.1|  putative cytochrome P450                                164   2e-78    
emb|CDY16450.1|  BnaA08g03170D                                          206   5e-78    
ref|XP_006414521.1|  hypothetical protein EUTSA_v10025137mg             182   5e-78    
gb|EAZ39816.1|  hypothetical protein OsJ_24256                          209   7e-78    
ref|XP_009776355.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    260   1e-77    
gb|EMT08723.1|  Cytochrome P450 87A3                                    167   1e-77    
ref|XP_002877207.1|  hypothetical protein ARALYDRAFT_323032             178   2e-77    
gb|AAF23843.1|AC007234_15  F1E22.5                                      172   3e-77    
ref|XP_009616056.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    259   3e-77    
emb|CDY09768.1|  BnaC07g32930D                                          177   4e-77    
gb|KCW64202.1|  hypothetical protein EUGRSUZ_G01855                     172   5e-77    
gb|AGT17443.1|  cytochrome P450                                         198   6e-77    
ref|NP_680696.2|  cytochrome P450, family 702, subfamily A, polyp...    184   7e-77    
ref|XP_002887742.1|  CYP708A3                                           164   8e-77    
gb|AAB60918.1|  Similar to Arabidopsis cytochrome P450 CYP90 (gb|...    172   1e-76    
ref|XP_010271639.1|  PREDICTED: cytochrome P450 87A3-like               214   2e-76    
ref|XP_002868253.1|  predicted protein                                  169   3e-76    
ref|XP_002870242.1|  hypothetical protein ARALYDRAFT_355245             164   6e-76    
ref|XP_002489065.1|  hypothetical protein SORBIDRAFT_0183s002030        252   8e-76    
ref|XP_010511939.1|  PREDICTED: cytochrome P450 708A2-like              173   3e-75    
emb|CDY38926.1|  BnaA04g13470D                                          157   5e-75    
ref|XP_008671137.1|  PREDICTED: cytochrome P450 87A3-like               248   6e-75    
ref|XP_010449951.1|  PREDICTED: cytochrome P450 708A2-like              177   7e-75    
gb|KCW61505.1|  hypothetical protein EUGRSUZ_H04233                     157   7e-75    
emb|CDY48293.1|  BnaC01g31470D                                          167   2e-74    
dbj|BAG97817.1|  unnamed protein product                                247   2e-74    
gb|KCW66735.1|  hypothetical protein EUGRSUZ_F00492                     159   4e-74    
ref|XP_006409819.1|  hypothetical protein EUTSA_v10016633mg             194   5e-74    
gb|EMS63415.1|  Cytochrome P450 87A3                                    184   6e-74    
ref|XP_010262836.1|  PREDICTED: cytochrome P450 90A1                    177   8e-74    
ref|XP_010432294.1|  PREDICTED: cytochrome P450 708A2-like              184   2e-73    
ref|XP_002870243.1|  CYP702A6                                           172   2e-73    
ref|NP_001078393.1|  cytochrome P450, family 702, subfamily A, po...    179   2e-73    
ref|NP_175990.2|  cytochrome P450, family 708, subfamily A, polyp...    256   3e-73    
ref|XP_008348936.1|  PREDICTED: cytochrome P450 87A3-like               160   3e-73    
ref|XP_002526166.1|  cytochrome P450, putative                          208   5e-73    
gb|AFW68203.1|  putative cytochrome P450 superfamily protein            245   7e-73    
ref|XP_010466591.1|  PREDICTED: cytochrome P450 708A2-like              179   9e-73    
ref|XP_007220390.1|  hypothetical protein PRUPE_ppa005060mg             170   9e-73    
gb|KDP44780.1|  hypothetical protein JCGZ_01280                         185   1e-72    
ref|XP_008233747.1|  PREDICTED: cytochrome P450 90A1                    170   1e-72    
ref|XP_008373932.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    172   4e-72    
gb|EYU37761.1|  hypothetical protein MIMGU_mgv1a025836mg                194   4e-72    
ref|XP_011044517.1|  PREDICTED: cytochrome P450 90A1-like               176   4e-72    
ref|XP_002894545.1|  hypothetical protein ARALYDRAFT_892617             248   6e-72    
ref|XP_009344816.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    173   9e-72    
ref|NP_001291222.1|  cytochrome P450 90A1                               176   1e-71    
ref|XP_006378664.1|  hypothetical protein POPTR_0010s19710g             176   1e-71    
ref|XP_004140660.1|  PREDICTED: cytochrome P450 87A3-like               202   2e-71    
gb|AJA04665.1|  constitutive photomorphogenesis and dwarfism 2          176   3e-71    
ref|XP_008373929.1|  PREDICTED: cytochrome P450 90A1-like isoform X1    169   3e-71    
gb|AES99584.2|  cytochrome P450 family monooxygenase                    177   3e-71    
gb|ACR20477.1|  steroid 23-alpha-hydroxylase                            177   3e-71    
ref|XP_004490985.1|  PREDICTED: cytochrome P450 90A1-like isoform X1    177   4e-71    
dbj|BAF56238.1|  cytochrome P450 enzyme                                 178   4e-71    
ref|XP_004490986.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    176   6e-71    
ref|XP_006304011.1|  hypothetical protein CARUB_v10011464mg             249   6e-71    
ref|XP_009344808.1|  PREDICTED: cytochrome P450 90A1-like isoform X1    170   7e-71    
ref|XP_008369248.1|  PREDICTED: cytochrome P450 90A1                    167   8e-71    
gb|AAF20011.1|AF216313_1  cytochrome P450                               236   8e-71    
gb|AET03943.2|  cytochrome P450 family 90 protein                       179   1e-70    
ref|XP_007009007.1|  Cytochrome P450 superfamily protein isoform 1      172   1e-70    
ref|XP_002311214.1|  hypothetical protein POPTR_0008s06740g             175   2e-70    
ref|XP_008463232.1|  PREDICTED: cytochrome P450 90A1 isoform X1         182   3e-70    
ref|XP_010254867.1|  PREDICTED: cytochrome P450 90B1-like               176   3e-70    
gb|KHF99479.1|  Cytochrome P450 protein                                 175   3e-70    
gb|EMS54525.1|  Cytochrome P450 87A3                                    198   4e-70    
dbj|BAE16979.1|  steroid 22-alpha-hydroxylase                           170   4e-70    
ref|XP_009415328.1|  PREDICTED: cytochrome P450 90B1-like               173   4e-70    
emb|CDY11332.1|  BnaA03g01680D                                          171   4e-70    
ref|XP_009130893.1|  PREDICTED: cytochrome P450 90A1-like               171   4e-70    
gb|KGN50649.1|  hypothetical protein Csa_5G202330                       181   5e-70    
gb|AER08631.1|  cytochrome P450 monooxygenase                           173   5e-70    
ref|XP_002316218.2|  hypothetical protein POPTR_0010s19710g             171   5e-70    
ref|XP_003538851.1|  PREDICTED: cytochrome P450 90B1-like               175   7e-70    
emb|CDY24488.1|  BnaC05g34660D                                          175   1e-69    
dbj|BAB02231.1|  cytochrome P450-like protein                           168   1e-69    
ref|XP_008463233.1|  PREDICTED: cytochrome P450 90A1 isoform X2         179   1e-69    
ref|XP_003517233.1|  PREDICTED: cytochrome P450 90B1-like isoform X1    174   1e-69    
ref|XP_002862857.1|  CYP708A3                                           178   2e-69    
ref|XP_003545232.1|  PREDICTED: cytochrome P450 90A1-like               177   2e-69    
ref|XP_009369157.1|  PREDICTED: cytochrome P450 90A1-like               166   2e-69    
ref|XP_004149251.1|  PREDICTED: cytochrome P450 90A1-like               180   2e-69    
ref|XP_003519393.1|  PREDICTED: cytochrome P450 90A1                    174   2e-69    
ref|XP_004307639.1|  PREDICTED: cytochrome P450 90A1-like               164   2e-69    
ref|XP_008783481.1|  PREDICTED: cytochrome P450 90B1-like               173   3e-69    
emb|CDP21192.1|  unnamed protein product                                233   3e-69    
ref|XP_003616626.1|  Cytochrome P450                                    170   3e-69    
gb|ABK25038.1|  unknown                                                 174   4e-69    
gb|KDO69000.1|  hypothetical protein CISIN_1g011522mg                   175   6e-69    
ref|XP_009402829.1|  PREDICTED: cytochrome P450 85A1-like               185   7e-69    
ref|XP_006395553.1|  hypothetical protein EUTSA_v10004108mg             239   8e-69    
gb|EEC82033.1|  hypothetical protein OsI_26005                          172   8e-69    
ref|XP_007156936.1|  hypothetical protein PHAVU_002G029700g             172   9e-69    
gb|KHN36124.1|  Cytochrome P450 90B1                                    171   1e-68    
ref|XP_007156037.1|  hypothetical protein PHAVU_003G253100g             175   1e-68    
ref|XP_010939273.1|  PREDICTED: cytochrome P450 90B1-like isoform X2    169   1e-68    
ref|XP_007163533.1|  hypothetical protein PHAVU_001G242200g             171   2e-68    
ref|XP_007045811.1|  Brassinosteroid-6-oxidase 2                        168   2e-68    
ref|XP_008786029.1|  PREDICTED: cytochrome P450 85A1-like               182   3e-68    
gb|EYU42117.1|  hypothetical protein MIMGU_mgv1a022195mg                179   4e-68    
emb|CDX77934.1|  BnaA09g31290D                                          169   5e-68    
ref|XP_009789229.1|  PREDICTED: cytochrome P450 90A1                    170   5e-68    
ref|XP_007141773.1|  hypothetical protein PHAVU_008G224600g             175   6e-68    
ref|XP_003611982.1|  Cytochrome P450                                    168   6e-68    
gb|AES94940.2|  cytochrome P450 family protein                          168   7e-68    
ref|XP_009387928.1|  PREDICTED: cytochrome P450 90B1-like               176   7e-68    
ref|XP_010095101.1|  Cytochrome P450 90A1                               167   8e-68    
ref|XP_004509297.1|  PREDICTED: cytochrome P450 90B1-like               166   8e-68    
ref|XP_008785666.1|  PREDICTED: cytochrome P450 90B1-like               167   1e-67    
ref|XP_010031233.1|  PREDICTED: cytochrome P450 90A1                    171   1e-67    
ref|XP_010937936.1|  PREDICTED: cytochrome P450 85A1                    178   1e-67    
ref|XP_006484352.1|  PREDICTED: cytochrome P450 85A1-like               177   1e-67    
ref|XP_008811805.1|  PREDICTED: cytochrome P450 85A1-like               181   1e-67    
gb|KDO69001.1|  hypothetical protein CISIN_1g011522mg                   170   2e-67    
gb|KHN48562.1|  Cytochrome P450 90A1                                    169   2e-67    
ref|XP_004512038.1|  PREDICTED: cytochrome P450 90B1-like isoform X1    170   2e-67    
gb|AIH07328.1|  steroid 22-alpha-hydroxylase                            164   3e-67    
emb|CAD27417.1|  cytochrome P450                                        170   3e-67    
ref|XP_004512039.1|  PREDICTED: cytochrome P450 90B1-like isoform X2    169   3e-67    
dbj|BAO79854.1|  brassinosteroid-6-oxidase                              176   3e-67    
ref|XP_009397228.1|  PREDICTED: cytochrome P450 85A1-like               176   4e-67    
ref|XP_011025770.1|  PREDICTED: cytochrome P450 90B1                    166   4e-67    
ref|NP_001275805.1|  uncharacterized protein LOC102608450               173   4e-67    
gb|ABC94481.1|  putative steroid 23-alpha-hydroxylase cytochrome ...    170   5e-67    
gb|AAF79335.1|AC002304_28  F14J16.21                                    240   5e-67    
ref|XP_008790366.1|  PREDICTED: cytochrome P450 90B1-like               176   5e-67    
ref|XP_002267187.1|  PREDICTED: cytochrome P450 90B1                    169   7e-67    
ref|XP_010060163.1|  PREDICTED: cytochrome P450 87A3-like isoform X2    192   8e-67    
ref|XP_008459397.1|  PREDICTED: cytochrome P450 85A-like                180   8e-67    
emb|CBI17531.3|  unnamed protein product                                168   9e-67    
dbj|BAF56239.1|  cytochrome P450 enzyme                                 169   1e-66    
ref|XP_006437886.1|  hypothetical protein CICLE_v10031449mg             176   1e-66    
ref|XP_002521603.1|  cytochrome P450, putative                          164   1e-66    
ref|XP_010923635.1|  PREDICTED: cytochrome P450 85A1-like isoform X2    182   1e-66    
ref|XP_010547498.1|  PREDICTED: cytochrome P450 90B1-like               165   1e-66    
gb|AAL77686.1|  At4g15396                                               185   1e-66    
ref|XP_010449950.1|  PREDICTED: cytochrome P450 708A2-like              144   1e-66    
ref|XP_004141472.1|  PREDICTED: cytochrome P450 85A-like                179   2e-66    
ref|XP_006574702.1|  PREDICTED: cytochrome P450 90B1-like isoform X1    169   2e-66    
ref|NP_001291242.1|  cytochrome P450 90B1-like precursor                162   2e-66    
ref|XP_011003742.1|  PREDICTED: cytochrome P450 90B1-like isoform X1    164   2e-66    
dbj|BAO79853.1|  brassinosteroid-6-oxidase                              172   3e-66    
ref|XP_006338854.1|  PREDICTED: cytochrome P450 90A1-like               166   3e-66    
ref|XP_010263684.1|  PREDICTED: cytochrome P450 90B1-like               171   3e-66    
emb|CDP02030.1|  unnamed protein product                                169   5e-66    
ref|XP_006383211.1|  hypothetical protein POPTR_0005s12550g             162   6e-66    
ref|XP_009388906.1|  PREDICTED: cytochrome P450 85A-like                176   7e-66    
ref|XP_010552879.1|  PREDICTED: cytochrome P450 90A1-like               168   9e-66    
ref|XP_006383212.1|  hypothetical protein POPTR_0005s12550g             162   9e-66    
emb|CDY49400.1|  BnaA01g35580D                                          170   1e-65    
ref|NP_001175197.1|  Os07g0482975                                       226   1e-65    
ref|XP_008356324.1|  PREDICTED: cytochrome P450 87A3-like               171   2e-65    
ref|XP_004149155.1|  PREDICTED: cytochrome P450 90B1-like               166   2e-65    
ref|XP_009396020.1|  PREDICTED: cytochrome P450 90B1-like isoform X2    164   2e-65    
ref|XP_006856023.1|  hypothetical protein AMTR_s00059p00056420          168   2e-65    
ref|XP_004240946.1|  PREDICTED: cytochrome P450 90A1                    164   2e-65    
gb|AGJ98214.1|  CPD                                                     157   3e-65    
ref|XP_008453737.1|  PREDICTED: cytochrome P450 90B1                    165   3e-65    
ref|XP_010032564.1|  PREDICTED: cytochrome P450 85A-like isoform X2     171   4e-65    
gb|ADR78274.1|  CYP720B17v2                                             165   5e-65    
gb|AFK34466.1|  unknown                                                 222   5e-65    
ref|XP_010936277.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    159   6e-65    
ref|XP_006856402.1|  hypothetical protein AMTR_s00047p00210610          175   6e-65    
ref|XP_006848201.1|  hypothetical protein AMTR_s00029p00241050          160   1e-64    
gb|ACN41063.1|  unknown                                                 164   1e-64    
gb|AIK01727.1|  CYP720PB11                                              179   1e-64    
ref|XP_002273613.1|  PREDICTED: cytochrome P450 85A                     170   1e-64    
ref|XP_008778138.1|  PREDICTED: cytochrome P450 90B1-like               164   1e-64    
ref|XP_006425689.1|  hypothetical protein CICLE_v10025451mg             164   2e-64    
gb|AJD25206.1|  cytochrome P450 CYP85A1                                 171   2e-64    
gb|AEI98636.1|  hypothetical protein 111O18.23                          169   2e-64    



>ref|XP_009776354.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Nicotiana sylvestris]
Length=483

 Score =   321 bits (822),  Expect(2) = 2e-156, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 195/246 (79%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN++K+IK+ L +++SS  K+K  +DFLD++L EV+ EE+ LTE+I VD++ +L+FA
Sbjct  224   QGRKNIVKVIKDILKKKQSS--KEKANQDFLDHMLKEVENEESLLTEEITVDLVLLLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             AYETTSS+ TL  K+LN HP VL +L EEHE I+  R D+ + I+W EY+SM FT+MVIN
Sbjct  282   AYETTSSSITLLFKYLNSHPEVLTELTEEHESILKRRTDEGALISWLEYKSMSFTNMVIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+IAP IFR  ++D +IKGYTIP GW F++CPSSVHL   KY+DPL+FNP RW G
Sbjct  342   ETVRLANIAPGIFRITLKDVQIKGYTIPAGWTFVVCPSSVHLDPNKYEDPLTFNPWRWKG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +ELH  SKKFMAFGG  RLCAGA+ +K+  AI LHYL+T Y+WKV +EGN++RKPGL F 
Sbjct  402   EELHMGSKKFMAFGGGVRLCAGADLSKMQTAIFLHYLLTNYRWKVTNEGNVIRKPGLIFN  461

Query  1341  DGFKVQ  1358
             +G  ++
Sbjct  462   NGLHIE  467


 Score =   261 bits (666),  Expect(2) = 2e-156, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 152/201 (76%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            ++L++ +V+ I+ WVY+WRNPKCKG+LPPGSMG P IGESIQ+F+SHS +GIPPFI +R 
Sbjct  6    LWLVAVIVVGISRWVYKWRNPKCKGVLPPGSMGLPFIGESIQYFSSHSYEGIPPFIAERT  65

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG LF+TSI+GQ V++STD EIN+++FQQE  L  CWYT+S + + G QG  VH G  
Sbjct  66   ARYGGLFKTSILGQPVVISTDPEINYYVFQQENNLFQCWYTKSASDLLGEQGLNVHGGAV  125

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            HKYLRNL L LVG ++LK  L++E+D   R+HLD W     +++K+A EIMLF   A K 
Sbjct  126  HKYLRNLVLFLVGQQSLKGNLMSEIDLITRKHLDWWAERGKIEVKEAVEIMLFTFIAKKT  185

Query  562  LSYDEKKAMELRKYYKAFMEG  624
            L  +E++A+ELR++YKAF  G
Sbjct  186  LGLEEQEALELREHYKAFFGG  206



>ref|XP_009803784.1| PREDICTED: cytochrome P450 87A3-like [Nicotiana sylvestris]
Length=481

 Score =   312 bits (799),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 194/246 (79%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN +K+IK+ + ER++S K+K+KK+DFLD+LL EVDKE T LTE+ A++ I  ++FA
Sbjct  223   QGRKNAMKMIKDIVKERKTS-KEKRKKQDFLDHLLYEVDKE-TILTEENALNTIFAVLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A+ETTS+A  L LKFLN HP VL QL EEHE I+  REDKE++I+W EY+SM FTH V+N
Sbjct  281   AFETTSAAIALGLKFLNDHPQVLPQLMEEHENIVKNREDKEAAISWAEYKSMTFTHKVVN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E VRLA+I P IFRKV++D +IKG+TIP GW+ ++CP SVHL +  Y+DP  FNP RW  
Sbjct  341   EIVRLANIVPGIFRKVLKDVKIKGFTIPAGWIVVVCPPSVHLDSNNYEDPYVFNPWRWKE  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +ELH ASKKFMAFGG  RLCAGA+ AKL ++I LHYLVTKY+W++  EGNIVR PGL F+
Sbjct  401   EELHSASKKFMAFGGGLRLCAGADLAKLQISIFLHYLVTKYRWRMKKEGNIVRTPGLYFV  460

Query  1341  DGFKVQ  1358
             DG  + 
Sbjct  461   DGLHIH  466


 Score =   266 bits (681),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 154/206 (75%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            WL +  ++ +V+   HWVYRWRNPKCKGLLPPGSMG PIIGESI++F+SH L+GIPPFIQ
Sbjct  2    WLSLLAVALIVVGFTHWVYRWRNPKCKGLLPPGSMGLPIIGESIEYFSSHPLEGIPPFIQ  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +R  RYG LF+TS+VG  V++STD E+N+++FQQE  L  CWYT+S  ++TG  GF+ + 
Sbjct  62   KRTARYGKLFKTSLVGHPVVLSTDPEVNYYVFQQEEVLFQCWYTKSAIELTGKDGFLDNK  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  HKYLRNL L+LVGP+ LK   ++E+D   R+HL  W    ++D+K+A EIML    A
Sbjct  122  GTVHKYLRNLVLSLVGPDKLKHNHISEIDLNIRKHLHRWAGQGDVDVKEAPEIMLITFMA  181

Query  553  SKVLSYDEKKAMELRKYYKAFMEGDV  630
             K+L  +E+KA+ELR+ Y+AFM G V
Sbjct  182  EKILGCNEEKALELREQYRAFMGGFV  207



>ref|XP_009611047.1| PREDICTED: cytochrome P450 87A3-like [Nicotiana tomentosiformis]
Length=483

 Score =   311 bits (798),  Expect(2) = 1e-154, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 190/246 (77%), Gaps = 1/246 (0%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN +K+IK+ + ER+ S K+K+ K+DFLD+LL EV  +ET LTE+ A++ I  ++FA
Sbjct  223   QGRKNAMKMIKDIVKERKRS-KEKRNKQDFLDHLLCEVANKETILTEENALNTIFAVLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A+ETTS+A  L LKFLN HP VL QL EEHE I+  REDKE++I+W EY+SM FTH V+N
Sbjct  282   AFETTSAAIALGLKFLNDHPQVLPQLMEEHENIVKNREDKEAAISWTEYKSMPFTHKVVN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E VRLA+I P IFRKV++D +IKG+TIP GW+ ++CP SVHL +  Y+DP  FNP RW  
Sbjct  342   EIVRLANIVPGIFRKVLKDVKIKGFTIPAGWIVVVCPPSVHLDSNNYEDPYVFNPWRWKE  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +ELH  SKKFMAFGG  RLCAGA+ AKL ++I LHYLVTKY+W++  EGNIVR PGL FL
Sbjct  402   EELHSVSKKFMAFGGGLRLCAGADLAKLQISIFLHYLVTKYRWRMKKEGNIVRTPGLYFL  461

Query  1341  DGFKVQ  1358
             DG  + 
Sbjct  462   DGLHIH  467


 Score =   265 bits (676),  Expect(2) = 1e-154, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            WL +  ++ +V+   HWVYRWRNPKCKGLLPPGSMG PIIGESI +F+SH L+GIPPFIQ
Sbjct  2    WLSLLAVALIVVGFTHWVYRWRNPKCKGLLPPGSMGLPIIGESIGYFSSHPLEGIPPFIQ  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +R  RYG +F+TS+VG  V+VS D E+N+++FQQE  L  CWYT+S  ++TG  GF+ + 
Sbjct  62   ERTARYGKIFKTSLVGHPVVVSADPEVNYYVFQQEEVLFQCWYTKSAIELTGKDGFLDNK  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  HKYLRNL L+LVGP+ LK   ++E+D   R+HL  W     +D+K+A+EIML    A
Sbjct  122  GTVHKYLRNLVLSLVGPDKLKHNHISEIDLNIRKHLHRWAGRGEVDVKEASEIMLITFMA  181

Query  553  SKVLSYDEKKAMELRKYYKAFMEGDV  630
             K+L  +E+KA+ELR+ Y+AFM G V
Sbjct  182  EKILECNEEKALELREQYRAFMGGFV  207



>ref|XP_009616055.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Nicotiana tomentosiformis]
Length=483

 Score =   312 bits (800),  Expect(2) = 2e-153, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 194/246 (79%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN++K+I++ L +R+SS  K+K  +DFLD++L EV+ EE+ LTE+I VD++ +L+FA
Sbjct  224   QGRKNIVKVIRDILKKRQSS--KEKANQDFLDHMLKEVENEESLLTEEIIVDLVLLLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             AYETTSS+ TL  K+LN HP VL +L EEHE I+ +R D+ + I+W EY+SM FT+MVIN
Sbjct  282   AYETTSSSITLLFKYLNSHPEVLTELTEEHESILKSRTDEGALISWLEYKSMSFTNMVIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+IAP IFR  ++D +IKGYTIP GW F++CPSSVHL   KY+DPL+FNP RW G
Sbjct  342   ETVRLANIAPGIFRITLKDVQIKGYTIPAGWTFVVCPSSVHLDPNKYEDPLTFNPWRWKG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +ELH  SKKFMAFGG  RLCAGA+ +K+  AI LHYL+T Y+WKV +EGN+ R+PGL F 
Sbjct  402   EELHKGSKKFMAFGGGVRLCAGADLSKMQTAIFLHYLLTNYRWKVTNEGNVTRQPGLIFK  461

Query  1341  DGFKVQ  1358
              G  ++
Sbjct  462   KGLHIE  467


 Score =   259 bits (663),  Expect(2) = 2e-153, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 151/201 (75%), Gaps = 0/201 (0%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            ++L++ +V+ I+ WVY+WRNPKCKG+LPPGSMG P IGESIQ+F+SHS +GIPPFI +R 
Sbjct  6    LWLVAVIVVGISGWVYKWRNPKCKGVLPPGSMGLPFIGESIQYFSSHSYEGIPPFIAERT  65

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG LF+TSI+GQ V++STD EIN+++FQQE  L  CWYT+S + + G QG  VH G  
Sbjct  66   ARYGGLFKTSILGQPVVISTDPEINYYVFQQENNLFQCWYTKSASDLLGEQGLNVHGGAV  125

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            HKYLRNL L+LVG + LK  L++E+D   R+HLD W     +++K+A EIMLF   A K 
Sbjct  126  HKYLRNLVLSLVGQQCLKGNLMSEIDLITRKHLDRWAEHGKVEVKEAAEIMLFTFMAKKT  185

Query  562  LSYDEKKAMELRKYYKAFMEG  624
            L  +E++A ELR++YKAF  G
Sbjct  186  LGCEEQEASELREHYKAFFGG  206



>emb|CDP19727.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   317 bits (813),  Expect(2) = 3e-150, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 188/252 (75%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   +GRK  +K IK T   RRS C    K   F+D+LL EV+KE+TFL E+IA+D++
Sbjct  218   AFHACLQGRKKAMKAIKNTFEMRRS-CNDATKV--FVDHLLKEVEKEDTFLNEEIAMDLV  274

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
              +L+FA++ETTS+A TLA++FLN HP VL +L+ EHE I+  RE ++S ++W EY+SM F
Sbjct  275   FLLLFASHETTSTAMTLAMRFLNDHPAVLAELKREHENILKIRETEDSGVSWKEYKSMIF  334

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             THMVINETVRLA+IAP IFRKVV++ EIKGYT P GW  M+CPSSVHL   +Y+DPL FN
Sbjct  335   THMVINETVRLANIAPGIFRKVVKEVEIKGYTFPAGWTLMVCPSSVHLDPNRYNDPLEFN  394

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW GQELH  SK FMAFGG  RLC GA+FAKL MAI LHYLVTKY W V+  G  +RK
Sbjct  395   PWRWEGQELHAGSKSFMAFGGGTRLCVGADFAKLQMAIFLHYLVTKYTWTVIHGGETIRK  454

Query  1323  PGLTFLDGFKVQ  1358
             PGL F  G  ++
Sbjct  455   PGLLFPSGLHIE  466


 Score =   243 bits (621),  Expect(2) = 3e-150, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 146/200 (73%), Gaps = 1/200 (1%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTR  207
            +I+ +++  +HWVYRWRNPKC G LPPGSMG PIIGE+IQ+FT ++   +P F+Q+RV+R
Sbjct  7    IIALIILLFSHWVYRWRNPKCNGALPPGSMGLPIIGETIQYFTPYAKDDVPQFLQKRVSR  66

Query  208  YGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHK  387
            YG +FRTS+VGQ VIVSTD E+N+ +FQQEG    C YTES  +I G Q  +VHHG+ HK
Sbjct  67   YGPIFRTSLVGQPVIVSTDPEVNYHVFQQEGNAFRCSYTESVFRIIGKQSLVVHHGEFHK  126

Query  388  YLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
            YL+NL L LV PE L++ L+ EMD   ++ L  W+ L  +D K  T  ++FKLAA K+L 
Sbjct  127  YLKNLILKLVSPEALREKLIYEMDGNTQKCLSSWSKLGKIDAKDGTAELVFKLAAKKILD  186

Query  568  YDEKKAM-ELRKYYKAFMEG  624
            Y+E KA  +LR  YKAFM+G
Sbjct  187  YEESKAQKKLRDSYKAFMDG  206



>ref|XP_011093255.1| PREDICTED: cytochrome P450 87A3-like [Sesamum indicum]
Length=473

 Score =   309 bits (791),  Expect(2) = 4e-146, Method: Compositional matrix adjust.
 Identities = 143/247 (58%), Positives = 189/247 (77%), Gaps = 5/247 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  IK+I+  L+ RRSS        DFLD ++ EV+ E+T LT ++A DV+ +L+FA
Sbjct  224   QGRERAIKMIRSALDARRSS----NGNHDFLDQIMREVEDEDTILTREVATDVLFLLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKES-SITWNEYRSMKFTHMVI  977
             ++ETTS+   LAL FL++HP+VL+ L+EEHEKI++ R++KE+  ITW EY+SM FTHMVI
Sbjct  280   SFETTSTTIALALHFLHRHPNVLQHLKEEHEKILSGRDNKETRGITWTEYKSMTFTHMVI  339

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NETVRLAD  P +FRKV+Q+ +IKGYTIP GW  ++CP + HL+  +Y+DP  FNP RW 
Sbjct  340   NETVRLADNVPGMFRKVMQEVKIKGYTIPAGWTVVVCPCATHLNPNEYEDPYLFNPWRWQ  399

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             GQELH ASKKF+AFGG +RLCAGA+FAKL +AI +HYLVT+Y+WK+  EG IVRKPGL F
Sbjct  400   GQELHAASKKFLAFGGGRRLCAGADFAKLQIAIFIHYLVTQYRWKITKEGVIVRKPGLAF  459

Query  1338  LDGFKVQ  1358
                  VQ
Sbjct  460   PKALCVQ  466


 Score =   239 bits (609),  Expect(2) = 4e-146, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 139/188 (74%), Gaps = 0/188 (0%)
 Frame = +1

Query  61   WVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVG  240
            WVYRWRNPKC G+LPPGSMG P+IGE+ ++F++  L+GIPPFI +R+ RYG +FRTS+VG
Sbjct  19   WVYRWRNPKCNGVLPPGSMGLPLIGETFEYFSAQPLEGIPPFIAKRMARYGPVFRTSLVG  78

Query  241  QKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVG  420
            Q V++STD E+N +IF QEGK+   WYT+SG +ITG +G  VH G+SHKYLRNL  ++VG
Sbjct  79   QPVVMSTDQEVNQYIFGQEGKMFQAWYTQSGFRITGEKGLPVHAGNSHKYLRNLIRDIVG  138

Query  421  PENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAMELRK  600
             ENLK+ L+ EMD+   +HL  W     +D+K A EIM+ +L   K L  +E KA+ELR+
Sbjct  139  LENLKEELVHEMDRITSKHLSRWAHSHEVDVKDAAEIMVVELGGKKFLGLEEGKALELRE  198

Query  601  YYKAFMEG  624
             YK F + 
Sbjct  199  NYKNFKDA  206



>ref|XP_007051922.1| Cytochrome P450 87A3 [Theobroma cacao]
 gb|EOX96079.1| Cytochrome P450 87A3 [Theobroma cacao]
Length=496

 Score =   318 bits (815),  Expect(2) = 2e-145, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 194/246 (79%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK V K+IK+   +R++S   K    DFL+YLL+EV++E+TFLTE+IA D++ +L+FA
Sbjct  226   QGRKKVYKVIKDIFEKRKAS---KGHHNDFLEYLLNEVEREDTFLTEQIAKDLVFVLLFA  282

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS+ATTLA+KF+  H  VL++L +EHE II +R ++ S +TW EY+SM FTHMVIN
Sbjct  283   SHETTSAATTLAVKFIADHHQVLEELTKEHEAIIKSRGNENSELTWQEYKSMTFTHMVIN  342

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+IAP +FRKVV+D EIKGYTIP GW+ M+ P++VHLS  KY++PL FNP RW G
Sbjct  343   ETVRLANIAPGMFRKVVKDVEIKGYTIPAGWLVMVVPAAVHLSPSKYENPLQFNPWRWEG  402

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             QELH  SK FMAFGG  RLC GA+FAKL M I +HY+VT+Y+W V+  G+IVRKPGL F 
Sbjct  403   QELHAGSKNFMAFGGGTRLCVGADFAKLQMGIFIHYMVTRYRWTVIKGGDIVRKPGLVFP  462

Query  1341  DGFKVQ  1358
             +G  ++
Sbjct  463   NGLHIK  468


 Score =   227 bits (578),  Expect(2) = 2e-145, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 141/197 (72%), Gaps = 2/197 (1%)
 Frame = +1

Query  52   IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            I+ WV+ W  PKC G+LPPGSMG P IGE+ QFF+ HSL  IPPFI +R+ RYG++FRTS
Sbjct  16   ISRWVHNWAYPKCNGVLPPGSMGLPFIGETTQFFSPHSLYDIPPFISKRMRRYGAVFRTS  75

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALN  411
            +VGQKV+VSTD EIN+ IFQQE K    WYTES  +I G Q  +  HG  HKYLRNL L 
Sbjct  76   LVGQKVVVSTDPEINYEIFQQENKSFLLWYTESFLEIFGQQSLVAQHGMVHKYLRNLILQ  135

Query  412  LVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK--KA  585
            LV PENLK  LL+EMD+  R+HL+ W++L ++D+K+ +  M+F+  A+K++ YDE     
Sbjct  136  LVSPENLKGKLLSEMDRATRKHLNSWSSLGSIDVKEGSSKMIFEYFATKLIGYDENMDPN  195

Query  586  MELRKYYKAFMEGDVKM  636
              +R  ++AF++G + +
Sbjct  196  RNVRDSFQAFLDGLISL  212



>ref|XP_010661699.1| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
Length=685

 Score =   303 bits (777),  Expect(2) = 5e-144, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 187/252 (74%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   +GR+N IK+I   +NER+SS   +K   DFLD+LL E   ++T L E I VD++
Sbjct  219   AFHACLKGRENAIKVINNVINERKSS---QKLCHDFLDFLLEEAKSKDTILNEAIIVDLV  275

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
              +L+FA+YETTS A TL +KFL+ HP V+ +L +EHE+I+  R+++E  ITW EY+SM F
Sbjct  276   FLLLFASYETTSEAITLVMKFLSDHPSVVVELTKEHEEILKNRKNEELGITWTEYKSMTF  335

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             THMVINET+RL +I P IFR V +D E+KG TIP G   M+CPS+VHL+  KY+DPL+F+
Sbjct  336   THMVINETLRLGNIVPGIFRGVTKDIEMKGTTIPAGSTVMVCPSAVHLNPAKYNDPLAFD  395

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW GQELH  SK F+AFGG  RLCAGA FAK+ +A+ LHYLVTKY+WK +  G+I+RK
Sbjct  396   PWRWEGQELHAGSKNFVAFGGGSRLCAGAHFAKVQVAVFLHYLVTKYRWKKIRGGDIIRK  455

Query  1323  PGLTFLDGFKVQ  1358
             PGL F DG  +Q
Sbjct  456   PGLVFPDGLHIQ  467


 Score =   237 bits (604),  Expect(2) = 5e-144, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 154/204 (75%), Gaps = 1/204 (0%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            LV+ LI+FLVI I+ W+ +W NPKCKG LP GSMG PIIGE+IQFF+ HS  GIPPFI +
Sbjct  4    LVICLIAFLVILISQWLQKWLNPKCKGRLPRGSMGLPIIGETIQFFSPHSFYGIPPFISK  63

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+T+YGS+F+TS+VG  V+VS DSE+N +IF++EGK V+C YTES  +I G Q  + +HG
Sbjct  64   RMTKYGSVFKTSLVGNLVVVSGDSELNQYIFKEEGKSVYCSYTESALKIMGEQSLLAYHG  123

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYL+NL L+++GPE+LK+ LL EMD   R++L   ++ ++ D+K+ +  M+F+  A 
Sbjct  124  VFHKYLKNLTLSMIGPESLKEVLLHEMDAVTRKYLHSCSSYASFDVKEESANMVFEYFAK  183

Query  556  KVLSYDEKKA-MELRKYYKAFMEG  624
            K+  Y+E KA  +LR+ YKAF++G
Sbjct  184  KLFGYEEAKASKKLRESYKAFLDG  207


 Score =   133 bits (335),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +3

Query  1050  GYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQELHPASKKFMAFGGVQRLCAGA  1229
             GYTIP+GW+ ++CPS  HL   KY DP +FNP RW GQELH  SK FMAFGG  RLCAGA
Sbjct  575   GYTIPKGWIVVVCPSVPHLDPTKYKDPFAFNPWRWEGQELHAGSKNFMAFGGGVRLCAGA  634

Query  1230  EFAKLAMAIMLHYLVTKYKWKVVDEG  1307
              FAKL MAI LHYLVTKY+W  V  G
Sbjct  635   HFAKLQMAIFLHYLVTKYRWTNVKGG  660



>ref|XP_010112562.1| Cytochrome P450 87A3 [Morus notabilis]
 gb|EXC34109.1| Cytochrome P450 87A3 [Morus notabilis]
Length=479

 Score =   298 bits (762),  Expect(2) = 6e-138, Method: Compositional matrix adjust.
 Identities = 141/245 (58%), Positives = 180/245 (73%), Gaps = 2/245 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRK  ++++K+ L ERR +   KK++ DF DY+L E+ KE T LTE IA+D++ +L+FA+
Sbjct  223   GRKRAMRMLKKLLQERREN--PKKQQSDFFDYVLEELQKEGTILTEAIALDLMFVLLFAS  280

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETTS A TLA+KFL  HP VLK+L EEHE I+  RE+ +S ITW EY+SM FT  VINE
Sbjct  281   FETTSLALTLAVKFLTDHPLVLKKLTEEHEMILKNRENADSGITWKEYKSMTFTIQVINE  340

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
             TVRLA+I P IFRK ++D + KGYTIP GW  M+CP +VHL+  KY+DPL+FNP RW G 
Sbjct  341   TVRLANIVPGIFRKALRDIQFKGYTIPAGWAVMVCPPAVHLNPAKYEDPLAFNPWRWEGV  400

Query  1164  ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLD  1343
             EL+ A+K FMAFGG  R C G EF K+ MA+ LH LVTKY+W  +  GNIVR PGL   D
Sbjct  401   ELNGATKHFMAFGGGMRFCVGTEFTKVQMAVFLHCLVTKYRWNAIGGGNIVRTPGLQLPD  460

Query  1344  GFKVQ  1358
             G+ VQ
Sbjct  461   GYHVQ  465


 Score =   222 bits (566),  Expect(2) = 6e-138, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 152/205 (74%), Gaps = 3/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            WL +++ +  VI+I HWVY W NPKC G LPPGSMGFP++GE++QFF+ ++   IPPFI+
Sbjct  2    WL-LFIGALAVISITHWVYTWMNPKCSGKLPPGSMGFPLLGETLQFFSPNTSFDIPPFIK  60

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            QR+ +YG++FRTS+VG+ V++STDS++N+FIFQQEG+L   WY E+  +I G Q     H
Sbjct  61   QRIKKYGAIFRTSLVGRPVVISTDSDLNYFIFQQEGRLFQSWYPETFTEIFGKQNVGSLH  120

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ LNL GPE+LK+ +L E++Q A   L  W+    +++K+AT  M+F L A
Sbjct  121  GFMYKYLKNMVLNLFGPESLKK-MLPEVEQAANGKLRQWSNRGVIELKEATARMIFDLTA  179

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++SYD++K+ E LR+ + AF++G
Sbjct  180  KKLISYDQEKSSENLRENFVAFIQG  204



>emb|CBI38770.3| unnamed protein product [Vitis vinifera]
Length=613

 Score =   305 bits (780),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 187/252 (74%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   +GR+N IK+I   +NER+SS   +K   DFLD+LL E   ++T L E I VD++
Sbjct  359   AFHACLKGRENAIKVINNVINERKSS---QKLCHDFLDFLLEEAKSKDTILNEAIIVDLV  415

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
              +L+FA+YETTS A TL +KFL+ HP V+ +L +EHE+I+  R+++E  ITW EY+SM F
Sbjct  416   FLLLFASYETTSEAITLVMKFLSDHPSVVVELTKEHEEILKNRKNEELGITWTEYKSMTF  475

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             THMVINET+RL +I P IFR V +D E+KG TIP G   M+CPS+VHL+  KY+DPL+F+
Sbjct  476   THMVINETLRLGNIVPGIFRGVTKDIEMKGTTIPAGSTVMVCPSAVHLNPAKYNDPLAFD  535

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW GQELH  SK F+AFGG  RLCAGA FAK+ +A+ LHYLVTKY+WK +  G+I+RK
Sbjct  536   PWRWEGQELHAGSKNFVAFGGGSRLCAGAHFAKVQVAVFLHYLVTKYRWKKIRGGDIIRK  595

Query  1323  PGLTFLDGFKVQ  1358
             PGL F DG  +Q
Sbjct  596   PGLVFPDGLHIQ  607


 Score =   214 bits (546),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 141/204 (69%), Gaps = 24/204 (12%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            LV+ LI+FLVI I+ W+ +W NPKCKG LP GSMG PIIGE+IQFF+ HS  GIPPFI +
Sbjct  167  LVICLIAFLVILISQWLQKWLNPKCKGRLPRGSMGLPIIGETIQFFSPHSFYGIPPFISK  226

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+T+YGS+F+TS+VG  V+VS DSE+N +IF++EGK V+C YTES  +I G Q  + +HG
Sbjct  227  RMTKYGSVFKTSLVGNLVVVSGDSELNQYIFKEEGKSVYCSYTESALKIMGEQSLLAYHG  286

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYL+NL L+++GPE+LK+ LL EMD                        M+F+  A 
Sbjct  287  VFHKYLKNLTLSMIGPESLKEVLLHEMDA-----------------------MVFEYFAK  323

Query  556  KVLSYDEKKA-MELRKYYKAFMEG  624
            K+  Y+E KA  +LR+ YKAF++G
Sbjct  324  KLFGYEEAKASKKLRESYKAFLDG  347


 Score =   174 bits (442),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = +1

Query  70   RWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKV  249
            +W NPKCKG LP GSMG PIIGE+I FF+ HS  GIP FI +R+T+YGS+ +TS+VG  V
Sbjct  5    KWLNPKCKGRLPRGSMGLPIIGETIPFFSPHSFYGIPHFISKRMTKYGSVLKTSLVGNLV  64

Query  250  IVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPEN  429
            +VS DSE+N +IF +EGK V+C Y ES  +I G Q  + +HG  HKYL+NL L+++GPE+
Sbjct  65   VVSGDSELNQYIF-KEGKSVYCSYKESALKIMGEQSLLAYHGVFHKYLKNLTLSMIGPES  123

Query  430  LKQTLLTEMDQTARQHLDHWTALSNLDIKQAT  525
            LK+ LL E D   R++L   +  ++ D+K+ +
Sbjct  124  LKEVLLHETDAITRKYLHSCSNYASFDVKEES  155



>ref|XP_002529163.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33222.1| cytochrome P450, putative [Ricinus communis]
Length=472

 Score =   303 bits (776),  Expect(2) = 9e-137, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 190/246 (77%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +++IK TL ERR++   KK+KKDFLD +L E DK+ +FLTEK A+D + ML FA
Sbjct  224   QGRKEAMEIIKSTLEERRTA--PKKEKKDFLDVMLEETDKDGSFLTEKTALDFLFMLPFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +E+TSS   LAL+ L+++P  L++L +EHE I++ RE  +S +TW EYRSM FTH+VIN
Sbjct  282   FFESTSSVMVLALQLLSENPEALEELTKEHEAILSNREKNDSKLTWEEYRSMTFTHLVIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RL +I P +FRK V D +IKGYTIP GWM M+CP++VHL+  KY+DPL+FNP RW G
Sbjct  342   ETTRLVNIVPRVFRKAVNDVQIKGYTIPAGWMVMVCPTTVHLNPVKYNDPLAFNPWRWQG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +EL+  SK FMAFGG  RLCAGA+F KL MAI LHYLVTKY+W V+ +G++++KPG+ F 
Sbjct  402   EELNAGSKNFMAFGGGVRLCAGADFVKLQMAIFLHYLVTKYRWSVI-KGHVLKKPGVVFP  460

Query  1341  DGFKVQ  1358
             DGF VQ
Sbjct  461   DGFHVQ  466


 Score =   213 bits (542),  Expect(2) = 9e-137, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 131/196 (67%), Gaps = 1/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            L++ +AHWVY WRNPKC G LPPGSMGFPIIGE+IQFF  H    +PPFI++R  +YGSL
Sbjct  11   LLLCLAHWVYNWRNPKCNGKLPPGSMGFPIIGETIQFFIPHRNLDVPPFIRKRTEKYGSL  70

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TSIVG K+IVS D+E+NH IFQQEGK    WY +S   I G    +   G  HK+LRN
Sbjct  71   FKTSIVGCKIIVSADAEVNHLIFQQEGKSFISWYMDSFTDILGKDNILFLQGFIHKHLRN  130

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD-E  576
            L LN VG ++LKQ LL E++    +HL  W+    +++K+A   M+F  +   + S +  
Sbjct  131  LILNFVGSQSLKQRLLPEIENLTCKHLQLWSTQGTVELKEAISTMIFSFSTELLFSCNGT  190

Query  577  KKAMELRKYYKAFMEG  624
            K   ++RKYY  F++G
Sbjct  191  KSTTKMRKYYADFLDG  206



>ref|XP_002303566.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE78545.1| cytochrome P450 family protein [Populus trichocarpa]
Length=481

 Score =   303 bits (776),  Expect(2) = 1e-136, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 185/246 (75%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             RGRK  ++++K  L ERR++   +K + DF DY+L E+ ++   LTE+IA+D++ +L+FA
Sbjct  222   RGRKKAMRMLKNQLQERRAN--PRKYRSDFFDYVLEELQEDRGILTEEIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ +P VLK+L EEHE I+  R D  S +TWNEY+SMKFT  VIN
Sbjct  280   SFETTSLALTLAVKFLSDNPLVLKKLTEEHEGILRNRVDSNSGLTWNEYKSMKFTFQVIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK ++D + KGYTIP GW  M+CP +VHLS EKY+DPL+FNP RW G
Sbjct  340   ETVRLANIVPGIFRKALRDIQFKGYTIPEGWAVMVCPPAVHLSPEKYEDPLAFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+ ASKKFMAFGG  R C G EF K+ MA+ LH LVTK++W+V+  GNIVR PGL F 
Sbjct  400   LELNGASKKFMAFGGGMRFCVGTEFTKVQMAVFLHCLVTKFRWQVIKGGNIVRTPGLQFP  459

Query  1341  DGFKVQ  1358
              G+ +Q
Sbjct  460   SGYHIQ  465


 Score =   213 bits (542),  Expect(2) = 1e-136, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 145/203 (71%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             ++  + ++I+I HWV+RWRNP+C G LPPGSMG P+IGE++QFF  ++   IPPF+++R
Sbjct  3    ALFFGALIIISITHWVHRWRNPRCNGTLPPGSMGLPLIGETLQFFAPNTSFDIPPFVKER  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +FRT++VG+ V+VSTD ++N+FIFQQEG+L   WY ++  +I G Q     HG 
Sbjct  63   MKRYGPIFRTNLVGRPVVVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGF  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ LNL GPE+LK+ +L E++QT  + L  W+   ++++K+ T  M+F L A K
Sbjct  123  MYKYLKNMVLNLFGPESLKK-MLPEVEQTTSKRLQLWSHQESVELKETTATMIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SYD+  + E LR  + AF+ G
Sbjct  182  LISYDQDNSSENLRDNFVAFIHG  204



>ref|XP_006573760.1| PREDICTED: cytochrome P450 87A3-like [Glycine max]
 gb|KHN25726.1| Cytochrome P450 87A3 [Glycine soja]
Length=482

 Score =   289 bits (739),  Expect(2) = 1e-136, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 178/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR    ++K++ DF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGRKRAMKMLKNMLQERRR--MQRKEQTDFFDYVVEELKKEGTILTEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+K L+ +P VLK+LQEEHE I+  RED  S +TW EY+SM FT   IN
Sbjct  280   SFETTSLALTYAIKLLSDNPVVLKRLQEEHEAILKQREDPNSGVTWKEYKSMTFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK +++   KGYTIP GW  M+CP +VHL+  KY DPL+FNP RW G
Sbjct  340   ETVRLANIVPGIFRKALREINFKGYTIPAGWAVMVCPPAVHLNPAKYHDPLAFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              ELH ASK FMAFGG  R C G +F K+ MA+ +H L+TKY+W+ +  GNI+R PGL F 
Sbjct  400   VELHGASKNFMAFGGGMRFCVGTDFTKVQMAMFIHSLLTKYRWRPIKGGNILRTPGLQFP  459

Query  1341  DGFKVQ  1358
             +GF VQ
Sbjct  460   NGFHVQ  465


 Score =   227 bits (578),  Expect(2) = 1e-136, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 152/203 (75%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             ++L + ++I I HWVYRWRNP C G LPPGSMGFP++GE++QFF+ ++  GIPPFI+QR
Sbjct  3    ALFLGALVIIGITHWVYRWRNPSCNGKLPPGSMGFPLLGETLQFFSPNTNSGIPPFIKQR  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +F+T++VG+ V+VSTD ++NHFIFQQEG++   WY ++  +I G Q     HG 
Sbjct  63   MKRYGPIFKTNLVGRPVVVSTDPDLNHFIFQQEGQVFQSWYPDTFTEIFGRQNVGSLHGF  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ LNL GPE+LK+ +L E++QT  + L+ W+  +++++K+AT  M+F L A K
Sbjct  123  MYKYLKNMVLNLFGPESLKK-MLPELEQTTCRTLEQWSCENSVELKEATARMIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SYD  K+ E LR+ + AF++G
Sbjct  182  LISYDSTKSSENLRENFVAFIQG  204



>emb|CDP18909.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   276 bits (706),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 180/252 (71%), Gaps = 6/252 (2%)
 Frame = +3

Query  612   FHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVIC  785
             FH   +GRK  +K+I +   ++RS        KDF+D+LL +++KE+T L E+IA D++ 
Sbjct  219   FHACLQGRKKAMKVIHDIFEKKRSG---NDTSKDFVDHLLEQIEKEDTILNEEIARDLVF  275

Query  786   MLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFT  965
             + +FAA+ETTS+A T+AL++L+ HP V+ +L+ EHE I+  RE + S+I+W EY+SM FT
Sbjct  276   LFLFAAHETTSTALTVALRYLDGHPRVMAELKREHENILKMRETEGSAISWKEYKSMTFT  335

Query  966   HMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNP  1145
             HMVINET+RLA+I P I RKVV++ E+KGYTIP GW  M+CPS+VHL    Y++P  FNP
Sbjct  336   HMVINETLRLANITPGILRKVVKEVEVKGYTIPAGWTVMVCPSTVHLDPNVYENPHEFNP  395

Query  1146  SRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKP  1325
              RW G+ELH  SK FMAF G  RLC GA++AK+ M+I LHYLVTKY W+V +    +R P
Sbjct  396   WRWEGKELHMGSKNFMAFAGGTRLCVGADYAKVQMSIFLHYLVTKYTWRVTNGAERIRTP  455

Query  1326  -GLTFLDGFKVQ  1358
              G+ +  G  ++
Sbjct  456   TGICYPKGLHME  467


 Score =   239 bits (610),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 144/200 (72%), Gaps = 1/200 (1%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTR  207
            +I+ +++  +HWVYRWRNPKC G+LPPGSMG PIIGE+IQ+FT ++   IPPF+Q+R  +
Sbjct  7    IIALIIVLFSHWVYRWRNPKCNGVLPPGSMGLPIIGETIQYFTPYASDDIPPFVQKRAAK  66

Query  208  YGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHK  387
            YG +FRTSIVG+ +IVSTD+++N+ +FQQEG     WYT+S  QI G Q  + HHGD HK
Sbjct  67   YGPIFRTSIVGEPIIVSTDADVNYRVFQQEGNAFQIWYTQSLFQIIGKQSVVAHHGDFHK  126

Query  388  YLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
            YL++L    V PE L++ L+ EMD++ ++ L  W+ L  LD K  T  ++FK AA K+L 
Sbjct  127  YLKSLTFKFVSPEALREKLIYEMDESTQESLRSWSKLGKLDAKDGTAELVFKYAAKKMLG  186

Query  568  YDEKKAME-LRKYYKAFMEG  624
            Y+E K  + LR  YKAFM+G
Sbjct  187  YEESKDQQKLRDSYKAFMDG  206



>ref|XP_011081025.1| PREDICTED: cytochrome P450 87A3-like [Sesamum indicum]
Length=473

 Score =   288 bits (738),  Expect(2) = 6e-136, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR     +K + DF DY+L E+ +E+T LTE IA+D++ +L+FA
Sbjct  224   QGRKKAMKMLKNMLQERRER--PRKVRTDFFDYVLEELQREDTLLTEAIALDLMFVLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA KFL +HP VLK+L EEHE II  RE+ +S +TW+EY+SM+FT   IN
Sbjct  282   SFETTSLALTLATKFLVEHPLVLKELTEEHEAIIKRRENPDSGLTWSEYKSMRFTFQFIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK +++ + KGYTIP GW  M+CP +VHL  +KY DPL+FNP RW G
Sbjct  342   ETVRLANIVPGIFRKAMRETKFKGYTIPAGWAIMVCPPAVHLDPKKYRDPLNFNPWRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              + + AS+ FMAFGG  R C G +F K+ MA+ LH LVTKYKWK +  G+I+R PGL F 
Sbjct  402   IDTNGASRNFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYKWKAIKGGDILRTPGLQFP  461

Query  1341  DGFKVQ  1358
             +GF V 
Sbjct  462   NGFHVH  467


 Score =   225 bits (573),  Expect(2) = 6e-136, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 155/203 (76%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
              Y+ + L+IAI +W+Y WRNP+C G+LPPGSMG+P+IGE++QFF  ++   IPPF++QR
Sbjct  5    AFYIGALLIIAITNWLYHWRNPRCNGVLPPGSMGWPLIGETLQFFAPNTSSDIPPFVKQR  64

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +F+TS+VG+ VIVSTD+++N+FIFQQEG+L   WY ++  +I G Q     HG 
Sbjct  65   MQRYGPVFKTSLVGRPVIVSTDADLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGF  124

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ LNL GPE+LK+ +L E++Q + ++L+ WT+ S +++K+AT  M+F+L A K
Sbjct  125  MYKYLKNMVLNLFGPESLKK-MLPEVEQASNRNLEKWTSQSIVEVKEATAKMIFELTAKK  183

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SYD +K+ E LR+ + AF++G
Sbjct  184  LISYDSEKSTENLRENFVAFIQG  206



>ref|XP_003538708.1| PREDICTED: cytochrome P450 87A3-like [Glycine max]
 gb|KHN35000.1| Cytochrome P450 87A3 [Glycine soja]
Length=477

 Score =   289 bits (740),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 178/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR    ++K++ DF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGRKRAMKMLKNMLQERRR--MQRKQQTDFFDYIVEELKKEGTILTEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+K L+ +P VLK+LQEEHE I+  RED  S ITW EY+SM FT   IN
Sbjct  280   SFETTSLALTYAIKLLSDNPLVLKRLQEEHEAILKQREDPNSGITWKEYKSMTFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK +++   KGYTIP GW  M+CP +VHL+ +KY DPL+FNP RW G
Sbjct  340   ETVRLANIVPGIFRKALREINFKGYTIPAGWAVMVCPPAVHLNPDKYQDPLAFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL  ASK FMAFGG  R C G +F K+ MA+ +H LVTKY+W+ +  GNI+R PGL F 
Sbjct  400   VELQGASKHFMAFGGGMRFCVGTDFTKVQMAMFIHSLVTKYRWRPIKGGNILRTPGLQFP  459

Query  1341  DGFKVQ  1358
             +GF VQ
Sbjct  460   NGFHVQ  465


 Score =   223 bits (569),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             + L + ++I I HWVYRWRNP C G LPPGSMGFP++GES+QFF+ ++  GIPPFI+QR
Sbjct  3    ALCLGALVIIGITHWVYRWRNPSCNGKLPPGSMGFPLLGESLQFFSPNTTSGIPPFIKQR  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +F+T++VG+ V+VSTD ++NHFIFQQEGK+   WY ++  +I G Q     HG 
Sbjct  63   MKRYGPIFKTNLVGRPVVVSTDPDLNHFIFQQEGKVFQSWYPDTFTEIFGKQNVGSLHGF  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ LNL G E+LK+ +L E++QT  + L+ W+   ++++K+AT  M+F L A K
Sbjct  123  MYKYLKNMVLNLFGHESLKK-MLPELEQTTCRTLEQWSCEDSVELKEATARMIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SYD  K+ E LR  + AF++G
Sbjct  182  LISYDSTKSSENLRDNFVAFIQG  204



>ref|XP_006358916.1| PREDICTED: cytochrome P450 87A3-like [Solanum tuberosum]
Length=482

 Score =   293 bits (749),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 178/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR+    +K+  DF DY+L E+ K +T LTE IA+D++ +L+FA
Sbjct  230   QGRKKAMKMLKTMLEERRAK--PRKEGTDFFDYVLEELQKNDTILTEAIALDLMFVLLFA  287

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA KFL+ HP  LK+L EEHE II +RE+  S +TW EY+SMKFT  VIN
Sbjct  288   SFETTSLAITLATKFLHDHPLALKELTEEHEAIIRSRENPASGLTWKEYKSMKFTFQVIN  347

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I PAIFRK ++D   KGYTIP GW  M+CP +VHL+  KY DPL FNP RW G
Sbjct  348   ETVRLANIVPAIFRKTLRDINFKGYTIPAGWAVMVCPPAVHLNPAKYQDPLDFNPWRWEG  407

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E++ A++ FMAFGG  R C G +F K+ MA+ LH LVTKY+W+ +  GN VR PGL F 
Sbjct  408   VEINGATRNFMAFGGGMRFCVGTDFTKVQMAVFLHSLVTKYRWQTIGGGNTVRTPGLQFP  467

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  468   NGYHVR  473


 Score =   219 bits (557),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 149/205 (73%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W ++  +SFL++ I HWVY WRNP+C G LPPGSMG+P++GE+IQFFT ++   I PF++
Sbjct  9    WTILIFLSFLILIIIHWVYNWRNPRCNGKLPPGSMGWPLLGETIQFFTPNTTSDIAPFVK  68

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +R+ RYG +FRTS+VG+ VIVSTD ++N+FIFQQEG+    WY ++  +I G Q     H
Sbjct  69   ERMKRYGPIFRTSVVGRPVIVSTDPDLNYFIFQQEGQSFQSWYPDTFTEIFGRQNVGSLH  128

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ LNL G E+LK+ +L E+++ A+  L  W+  +++++K+AT  M+F L A
Sbjct  129  GFMYKYLKNMVLNLFGSESLKK-MLPEVEEVAKNKLKRWSGQTSVEMKEATANMIFDLTA  187

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++SYD + + E LR+ + AF++G
Sbjct  188  KKLISYDSETSSENLRESFVAFIQG  212



>ref|XP_007038615.1| Cytochrome P450, family 87, subfamily A, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOY23116.1| Cytochrome P450, family 87, subfamily A, polypeptide 2, putative 
[Theobroma cacao]
Length=480

 Score =   295 bits (754),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 184/246 (75%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR   +K+IK  L ERR+S   K+++KDFLD ++ E+ K ET L+E+ A+D++  L FA
Sbjct  224   QGRNKAMKVIKSMLEERRAS--PKRQQKDFLDIVVEEMKKAETILSEQTALDLLFALPFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A+E+ SSA  LAL++L  +P  L +L +EHE I+  RE K+S ITW EY+SM FTHMVIN
Sbjct  282   AFESASSAVVLALQYLRNNPLALAELTQEHEAILTERETKDSGITWKEYKSMTFTHMVIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+RL +I PAIFRKVV+D E+KGYTIP GW+ + C  +VHL++E Y+DPLSFNP RW G
Sbjct  342   ETIRLGNIVPAIFRKVVKDVEVKGYTIPAGWIILACTPAVHLNSEIYEDPLSFNPWRWKG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +EL+  SK FM FG   RLCAGAEF KL M+I LH+LVTKY+W V+ EG+  R+PGL F 
Sbjct  402   RELNAGSKFFMGFGSGVRLCAGAEFVKLQMSIFLHHLVTKYRWTVIKEGDAARQPGLVFP  461

Query  1341  DGFKVQ  1358
             +GF VQ
Sbjct  462   EGFHVQ  467


 Score =   216 bits (551),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 138/202 (68%), Gaps = 1/202 (0%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            +  I+ + + IA W+Y WRNP+C G LPPGSMG PI+GES QFF+ ++   + PFI++R+
Sbjct  5    LLCIAVIFLGIALWIYNWRNPRCNGKLPPGSMGLPIVGESFQFFSPYTTSDVSPFIKKRM  64

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYGSLFRTS+VG+K++VSTD E+N FIFQQEG+LV  WY +S   I G +  +  HG  
Sbjct  65   DRYGSLFRTSLVGRKIVVSTDPEVNRFIFQQEGRLVQTWYMDSFDDIVGKENILSSHGFL  124

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            HKYLRNL LNL G ++LK+ LL+E ++   ++L  W+    +++KQA   M++     K+
Sbjct  125  HKYLRNLILNLFGSKSLKERLLSETEELTVKNLQLWSCEPGVELKQAMATMIYNFTVKKL  184

Query  562  LSY-DEKKAMELRKYYKAFMEG  624
             S  D + A +LR  Y AF++G
Sbjct  185  FSCNDPRSAKKLRACYSAFLDG  206



>ref|XP_011033792.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=481

 Score =   298 bits (762),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 139/246 (57%), Positives = 184/246 (75%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K    ERR++   +K + DF DY+L E+ ++   LTE+IA+D++ +L+FA
Sbjct  222   QGRKKAMKMLKNQQQERRAN--PRKYRSDFFDYVLEELQEDRGILTEEIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ +P VLK+L EEHE I+  R +  S +TWNEY+SMKFT  VIN
Sbjct  280   SFETTSLALTLAVKFLSDNPLVLKKLTEEHEGILRNRVNSNSGLTWNEYKSMKFTFQVIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK ++D + KGYTIP GW  M+CP +VHLS EKY+DPL+FNP RW G
Sbjct  340   ETVRLANIVPGIFRKALRDIQFKGYTIPEGWAVMVCPPAVHLSPEKYEDPLAFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+ ASKKFMAFGG  R C G EF K+ MA+ LH LVTK++W+V+  GNIVR PGL F 
Sbjct  400   LELNGASKKFMAFGGGMRFCVGTEFTKVQMAVFLHCLVTKFRWQVIKGGNIVRTPGLQFP  459

Query  1341  DGFKVQ  1358
              G+ +Q
Sbjct  460   SGYHIQ  465


 Score =   213 bits (542),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 145/203 (71%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             ++  + ++I+I HWV+RWRNP+C G LPPGSMG P+IGE++QFF  ++   IPPF+++R
Sbjct  3    ALFFGALIIISITHWVHRWRNPRCNGTLPPGSMGLPLIGETLQFFAPNTSFDIPPFVKER  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +FRT++VG+ V+VSTD ++N+FIFQQEG+L   WY ++  +I G Q     HG 
Sbjct  63   MKRYGPIFRTNLVGRPVVVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGF  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ LNL GPE+LK+ +L E++QT  + L  W+   ++++K+ T  M+F L A K
Sbjct  123  MYKYLKNMVLNLFGPESLKK-MLPEVEQTTSKRLQLWSHQESVELKETTATMIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SYD+  + E LR  + AF+ G
Sbjct  182  LISYDQDNSSENLRDNFVAFIHG  204



>ref|XP_008238815.1| PREDICTED: cytochrome P450 87A3-like isoform X2 [Prunus mume]
Length=483

 Score =   291 bits (745),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN ++++K  L ERR+  +K+    DF DY+L E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGRKNAMRMLKNMLQERRAESRKQPV--DFFDYVLEELKKEGTILTEGIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ HP VLKQL +EHE II  RE  +S +TW EY+SM FT   IN
Sbjct  280   SFETTSLAITLAMKFLSDHPLVLKQLTKEHEMIIKQREIADSGLTWKEYKSMTFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK V++   KGYTIP GW  M+CP +VHL+  KY+DP++FNP RW G
Sbjct  340   ETVRLANIVPGIFRKAVREINFKGYTIPAGWAVMVCPPAVHLNPGKYEDPVAFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+  ASK FMAFGG  R C G +F K+ MA+ LH LVTKY+W+ +  G+IVR PGL F 
Sbjct  400   VEVSSASKHFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYRWEAIKGGDIVRTPGLQFP  459

Query  1341  DGFKVQ  1358
             +GF V+
Sbjct  460   NGFHVK  465


 Score =   219 bits (559),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 145/203 (71%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             + L + L+I+I HWVYRWRNP+C G LPPGSMG P++GE++QFFT ++   IPPFI++R
Sbjct  3    ALCLAALLIISITHWVYRWRNPRCHGKLPPGSMGLPLLGETLQFFTPNTSSDIPPFIKKR  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +FRT++VG+ VI+STD ++N+F+FQQEGKL   WY ++  +I G Q     HG 
Sbjct  63   MKRYGPIFRTNLVGRPVIISTDPDLNYFVFQQEGKLFQSWYPDTFTEIFGKQNVGSLHGI  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ L+L GPENLK+ ++ E++Q A   L  W+     ++K AT  M+F L A K
Sbjct  123  MYKYLKNMVLHLFGPENLKK-MIPEVEQAALSRLQQWSCQDITELKDATASMIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SYD  K+ E LR+ + AF++G
Sbjct  182  LISYDSNKSSENLRENFVAFIQG  204



>ref|XP_002299557.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE84362.1| cytochrome P450 family protein [Populus trichocarpa]
Length=477

 Score =   292 bits (747),  Expect(2) = 9e-135, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 181/246 (74%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  ++++K  L ER+++   +K + DF DY+L E+ K +T LTE+IA+D++ +L+FA
Sbjct  222   QGRKKAMRMLKNLLQERQAN--PRKHETDFFDYVLEELQKNKTILTEEIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS   TLA+KF++ HP VLK+L EEHE I+  RE+  S +TW EY+SMKFT  VIN
Sbjct  280   SFETTSLGLTLAVKFISDHPLVLKELTEEHEGILKNRENANSGLTWKEYKSMKFTFQVIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK ++D + KGYTIP GW  M+CP +VHL+  KY+DPL+FNP RW G
Sbjct  340   ETVRLANIVPGIFRKTLRDIQFKGYTIPAGWAVMVCPPAVHLNPAKYEDPLAFNPWRWKG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E++ ASK FMAFGG  R C G EF K+ MA+ LH LVTK +W+ +  GNIVR PGL F 
Sbjct  400   MEVNGASKTFMAFGGGMRFCVGTEFTKVQMAVFLHCLVTKSRWQAIKGGNIVRTPGLQFP  459

Query  1341  DGFKVQ  1358
              G+ +Q
Sbjct  460   SGYHIQ  465


 Score =   218 bits (554),  Expect(2) = 9e-135, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 147/203 (72%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             ++  + ++I+I HWVYRWRNP+C G LPPGSMG P+IGE++QFF  ++   I PF++ R
Sbjct  3    ALFFGALIIISITHWVYRWRNPRCNGTLPPGSMGLPLIGETLQFFAPNTSCDISPFVRDR  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +FRT++VG+ V+VSTD ++N+FIFQQEGKL   WY ++  +I G Q     HG 
Sbjct  63   MKRYGPIFRTNLVGRPVVVSTDPDLNYFIFQQEGKLFQSWYPDTFTEIFGRQNVGSLHGF  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ LNL GPE+LK+ +L E++QTA   L  W+   ++++K+AT  M+F L A K
Sbjct  123  MYKYLKNMVLNLFGPESLKK-MLPEVEQTASNRLQLWSHQESVELKEATATMIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SYD++ + E LR+ + AF++G
Sbjct  182  LISYDQENSSENLRENFVAFIQG  204



>ref|XP_006477592.1| PREDICTED: cytochrome P450 87A3-like [Citrus sinensis]
 gb|KDO63547.1| hypothetical protein CISIN_1g040767mg [Citrus sinensis]
Length=476

 Score =   288 bits (736),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 180/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K +K  L ERR++   +K++ DF DY+L E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGRERAMKKLKNLLQERRAN--PRKEQSDFYDYVLKELQKEGTILTEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+++P VLKQL EEHE I+  RE+  S +TW EY+SM +T   IN
Sbjct  280   SFETTSVAITLAIKFLSENPLVLKQLTEEHEAILKNRENVHSGLTWREYKSMTYTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I P IFRK ++D + KGYTIP GW  M+CP +VHL+  KY+DPL+FNPSRW G
Sbjct  340   ETARLANIVPGIFRKALRDIQFKGYTIPAGWAVMVCPPAVHLNPSKYEDPLAFNPSRWKG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E + ASK FMAFGG  R C G +F K+ MA+ LH  +TKY+W+ +  GNIVR PG+ F 
Sbjct  400   METNCASKNFMAFGGGMRFCVGTDFTKVQMAVFLHCFLTKYRWQAIRGGNIVRTPGIQFP  459

Query  1341  DGFKVQ  1358
             +GF V+
Sbjct  460   NGFHVR  465


 Score =   220 bits (561),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 145/198 (73%), Gaps = 2/198 (1%)
 Frame = +1

Query  34   SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            + + ++I HW+YRWRNP+C G LPPGSMG P++GE++QFF  ++   IPPFI+ R+  YG
Sbjct  8    ALVFVSITHWLYRWRNPRCNGKLPPGSMGLPLLGETLQFFAPNTSSDIPPFIKNRMKSYG  67

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYL  393
             +FRTS+VG+ VI+STD ++N+FIFQQEG+L   WY ++  +I G Q     HG  ++YL
Sbjct  68   PIFRTSLVGRPVIISTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGFMYRYL  127

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD  573
            +N+ LNL GPE+L++ +L E++Q AR  L  W++   +++K+AT  M+F L A K++SYD
Sbjct  128  KNMVLNLFGPESLRK-MLPEVEQVARARLQQWSSQDTVELKEATATMIFDLTAKKLISYD  186

Query  574  EKKAME-LRKYYKAFMEG  624
            ++K+ E LR+ + AFMEG
Sbjct  187  QEKSSENLRENFVAFMEG  204



>ref|XP_002510826.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51428.1| cytochrome P450, putative [Ricinus communis]
Length=473

 Score =   296 bits (758),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 187/246 (76%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  + ++K  L ERR++   K++KKDFLD ++ E  K+ +FLTEK+ +D++ ML FA
Sbjct  224   QGRKEAMGILKSMLEERRTA--PKREKKDFLDVMVEETKKDGSFLTEKMVLDLLFMLPFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +E+TSS   LA+KFL ++P  L+ L +EHE I++ R+  +S ITW EYRSM FTHMVIN
Sbjct  282   FFESTSSTMVLAVKFLVENPEALEDLTKEHEAILSNRKTNDSEITWEEYRSMTFTHMVIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I P IFRK V+D +IKGYTIP GWM + CP++VHL+  KY DPL+FNP RW G
Sbjct  342   ETTRLANIVPGIFRKAVKDVQIKGYTIPAGWMVVACPTTVHLNPVKYSDPLAFNPWRWQG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +ELH  SK +MAFGG  RLCAGA+F KL MAI LHYLVTKY+W V+ +G++++KPG+ F 
Sbjct  402   EELHSGSKNYMAFGGGVRLCAGADFVKLQMAIFLHYLVTKYRWSVI-KGHVLKKPGVVFP  460

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  461   DGFHIQ  466


 Score =   211 bits (538),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 137/196 (70%), Gaps = 1/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            L++ +AHW+Y WRNPKC G LPPGSMGFPIIGE++Q+F   +   IPPF+++R+ RYGSL
Sbjct  11   LLLCLAHWIYTWRNPKCNGKLPPGSMGFPIIGETVQYFIPCTNLDIPPFLRERMERYGSL  70

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TSIVG K++VSTD EINHFIFQ+EGK    WY +S   I G        G  HKY+RN
Sbjct  71   FKTSIVGYKIVVSTDPEINHFIFQEEGKSFISWYVDSFTDIFGKDNSFFLQGFVHKYVRN  130

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            L LN VG ++LK+ +L ++++   +HL  W++   +++K+A   M+F  +A  + S +E 
Sbjct  131  LTLNFVGVQSLKERVLPQVEKLTCKHLQSWSSQGTVELKEAISTMIFNFSAEMLFSSNET  190

Query  580  KA-MELRKYYKAFMEG  624
            ++  +LRK Y AF++G
Sbjct  191  ESTTKLRKSYAAFLDG  206



>ref|XP_006440550.1| hypothetical protein CICLE_v10023269mg [Citrus clementina]
 gb|ESR53790.1| hypothetical protein CICLE_v10023269mg [Citrus clementina]
Length=476

 Score =   287 bits (735),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 180/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K +K  L ERR++   +K++ DF DY+L E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGRERAMKKLKNLLQERRAN--PRKEQSDFYDYVLKELQKEGTILTEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+++P VLKQL EEHE I+  RE+  S +TW EY+SM +T   IN
Sbjct  280   SFETTSVAITLAIKFLSENPLVLKQLTEEHEAILKNRENVHSGLTWREYKSMTYTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I P IFRK ++D + KGYTIP GW  M+CP +VHL+  KY+DPL+FNPSRW G
Sbjct  340   ETARLANIVPGIFRKALRDIQFKGYTIPAGWAVMVCPPAVHLNPAKYEDPLAFNPSRWKG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E + ASK FMAFGG  R C G +F K+ MA+ LH  +TKY+W+ +  GNIVR PG+ F 
Sbjct  400   METNCASKNFMAFGGGMRFCVGTDFTKVQMAVFLHCFLTKYRWQAIRGGNIVRTPGIQFP  459

Query  1341  DGFKVQ  1358
             +GF V+
Sbjct  460   NGFHVR  465


 Score =   219 bits (557),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 144/198 (73%), Gaps = 2/198 (1%)
 Frame = +1

Query  34   SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            + + ++I HW+YRWRNP+C G LPPGSMG P++GE++QFF  ++   IPPFI+ R+  YG
Sbjct  8    ALVFVSITHWLYRWRNPRCNGKLPPGSMGLPLLGETLQFFAPNTSSDIPPFIKNRMKSYG  67

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYL  393
             +FRTS+VG+ VI+STD ++N+FIFQQEG+    WY ++  +I G Q     HG  ++YL
Sbjct  68   PIFRTSLVGRPVIISTDPDLNYFIFQQEGQFFQSWYPDTFTEIFGRQNVGSLHGFMYRYL  127

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD  573
            +N+ LNL GPE+L++ +L E++Q AR  L  W++   +++K+AT  M+F L A K++SYD
Sbjct  128  KNMVLNLFGPESLRK-MLPEVEQVARARLQQWSSQDTVELKEATATMIFDLTAKKLISYD  186

Query  574  EKKAME-LRKYYKAFMEG  624
            ++K+ E LR+ + AFMEG
Sbjct  187  QEKSSENLRENFVAFMEG  204



>ref|XP_007040135.1| Cytochrome P450, family 87, subfamily A, polypeptide 2 [Theobroma 
cacao]
 gb|EOY24636.1| Cytochrome P450, family 87, subfamily A, polypeptide 2 [Theobroma 
cacao]
Length=481

 Score =   293 bits (751),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +K++K  LNERR+     K + DF DY+L E+ KE T L+E IA+D++ +L+FA
Sbjct  222   QGRRNAMKMLKNLLNERRA--MPGKNRSDFFDYVLEELQKEGTILSEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED +S +TW EY+SM +T   IN
Sbjct  280   SFETTSLALTLAVKFLSDDPSVLKKLTEEHETILRNREDPDSGLTWKEYKSMTYTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK +++ +  GYTIP GW  M+CP +VHL+A KY DP +FNPSRW G
Sbjct  340   ETVRLANIVPGIFRKALREIQFNGYTIPAGWAVMVCPPAVHLNAAKYRDPHAFNPSRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E + ASK FMAFGG  R C G +F K+ MA+ LH LVTKY+W+ +  GNI+R PGL F 
Sbjct  400   VETNGASKNFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYRWQPIKGGNILRTPGLQFP  459

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  460   DGFHIQ  465


 Score =   212 bits (540),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 146/204 (72%), Gaps = 2/204 (1%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            L +++ + LVI I HW Y WRNP+C G LPPGSMGFP++GE++QFF   +   I PF+++
Sbjct  2    LALFIGALLVICITHWFYNWRNPRCNGKLPPGSMGFPLLGETLQFFGPSTTSDIHPFVKE  61

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+ R+G +F+TS+VG+ VIVSTD ++NHF+F QEG+L   WY ++  +I G Q     HG
Sbjct  62   RMKRHGPIFKTSLVGRSVIVSTDPDLNHFVFLQEGQLFQSWYPDTFTEIFGRQNVGSLHG  121

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              +KYL+N+ LNL GPE+LK+ +L E+++TA + L  W++   +++K+AT  M+F L A 
Sbjct  122  FMYKYLKNMVLNLFGPESLKK-MLPEVERTACRRLQRWSSQETVELKEATASMIFDLTAK  180

Query  556  KVLSYDEKKAME-LRKYYKAFMEG  624
            K++SYD+  + E LR+ + AF++G
Sbjct  181  KLISYDQDNSSENLRENFVAFIQG  204



>ref|XP_011029202.1| PREDICTED: cytochrome P450 87A3 [Populus euphratica]
Length=477

 Score =   290 bits (743),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 182/246 (74%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  ++++K  L ERR++   +K + DF DY+L E+ K +T LTE+IA+D++ +L+FA
Sbjct  222   QGRKKAMRMLKNLLQERRAN--PRKHETDFFDYVLEELQKNKTILTEEIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KF++ HP VL++L EEH+ I+  RE+  S +TW EY+SMKFT  VIN
Sbjct  280   SFETTSLALTLAVKFISDHPLVLQKLTEEHDGILKNRENANSGLTWKEYKSMKFTFQVIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK ++D + KGYTIP GW  M+CP +VHL+  KY+DPL+FNP RW G
Sbjct  340   ETVRLANIVPGIFRKTLRDIQFKGYTIPAGWAVMVCPPAVHLNPAKYEDPLAFNPWRWKG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E++ ASK FMAFGG  R C G +F K+ MA+ LH LVTK +W+ +  GNIVR PGL F 
Sbjct  400   MEVNGASKTFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKCRWQAIKGGNIVRTPGLQFP  459

Query  1341  DGFKVQ  1358
              G+ +Q
Sbjct  460   SGYHIQ  465


 Score =   215 bits (547),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             +++ + ++I+I HWVYRWRNP+C G LPPGSMG P+IGE++QFF  ++   I PF++ R
Sbjct  3    ALFVGALIIISITHWVYRWRNPRCNGTLPPGSMGLPLIGETLQFFAPNTSCDISPFVRDR  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +FRT++VG+ V+VSTD ++N+FIFQQEG+L   WY ++  +I G Q     HG 
Sbjct  63   MKRYGPIFRTNLVGRPVVVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGF  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ LNL GPE+LK+ +L E++QTA + L  W+   ++++K+AT  ++F L A K
Sbjct  123  MYKYLKNMVLNLFGPESLKK-MLPEVEQTASKRLQLWSHQESVELKEATATVIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SYD++ + E LR+ + AF++G
Sbjct  182  LISYDQENSSENLRENFVAFIQG  204



>ref|XP_006857880.1| hypothetical protein AMTR_s00069p00107680 [Amborella trichopoda]
 gb|ERN19347.1| hypothetical protein AMTR_s00069p00107680 [Amborella trichopoda]
Length=473

 Score =   276 bits (706),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 176/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K++K+ L ERR     +K   DF DY+L E+ KE + LTE+IA+D++ +L+FA
Sbjct  225   QGRQKAMKMLKKMLEERRRE--PEKAHGDFFDYVLGELKKERSVLTEEIALDLMFVLLFA  282

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ HP VL++L +EHE I   RE++ S +TW EY+SM FT  VIN
Sbjct  283   SFETTSLALTLAVKFLSDHPKVLEELTKEHEAIRRNRENQCSGLTWKEYKSMIFTSQVIN  342

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK +++ E KG+TIP GW  M CP +VHL+   Y +PL+FNP RW G
Sbjct  343   ETVRLANIVPGIFRKALKEIEFKGHTIPAGWAVMACPPAVHLNPSMYPNPLAFNPWRWGG  402

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E +  SK FMAFGG  R C G +F K+ MA+ LH LVT+Y+WK +  G+IVR PGL F 
Sbjct  403   VESNGGSKNFMAFGGGLRFCVGTDFTKIQMAVFLHCLVTRYRWKPIKGGDIVRTPGLQFP  462

Query  1341  DGFKVQ  1358
             +GF +Q
Sbjct  463   NGFHIQ  468


 Score =   228 bits (582),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 147/204 (72%), Gaps = 1/204 (0%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            L + + + + I + +WVYRWRNPKC G LPPGSMGFP+IGE++QFF+ ++   IPPFI+Q
Sbjct  4    LSLCIATLVAIWVTYWVYRWRNPKCNGKLPPGSMGFPLIGETLQFFSPNTTSDIPPFIRQ  63

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+ RYG +FRTS+V + VIVSTD E+NH IFQQEGKL   WY ++  +I G Q     HG
Sbjct  64   RMNRYGPVFRTSLVSRPVIVSTDPELNHLIFQQEGKLFQSWYPDTFTEIFGRQNVGSLHG  123

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              +KYL++L LNL GPE+LK+ LL E++  A ++L  W   S++D+K+AT  M+F L A 
Sbjct  124  FMYKYLKSLVLNLFGPESLKEKLLPELELAASRNLQTWATQSSIDLKEATATMIFNLTAK  183

Query  556  KVLSYDEKKAME-LRKYYKAFMEG  624
            K++SYD  K+ E L+K + AF++G
Sbjct  184  KLISYDPTKSSENLQKNFVAFVDG  207



>ref|XP_007211052.1| hypothetical protein PRUPE_ppa018745mg [Prunus persica]
 gb|EMJ12251.1| hypothetical protein PRUPE_ppa018745mg [Prunus persica]
Length=462

 Score =   287 bits (735),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 174/239 (73%), Gaps = 2/239 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN ++++K  L ERR+  +K+    DF DY+L E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGRKNAMRMLKNMLQERRAESRKQPV--DFFDYVLEELKKEGTILTEGIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ HP VLKQL EEHE II  RE  +S +TW EY+SM FT   IN
Sbjct  280   SFETTSLAITLAMKFLSDHPLVLKQLTEEHEMIIKQREIADSGLTWKEYKSMTFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK V++   KGYTIP GW  M+CP +VHL+  KY+DP++FNP RW G
Sbjct  340   ETVRLANIVPGIFRKAVREINFKGYTIPAGWAVMVCPPAVHLNPAKYEDPVAFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
              E+  ASK FMAFGG  R C G +F K+ MA+ LH LVTKY+W+ +  G+IVR PGL F
Sbjct  400   VEVSSASKHFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYRWEAIKGGDIVRTPGLQF  458


 Score =   217 bits (553),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 144/203 (71%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             + L + L+I+I HWVYRWRNP+C G LPPGSMG P++GE++QFFT ++   IPPFI++R
Sbjct  3    ALCLAALLIISITHWVYRWRNPRCHGKLPPGSMGLPLLGETLQFFTPNTSSDIPPFIKKR  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +FRT++VG+ VI+STD ++N+F+FQQEG L   WY ++  +I G Q     HG 
Sbjct  63   MKRYGPIFRTNLVGRPVIISTDPDLNYFVFQQEGNLFQSWYPDTFTEIFGKQNVGSLHGV  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ L+L GPENLK+ ++ E++Q A   L  W+     ++K AT  M+F L A K
Sbjct  123  MYKYLKNMVLHLFGPENLKK-MIPEVEQAALSRLQQWSYQDITELKDATASMIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SYD  K+ E LR+ + AF++G
Sbjct  182  LISYDSNKSSENLRENFVAFIQG  204



>ref|XP_008238814.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Prunus mume]
Length=489

 Score =   291 bits (744),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN ++++K  L ERR+  +K+    DF DY+L E+ KE T LTE IA+D++ +L+FA
Sbjct  228   QGRKNAMRMLKNMLQERRAESRKQPV--DFFDYVLEELKKEGTILTEGIALDLMFVLLFA  285

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ HP VLKQL +EHE II  RE  +S +TW EY+SM FT   IN
Sbjct  286   SFETTSLAITLAMKFLSDHPLVLKQLTKEHEMIIKQREIADSGLTWKEYKSMTFTFQFIN  345

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK V++   KGYTIP GW  M+CP +VHL+  KY+DP++FNP RW G
Sbjct  346   ETVRLANIVPGIFRKAVREINFKGYTIPAGWAVMVCPPAVHLNPGKYEDPVAFNPWRWEG  405

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+  ASK FMAFGG  R C G +F K+ MA+ LH LVTKY+W+ +  G+IVR PGL F 
Sbjct  406   VEVSSASKHFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYRWEAIKGGDIVRTPGLQFP  465

Query  1341  DGFKVQ  1358
             +GF V+
Sbjct  466   NGFHVK  471


 Score =   213 bits (543),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 145/209 (69%), Gaps = 8/209 (4%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             + L + L+I+I HWVYRWRNP+C G LPPGSMG P++GE++QFFT ++   IPPFI++R
Sbjct  3    ALCLAALLIISITHWVYRWRNPRCHGKLPPGSMGLPLLGETLQFFTPNTSSDIPPFIKKR  62

Query  199  ------VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGF  360
                  + RYG +FRT++VG+ VI+STD ++N+F+FQQEGKL   WY ++  +I G Q  
Sbjct  63   MKRHFGLCRYGPIFRTNLVGRPVIISTDPDLNYFVFQQEGKLFQSWYPDTFTEIFGKQNV  122

Query  361  MVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLF  540
               HG  +KYL+N+ L+L GPENLK+ ++ E++Q A   L  W+     ++K AT  M+F
Sbjct  123  GSLHGIMYKYLKNMVLHLFGPENLKK-MIPEVEQAALSRLQQWSCQDITELKDATASMIF  181

Query  541  KLAASKVLSYDEKKAME-LRKYYKAFMEG  624
             L A K++SYD  K+ E LR+ + AF++G
Sbjct  182  DLTAKKLISYDSNKSSENLRENFVAFIQG  210



>ref|XP_009782612.1| PREDICTED: cytochrome P450 87A3 [Nicotiana sylvestris]
Length=476

 Score =   288 bits (738),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR+    +K++ DF DY+L E+ +++T LTE IA+D++ +L+FA
Sbjct  224   QGRKKAMKMLKTLLEERRAK--PRKEQSDFFDYVLEELQRKDTILTEAIALDLMFVLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA KFL+ HP  LK+L EEHE II  RE+  S +TW EY+SMKFT  VIN
Sbjct  282   SFETTSLAITLATKFLHDHPLALKELTEEHEAIIRRRENPASGLTWKEYKSMKFTFQVIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I PAIFRK ++D   KGYTIP GW  M+CP +VHL+  KY DPL FNP RW G
Sbjct  342   ETVRLANIVPAIFRKALRDVNFKGYTIPAGWAIMVCPPAVHLNPAKYQDPLEFNPWRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+ AS+ FMAFGG  R C G +F K+ MA+ LH LVTKY+W+ +  G+ +R PGL F 
Sbjct  402   VELNGASRNFMAFGGGMRFCVGTDFTKVQMAVFLHSLVTKYRWETIQGGDTLRTPGLQFP  461

Query  1341  DGFKVQ  1358
             +G+ ++
Sbjct  462   NGYHIR  467


 Score =   215 bits (547),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 145/198 (73%), Gaps = 2/198 (1%)
 Frame = +1

Query  34   SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            +FL+I I HWVY WRNP+C G LPPGSMG+P++GE+IQFF  ++   I PF++ R+ RYG
Sbjct  10   AFLLIIIIHWVYNWRNPRCNGKLPPGSMGWPLLGETIQFFAPNTSSDIAPFVKDRMQRYG  69

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYL  393
             +FRTS+VG+ VIVSTD ++N+FIFQQEG+L   WY ++  +I G Q     HG  +KYL
Sbjct  70   PIFRTSVVGRPVIVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGFMYKYL  129

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD  573
            +N+ LNL GPE+LK+ ++ E+++ A+  L  W+  +++++K+AT  M+F L A K++SYD
Sbjct  130  KNMVLNLFGPESLKK-MMPEVEEAAKNKLKRWSGQTSVEMKEATANMIFDLTAKKLISYD  188

Query  574  EKKAME-LRKYYKAFMEG  624
             + + E LR+ + AF++G
Sbjct  189  SENSSENLRESFVAFIQG  206



>ref|XP_004246127.1| PREDICTED: cytochrome P450 87A3-like [Solanum lycopersicum]
Length=476

 Score =   290 bits (742),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 176/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR+    +K+  DF DY+L E+ K +  LTE IA+D++ +L+FA
Sbjct  224   QGRKKAMKMLKTMLEERRAK--PRKEGTDFFDYVLEELQKNDIILTEAIALDLMFVLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA KFL+ HP  LK+L EEHE II +RE+  S +TW EY+SMKFT  VIN
Sbjct  282   SFETTSLAITLATKFLHDHPLALKELTEEHEAIIRSRENPASGLTWKEYKSMKFTFQVIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I PAIFRK + D   KGYTIP GW  M+CP +VHL+  KY DPL FNP RW G
Sbjct  342   ETVRLANIVPAIFRKTLTDINFKGYTIPAGWAVMVCPPAVHLNPAKYQDPLDFNPWRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E++ A++ FMAFGG  R C G +F K+ MA+ LH LVTKY+W+ +  GN VR PGL F 
Sbjct  402   VEINGATRNFMAFGGGMRFCVGTDFTKVQMAVFLHSLVTKYRWQTIGGGNTVRTPGLQFP  461

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  462   NGYHVR  467


 Score =   212 bits (540),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 147/202 (73%), Gaps = 2/202 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            M + +FL++ I HWVY WRNP+C G LPPGSMG+P++GE+IQFFT ++   I PF+++R+
Sbjct  6    MSIGAFLILIIIHWVYNWRNPRCNGKLPPGSMGWPLLGETIQFFTPNTTLDIAPFVKERM  65

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG +FRTS+VG+ VIVSTD ++N+FIFQQEG+    WY ++  +I G Q     HG  
Sbjct  66   KRYGPIFRTSVVGRPVIVSTDPDLNYFIFQQEGQSFQSWYPDTFTEIFGRQNVGSLHGFM  125

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            +KYL+N+ LNL G E+LK+ +L E+++ A+  L  W+  +++++K+AT  M+F L A K+
Sbjct  126  YKYLKNMVLNLFGSESLKK-MLPEVEEVAKNKLKRWSGQTSVEMKEATANMIFDLTAKKL  184

Query  562  LSYDEKKAME-LRKYYKAFMEG  624
            +SYD + + E LR+ + AF++G
Sbjct  185  ISYDSETSSENLRESFVAFIQG  206



>ref|XP_004511599.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Cicer arietinum]
Length=486

 Score =   286 bits (732),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 178/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR     +K++KDF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  223   QGRKRAMKMLKNMLQERRE--MPRKQQKDFFDYVIEELRKEGTLLTEAIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+K L+ +P VL QLQEE+E I+  R++  S +TW EY+SM FT  +I 
Sbjct  281   SFETTSLALTYAIKLLSDNPSVLNQLQEENEAILKRRKNPNSGVTWQEYKSMTFTFQLIT  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I P IFRK +++   KGYTIP GW  M+CP +VHL+  KY DPL+FNPSRW G
Sbjct  341   ETARLANIVPGIFRKALREVNFKGYTIPAGWAIMVCPPAVHLNPAKYQDPLAFNPSRWEG  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+ A+K FMAFGG  R C G +FAK+ MA+ LH LVTKY+W+ +  GNIVR PGL F 
Sbjct  401   MELNGATKHFMAFGGGMRFCVGTDFAKVQMAVFLHSLVTKYRWQPIKGGNIVRTPGLQFP  460

Query  1341  DGFKVQ  1358
             +GF VQ
Sbjct  461   NGFHVQ  466


 Score =   215 bits (548),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 148/204 (73%), Gaps = 3/204 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
            V+ L + ++I I HWVYRWRNP C G LPPGSMGFP++GE++QFF+ ++   IPPFI+QR
Sbjct  3    VLCLGALVIICITHWVYRWRNPSCNGKLPPGSMGFPLLGETLQFFSPNTSCDIPPFIKQR  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +F+TS+VG+ V+VSTD ++N+FIFQQEGK+   WY ++  +I G Q     HG 
Sbjct  63   MKRYGPIFKTSLVGRPVVVSTDPDLNYFIFQQEGKIFQSWYPDTFTEIFGKQNVGSLHGF  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSN-LDIKQATEIMLFKLAAS  555
             +KYL+N+ LNL GPE+LK+ +L+E+++ A   L   +   N +++K+AT  M+F L A 
Sbjct  123  MYKYLKNMVLNLFGPESLKK-MLSEVEEAACTTLQQLSCQENCVELKEATARMIFDLTAK  181

Query  556  KVLSYDEKKAME-LRKYYKAFMEG  624
            K++SYD  K+ E LR+ + AF++G
Sbjct  182  KLISYDSTKSSENLRENFVAFIQG  205



>ref|XP_009627452.1| PREDICTED: cytochrome P450 87A3 [Nicotiana tomentosiformis]
Length=476

 Score =   288 bits (736),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 180/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR+    +K++ DF DY+L E+ +++T LTE IA+D++ +L+FA
Sbjct  224   QGRKKAMKMLKTLLEERRAQ--PRKEQSDFFDYVLEELQRKDTILTEAIALDLMFVLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA KFL+ HP  LK+L EEHE II  RE+  S +TW EY+SMKFT  VIN
Sbjct  282   SFETTSLAITLATKFLHDHPLALKELTEEHEAIIRRRENPASGLTWKEYKSMKFTFQVIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I PAIFRK ++D   KGYTIP GW  M+CP +VHL+ +KY DPL FNP RW G
Sbjct  342   ETVRLANIVPAIFRKALRDVNFKGYTIPAGWAIMVCPPAVHLNPDKYQDPLEFNPWRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E++ AS+ FMAFGG  R C G +F K+ MA+ LH LVT+Y+W+ +  G+ +R PGL F 
Sbjct  402   VEINGASRNFMAFGGGMRFCVGTDFTKVQMAVFLHSLVTRYRWETIQGGDTLRTPGLQFP  461

Query  1341  DGFKVQ  1358
             +G+ ++
Sbjct  462   NGYHIR  467


 Score =   214 bits (544),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 144/198 (73%), Gaps = 2/198 (1%)
 Frame = +1

Query  34   SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            +FL+I I HWVY WRNP+C G LPPGSMG+P++GE+IQFF  ++   I PF++ R+ RYG
Sbjct  10   AFLLIIIIHWVYNWRNPRCNGKLPPGSMGWPLLGETIQFFAPNTSSDIAPFVKDRMQRYG  69

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYL  393
             +FRTS+VG+ VIVSTD ++N+FIFQQEG+L   WY ++  +I G Q     HG  +KYL
Sbjct  70   PIFRTSVVGRPVIVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGFMYKYL  129

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD  573
            +N+ LNL GPE+LK+ ++ E+++ A   L  W+  +++++K+AT  M+F L A K++SYD
Sbjct  130  KNMVLNLFGPESLKK-MMPEVEEAANNKLKRWSGQTSVEMKEATANMIFDLTAKKLISYD  188

Query  574  EKKAME-LRKYYKAFMEG  624
             + + E LR+ + AF++G
Sbjct  189  SENSSENLRESFVAFIQG  206



>ref|XP_004300758.1| PREDICTED: cytochrome P450 87A3-like [Fragaria vesca subsp. vesca]
Length=484

 Score =   285 bits (728),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 178/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN ++++   L ERR +   +K+  DF D++L E  KE T LTE I +D++ +L+FA
Sbjct  223   QGRKNAMRMLVNLLQERREN--PRKQPIDFFDHVLEEFKKEGTILTEPIFLDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ HP VLK+L EEHE I+  RE+ +S +TW EY+SM FT  +IN
Sbjct  281   SFETTSLALTLAIKFLSDHPAVLKKLTEEHEMILKQRENADSGLTWKEYKSMTFTFQIIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P +FRK  ++ + KG+TIP GW+ M+CP +VHL+ +KY DP++F+P RW G
Sbjct  341   ETVRLANIVPGVFRKAKREIQFKGHTIPAGWVVMVCPPAVHLNPQKYADPVAFSPERWEG  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E    SK FMAFGG  R C G +FAK+ MA+ LH LVTKY+W+ V  GNIVR PGL F 
Sbjct  401   METSSVSKNFMAFGGGMRFCVGTDFAKVQMAVFLHCLVTKYRWQAVRGGNIVRTPGLQFP  460

Query  1341  DGFKVQ  1358
             DGF ++
Sbjct  461   DGFHIR  466


 Score =   217 bits (552),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 148/205 (72%), Gaps = 3/205 (1%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            L + +++ +V++I HWVYRW+NPKC G LPPGSMG P+IGE++QFFT ++   IPPFI++
Sbjct  2    LALCIVALVVLSITHWVYRWKNPKCNGKLPPGSMGLPLIGETLQFFTPNTSSDIPPFIKK  61

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+ RYG +FRT++VG+ VIVSTD ++N+F+FQQEG L H  Y  S  +I G +     HG
Sbjct  62   RMERYGPIFRTNLVGRPVIVSTDPDLNYFVFQQEGNLFHSSYPYSFTEIFGRKNVGNLHG  121

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              +KYL+N+ L+L GPE+LK+ ++TE++Q A + L  W++   ++ K A+  ++F LAA 
Sbjct  122  IMYKYLKNIMLHLFGPESLKK-MITEIEQAALRRLQQWSSEDTIEFKDASASLIFDLAAK  180

Query  556  KVLSYDEKKAME--LRKYYKAFMEG  624
            K++SYD +K  E  LR  + AF++G
Sbjct  181  KLISYDSEKCSEKNLRNNFSAFIQG  205



>ref|XP_011022914.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=494

 Score =   292 bits (747),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 189/246 (77%), Gaps = 1/246 (0%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +++IK  L E R +  +K+++KDFLD ++ E+ K  + +TE +A+D++ +L+FA
Sbjct  231   QGRKKAVEIIKSIL-EERCATPRKRQEKDFLDLVIEEIKKNGSLMTEAMALDLLFVLVFA  289

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A+ETTS A TLA+K + +HP VL++L +EHE I+  R+  ES ITW EY+SM FTH VI+
Sbjct  290   AFETTSIALTLAVKNVCEHPKVLEELIKEHEAILRNRKIIESGITWQEYKSMTFTHAVIH  349

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRKV++D +IKGYTIP GW+ M+CP +VH++ ++YDDP +FNP RW G
Sbjct  350   ETVRLANIVPGIFRKVLKDVDIKGYTIPAGWIVMVCPPAVHMNPKQYDDPFTFNPWRWQG  409

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             Q LH  S+KFM FGG  RLCAGAEF+K+ MAI LH+LVTKY+W+V+  G+I+R P + F 
Sbjct  410   QVLHAGSQKFMGFGGGSRLCAGAEFSKMQMAIFLHHLVTKYRWRVIKGGDIIRIPAVIFP  469

Query  1341  DGFKVQ  1358
             +GF +Q
Sbjct  470   NGFHIQ  475


 Score =   209 bits (532),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 136/199 (68%), Gaps = 1/199 (1%)
 Frame = +1

Query  31   ISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRY  210
            +S +++ + HW+Y+WRNPKC G LPPGSMGFP++GE+IQFF  +    I PFI +++ RY
Sbjct  15   VSVVILCVTHWIYKWRNPKCNGKLPPGSMGFPLLGETIQFFAPYKANNISPFITKKMERY  74

Query  211  GSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKY  390
            GS+F+T +VG ++I+STD+  N FIFQQEGKL  C Y +S ++I G +  +   G  HKY
Sbjct  75   GSIFKTHLVGHRLIISTDAGFNSFIFQQEGKLFQCCYPKSFSEIAGRESIVSAGGFLHKY  134

Query  391  LRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSY  570
            LRNL +NLVG E++KQ LL ++++   +HL  W   +++++++A   M F   A  +LSY
Sbjct  135  LRNLVMNLVGNESMKQKLLPKVEKMVCEHLQSWCGQASIELREAVAKMAFSFGAKILLSY  194

Query  571  DEKKAME-LRKYYKAFMEG  624
             E K+ + LRK Y  F  G
Sbjct  195  SESKSSKNLRKAYADFQRG  213



>emb|CBI34719.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   286 bits (731),  Expect(2) = 5e-132, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  + ++K  L ERR+    +KK+ DF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  240   QGRKKAMSMLKNMLKERRA--MPRKKQSDFFDYVIEELKKEGTILTEAIALDLMFVLLFA  297

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA KFL+ HP VLK+L EEHE I+  RE  +S +TW EY+SM FT   IN
Sbjct  298   SFETTSLAITLATKFLSDHPLVLKKLTEEHEAILEKREIVDSELTWKEYKSMTFTFQFIN  357

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK +++ + KGYTIP GW  M+CP +VHL+  KY+DPL+FNP RW G
Sbjct  358   ETVRLANIVPGIFRKALREIQFKGYTIPAGWAIMVCPPAVHLNPAKYEDPLAFNPWRWEG  417

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E   ASK FMAFGG  R C G +F K+ MA+ LH LVTKY+W+ V  G+IVR PGL F 
Sbjct  418   VESSGASKHFMAFGGGMRFCVGTDFTKMQMAVFLHCLVTKYRWQTVRGGDIVRTPGLQFP  477

Query  1341  DGFKVQ  1358
             +GF VQ
Sbjct  478   NGFHVQ  483


 Score =   214 bits (546),  Expect(2) = 5e-132, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 150/209 (72%), Gaps = 2/209 (1%)
 Frame = +1

Query  1    SEMTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIP  180
            S+M  + + + +F++I I HW Y WRNPKC G LPPGSMG P++GE++QFF  ++   IP
Sbjct  15   SKMWPIALCIGTFVIIRIIHWGYSWRNPKCNGKLPPGSMGLPLLGETLQFFAPNTSSDIP  74

Query  181  PFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGF  360
            PFI++R+ RYG +FRT++VG+ V+VSTD ++N+FIFQQEG+L   WY ++  +I G Q  
Sbjct  75   PFIKERMERYGPIFRTNLVGRPVVVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNV  134

Query  361  MVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLF  540
               HG  +KYL+N+ LNL GPE+LK+ +L E++    ++LD W+    +++K+AT  M+F
Sbjct  135  GSLHGFMYKYLKNMVLNLFGPESLKK-MLPEVEHATCRNLDRWSCQDTVELKEATARMIF  193

Query  541  KLAASKVLSYDEKKAME-LRKYYKAFMEG  624
             L A K++SY++ K+ E LR+ + AF++G
Sbjct  194  DLTAKKLISYEQDKSSENLRENFVAFIQG  222



>ref|XP_010248255.1| PREDICTED: cytochrome P450 87A3 [Nelumbo nucifera]
Length=472

 Score =   276 bits (706),  Expect(2) = 5e-132, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 175/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +KL+K+ L ERR+    +K+  DF D ++ E++K+ T LTE IA+D++  L+FA
Sbjct  224   QGRKKAMKLLKDMLXERRA--MPZKRHGDFFDLVVEELEKQGTVLTESIALDLMFXLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TL +KFL+ HP VLK+L EEHE I+  +E+ +S +TW +Y+SM FT  VI 
Sbjct  282   SFETTSLALTLGMKFLSDHPSVLKRLTEEHEAILRRKENGDSGLTWKDYKSMTFTFQVIX  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E VRLA+I P IFRK + D   KGYTIP GW  ++CP +VHL+  KY+DP++FNP RW+G
Sbjct  342   EIVRLANIVPGIFRKALHDIHFKGYTIPAGWGVIVCPPAVHLNPAKYEDPVAFNPWRWDG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+ A+K FMAFGG  R C G +F K  MA+  H LVTKY+W  V  G+I+R PGL F 
Sbjct  402   VELNGATKHFMAFGGGMRXCXGTDFTKXQMAVFFHCLVTKYRWTAVSGGDILRTPGLXFP  461

Query  1341  DGFKVQ  1358
             +GF +Q
Sbjct  462   NGFHIQ  467


 Score =   224 bits (571),  Expect(2) = 5e-132, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 144/198 (73%), Gaps = 1/198 (1%)
 Frame = +1

Query  34   SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            +F++  I HWVY WRNP+C G LPPGSMG P++GE++QFF  ++   IPPFI++R+ +YG
Sbjct  9    AFIITCIMHWVYNWRNPRCNGKLPPGSMGLPLLGETLQFFAPNTSSDIPPFIKERMEKYG  68

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYL  393
             +FRTS+VG+ V++STDS++N+FIFQQEG+L   WY ++  +I G Q     HG  +KYL
Sbjct  69   PVFRTSLVGRPVVISTDSDLNYFIFQQEGRLFQSWYPDTFTEIFGRQNVGSLHGFMYKYL  128

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD  573
            +NL LNL GPENLK+ LL E+++ AR+ L  WT  + +++K+A   M+F L A K++ YD
Sbjct  129  KNLVLNLFGPENLKEKLLPEVEEAARKSLHLWTCQNTVELKEAISTMIFNLTAKKLIXYD  188

Query  574  EKKAME-LRKYYKAFMEG  624
              K+ E LR+ + AF++G
Sbjct  189  ATKSTENLRENFVAFIKG  206



>ref|XP_007210081.1| hypothetical protein PRUPE_ppa019666mg [Prunus persica]
 gb|EMJ11280.1| hypothetical protein PRUPE_ppa019666mg [Prunus persica]
Length=480

 Score =   288 bits (737),  Expect(2) = 9e-132, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 181/246 (74%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR   I ++K+ L ERR   + +    DF DY++ E++KE T LTE+I++D++ +L+FA
Sbjct  222   QGRNRAIGMLKDMLRERRGKSQDQPN--DFFDYVIEELEKEGTILTEEISLDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ HP VLKQL EEHE I+  R++ +S +TW EY+SM FT   IN
Sbjct  280   SFETTSIAMTLAIKFLSDHPLVLKQLTEEHEMILKQRKNADSGLTWKEYKSMTFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRL +IAP IFRK +++   KGYTIP GW  M+  ++VHL+ E YDDP++FNP RW G
Sbjct  340   ETVRLGNIAPCIFRKALKEINFKGYTIPAGWGVMVSNTTVHLNPEIYDDPVAFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E + ASK FMAFGG QRLC GA+FAK+ MA+ LH LVTKY+W+ +  GNIVR PGL F 
Sbjct  400   TETNSASKDFMAFGGGQRLCVGADFAKVEMAVFLHCLVTKYRWEAIRGGNIVRTPGLQFP  459

Query  1341  DGFKVQ  1358
             +GF ++
Sbjct  460   EGFHIR  465


 Score =   211 bits (538),  Expect(2) = 9e-132, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 143/203 (70%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             + + +  +I+I HWVYRWRNPKC G LPPGSMG P++GE++QFFT+++   IPPFI++R
Sbjct  3    ALCMAALAIISITHWVYRWRNPKCHGKLPPGSMGLPLLGETLQFFTANTSSDIPPFIKKR  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + +YG +FRT++VG+ +I+STD ++N+F+FQQEG L   WY ++  +I G Q     HG 
Sbjct  63   MEKYGPIFRTNLVGRPIIISTDPDLNYFVFQQEGNLFQSWYPDTFTEIFGKQNVSSLHGV  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ L+L GPE+LK+ ++ +++Q A   L  W+     ++K AT  M+F L A K
Sbjct  123  MYKYLKNMVLHLFGPESLKK-MIPDVEQAALSRLQQWSCQDITELKDATASMIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SYD  K+ E LR  + AF++G
Sbjct  182  LISYDSSKSSENLRDNFVAFIQG  204



>ref|XP_009342629.1| PREDICTED: cytochrome P450 87A3 [Pyrus x bretschneideri]
Length=473

 Score =   285 bits (730),  Expect(2) = 9e-132, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 178/245 (73%), Gaps = 2/245 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRK+ ++++K  L ERR+  +K+    DF DY+L E+ KE T LTE IA+D++ +L+FA+
Sbjct  223   GRKSAMRMLKNMLQERRAESRKQPI--DFFDYVLEELKKEGTILTEGIALDLMFVLLFAS  280

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETTS A TLA+KFL  HP VLKQL EEHE I+  RE+ +S +TW EY+SMKFT   I+E
Sbjct  281   FETTSLAITLAMKFLTDHPLVLKQLTEEHEMILKQRENSDSGLTWKEYKSMKFTFQFISE  340

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
             TVRLA+I P IFRK V++   KGYTIP GW  M+CP +VHL+  KY++P++FNP RW G 
Sbjct  341   TVRLANIVPGIFRKAVREINFKGYTIPAGWAVMVCPPAVHLNPAKYENPVAFNPWRWEGV  400

Query  1164  ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLD  1343
             E+  ASK FMAFGG  R C G EF K+ MA+ LH LVTK +W+ +  G+IVR PGL F +
Sbjct  401   EVCNASKHFMAFGGGMRFCVGTEFTKVQMAVFLHCLVTKCRWEPIKGGDIVRTPGLQFPN  460

Query  1344  GFKVQ  1358
             GF V+
Sbjct  461   GFHVK  465


 Score =   214 bits (544),  Expect(2) = 9e-132, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 146/203 (72%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             + + + +VI+I HWVYRWRNPKC G LPPGSMG P++GE++QFFT ++   IPPFI++R
Sbjct  3    ALCITALVVISITHWVYRWRNPKCNGKLPPGSMGLPLLGETLQFFTPNTSSDIPPFIKER  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +FR+++VG+ +IVSTD ++N+F+FQQEG L   WY ++  +I G Q     HG 
Sbjct  63   MERYGPIFRSNLVGRPIIVSTDPDLNYFVFQQEGNLFQSWYPDTFTEIFGRQNVGSLHGV  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ L+L GPE+LK+ ++ E++Q A   L  W++L + ++K +   M+F L A K
Sbjct  123  MYKYLKNMVLHLFGPESLKK-MIPEIEQAALSRLQQWSSLDSTELKDSIASMIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SY+  K+ E LR+ + AF++G
Sbjct  182  LISYESNKSSENLRENFVAFIQG  204



>ref|XP_007158463.1| hypothetical protein PHAVU_002G154400g [Phaseolus vulgaris]
 gb|ESW30457.1| hypothetical protein PHAVU_002G154400g [Phaseolus vulgaris]
Length=482

 Score =   280 bits (717),  Expect(2) = 9e-132, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K+ L ERR    K+K++KDF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGRKKAMKMLKKMLQERRG--MKRKEQKDFFDYVIEELKKEGTVLTEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+K L+ +P VLKQLQEEHE I+  RED  S ITW EY+SM +T   IN
Sbjct  280   SFETTSLALTYAIKVLSDNPLVLKQLQEEHEAILKRREDPNSGITWKEYKSMTYTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK +++   KGYTIP GW  M+CP +VHL+  KY DPL+FNP RW G
Sbjct  340   ETVRLANIVPGIFRKALREINFKGYTIPAGWAVMVCPPAVHLNPAKYQDPLTFNPQRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL  A+K FMAFGG  R C G +F K+ MAI LH LVTKY+W+ V  GNIVR PGL F 
Sbjct  400   MELTGATKNFMAFGGGMRFCVGTDFTKVQMAIFLHSLVTKYRWRPVKGGNIVRTPGLQFP  459

Query  1341  DGFKVQ  1358
             +GF VQ
Sbjct  460   NGFHVQ  465


 Score =   219 bits (557),  Expect(2) = 9e-132, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + L + ++I I HWVYRWRNP C G LPPGSMG P++GE++QFF+ ++   IPPFI+QR+
Sbjct  4    LCLAALVIIGITHWVYRWRNPSCHGKLPPGSMGLPLLGETLQFFSPNTSSDIPPFIKQRM  63

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG +F+T++VG+ ++VSTD ++N+FIFQQEG++   WY ++  +I G Q     HG  
Sbjct  64   KRYGPIFKTNLVGRPIVVSTDPDLNYFIFQQEGQVFQSWYPDTFTEIFGRQNVGSLHGFM  123

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            +KYL+NL LNL GPE+LK+ +L+E++QTA + L+ W+   ++++K+AT  M+F L A K+
Sbjct  124  YKYLKNLVLNLFGPESLKK-MLSEVEQTACRTLEKWSFEDSVELKEATARMIFDLTAKKL  182

Query  562  LSYDEKKAME-LRKYYKAFMEG  624
            +SYD  K+ E LR  + AF++G
Sbjct  183  ISYDSTKSSENLRDNFVAFIQG  204



>ref|XP_002283337.1| PREDICTED: cytochrome P450 87A3 [Vitis vinifera]
Length=472

 Score =   285 bits (730),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  + ++K  L ERR+    +KK+ DF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  224   QGRKKAMSMLKNMLKERRA--MPRKKQSDFFDYVIEELKKEGTILTEAIALDLMFVLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA KFL+ HP VLK+L EEHE I+  RE  +S +TW EY+SM FT   IN
Sbjct  282   SFETTSLAITLATKFLSDHPLVLKKLTEEHEAILEKREIVDSELTWKEYKSMTFTFQFIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK +++ + KGYTIP GW  M+CP +VHL+  KY+DPL+FNP RW G
Sbjct  342   ETVRLANIVPGIFRKALREIQFKGYTIPAGWAIMVCPPAVHLNPAKYEDPLAFNPWRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E   ASK FMAFGG  R C G +F K+ MA+ LH LVTKY+W+ V  G+IVR PGL F 
Sbjct  402   VESSGASKHFMAFGGGMRFCVGTDFTKMQMAVFLHCLVTKYRWQTVRGGDIVRTPGLQFP  461

Query  1341  DGFKVQ  1358
             +GF VQ
Sbjct  462   NGFHVQ  467


 Score =   213 bits (543),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = +1

Query  13   WLVMYLI-SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFI  189
            W +   I +F++I I HW Y WRNPKC G LPPGSMG P++GE++QFF  ++   IPPFI
Sbjct  2    WPIALCIGTFVIIRIIHWGYSWRNPKCNGKLPPGSMGLPLLGETLQFFAPNTSSDIPPFI  61

Query  190  QQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVH  369
            ++R+ RYG +FRT++VG+ V+VSTD ++N+FIFQQEG+L   WY ++  +I G Q     
Sbjct  62   KERMERYGPIFRTNLVGRPVVVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSL  121

Query  370  HGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLA  549
            HG  +KYL+N+ LNL GPE+LK+ +L E++    ++LD W+    +++K+AT  M+F L 
Sbjct  122  HGFMYKYLKNMVLNLFGPESLKK-MLPEVEHATCRNLDRWSCQDTVELKEATARMIFDLT  180

Query  550  ASKVLSYDEKKAME-LRKYYKAFMEG  624
            A K++SY++ K+ E LR+ + AF++G
Sbjct  181  AKKLISYEQDKSSENLRENFVAFIQG  206



>ref|XP_011022911.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Populus euphratica]
Length=557

 Score =   296 bits (758),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 190/246 (77%), Gaps = 1/246 (0%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +++IK  L E R +  +K+++KDFLD ++ E+ K  + +TE +A+D++ +L+FA
Sbjct  231   QGRKKAVEIIKSIL-EERCATPRKRQEKDFLDLVIEEIKKNGSLMTEAMALDLLFVLVFA  289

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A+ETTS   TLA+K + +HP VL++L +EHE I+  R++ ES ITW EY+SM FTH VI+
Sbjct  290   AFETTSITLTLAVKNVCEHPKVLEELIKEHEAILRNRKNIESGITWQEYKSMNFTHAVIH  349

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRKV++D +IKGYTIP GW+ M+CP +VH++ ++YDDP +FNP RW G
Sbjct  350   ETVRLANIVPGIFRKVLKDVDIKGYTIPAGWIVMVCPPAVHMNPKQYDDPFTFNPWRWQG  409

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             QELH  S+KFM FGG  RLCAGAEF+K+ MAI LH+LVTKY+W+V+  G+I+R P + F 
Sbjct  410   QELHAGSQKFMGFGGGSRLCAGAEFSKMQMAIFLHHLVTKYRWRVIKGGDIIRIPAVMFP  469

Query  1341  DGFKVQ  1358
             +GF +Q
Sbjct  470   NGFHIQ  475


 Score =   202 bits (514),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 132/195 (68%), Gaps = 1/195 (1%)
 Frame = +1

Query  43   VIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLF  222
            ++ +  W+Y+WR PKCKG LPPGSMGFP++GE+IQFF  +    I PFI +++ RYGS+F
Sbjct  19   ILCVTQWIYKWRKPKCKGKLPPGSMGFPLLGETIQFFAPYKANNISPFITKKMERYGSIF  78

Query  223  RTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNL  402
            +T +VG ++I+STD+  N FIFQQEGKL  C Y +S ++I G +  +   G  HKYLRNL
Sbjct  79   KTHLVGHRLIISTDAGFNSFIFQQEGKLFQCCYPKSFSEIAGRESIVSAGGFLHKYLRNL  138

Query  403  ALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKK  582
             +NLVG E++KQ L+ ++++   +HL  W   +++++++A   M F   A  +LSY E K
Sbjct  139  VMNLVGNESMKQKLIPKVEKMVCEHLQSWCGQASIELREAVTKMAFSFGAKILLSYSESK  198

Query  583  AME-LRKYYKAFMEG  624
            + + LRK Y  F  G
Sbjct  199  SSKNLRKAYADFQRG  213



>ref|XP_011022912.1| PREDICTED: cytochrome P450 87A3-like isoform X2 [Populus euphratica]
Length=494

 Score =   295 bits (755),  Expect(2) = 6e-131, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 190/246 (77%), Gaps = 1/246 (0%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +++IK  L E R +  +K+++KDFLD ++ E+ K  + +TE +A+D++ +L+FA
Sbjct  231   QGRKKAVEIIKSIL-EERCATPRKRQEKDFLDLVIEEIKKNGSLMTEAMALDLLFVLVFA  289

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A+ETTS   TLA+K + +HP VL++L +EHE I+  R++ ES ITW EY+SM FTH VI+
Sbjct  290   AFETTSITLTLAVKNVCEHPKVLEELIKEHEAILRNRKNIESGITWQEYKSMNFTHAVIH  349

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRKV++D +IKGYTIP GW+ M+CP +VH++ ++YDDP +FNP RW G
Sbjct  350   ETVRLANIVPGIFRKVLKDVDIKGYTIPAGWIVMVCPPAVHMNPKQYDDPFTFNPWRWQG  409

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             QELH  S+KFM FGG  RLCAGAEF+K+ MAI LH+LVTKY+W+V+  G+I+R P + F 
Sbjct  410   QELHAGSQKFMGFGGGSRLCAGAEFSKMQMAIFLHHLVTKYRWRVIKGGDIIRIPAVMFP  469

Query  1341  DGFKVQ  1358
             +GF +Q
Sbjct  470   NGFHIQ  475


 Score =   202 bits (513),  Expect(2) = 6e-131, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 132/195 (68%), Gaps = 1/195 (1%)
 Frame = +1

Query  43   VIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLF  222
            ++ +  W+Y+WR PKCKG LPPGSMGFP++GE+IQFF  +    I PFI +++ RYGS+F
Sbjct  19   ILCVTQWIYKWRKPKCKGKLPPGSMGFPLLGETIQFFAPYKANNISPFITKKMERYGSIF  78

Query  223  RTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNL  402
            +T +VG ++I+STD+  N FIFQQEGKL  C Y +S ++I G +  +   G  HKYLRNL
Sbjct  79   KTHLVGHRLIISTDAGFNSFIFQQEGKLFQCCYPKSFSEIAGRESIVSAGGFLHKYLRNL  138

Query  403  ALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKK  582
             +NLVG E++KQ L+ ++++   +HL  W   +++++++A   M F   A  +LSY E K
Sbjct  139  VMNLVGNESMKQKLIPKVEKMVCEHLQSWCGQASIELREAVTKMAFSFGAKILLSYSESK  198

Query  583  AME-LRKYYKAFMEG  624
            + + LRK Y  F  G
Sbjct  199  SSKNLRKAYADFQRG  213



>ref|XP_010919431.1| PREDICTED: cytochrome P450 87A3 [Elaeis guineensis]
Length=477

 Score =   286 bits (731),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 180/247 (73%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN +KL+K  L ER++S   +++  DF D ++ E+ KE   +TE IA+D++ +L+FA
Sbjct  226   QGRKNAMKLLKTMLKERQNS--PRRQCMDFFDSVIEELKKERPVITETIALDLMFVLLFA  283

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T+A+K L  +P VL++L+EEHE I+  RE+ +S ITWNEY+SM FT  VIN
Sbjct  284   SFETTSLALTVAMKLLTDNPRVLEELKEEHEAILKHRENPDSGITWNEYKSMSFTFQVIN  343

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK V+D +IKG+TIP GW  M+CP +VHL+ E Y DPL+FNP RW  
Sbjct  344   ETVRLANIVPGIFRKAVEDIKIKGFTIPAGWGVMVCPPAVHLNPEIYKDPLAFNPWRWKD  403

Query  1161  Q-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             + EL   SK FMA GG  R C GA+F KL MAI LH LVTKYKW+ +  GNIVR PGL F
Sbjct  404   KLELSGGSKHFMALGGGLRFCVGADFTKLQMAIFLHCLVTKYKWRAIRGGNIVRTPGLGF  463

Query  1338  LDGFKVQ  1358
              DG+ +Q
Sbjct  464   PDGYHIQ  470


 Score =   210 bits (534),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 138/197 (70%), Gaps = 1/197 (1%)
 Frame = +1

Query  37   FLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGS  216
             L I +  W YRWRNP+C G LPPGSMG P+IGE++QFFT ++   +PPF+++R+ +YG+
Sbjct  12   LLTIWLIQWAYRWRNPRCSGRLPPGSMGLPLIGETLQFFTPNTTSDVPPFVKERMKKYGT  71

Query  217  LFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLR  396
            +F+TS+VG+ ++VSTD E+NHF+FQQEGKL   WY ++  +I G       HG  +KYL+
Sbjct  72   IFKTSLVGRPLVVSTDPELNHFVFQQEGKLFQSWYPDTFTEIFGRDNVGSLHGFMYKYLK  131

Query  397  NLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDE  576
            +L L L GPENLK+ LL +++++    L  W+   ++++K+AT  M+F L A K++SYD 
Sbjct  132  SLVLRLFGPENLKENLLHDVEKSVLNSLSSWSGQPSVELKEATSKMIFDLTAKKLISYDP  191

Query  577  KKAME-LRKYYKAFMEG  624
              + + LRK + AF+ G
Sbjct  192  SSSSDNLRKNFVAFIRG  208



>ref|XP_003611140.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94098.1| cytochrome P450 family protein [Medicago truncatula]
Length=483

 Score =   287 bits (734),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 174/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR     +K++ DF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  223   QGRKKAMKMLKNMLQERRE--MPRKQQMDFFDYVIEELRKEGTLLTEAIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+K L+ +P V KQLQEEHE I+  RE+  S +TW EY+SM FT  +I 
Sbjct  281   SFETTSQALTYAIKLLSDNPLVFKQLQEEHEAILERRENPNSGVTWQEYKSMTFTFQLIT  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I P IFRK +++   KGYTIP GW  M+CP +VHL+  KY DPL FNPSRW G
Sbjct  341   ETARLANIVPGIFRKALREINFKGYTIPAGWAIMVCPPAVHLNPAKYQDPLVFNPSRWEG  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E   A+K F+AFGG  R C G EFAK+ MA+ LH LVTKY+W+ +  GNIVR PGL F 
Sbjct  401   MEPSGATKHFLAFGGGMRFCVGTEFAKVQMAVFLHCLVTKYRWRPIKGGNIVRTPGLQFP  460

Query  1341  DGFKVQ  1358
             +GF VQ
Sbjct  461   NGFHVQ  466


 Score =   207 bits (528),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 145/205 (71%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W++       +  I  WVYRWRNP C G LPPGSMG P++GES+QFF+ ++   IPPFI+
Sbjct  2    WVLCLGALVTICIITRWVYRWRNPSCNGKLPPGSMGLPLLGESLQFFSPNTSCDIPPFIR  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +R+ RYG +F+T++VG+ V+VSTD ++N+FIFQQEGK+   WY ++  +I G Q     H
Sbjct  62   KRMKRYGPIFKTNLVGRPVVVSTDPDLNYFIFQQEGKIFQSWYPDTFTEIFGQQNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ LNL GPE+LK+ +++E++Q A + L   +   ++++K+ATE M+F L A
Sbjct  122  GFMYKYLKNMMLNLFGPESLKK-MISEVEQAACRTLQQASCQDSVELKEATETMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++SYD  ++ E LR+ + AF++G
Sbjct  181  KKLISYDPTESSENLRENFVAFIQG  205



>ref|XP_004298752.1| PREDICTED: cytochrome P450 87A3-like [Fragaria vesca subsp. vesca]
Length=480

 Score =   283 bits (723),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 135/254 (53%), Positives = 175/254 (69%), Gaps = 10/254 (4%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             RGRK V+  +K  L ERR+   K+    DF DY++ E+DK+ T LTE +++D++ +L+FA
Sbjct  222   RGRKRVLSTLKSMLQERRAKLMKRPI--DFFDYVIEELDKDGTLLTEGMSLDLMFLLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLALKFL+ HP VLKQL EEHE I+  R D +S +TW EY+SM FT   IN
Sbjct  280   SFETTSVAMTLALKFLSDHPLVLKQLTEEHEMILEQRVDADSGLTWEEYKSMTFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK +     KG+TIP GW  M+CP ++HL+  KY++PL FNP RW  
Sbjct  340   ETVRLANIVPGIFRKTMSQISFKGHTIPAGWTVMVCPPAMHLNPAKYENPLDFNPWRWEM  399

Query  1161  QELH--------PASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIV  1316
              E H         ASK FMAFGG  R C GA+FAK+ +A+ LH L+TKY+WK +  GNIV
Sbjct  400   GEYHLLQGTGKNGASKNFMAFGGGMRFCVGADFAKVQIAVFLHCLLTKYRWKAIRGGNIV  459

Query  1317  RKPGLTFLDGFKVQ  1358
             R PG+ F DGF +Q
Sbjct  460   RTPGIQFPDGFHIQ  473


 Score =   212 bits (539),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 141/204 (69%), Gaps = 2/204 (1%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            L + +++ + IAI+HW+YRWRNP+C G LPPGSMG P+IGES+ FF+  +   + PFI++
Sbjct  2    LSLCIVALVAIAISHWIYRWRNPRCSGKLPPGSMGLPLIGESLHFFSPSTSFDVSPFIRK  61

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R  R+G +F+TS+VG+ +IVSTD + NH+IFQQE KL   WY +S  +I G +   V HG
Sbjct  62   RTERFGPIFKTSLVGRPLIVSTDPDFNHYIFQQENKLFQSWYPDSVREILGRENMAVLHG  121

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              H Y++ + LNLVGPENLK  +L E+ Q A + L  W+   ++++K+A+  M+F L A 
Sbjct  122  FLHIYVKKMVLNLVGPENLKN-MLPEIQQVAERTLQQWSCADSIELKEASASMIFGLTAK  180

Query  556  KVLSYDEKKAME-LRKYYKAFMEG  624
            K++SYD  K+ E ++  + AFM G
Sbjct  181  KLISYDSNKSNEDIKGNFDAFMSG  204



>gb|KDP25498.1| hypothetical protein JCGZ_20654 [Jatropha curcas]
Length=476

 Score =   290 bits (743),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L+ERR+    +K + DF D++L E+ KE + LTE IA+D++ +L+FA
Sbjct  222   QGRKRAMKMLKNLLHERRAK--PRKHQSDFFDFVLEELQKEGSILTEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T+ +KFL+  P  LKQL EEHE I+  RE+  SSITW EY+SM FT  VIN
Sbjct  280   SFETTSLAITMVIKFLSDSPLALKQLTEEHEAILRNRENANSSITWKEYKSMTFTFQVIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRKV+ D + KGY IP GW  M+CP +VHL   KY+DPL+FNP RW G
Sbjct  340   ETVRLANIVPVIFRKVLTDIQFKGYAIPAGWAIMVCPPAVHLDRAKYEDPLTFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +E+  ASK FMAFGG  R C G EF K+ MA+ LH LVTKY W+V+  GN VR PGL F 
Sbjct  400   REITGASKHFMAFGGGMRFCVGTEFTKVQMAVFLHCLVTKYSWQVIGGGNTVRTPGLQFP  459

Query  1341  DGFKVQ  1358
             +G+ VQ
Sbjct  460   NGYHVQ  465


 Score =   204 bits (519),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 138/198 (70%), Gaps = 2/198 (1%)
 Frame = +1

Query  34   SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            + ++I+   WVYRWRNP+C G LPPGSMG P++GE+ QFF  +    IPPF+++R+ +YG
Sbjct  8    ALVIISFTRWVYRWRNPRCNGKLPPGSMGLPLLGETFQFFEPNFSADIPPFVKKRMKKYG  67

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYL  393
             +F+T++VG+ V+VSTD ++N+FIFQQEG+L   WY E+  QI G Q     HG  +KYL
Sbjct  68   PIFKTNLVGRPVVVSTDPDLNYFIFQQEGQLFQSWYPETFTQIFGRQNVGSLHGFMYKYL  127

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD  573
            + + LNL GPE LK+ +L E+ +T    L  W+   ++++K+AT  M+F L A K++SYD
Sbjct  128  KKMVLNLFGPEGLKK-MLPEVQKTTYDRLWLWSHQDSIELKEATASMIFDLTAKKLISYD  186

Query  574  EKKAME-LRKYYKAFMEG  624
            E  + E LR+ + AFM+G
Sbjct  187  ENNSSENLRENFVAFMQG  204



>ref|XP_008448963.1| PREDICTED: cytochrome P450 87A3 isoform X1 [Cucumis melo]
Length=469

 Score =   287 bits (735),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 181/246 (74%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  ++++K  L ERR++   +K++ DF D++L E++K+ T LTE+IA+D++ +L+FA
Sbjct  222   QGRKKAMRMLKNMLQERRAN--PRKQRIDFFDFVLEELEKDGTLLTEEIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+KFL  +PHVL++L  EHE I+  RE  +S +TW EY+SM FT   IN
Sbjct  280   SFETTSLAITAAIKFLLNNPHVLEELTAEHEGILKRREISDSGLTWGEYKSMTFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK ++D + KGYTIP GW  M+CP +VHL+ EKY DPL+FNP RW  
Sbjct  340   ETVRLANIVPGIFRKALKDIQFKGYTIPSGWAVMVCPPAVHLNPEKYVDPLAFNPWRWEK  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+ ASK FMAFGG  R C G +F K+ MA+ LH LVTKY++K +  GNIVR PGL F 
Sbjct  400   SELNGASKHFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYRFKAIKGGNIVRTPGLQFP  459

Query  1341  DGFKVQ  1358
             DGF VQ
Sbjct  460   DGFHVQ  465


 Score =   206 bits (525),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            WL++ + + +V++  HWVY WRNPKC G LPPGSMG P++GE++QFF  ++   IPPFI+
Sbjct  2    WLLL-IGAIVVLSFTHWVYSWRNPKCNGKLPPGSMGLPLLGETLQFFAPNTSSDIPPFIR  60

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +R+ RYG +FRTS+VG+ +IVSTD ++N+FIFQQEG+L   WY ++  +I G Q     H
Sbjct  61   KRMDRYGPIFRTSLVGRPLIVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLH  120

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ L+L GPE+LK+ ++ E++  A + L  W++ + +++K  T  M+F L A
Sbjct  121  GFMYKYLKNMVLHLFGPESLKK-MIPEVEAVATRRLKQWSSHNPVELKDKTASMIFDLTA  179

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++SYD + + E LR  + AF++G
Sbjct  180  KKLISYDSESSSENLRDNFVAFIQG  204



>ref|XP_010055602.1| PREDICTED: cytochrome P450 87A3-like isoform X2 [Eucalyptus grandis]
 gb|KCW72095.1| hypothetical protein EUGRSUZ_E00537 [Eucalyptus grandis]
Length=477

 Score =   285 bits (730),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  ++++K  + ER+++   KK + DF DY+L E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGREKAMRMLKNLMQERQAT--PKKHRSDFFDYVLEELQKEGTLLTEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ HP VLKQL EEHE I+  R+D    ++W EY+ M +T   IN
Sbjct  280   SFETTSLALTLAIKFLSDHPRVLKQLTEEHEAILRKRDDATPGLSWKEYKLMTYTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFR+ ++D + KGYTIP GW  + CP +VHL+  KY+DPLSF+P RW G
Sbjct  340   ETVRLANIVPGIFRRALRDIQFKGYTIPAGWAVVACPPAVHLNPMKYEDPLSFDPERWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E++ ASK FMAFGG  R C G +F K+ MA+ LH LVTKY+W+++  GNIVR PGL F 
Sbjct  400   IEVNGASKHFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYRWQIIKGGNIVRTPGLQFP  459

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  460   DGFHIQ  465


 Score =   207 bits (527),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 140/198 (71%), Gaps = 2/198 (1%)
 Frame = +1

Query  34   SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            + ++I+I HWVYRWRNP+C G LPPGSMG+P++GE++QFFT ++   I PFI++R+ RYG
Sbjct  8    ALIIISITHWVYRWRNPRCDGKLPPGSMGWPLLGETLQFFTPNTTHDIAPFIKERMERYG  67

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYL  393
             +FRTS+VG+ V+VSTD + +H IFQQEG LV  WY ++  +I G Q     HG  ++YL
Sbjct  68   PIFRTSLVGRPVVVSTDPDFSHLIFQQEGHLVESWYPDTFTEIFGRQNVGSLHGIMYRYL  127

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD  573
            +N+ L L GPE+LK+ +L E+++ A Q L  W+    +++K AT  M+F L A K++S+D
Sbjct  128  KNMVLYLFGPESLKK-MLPEIEEVAIQRLKQWSNQDKVEVKDATASMIFHLTAKKLISHD  186

Query  574  EKKAME-LRKYYKAFMEG  624
               + E LR  + AF++G
Sbjct  187  SDSSPENLRANFDAFIKG  204



>ref|XP_004147972.1| PREDICTED: cytochrome P450 87A3-like [Cucumis sativus]
 ref|XP_004166827.1| PREDICTED: cytochrome P450 87A3-like [Cucumis sativus]
 gb|KGN55957.1| hypothetical protein Csa_3G038790 [Cucumis sativus]
Length=469

 Score =   286 bits (733),  Expect(2) = 2e-129, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 180/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  ++++K  L ERR++   +K++ DF D++L E++K+ T LTE+IA+D++ +L+FA
Sbjct  222   QGRKKAMRMLKNMLQERRTN--PRKQRIDFFDFVLEELEKDGTLLTEEIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+KFL  +PHVL++L  EHE I+  RE  +S +TW EY+SM FT   IN
Sbjct  280   SFETTSLAITAAIKFLLNNPHVLEELTAEHEGILKRREISDSRLTWGEYKSMTFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK ++D E KGYTIP GW  M+CP +VHL+ EKY DPL+FNP RW  
Sbjct  340   ETVRLANIVPGIFRKALKDIEFKGYTIPSGWAVMVCPPAVHLNPEKYVDPLAFNPWRWEK  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+  SK FMAFGG  R C G +F K+ MA+ LH LVTKY++K +  GNI+R PGL F 
Sbjct  400   SELNGGSKHFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYRFKAIKGGNIIRTPGLQFP  459

Query  1341  DGFKVQ  1358
             DGF VQ
Sbjct  460   DGFHVQ  465


 Score =   205 bits (522),  Expect(2) = 2e-129, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 145/205 (71%), Gaps = 3/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            WL++ + + +V++  HWVY W NPKC G LPPGSMG P++GE++QFF  ++   IPPFI+
Sbjct  2    WLLL-IGAIVVLSFTHWVYSWINPKCNGKLPPGSMGLPLLGETLQFFAPNTSSDIPPFIR  60

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +R+ RYG +FRTS+VG+ +IVSTD ++NHFIFQQEG+L   WY ++  +I G Q     H
Sbjct  61   KRMDRYGPIFRTSLVGRPLIVSTDPDLNHFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLH  120

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ L+L GPE+LK+ ++ E++  A + L  W++ + +++K  T  M+F L A
Sbjct  121  GFMYKYLKNMVLHLFGPESLKK-MIPEVEAVATRRLKQWSSHNPVELKDKTASMIFDLTA  179

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++SYD + + E LR  + AF++G
Sbjct  180  KKLISYDSENSSENLRDNFVAFIQG  204



>gb|KDO40279.1| hypothetical protein CISIN_1g012100mg [Citrus sinensis]
Length=471

 Score =   283 bits (725),  Expect(2) = 2e-129, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 185/253 (73%), Gaps = 6/253 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   +GRK   K+I++   ER++S   K    DF+D+L++EV+KE++F+ E  A++++
Sbjct  218   AFHACLQGRKEATKVIEDIYQERKAS---KIYCDDFMDHLVAEVEKEDSFMDETNAINLV  274

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAARED-KESSITWNEYRSMK  959
              +L+FA YET+S A TL +K++  +P VL +L +EHE I+ +R++  +S +TW EY+SM 
Sbjct  275   FLLLFAVYETSSQAITLLVKYIFDNPDVLAELTKEHEGILRSRKNGNKSEVTWEEYKSMT  334

Query  960   FTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSF  1139
             F+HMVINETVRLA+I P +FRK  +D +IKGYTIP GW+ M+  S VH + EKY+DPL+F
Sbjct  335   FSHMVINETVRLANIVPGVFRKASKDVQIKGYTIPAGWLVMVASSVVHFTPEKYEDPLAF  394

Query  1140  NPSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVR  1319
             NP RW G+ELH  SK FMAFGG  RLCAGA+ AKL MA+ LHYLVT Y W ++  G+ VR
Sbjct  395   NPWRWEGKELHAGSKSFMAFGGGTRLCAGADLAKLQMAVFLHYLVTTYSWSIIKGGDGVR  454

Query  1320  KPGLTFLDGFKVQ  1358
             KPGL F +G  +Q
Sbjct  455   KPGLIFPNGLHIQ  467


 Score =   208 bits (530),  Expect(2) = 2e-129, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 128/192 (67%), Gaps = 2/192 (1%)
 Frame = +1

Query  52   IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            I HW Y W NPK  G LPPGSMG PIIGE+ QF + H L  +PPFI +R+ RYG LFRT+
Sbjct  16   ITHWFYTWANPKGNGKLPPGSMGLPIIGETFQFLSQHGLYDVPPFITKRMARYGPLFRTN  75

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALN  411
            + GQKVIVSTD E+N+ I  QE K     Y ES  QI G  G +  H + HKYLRNL L+
Sbjct  76   LFGQKVIVSTDPEVNYKIL-QENKTFPVSYPESFLQIMGRNGMLTSHENFHKYLRNLILH  134

Query  412  LVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME  591
            LVGPENL+  LL  +DQT R+HL  W +    D+K+   +M+F     K++SYDE + +E
Sbjct  135  LVGPENLRAKLLHGVDQTTRRHLHSWASCGIYDVKEGAALMIFDYFCKKLISYDETQDVE  194

Query  592  -LRKYYKAFMEG  624
             LR+Y+K FM+G
Sbjct  195  KLREYFKDFMDG  206



>ref|XP_008345352.1| PREDICTED: cytochrome P450 87A3-like [Malus domestica]
Length=492

 Score =   281 bits (720),  Expect(2) = 4e-129, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 177/245 (72%), Gaps = 5/245 (2%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRK+ ++++K  L ERR+  +K+    DF DY+L E+ KE T LTE IA+D++ +L+FA+
Sbjct  223   GRKSAMRMLKNMLQERRAESRKQPI--DFFDYVLEELKKEGTILTEGIALDLMFVLLFAS  280

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETTS A TLA+KFL  HP VLKQL EEHE I+  RE+ +S +TW EY+SMKFT  VI+E
Sbjct  281   FETTSLAITLAMKFLTDHPLVLKQLTEEHEMILKQRENSDSGLTWKEYKSMKFTFQVISE  340

Query  984   TVRLADIAPAIFRKVV---QDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW  1154
             TVRLA+I P IFRK V   ++   KGYTIP GW  M+CP +VHL+  KY++P++FNP RW
Sbjct  341   TVRLANIVPGIFRKAVVPMREINFKGYTIPAGWAVMVCPPAVHLNPAKYENPVAFNPXRW  400

Query  1155  NGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLT  1334
              G E+  ASK FMAFGG  R C G EF K+ MA+ LH LVTK +W+ +  G+IVR PGL 
Sbjct  401   EGVEVCNASKHFMAFGGGMRFCVGTEFTKVQMAVFLHCLVTKCRWEPIKGGDIVRTPGLQ  460

Query  1335  FLDGF  1349
             F +GF
Sbjct  461   FPNGF  465


 Score =   209 bits (533),  Expect(2) = 4e-129, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 144/203 (71%), Gaps = 2/203 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
             + + + +VI+I HWVYRWRNPKC G LPPGSMG P++GE++QFFT ++   IPPFI++R
Sbjct  3    ALCITALVVISITHWVYRWRNPKCNGKLPPGSMGLPLLGETLQFFTPNTSSDIPPFIKER  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +FR+++VG+ +IVSTD ++N+F+FQQEG L   WY ++  +I G Q     HG 
Sbjct  63   MERYGPIFRSNLVGRPIIVSTDPDLNYFVFQQEGNLFQSWYPDTFTEIFGRQNVGSLHGV  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             +KYL+N+ L+L GPE+LK+ ++ E++Q     L  W++  + ++K +   M+F L A K
Sbjct  123  MYKYLKNMVLHLFGPESLKK-MIPEIEQAXLSRLQQWSSQDSTELKDSIASMIFDLTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEG  624
            ++SY+  K+ E LR+ + AF++G
Sbjct  182  LISYESNKSSENLRENFVAFIQG  204



>ref|XP_010053329.1| PREDICTED: cytochrome P450 87A3 [Eucalyptus grandis]
 gb|KCW77602.1| hypothetical protein EUGRSUZ_D01916 [Eucalyptus grandis]
Length=477

 Score =   293 bits (750),  Expect(2) = 6e-129, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 181/246 (74%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  ++++K  L ERR     +K++ DF DY+L E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGRKRAMRMLKNLLQERR--MMPRKQQNDFFDYVLEELQKEGTILTEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL ++P  LK+L EEHE II  RED +S++TW EY+SM FT  VIN
Sbjct  280   SFETTSLALTLAMKFLLENPTALKRLTEEHEAIIRKREDADSALTWKEYKSMTFTFQVIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK ++  + KGYTIP GW  M+CP +VHL+  KY+DPL+FNP RW G
Sbjct  340   ETVRLANIVPGIFRKALRQIQFKGYTIPEGWAVMVCPPAVHLNPAKYEDPLTFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              ++H ASK+FMAFGG  R C G +F K+ MA+ LH LVT+Y+W+ +  GN VR PGL F 
Sbjct  400   MDVHVASKQFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTRYRWQAIKGGNTVRTPGLQFP  459

Query  1341  DGFKVQ  1358
             DGF ++
Sbjct  460   DGFHIR  465


 Score =   197 bits (501),  Expect(2) = 6e-129, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 136/200 (68%), Gaps = 2/200 (1%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTR  207
            L + +VI I  W+YRWRNP+C G LPPGSMG P++GE++QFF  ++   I PFI++R+  
Sbjct  6    LGALVVIGIVCWIYRWRNPRCNGKLPPGSMGLPLLGETLQFFAPNTSHDISPFIKERMKN  65

Query  208  YGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHK  387
            YG +FRTS+VG+ VIVSTD + N+FIFQQEG L   WY ++  ++ G Q     HG  +K
Sbjct  66   YGPIFRTSLVGRPVIVSTDPDFNYFIFQQEGNLFQSWYPDTFTEVFGRQNVGSLHGFMYK  125

Query  388  YLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
            YL+N+ L+L GP +L Q +L E+++TA   L  W+    +++K+ T  M+F L A K++S
Sbjct  126  YLKNMVLSLFGPASL-QKMLPEVEKTAYGRLQQWSCQHMIEVKEETASMIFHLTAKKLIS  184

Query  568  YDEKKAME-LRKYYKAFMEG  624
            YD + + E LR+ + +F+ G
Sbjct  185  YDSESSSENLRESFVSFIRG  204



>ref|XP_009400447.1| PREDICTED: cytochrome P450 87A3-like [Musa acuminata subsp. malaccensis]
Length=476

 Score =   293 bits (750),  Expect(2) = 8e-129, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 182/247 (74%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKNV+K++K  L ERR+S    K+  DF D ++ E++KE + +TE IA+D++  L+FA
Sbjct  227   QGRKNVLKVLKNMLKERRNS--PWKQHGDFFDCVIEELNKERSLITETIALDLMFALLFA  284

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL  HP+VL++L EEH+ I+  RED  + +TW EYRSM FT  VIN
Sbjct  285   SFETTSLALTLAIKFLTDHPNVLEKLTEEHDTILKNREDPMTGVTWMEYRSMTFTFQVIN  344

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+IAP IFRK ++D +  GYTIP GW  M+CP +VHL+ E Y+DPL+F+PSRW  
Sbjct  345   ETARLANIAPGIFRKALKDIQFNGYTIPAGWRIMVCPPAVHLNPEIYEDPLTFDPSRWKE  404

Query  1161  Q-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             + EL+  SK FMAFGG  R C GAEFAKL MAI LH LVTKY W+ +  GNIVR PGL F
Sbjct  405   RPELNGGSKHFMAFGGGMRFCVGAEFAKLQMAIFLHRLVTKYSWRAIRGGNIVRTPGLGF  464

Query  1338  LDGFKVQ  1358
              +G+ +Q
Sbjct  465   PNGYHIQ  471


 Score =   196 bits (499),  Expect(2) = 8e-129, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 140/209 (67%), Gaps = 3/209 (1%)
 Frame = +1

Query  7    MTWLV-MYLISFLVIAIAHWVYRWRNPKCK-GLLPPGSMGFPIIGESIQFFTSHSLQGIP  180
            M +LV M+    +V+   HWVYRWRNP+C  G LPPGSMG P++GE++QFF+ ++   + 
Sbjct  1    MAFLVAMFSAVSVVVLAVHWVYRWRNPRCSTGNLPPGSMGLPLLGETMQFFSPNTTFDVS  60

Query  181  PFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGF  360
            PFI+ R+ RYG +FRTS+VG  V+VSTD E+NHF+FQQEG+L   WY E+  +I G    
Sbjct  61   PFIKNRIKRYGPVFRTSLVGLPVVVSTDPELNHFVFQQEGRLFESWYPETFTEIFGRSNV  120

Query  361  MVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLF  540
               HG  +KYL++L L L GPE+LK+ LL +++  A  +L  W+ LS++++K+AT  M+F
Sbjct  121  SSLHGFMYKYLKSLVLKLFGPESLKELLLRDVETAACANLSSWSRLSSIELKEATSNMIF  180

Query  541  KLAASKVL-SYDEKKAMELRKYYKAFMEG  624
             L A K++       +  LRK + AF+ G
Sbjct  181  DLTAKKLISYESSSSSESLRKNFVAFLRG  209



>gb|EYU29834.1| hypothetical protein MIMGU_mgv1a005289mg [Erythranthe guttata]
Length=490

 Score =   281 bits (718),  Expect(2) = 1e-128, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR     +K + DF DY+L E+ +E+T LTE IA+D++ +L+FA
Sbjct  224   QGRKKAMKMLKNMLQERRER--PRKIQTDFFDYVLEELQREDTVLTEAIALDLMFVLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA KFL ++P VLK+L EEHE II  RE+ +S +TWNEY+SMKFT   IN
Sbjct  282   SFETTSLAITLATKFLVEYPLVLKELTEEHEAIIKRRENPDSGLTWNEYKSMKFTFQFIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I PAIFRK +++ + K YTIP GW  M+CP +VHL+  +Y +PL F+P RW G
Sbjct  342   ETVRLANIVPAIFRKALREIKFKEYTIPAGWAVMVCPPAVHLNPTRYKNPLDFDPWRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              + + AS+ FMAFGG  R C G +F K+ MA+ LH LVTKYKW  +  GN +R PGL F 
Sbjct  402   IDTNGASRNFMAFGGGMRFCVGTDFTKVQMAVFLHSLVTKYKWTPIKGGNTLRTPGLQFP  461

Query  1341  DGFKVQ  1358
             +G+ +Q
Sbjct  462   NGYHIQ  467


 Score =   209 bits (531),  Expect(2) = 1e-128, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 151/204 (74%), Gaps = 2/204 (1%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            +V ++ + L+I I +W+Y W NPKC G+LPPGSMG+PI+GE++ FF  ++   I PF++ 
Sbjct  4    IVFFVGALLIILITNWLYNWWNPKCNGVLPPGSMGWPILGETLSFFAPNTTLDISPFVKD  63

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+ RYG +F+TS+VG+ +IVSTD+++N++IFQQEG+L   WY ++  +I G Q     HG
Sbjct  64   RMQRYGPIFKTSVVGRPIIVSTDADLNYYIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHG  123

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              +KYL+N+ LNL G E+LK+ +L E++QT++++L  W+  +++D+K A+  M+F L+A 
Sbjct  124  FMYKYLKNMVLNLFGIESLKK-MLPEVEQTSKRNLQRWSLETSVDVKDASAQMIFDLSAK  182

Query  556  KVLSYDEKKAME-LRKYYKAFMEG  624
            K++SYD +K+ E LR+ + AF++G
Sbjct  183  KLISYDSEKSTENLRESFVAFIQG  206



>ref|NP_172734.2| cytochrome P450, family 87, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 gb|AAR24666.1| At1g12740 [Arabidopsis thaliana]
 dbj|BAD44087.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28919.1| cytochrome P450, family 87, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=472

 Score =   281 bits (718),  Expect(2) = 3e-128, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 174/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR   +K+++  L ERR +   +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  223   QGRAKAMKMLRNMLQERREN--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED +S +TW EY+SM +T   IN
Sbjct  281   SFETTSLALTLAIKFLSDDPEVLKRLTEEHETILRNREDADSGLTWEEYKSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK ++D + K YTIP GW  M+CP +VHL+ E Y DPL FNPSRW G
Sbjct  341   ETARLANIVPAIFRKALRDIKFKDYTIPAGWAVMVCPPAVHLNPEMYKDPLVFNPSRWEG  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              ++  ASK FMAFGG  R C G +F KL MA  LH LVTKY+W+ +  GNI R PGL F 
Sbjct  401   SKVTNASKHFMAFGGGMRFCVGTDFTKLQMAAFLHSLVTKYRWEEIKGGNITRTPGLQFP  460

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  461   NGYHVK  466


 Score =   207 bits (526),  Expect(2) = 3e-128, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 144/205 (70%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W ++  +S L+I+I HWVY WRNPKC+G LPPGSMGFP++GESIQFF  +    IPPFI+
Sbjct  2    WALLIWVSLLLISITHWVYSWRNPKCRGKLPPGSMGFPLLGESIQFFKPNKTSDIPPFIK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +RV +YG +F+T++VG+ VIVSTD+++++F+F QEG+    WY ++   I G +     H
Sbjct  62   ERVKKYGPIFKTNLVGRPVIVSTDADLSYFVFNQEGRCFQSWYPDTFTHIFGKKNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKNMVLTLFGHDGLKK-MLPQVEMTANKRLELWSNQDSVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D  K+ E LR  + AF++G
Sbjct  181  KKLISHDPDKSSENLRANFVAFIQG  205



>ref|XP_002509718.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51105.1| cytochrome P450, putative [Ricinus communis]
Length=544

 Score =   268 bits (686),  Expect(2) = 5e-128, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 167/222 (75%), Gaps = 2/222 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  LNERR +   ++ ++DF DY+L ++ KE + LTE+I +D++ +L+FA
Sbjct  222   QGRKRAMKILKNLLNERRRN--PRQHQRDFFDYVLEDLQKEGSVLTEEIVLDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T+A+KFL+ HP  LKQL EEHE I+  RE+ +S ITW EY+SM FT  VIN
Sbjct  280   SFETTSLAITMAVKFLSDHPLALKQLTEEHEAILENRENADSGITWKEYKSMTFTFQVIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRKV++D + KGYTIP GW  M+CP +VHL+  KY+DPLSFNP RW  
Sbjct  340   ETVRLANIVPVIFRKVLRDIQFKGYTIPAGWAVMVCPPAVHLNRTKYEDPLSFNPWRWKD  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYK  1286
             QE++ ASK FMAFGG  R C G +F K+ MA+ LH LVTKY+
Sbjct  400   QEINTASKNFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYR  441


 Score =   218 bits (556),  Expect(2) = 5e-128, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 146/202 (72%), Gaps = 2/202 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            ++  + ++I+I +WVY WRNPKC G LPPGSMG P++GE++QFFT ++   IPPF+++R+
Sbjct  4    LWFGALVIISITNWVYHWRNPKCNGKLPPGSMGLPLLGETLQFFTPNTSSEIPPFVKERM  63

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG +FRTS+VG+ V+VSTD ++N+FIFQQEG+L   WY ++  +I G Q     HG  
Sbjct  64   KRYGPVFRTSLVGRPVVVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGFM  123

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            +KYL+N+ LNL GPE+LK+ +L E+ Q A + L  W+   ++++K+AT  M+F L A K+
Sbjct  124  YKYLKNMVLNLFGPESLKK-MLPEVQQAASERLQLWSTQGSVELKEATASMIFDLTAKKL  182

Query  562  LSYDEKKAME-LRKYYKAFMEG  624
            +SYDEK   E LR  + AFM+G
Sbjct  183  ISYDEKNYSENLRDNFVAFMQG  204



>ref|XP_010545860.1| PREDICTED: cytochrome P450 87A3-like [Tarenaya hassleriana]
Length=540

 Score =   281 bits (718),  Expect(2) = 5e-128, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 175/243 (72%), Gaps = 2/243 (1%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             +  +K++K  L ERR +   ++   DF DY++ E+ KE T LTE IA+D++ +L+FA++E
Sbjct  289   ERAMKILKNMLQERREN--PRESPSDFFDYVIEELQKEGTILTEAIALDLMFVLLFASFE  346

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETV  989
             TTS A TLA+KFL+ +P VLK+L EEHE I+  R+  +S +TW EYRSM +T   INET 
Sbjct  347   TTSLALTLAIKFLSDYPSVLKRLTEEHEAILRNRDHADSGLTWKEYRSMTYTFQFINETA  406

Query  990   RLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQEL  1169
             RLA+I PAIFRK ++D + KGYTIP GW  M+CP +VHL+ ++Y+DPL FNPSRW G E 
Sbjct  407   RLANIVPAIFRKALRDIQFKGYTIPAGWAVMVCPPAVHLNPDRYEDPLVFNPSRWEGTES  466

Query  1170  HPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGF  1349
             + ASK FMAFGG  R C G +F K+ MA  LH LVTKY+W+ +  GNI+R PGL F +G+
Sbjct  467   NSASKHFMAFGGGMRFCVGTDFTKVQMAAFLHCLVTKYRWQEISGGNILRTPGLQFPNGY  526

Query  1350  KVQ  1358
              V+
Sbjct  527   HVR  529


 Score =   206 bits (524),  Expect(2) = 5e-128, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 144/205 (70%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W      S L+++I +WVYRWRNPKC+G LPPGSMGFP++GE+IQFF  ++   IP FI+
Sbjct  64   WAFCIWASLLLVSITYWVYRWRNPKCRGDLPPGSMGFPLLGETIQFFKPNTTSDIPSFIK  123

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +R  +YG++F+TS+VG+ VIVST+ E+++F+FQQEG+    WY ++  +I G Q     H
Sbjct  124  ERTKKYGTIFKTSLVGRPVIVSTEPELSYFVFQQEGRCFQSWYPDTFTEIFGRQNVGSLH  183

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ L L G E LK+ +L E++Q A + L+ W+   ++++K AT  M+F L A
Sbjct  184  GFMYKYLKNMVLTLFGHEGLKK-MLPEIEQIACRKLEQWSTQDSVELKDATASMIFDLTA  242

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D +K+ E LR+ + AF+ G
Sbjct  243  KKLISHDPEKSSENLRENFVAFIRG  267



>ref|XP_010533714.1| PREDICTED: cytochrome P450 87A3 [Tarenaya hassleriana]
Length=477

 Score =   287 bits (734),  Expect(2) = 6e-128, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  ++++K  L ERR +   +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  223   KGRERAMRMLKNMLQERRGN--PRKNPSDFFDYVIEELQKEGTILTEEIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TL++KFL  +P VLK+L EEHE I+  RED +S +TW EYRSM +T   IN
Sbjct  281   SFETTSLALTLSIKFLTDYPSVLKRLTEEHEAILREREDPDSELTWKEYRSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK ++D + KGYTIP GW  M+CP +VHL+ ++Y+ PL FNPSRW  
Sbjct  341   ETARLANIVPAIFRKALRDIQFKGYTIPGGWTVMVCPPAVHLNPDRYEYPLVFNPSRWEA  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E + ASK FMAFGG  R C G +F KL MA+ LH LVTKY+W+ +  GNI+R PGL F 
Sbjct  401   SESNNASKNFMAFGGGMRFCVGTDFTKLQMAVFLHCLVTKYRWREISGGNIIRTPGLQFP  460

Query  1341  DGFKVQ  1358
             +G++V+
Sbjct  461   NGYRVK  466


 Score =   200 bits (508),  Expect(2) = 6e-128, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 140/205 (68%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +    S  +I+I HWVYRWRNPKC+G LPPGSMG P++GE++QFF  ++   IP FI+
Sbjct  2    WALCIWASLFLISITHWVYRWRNPKCRGNLPPGSMGLPLLGETLQFFRPNTSSDIPSFIK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +R  +YG +F+TS+VG+ VIVST+ E+++F+FQQEG+    WY E+  +I G Q     H
Sbjct  62   ERTKKYGPVFKTSLVGRPVIVSTEPELSYFVFQQEGRCFQSWYPETFTEIFGRQNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ L L G E LK+ +L E++Q A + LD W++  + ++K  T  M+F L A
Sbjct  122  GFMYKYLKNMVLTLFGHEGLKK-MLPEIEQIACRKLDLWSSQDSAELKDETASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D   + E LR+ + AF++G
Sbjct  181  KKLISHDPGNSSENLRENFVAFIKG  205



>emb|CBI31826.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   283 bits (724),  Expect(2) = 1e-127, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 175/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K I+  L+ERR+S   +++ KD++D++L E+ K++T LTE+I +D++  L FA
Sbjct  227   QGRKRAMKTIRNMLDERRAS--PEREDKDYIDFVLEEMQKDQTILTEEIVLDLLFALPFA  284

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              YETTSSA  LA+++L  HP  L ++ +EHE I+ +RE  +S ITWNEY+SM FT MVIN
Sbjct  285   TYETTSSALVLAIQYLGSHPSALAEITKEHESILRSRERVDSGITWNEYKSMNFTMMVIN  344

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRL +I P IFRKV +D EIKGYTIP GWM MI P +VH +   Y DPL FNP RW  
Sbjct  345   ETVRLGNIVPGIFRKVAKDIEIKGYTIPAGWMVMISPPAVHFNPTLYKDPLVFNPWRWQC  404

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             QE +  S+ FM FGG  R C GAEF KL MAI LH+L+TKY+W V+  G+ V KPGL F 
Sbjct  405   QEPNAGSRNFMGFGGGIRQCVGAEFVKLQMAIFLHHLLTKYRWTVIKGGDTVWKPGLVFP  464

Query  1341  DGFKVQ  1358
              GF VQ
Sbjct  465   KGFHVQ  470


 Score =   203 bits (516),  Expect(2) = 1e-127, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 134/205 (65%), Gaps = 1/205 (0%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W      + L++ I HWVY +R PK  G LPPGSMG PI+GE++QFF  ++   + PFI+
Sbjct  5    WYAFAFTATLLVCITHWVYSFRKPKFNGKLPPGSMGLPILGETLQFFAPNTALDVAPFIR  64

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +R+ RYG LFRTS+VG  +++STD +++ FI QQEGKLVH WYTES   + G Q  +   
Sbjct  65   ERMNRYGPLFRTSLVGWPLVISTDPDLSRFILQQEGKLVHSWYTESFDNVVGKQNVLSAK  124

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  HK LRNL LN  G E+LK   LT++++   +HL  W+  +++++K+A   M+F   A
Sbjct  125  GAMHKCLRNLILNQFGSESLKTRFLTQVEELVLKHLQLWSNCTSVELKEAIASMIFGFTA  184

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K+  YDE +  E LR+ Y AF++G
Sbjct  185  KKLFDYDESRTPEKLRENYAAFLDG  209



>ref|XP_007149239.1| hypothetical protein PHAVU_005G053400g [Phaseolus vulgaris]
 gb|ESW21233.1| hypothetical protein PHAVU_005G053400g [Phaseolus vulgaris]
Length=477

 Score =   285 bits (728),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 176/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K +K  L ERR     +K+  DF DY++ E+ KE T L E++A+D++  L+FA
Sbjct  222   QGRKRAMKTLKSMLKERREK--PRKEVSDFFDYVVEELSKEGTPLNEEMALDLMFTLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+K L+ HP VLK+LQEEHE I+  RED  S +TW+EY+SM FT  VIN
Sbjct  280   SFETTSLALTYAIKELSHHPSVLKKLQEEHEGILKGREDPNSELTWHEYKSMTFTFQVIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+RLA+I P IFRK +Q+ +  GYTIP GW  M+CP +VHL+   YDDPLSFNPSRW G
Sbjct  340   ETIRLANIVPGIFRKTLQEIKYGGYTIPAGWAIMVCPPAVHLNPTIYDDPLSFNPSRWVG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              ++ PASK  M FGG  R C GA+FAK+ MA+ LH LVTKY+W+ +  GNIVR  GL F 
Sbjct  400   MDMSPASKHLMGFGGGIRFCVGADFAKVQMAVFLHNLVTKYRWRPIKGGNIVRNLGLQFP  459

Query  1341  DGFKVQ  1358
             +GF V+
Sbjct  460   EGFYVR  465


 Score =   200 bits (509),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 136/207 (66%), Gaps = 2/207 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
            V+ L +   I I HWVYRWRNP C G LPPGSMG P++GES++FFT +S   I PFI+Q+
Sbjct  3    VLCLATLFFIGITHWVYRWRNPSCNGKLPPGSMGLPLLGESLKFFTPYSSSDIHPFIKQK  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            V RYG +F+T   G+  +VSTD + N+ IFQQEG++   WY ++  +I G Q     HG 
Sbjct  63   VERYGPIFKTGFAGRPTVVSTDQKFNNLIFQQEGEMFQSWYPDTLNKIFGRQNLSSLHGS  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
              KY++N+ L++ GPE LK+ +L+E++Q A   L  W+    L++  AT+ M+F+L A K
Sbjct  123  VFKYVKNMVLHMFGPEGLKR-MLSEVEQKACTTLQQWSCQDTLELCDATKRMIFELTAKK  181

Query  559  VLSYDEKKAME-LRKYYKAFMEGDVKM  636
            +LS D K+ +E L   + +FMEG + +
Sbjct  182  LLSCDSKETLESLMDNFNSFMEGLISL  208



>ref|XP_006417203.1| hypothetical protein EUTSA_v10007534mg [Eutrema salsugineum]
 gb|ESQ35556.1| hypothetical protein EUTSA_v10007534mg [Eutrema salsugineum]
Length=474

 Score =   283 bits (723),  Expect(2) = 3e-127, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +K+++  L ERR     +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  223   KGRENAMKMLRNMLQERRKK--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED +S +TW EY+SM +T   IN
Sbjct  281   SFETTSLALTLAIKFLSDDPAVLKRLTEEHETILKKREDADSGLTWEEYKSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK + D + K YTIP GW  M+CP +VHL+ +KY+DPL FNPSRW  
Sbjct  341   ETARLANIVPAIFRKALIDIKFKDYTIPAGWAVMVCPPAVHLNPDKYEDPLVFNPSRWEE  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              + + ASK FMAFGG  R C G +F KL MA+ LH LVTKY+W+ +  GNI+R PGL F 
Sbjct  401   SKANNASKHFMAFGGGMRFCVGTDFTKLQMAVFLHSLVTKYRWEEIKGGNILRTPGLQFP  460

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  461   NGYHVK  466


 Score =   202 bits (513),  Expect(2) = 3e-127, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 143/205 (70%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +    S L+I+I HWVY WRNPKC+G LPPGSMGFP++GE+IQFF  ++   IPPF++
Sbjct  2    WALFIWASLLLISITHWVYSWRNPKCRGKLPPGSMGFPLLGETIQFFKPNTTSDIPPFVR  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +RV +YG +F+T++VG+ VIVSTD ++++F+FQQEG+    WY ++   I G +     H
Sbjct  62   ERVKKYGPIFKTNLVGRPVIVSTDPDLSYFVFQQEGRCFQSWYPDTFTNIFGKKNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+++ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKSMVLTLFGYDGLKK-MLPQVELTANKRLELWSNQESVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D  K+ E LR  + AF++G
Sbjct  181  KKLISHDPDKSSENLRANFVAFIQG  205



>ref|XP_009118059.1| PREDICTED: cytochrome P450 87A3-like [Brassica rapa]
Length=472

 Score =   283 bits (724),  Expect(2) = 4e-127, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +K+++  L ERR     +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  223   KGRENAMKMLRNMLQERRKK--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED ES +TW EY+SM +T   IN
Sbjct  281   SFETTSLALTLAIKFLSDDPEVLKRLTEEHETILRNREDAESGLTWEEYKSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK + D + K YTIP GW  M+CP +VHL+ +KY+DPL FNPSRW  
Sbjct  341   ETARLANIVPAIFRKALIDIKYKDYTIPAGWAVMVCPPAVHLNPDKYEDPLVFNPSRWEE  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              + + ASK FMAFGG  R C G +F KL MA+ LH LVTKY+W+ +  GNI+R PGL F 
Sbjct  401   SKSNNASKHFMAFGGGMRFCVGTDFTKLQMAVFLHSLVTKYRWEEIKGGNILRTPGLQFP  460

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  461   NGYHVK  466


 Score =   201 bits (511),  Expect(2) = 4e-127, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 141/205 (69%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +   +S L+I I HWVY WRNPKC+G LPPGSMGFP++GE+IQFF  +    IPPFI+
Sbjct  2    WALFIWVSLLLITITHWVYSWRNPKCRGKLPPGSMGFPLLGETIQFFKPNPTSDIPPFIK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            QRV ++G +F+T++VG+ VIVSTD ++++F+FQQEG+    WY ++   I G +     H
Sbjct  62   QRVKKHGPIFKTNLVGRPVIVSTDPDLSYFVFQQEGRCFQSWYPDTFTNIFGKKNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+++ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKSMVLTLFGYDGLKK-MLPQVELTANKRLELWSNQESVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D  K+ E LR  + AF+ G
Sbjct  181  KKLISHDPDKSSENLRANFVAFIRG  205



>ref|XP_006391779.1| hypothetical protein EUTSA_v10023919mg [Eutrema salsugineum]
 gb|ESQ29065.1| hypothetical protein EUTSA_v10023919mg [Eutrema salsugineum]
Length=480

 Score =   286 bits (731),  Expect(2) = 5e-127, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K+++  L ERR     ++   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  224   KGRERAMKMLRNMLQERRDK--PRENPSDFFDYVIEELKKEGTILTEEIALDLMFVLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+Q P VLK+L EEHE I+  RED  S +TW EY+SM +T   IN
Sbjct  282   SFETTSLALTLAIKFLSQDPSVLKRLTEEHEAILRNREDAHSGLTWKEYKSMTYTFQFIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I PAIFRK ++D + K YTIP GW  M+CP +VHL+ +KY DPL FNPSRW G
Sbjct  342   ETVRLANIVPAIFRKALRDIQYKNYTIPAGWAVMVCPPAVHLNPDKYQDPLVFNPSRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E   ASK F+AFGG  R C G +F K+ MA+ LH LVTKY+W+ +  GNI+R PGL F 
Sbjct  402   SESTNASKNFLAFGGGMRFCVGTDFTKVQMAVFLHSLVTKYRWEEISGGNIIRTPGLQFP  461

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  462   NGYHVR  467


 Score =   198 bits (503),  Expect(2) = 5e-127, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 147/207 (71%), Gaps = 2/207 (1%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M W +   +S  +I+I  WVY+WRNPKC+G LPPGSMG P++GE+I FF  ++   IP F
Sbjct  1    MLWPLCIWVSLFLISITTWVYKWRNPKCRGKLPPGSMGLPLLGETIHFFKPNTTSDIPQF  60

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMV  366
            I++RV +YG +F+TS+VG+ VIVSTDS++++F+FQQEG+    WY ++  +I G Q    
Sbjct  61   IKERVKKYGPIFKTSLVGRPVIVSTDSDLSYFVFQQEGRCFQSWYPDTFTEIFGKQNVGS  120

Query  367  HHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKL  546
             HG  +KYL+++ L+L G E+LK+ +L E++++A + L+ W+   ++++K +T  ++F L
Sbjct  121  LHGFMYKYLKHMVLSLFGHESLKK-MLPEIEKSACKKLELWSNQDSVELKDSTASLIFDL  179

Query  547  AASKVLSYDEKKAME-LRKYYKAFMEG  624
             A K++S+D +K+ E LR+ + AF+ G
Sbjct  180  TAKKLISHDPEKSSENLRENFVAFIRG  206



>ref|XP_010494547.1| PREDICTED: cytochrome P450 87A3-like [Camelina sativa]
Length=472

 Score =   283 bits (723),  Expect(2) = 6e-127, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 176/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K++K  L ERR +   +K   DF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  223   QGREKAMKMLKSMLQERRKN--PRKVPSDFFDYVIEEIQKEGTILTEDIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL   P VLK+L EEHE I+  RED +S +TW EY+SM +T   IN
Sbjct  281   SFETTSLALTLAIKFLTDDPAVLKRLTEEHETILRNREDADSGLTWEEYKSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK ++D + K YTIP GW  M+CP +VHL+ EKY DPL FNPSRW G
Sbjct  341   ETARLANIVPAIFRKTLRDIKFKDYTIPAGWAVMVCPPAVHLNPEKYKDPLVFNPSRWEG  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              ++  ASK FMAFGG  R C G +F KL MA  LH LVTKY+W+ +  G+I+R PGL F 
Sbjct  401   SKVTNASKHFMAFGGGMRFCVGTDFTKLQMAAFLHTLVTKYRWEEIKGGDILRTPGLQFP  460

Query  1341  DGFKVQ  1358
             +G++V+
Sbjct  461   NGYQVR  466


 Score =   201 bits (510),  Expect(2) = 6e-127, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 143/205 (70%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +   +S L+I+I HWVY WRNPKC+G LPPGSMGFP++GE+IQFF  +    IPPF++
Sbjct  2    WALFIWVSLLLISITHWVYSWRNPKCRGKLPPGSMGFPLLGETIQFFKPNPTSDIPPFVK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +RV +YG +F+T++VG+ VIVSTD+++++F+FQQEG+    WY ++   I G       H
Sbjct  62   ERVKKYGPIFKTNLVGRPVIVSTDADLSYFVFQQEGRCFQSWYPDTFTNIFGRNNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+++ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKSMVLTLFGHDGLKK-MLPQVEITASKRLELWSNQDSVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S++  K+ E LR  + AF++G
Sbjct  181  KKLISHEPDKSSENLRANFVAFIQG  205



>ref|XP_010676534.1| PREDICTED: cytochrome P450 87A3 [Beta vulgaris subsp. vulgaris]
Length=481

 Score =   281 bits (719),  Expect(2) = 7e-127, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 181/252 (72%), Gaps = 4/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   +GRK  +K++K+ L +RR     KK+  DF DY+L E+ KE T LTE IA+D++
Sbjct  218   AFHKCLQGRKKAMKMLKDMLQKRR--MMPKKQSTDFFDYVLEELAKEGTPLTEGIALDLM  275

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
              +L+FA++ETTS A T+A+K+L+++P VL++L EEHE I+  RED  S +TW EY+SM +
Sbjct  276   FVLLFASFETTSLALTVAIKYLSEYPLVLQKLTEEHEAILKRREDPNSHLTWKEYKSMTY  335

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T  VINETVR+A+I P IFRK ++D   KGYTIP GW  M+CP +VHL+  +Y++PL FN
Sbjct  336   TFQVINETVRVANIVPGIFRKALRDVSFKGYTIPAGWGVMVCPPAVHLNPARYENPLEFN  395

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             PSRW G E++ ASK FMAFGG  R C G +F K+ MA+ LH LVTKY+W     G+IVR 
Sbjct  396   PSRWEGGEINGASKHFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYRWNPTKGGSIVRT  455

Query  1323  PGLTFLDGFKVQ  1358
             PGL F DG  ++
Sbjct  456   PGLQFPDGLHIR  467


 Score =   202 bits (514),  Expect(2) = 7e-127, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 147/207 (71%), Gaps = 2/207 (1%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M+ + + LI+  +I+I  W+YRW NP+C G LPPGSMG+P++GE+++FF  ++   IPPF
Sbjct  1    MSPIALSLIAVAIISITRWLYRWWNPRCNGKLPPGSMGWPLLGETLRFFAPNTSFDIPPF  60

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMV  366
            ++ R+ RYG +F+TS+VG+ +IVS D E+++ IFQQEG+    WY ++  +I G Q    
Sbjct  61   VKNRMKRYGPIFKTSLVGRPIIVSADPELSYLIFQQEGQTFQSWYPDTFTEIFGKQNVGS  120

Query  367  HHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKL  546
             HG  +KYL+N+ L+L GPE+LK+ +L E+++T  + ++ WT L +++IK AT  M+F L
Sbjct  121  LHGFMYKYLKNMVLSLFGPESLKK-MLPEVEETVLKQMNQWTKLDSVEIKDATASMIFNL  179

Query  547  AASKVLSYDEKKAME-LRKYYKAFMEG  624
             A K++S+D + + E LR+ + AF++G
Sbjct  180  TAKKLISHDAENSSENLRENFVAFIKG  206



>ref|XP_010545904.1| PREDICTED: cytochrome P450 87A3-like [Tarenaya hassleriana]
Length=503

 Score =   283 bits (723),  Expect(2) = 7e-127, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  ++++K  L ERR +   +K   DF DY++ E+ KE T LTE IA+D++ +LIFA
Sbjct  253   KGRERAMQMLKNMLKERREN--PRKNPSDFYDYVIEELQKEGTILTEAIALDLMFVLIFA  310

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ +P VLK+L EEHE I+  RED +S +TW EYRSM +T   IN
Sbjct  311   SFETTSLALTLAIKFLSDYPSVLKRLTEEHEAILRNREDPDSGLTWEEYRSMTYTFQFIN  370

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+IAP +FRK ++D+  KGYTIP GW  +ICP +VHL+ + Y+DPL FNPSRW G
Sbjct  371   ETARLANIAPVLFRKALKDYHFKGYTIPAGWGLIICPPAVHLNPDTYEDPLIFNPSRWEG  430

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E   ASK FMAFGG  RLC GA+FAK+ MA+ LH L TKY  + +  G+ +R PGL F 
Sbjct  431   LETSNASKHFMAFGGGMRLCVGADFAKMQMAVFLHCLTTKYSLQEIGGGDTIRSPGLQFP  490

Query  1341  DGFKVQ  1358
             +G+ +Q
Sbjct  491   NGYHIQ  496


 Score =   201 bits (510),  Expect(2) = 7e-127, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 143/211 (68%), Gaps = 2/211 (1%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M W +  L S L+I I  WVYRWRNPKC G LPPGSM FP++GE++QF   +    IPPF
Sbjct  30   MMWALSILASLLLIGITRWVYRWRNPKCNGTLPPGSMAFPLLGETLQFLKPNITSDIPPF  89

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMV  366
            I+ R  +YG +F+TS+ GQ VIVSTD+E+N+F+FQQEG+L    Y ++  +I G Q    
Sbjct  90   IKDRTRKYGPIFKTSLFGQPVIVSTDAELNYFVFQQEGQLFQSSYPDTFVRIFGRQNLST  149

Query  367  HHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKL  546
             HG  +KYL+N+ L LVG E LK+ +L E++Q AR+ L  W+  +++++K AT  M+F  
Sbjct  150  LHGFMYKYLKNMVLTLVGHEGLKK-MLPEIEQVARRKLGLWSTQNSIELKDATARMIFDF  208

Query  547  AASKVLSYDEKKAME-LRKYYKAFMEGDVKM  636
             A K++S+D +K+ E LR+ + AF+ G + +
Sbjct  209  TAKKLISHDPEKSSENLRENFDAFIRGLISL  239



>ref|XP_010476246.1| PREDICTED: cytochrome P450 87A3-like [Camelina sativa]
Length=472

 Score =   282 bits (721),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 175/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K++K  L ERR +   +K   DF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  223   QGREKAMKMLKSMLQERRKN--PRKVPSDFFDYVIEEIQKEGTILTEDIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL   P VLK+L EEHE I+  RED +S +TW EY+SM +T   IN
Sbjct  281   SFETTSLALTLAIKFLTDDPAVLKRLTEEHETILRNREDADSGLTWEEYKSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK ++D + K YTIP GW  M+CP +VHL+ EKY DPL FNPSRW G
Sbjct  341   ETARLANIVPAIFRKTLRDIKFKDYTIPAGWAVMVCPPAVHLNPEKYKDPLVFNPSRWEG  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              ++  ASK FMAFGG  R C G +F KL MA  LH LVTKY+W+ +  G+I+R PGL F 
Sbjct  401   SKVTNASKHFMAFGGGMRFCVGTDFTKLQMAAFLHTLVTKYRWEEIKGGDILRTPGLQFP  460

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  461   NGYHVR  466


 Score =   201 bits (510),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 143/205 (70%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +   +S L+I+I HWVY WRNPKC+G LPPGSMGFP++GE+IQFF  +    IPPF++
Sbjct  2    WALFIWVSLLLISITHWVYSWRNPKCRGRLPPGSMGFPLLGETIQFFKPNPTSDIPPFVK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +RV +YG +F+T++VG+ VIVSTD+++++F+FQQEG+    WY ++   I G       H
Sbjct  62   ERVKKYGPIFKTNLVGRPVIVSTDADLSYFVFQQEGRCFQSWYPDTFTNIFGRNNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+++ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKSMVLTLFGHDGLKK-MLPQVEITASKRLELWSNQDSVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S++  K+ E LR  + AF++G
Sbjct  181  KKLISHEPDKSSENLRANFVAFIQG  205



>ref|NP_001184974.1| cytochrome P450, family 87, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 gb|AEE28920.1| cytochrome P450, family 87, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=478

 Score =   280 bits (717),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 174/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR   +K+++  L ERR +   +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  229   QGRAKAMKMLRNMLQERREN--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED +S +TW EY+SM +T   IN
Sbjct  287   SFETTSLALTLAIKFLSDDPEVLKRLTEEHETILRNREDADSGLTWEEYKSMTYTFQFIN  346

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK ++D + K YTIP GW  M+CP +VHL+ E Y DPL FNPSRW G
Sbjct  347   ETARLANIVPAIFRKALRDIKFKDYTIPAGWAVMVCPPAVHLNPEMYKDPLVFNPSRWEG  406

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              ++  ASK FMAFGG  R C G +F KL MA  LH LVTKY+W+ +  GNI R PGL F 
Sbjct  407   SKVTNASKHFMAFGGGMRFCVGTDFTKLQMAAFLHSLVTKYRWEEIKGGNITRTPGLQFP  466

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  467   NGYHVK  472


 Score =   202 bits (513),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 144/211 (68%), Gaps = 8/211 (4%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W ++  +S L+I+I HWVY WRNPKC+G LPPGSMGFP++GESIQFF  +    IPPFI+
Sbjct  2    WALLIWVSLLLISITHWVYSWRNPKCRGKLPPGSMGFPLLGESIQFFKPNKTSDIPPFIK  61

Query  193  QRV------TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQ  354
            +RV       RYG +F+T++VG+ VIVSTD+++++F+F QEG+    WY ++   I G +
Sbjct  62   ERVKNDVDMCRYGPIFKTNLVGRPVIVSTDADLSYFVFNQEGRCFQSWYPDTFTHIFGKK  121

Query  355  GFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIM  534
                 HG  +KYL+N+ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M
Sbjct  122  NVGSLHGFMYKYLKNMVLTLFGHDGLKK-MLPQVEMTANKRLELWSNQDSVELKDATASM  180

Query  535  LFKLAASKVLSYDEKKAME-LRKYYKAFMEG  624
            +F L A K++S+D  K+ E LR  + AF++G
Sbjct  181  IFDLTAKKLISHDPDKSSENLRANFVAFIQG  211



>gb|AAF88087.1|AC025417_15 T12C24.27 [Arabidopsis thaliana]
Length=478

 Score =   274 bits (700),  Expect(2) = 4e-126, Method: Compositional matrix adjust.
 Identities = 132/252 (52%), Positives = 174/252 (69%), Gaps = 8/252 (3%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR   +K+++  L ERR +   +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  223   QGRAKAMKMLRNMLQERREN--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED +S +TW EY+SM +T   IN
Sbjct  281   SFETTSLALTLAIKFLSDDPEVLKRLTEEHETILRNREDADSGLTWEEYKSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIK------GYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             ET RLA+I PAIFRK ++D + K       YTIP GW  M+CP +VHL+ E Y DPL FN
Sbjct  341   ETARLANIVPAIFRKALRDIKFKEFVNDTDYTIPAGWAVMVCPPAVHLNPEMYKDPLVFN  400

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             PSRW G ++  ASK FMAFGG  R C G +F KL MA  LH LVTKY+W+ +  GNI R 
Sbjct  401   PSRWEGSKVTNASKHFMAFGGGMRFCVGTDFTKLQMAAFLHSLVTKYRWEEIKGGNITRT  460

Query  1323  PGLTFLDGFKVQ  1358
             PGL F +G+ V+
Sbjct  461   PGLQFPNGYHVK  472


 Score =   207 bits (526),  Expect(2) = 4e-126, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 144/205 (70%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W ++  +S L+I+I HWVY WRNPKC+G LPPGSMGFP++GESIQFF  +    IPPFI+
Sbjct  2    WALLIWVSLLLISITHWVYSWRNPKCRGKLPPGSMGFPLLGESIQFFKPNKTSDIPPFIK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +RV +YG +F+T++VG+ VIVSTD+++++F+F QEG+    WY ++   I G +     H
Sbjct  62   ERVKKYGPIFKTNLVGRPVIVSTDADLSYFVFNQEGRCFQSWYPDTFTHIFGKKNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKNMVLTLFGHDGLKK-MLPQVEMTANKRLELWSNQDSVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D  K+ E LR  + AF++G
Sbjct  181  KKLISHDPDKSSENLRANFVAFIQG  205



>ref|XP_010458707.1| PREDICTED: cytochrome P450 87A3-like [Camelina sativa]
Length=472

 Score =   279 bits (714),  Expect(2) = 4e-126, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 174/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K++K  L ERR +   +K   DF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  223   QGREKAMKMLKSMLQERRKN--PRKIPSDFFDYVIEEIQKEGTILTEDIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL   P VLK+L EEHE I+  R+D +S +TW EY+SM +T   IN
Sbjct  281   SFETTSLALTLAIKFLTDDPAVLKRLTEEHETILRNRKDADSGLTWEEYKSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK ++D + K YTIP GW  M+CP +VHL+ EKY DPL FNPSRW G
Sbjct  341   ETARLANIVPAIFRKTLRDIKFKDYTIPAGWAVMVCPPAVHLNPEKYKDPLVFNPSRWEG  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              +   ASK FMAFGG  R C G +F KL MA  LH LVTKY+W+ +  G+I+R PGL F 
Sbjct  401   SKATNASKHFMAFGGGMRFCVGTDFTKLQMAAFLHTLVTKYRWEEIKGGDILRTPGLQFP  460

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  461   NGYHVR  466


 Score =   201 bits (512),  Expect(2) = 4e-126, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 144/205 (70%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +   +S L+I+I HW+Y W+NPKCKG LPPGSMGFP++GE+IQFF  +S   IPPF++
Sbjct  2    WALFIWVSLLLISITHWIYSWKNPKCKGKLPPGSMGFPLLGETIQFFKPNSTSDIPPFVK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +RV +YG +F+T++VG+ VIVSTD+++++F+FQQEG+    WY ++   I G       H
Sbjct  62   ERVKKYGPIFKTNLVGRPVIVSTDADLSYFVFQQEGRCFQSWYPDTFTNIFGRNNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+++ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKSMVLTLFGHDGLKK-MLPQVEITASKRLELWSNQDSVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S++  K+ E LR  + AF++G
Sbjct  181  KKLISHEPDKSSENLRANFVAFIQG  205



>emb|CDY16028.1| BnaC08g40950D [Brassica napus]
Length=473

 Score =   279 bits (714),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 176/247 (71%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +K+++  L ERR     +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  223   KGRENAMKMLRNMLQERRKK--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFT-HMVI  977
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED ES +TW EY+SM +T    I
Sbjct  281   SFETTSLALTLAIKFLSDDPEVLKRLTEEHETILRNREDAESGLTWEEYKSMTYTFQQFI  340

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NET RLA+I PAIFRK + D   K YTIP GW  M+CP +VHL+ +KY+DPL FNPSRW 
Sbjct  341   NETARLANIVPAIFRKALIDINYKDYTIPAGWAVMVCPPAVHLNPDKYEDPLVFNPSRWE  400

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
               + + ASK FMAFGG  R C G +F KL MA+ LH LVTKY+W+ +  GNI+R PGL F
Sbjct  401   ESKSNNASKHFMAFGGGMRFCVGTDFTKLQMAVFLHSLVTKYRWEEIKGGNILRTPGLQF  460

Query  1338  LDGFKVQ  1358
              +G+ V+
Sbjct  461   PNGYHVK  467


 Score =   200 bits (509),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 140/205 (68%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +   +S L+I I HWVY WRNPKC+G LPPGSMGFP++GE+IQFF  +    IPPFI+
Sbjct  2    WALFIWVSLLLITITHWVYSWRNPKCRGKLPPGSMGFPLLGETIQFFKPNPTSDIPPFIK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            QRV ++G +F+T++VG+ VIVSTD +++ F+FQQEG+    WY ++   I G +     H
Sbjct  62   QRVKKHGPIFKTNLVGRPVIVSTDPDLSFFVFQQEGRCFQSWYPDTFTNIFGKKNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+++ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKSMVLTLFGYDGLKK-MLPQVELTANKRLELWSNQESVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D  K+ E LR  + AF+ G
Sbjct  181  KKLISHDPDKSSENLRANFVAFIRG  205



>emb|CDY60267.1| BnaC05g49310D [Brassica napus]
Length=473

 Score =   275 bits (704),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 176/247 (71%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +++++  L ERR     +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  223   KGRENAMRMLRNMLQERRRK--PRKNPIDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFT-HMVI  977
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED +S +TW EY+SM +T    I
Sbjct  281   SFETTSLALTLAIKFLSDDPEVLKRLTEEHETILRNREDADSGLTWEEYKSMTYTFQQFI  340

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NET RLA+I PAIFRK + D + K YTIP GW  M+CP +VHL+ ++Y+DPL FNPSRW 
Sbjct  341   NETARLANIVPAIFRKALIDIKYKDYTIPAGWAVMVCPPAVHLNPKRYEDPLVFNPSRWE  400

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
                 + ASK FMAFGG  R C G +F KL MA++LH LVTKY+W  +  GNIVR PGL F
Sbjct  401   ESTANNASKHFMAFGGGMRFCVGTDFTKLQMAVVLHSLVTKYRWVEIKGGNIVRTPGLHF  460

Query  1338  LDGFKVQ  1358
              +G+ V+
Sbjct  461   PNGYHVR  467


 Score =   202 bits (515),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 142/205 (69%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +   +S LVI+I HWVY WRNPKCKG LPPGSMG P++GE+IQFF  ++   IPPFI+
Sbjct  2    WALFIWVSLLVISITHWVYSWRNPKCKGKLPPGSMGLPLLGETIQFFKPNTTSDIPPFIK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +RV +YGS+F+T++VG+ VIVS D ++++F+FQQEG+    WY ++   I G       H
Sbjct  62   ERVKKYGSIFKTNLVGRTVIVSADPDLSYFVFQQEGRRFQSWYPDTFTNIFGKNNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+++ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GLMYKYLKSMVLTLFGYDGLKK-MLPQVELTANKRLELWSNQESVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D  K+ E LR  + AF++G
Sbjct  181  KKLISHDPDKSSENLRANFVAFIQG  205



>ref|XP_002889964.1| T12C24.27 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66223.1| T12C24.27 [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score =   273 bits (699),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 174/252 (69%), Gaps = 8/252 (3%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K+++  L ERR     +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  223   QGREKAMKMLRNMLQERRKK--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED +S +TW EY+SM +T   IN
Sbjct  281   SFETTSLAITLAIKFLSDDPAVLKRLTEEHETILRNREDADSGLTWEEYKSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIK------GYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             ET RLA+I PAIFRK + D + K       YTIP GW  M+CP +VHL+ E Y DPL FN
Sbjct  341   ETARLANIVPAIFRKALIDIKFKEFVNDADYTIPAGWAVMVCPPAVHLNPEMYKDPLVFN  400

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             PSRW G ++  ASK FMAFGG  R C G +F KL MA  LH LVTKY+W+ +  GNIVR 
Sbjct  401   PSRWEGSKVTNASKHFMAFGGGMRFCVGTDFTKLQMAAFLHSLVTKYRWEEIKGGNIVRT  460

Query  1323  PGLTFLDGFKVQ  1358
             PGL F +G+ V+
Sbjct  461   PGLQFPNGYHVK  472


 Score =   204 bits (519),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 143/205 (70%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +   ++ L+I+I HWVY WRNPKC+G LPPGSMGFP++GE+IQFF  +    IPPFI+
Sbjct  2    WALFIWVTLLLISITHWVYSWRNPKCRGKLPPGSMGFPLLGETIQFFKPNKTSDIPPFIK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +RV +YG +F+T++VG+ VIVSTD+++++F+F QEG+    WY ++   I G +     H
Sbjct  62   ERVKKYGPIFKTNLVGRPVIVSTDADLSYFVFNQEGRCFQSWYPDTFTHIFGEKNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKNMVLTLFGHDGLKK-MLPQVEMTANKRLELWSNQDSVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D  K+ E LR  + AF++G
Sbjct  181  KKLISHDPDKSSENLRANFVAFIQG  205



>ref|XP_009148571.1| PREDICTED: cytochrome P450 87A3 [Brassica rapa]
Length=476

 Score =   280 bits (717),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 175/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +++++  L ERR     +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  223   KGRENAMRMLRNMLQERRKK--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+  P VL++L EEHE I+  RED  S +TW EY+SM +T   IN
Sbjct  281   SFETTSLALTLAIKFLSDDPKVLRRLTEEHETILRNREDANSGLTWEEYKSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK + D + K YTIP GW  M+CP +VHL+ +KY+DPL FNPSRW  
Sbjct  341   ETARLANIVPAIFRKALIDIKYKDYTIPAGWAVMVCPPAVHLNPKKYEDPLVFNPSRWEE  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
                + ASK FMAFGG  R C G +F KL MA+ LH LVTKY+W+ +  GNIVR PGL F 
Sbjct  401   SNANDASKHFMAFGGGMRFCVGTDFTKLQMAVFLHSLVTKYRWEEIKGGNIVRTPGLQFP  460

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  461   NGYHVR  466


 Score =   197 bits (501),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 139/205 (68%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +   +S LVI + HWVY WRNPKCKG LPPGSMG P++GE+ QFF  ++   IPPFI+
Sbjct  2    WALFIWVSLLVITVTHWVYSWRNPKCKGKLPPGSMGLPLLGETFQFFKPNTTSDIPPFIK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +RV +YG +F+T++VG+ VIVS D ++++F+FQQEG+    WY ++   I G       H
Sbjct  62   ERVKKYGPIFKTNLVGRPVIVSADPDLSYFVFQQEGRRFQSWYPDTFTNIFGKNNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+++ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKSMVLTLFGYDGLKK-MLPQVELTANKRLELWSNQESVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D  ++ E LR  + AF++G
Sbjct  181  KKLISHDPDESSENLRANFVAFIQG  205



>ref|XP_010055601.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Eucalyptus grandis]
Length=509

 Score =   270 bits (690),  Expect(2) = 6e-125, Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 180/278 (65%), Gaps = 34/278 (12%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  ++++K  + ER+++   KK + DF DY+L E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGREKAMRMLKNLMQERQAT--PKKHRSDFFDYVLEELQKEGTLLTEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQL--------------------------------QE  884
             ++ETTS A TLA+KFL+ HP VLKQL                                QE
Sbjct  280   SFETTSLALTLAIKFLSDHPRVLKQLTVCKILPFWFHCIILPIGLKCWQTFPESLCLWQE  339

Query  885   EHEKIIAAREDKESSITWNEYRSMKFTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIP  1064
             EHE I+  R+D    ++W EY+ M +T   INETVRLA+I P IFR+ ++D + KGYTIP
Sbjct  340   EHEAILRKRDDATPGLSWKEYKLMTYTFQFINETVRLANIVPGIFRRALRDIQFKGYTIP  399

Query  1065  RGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKL  1244
              GW  + CP +VHL+  KY+DPLSF+P RW G E++ ASK FMAFGG  R C G +F K+
Sbjct  400   AGWAVVACPPAVHLNPMKYEDPLSFDPERWEGIEVNGASKHFMAFGGGMRFCVGTDFTKV  459

Query  1245  AMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGFKVQ  1358
              MA+ LH LVTKY+W+++  GNIVR PGL F DGF +Q
Sbjct  460   QMAVFLHCLVTKYRWQIIKGGNIVRTPGLQFPDGFHIQ  497


 Score =   207 bits (526),  Expect(2) = 6e-125, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 140/198 (71%), Gaps = 2/198 (1%)
 Frame = +1

Query  34   SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            + ++I+I HWVYRWRNP+C G LPPGSMG+P++GE++QFFT ++   I PFI++R+ RYG
Sbjct  8    ALIIISITHWVYRWRNPRCDGKLPPGSMGWPLLGETLQFFTPNTTHDIAPFIKERMERYG  67

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYL  393
             +FRTS+VG+ V+VSTD + +H IFQQEG LV  WY ++  +I G Q     HG  ++YL
Sbjct  68   PIFRTSLVGRPVVVSTDPDFSHLIFQQEGHLVESWYPDTFTEIFGRQNVGSLHGIMYRYL  127

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD  573
            +N+ L L GPE+LK+ +L E+++ A Q L  W+    +++K AT  M+F L A K++S+D
Sbjct  128  KNMVLYLFGPESLKK-MLPEIEEVAIQRLKQWSNQDKVEVKDATASMIFHLTAKKLISHD  186

Query  574  EKKAME-LRKYYKAFMEG  624
               + E LR  + AF++G
Sbjct  187  SDSSPENLRANFDAFIKG  204



>ref|XP_010545893.1| PREDICTED: cytochrome P450 87A3-like [Tarenaya hassleriana]
Length=474

 Score =   281 bits (719),  Expect(2) = 6e-125, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K++K  LNERR +  ++K   DF DY+L E+ KE + LTE+IA+D+I  ++FA
Sbjct  224   KGRERAMKMLKNMLNERRKT--QRKNPSDFFDYVLRELQKEGSILTEEIALDLIFSMLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ +P  LK+L EEHE I+  RE  +S +TW EYRSM +T   IN
Sbjct  282   SFETTSLALTLAIKFLSDYPSALKRLTEEHEGILRNREVSDSGLTWEEYRSMTYTFQFIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+IAP +FRK ++D + KGYTIP GW  +ICP +VHL+ + Y+DPL FNPSRW G
Sbjct  342   ETARLANIAPVLFRKALEDTQFKGYTIPAGWEVVICPPAVHLNPDIYEDPLVFNPSRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E   ASK FMAFGG  RLC+G +FAKL +A+ +H L+TK++W  +  G+ +R PGL F 
Sbjct  402   SETSNASKHFMAFGGGMRLCSGTDFAKLEIAVFIHCLITKFRWNKIGRGDAIRSPGLQFP  461

Query  1341  DGFKVQ  1358
             +G+ +Q
Sbjct  462   NGYHIQ  467


 Score =   196 bits (497),  Expect(2) = 6e-125, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 143/211 (68%), Gaps = 2/211 (1%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M W +  L S L+I I  W+YRWRNPKC G+LPPGSM  P++GE++QF  S+    IP F
Sbjct  1    MMWALSILASLLLIGITRWIYRWRNPKCNGILPPGSMALPLLGETLQFLKSNITSDIPHF  60

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMV  366
            +++R  +YG +F+TS+ GQ VIVSTD+E+NHF+FQQEG+L    Y ++  +I G Q    
Sbjct  61   VKERARKYGPIFKTSLFGQSVIVSTDAELNHFVFQQEGQLFQSSYPDTFNEILGRQNIGS  120

Query  367  HHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKL  546
             HG  HKY++N+ L  VG E LK+ +L E++Q   + L+ W+  +++++K AT  M+F  
Sbjct  121  LHGYMHKYIKNMILTFVGHEALKK-MLPEIEQVTCKKLELWSTQASVELKDATAGMIFDF  179

Query  547  AASKVLSYDEKKAME-LRKYYKAFMEGDVKM  636
             A K++S+D +K+ E +R+Y+ AF+ G + +
Sbjct  180  TAKKLISHDSEKSSENIREYFDAFIRGLISL  210



>ref|XP_006442982.1| hypothetical protein CICLE_v10019989mg [Citrus clementina]
 ref|XP_006478738.1| PREDICTED: cytochrome P450 87A3-like [Citrus sinensis]
 gb|ESR56222.1| hypothetical protein CICLE_v10019989mg [Citrus clementina]
Length=475

 Score =   275 bits (702),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 174/246 (71%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK++ K+I++   ER+++   K    DFLD +L EV+KE   L +  A+D++ +L+FA
Sbjct  226   KGRKHIRKVIEDIYQERKAT---KVPGHDFLDRVLEEVEKENAVLNDSNAIDLLFVLLFA  282

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A+ET S + TL  K L  HP VL +L EEHE II+ RED+ S +TW EY+SM FTHMVIN
Sbjct  283   AFETVSQSITLITKHLTDHPQVLAELTEEHEGIISRREDENSEVTWEEYKSMTFTHMVIN  342

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E VRLA+I P  FRKV++D E+ GYTIP GW+ M+    VH  A+KY+DPL+FNP RW G
Sbjct  343   EIVRLANIIPVTFRKVLKDMELDGYTIPAGWVIMMVLPLVHFDADKYEDPLAFNPWRWKG  402

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +ELH  +K FM FGG  R CAGA+FAK+ +A+ +HYLVTKY+W VV  G + ++P L F 
Sbjct  403   KELHTGTKTFMGFGGGVRPCAGADFAKVHLAVYIHYLVTKYRWSVVKGGEVFKQPALKFP  462

Query  1341  DGFKVQ  1358
             +G  V+
Sbjct  463   NGLHVK  468


 Score =   201 bits (511),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 133/195 (68%), Gaps = 2/195 (1%)
 Frame = +1

Query  52   IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            I+HWVY W NPKC G LPPGSMG PIIGE+IQFFT +SL    PFI++R+ RYGS+FRT+
Sbjct  16   ISHWVYTWANPKCNGKLPPGSMGLPIIGETIQFFTPYSLYETQPFIKKRMARYGSVFRTN  75

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALN  411
            I GQKVIVSTD   N+ I   E + +  W T+  + I G Q F+  HG  HKYLR+L L+
Sbjct  76   IAGQKVIVSTDPVTNYSIMNTENESLLFWCTDGLSHIFGNQNFLSQHGSVHKYLRSLVLH  135

Query  412  LVGPENLKQTLLTEMDQTARQHLDHW-TALSNLDIKQATEIMLFKLAASKVLSYDEKK-A  585
            L G E L+Q  L E+DQT R HL  W ++   ++++ A   M+F+ +A K++SYDE K +
Sbjct  136  LTGREILRQKFLHEIDQTTRSHLHSWASSPGTVNVRDACAEMIFESSAKKLISYDESKYS  195

Query  586  MELRKYYKAFMEGDV  630
             +LR+ Y+AF  G V
Sbjct  196  KKLRQNYRAFKLGIV  210



>ref|XP_008799522.1| PREDICTED: cytochrome P450 87A3 [Phoenix dactylifera]
Length=467

 Score =   280 bits (715),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 177/246 (72%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN +K++K  L ER++S   +++  DF D ++ E+ KE   +TE IA+D++ +L+FA
Sbjct  220   QGRKNAMKVLKTMLKERQNS--PRRQCVDFFDSVIEELKKERPVITETIALDLMFVLLFA  277

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+K L  HP VL++L EEHE I+  RE+ +S ITWNEY+SM FT  VIN
Sbjct  278   SFETTSLALTAAMKLLTDHPRVLEELTEEHEAILKNRENPDSGITWNEYKSMSFTFQVIN  337

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I P IFRK ++D +IKG+TIP GW  M+CP +VHL+ E Y+DPL+FNP RW  
Sbjct  338   ETARLANIVPGIFRKTMEDIKIKGFTIPAGWGVMVCPPAVHLNPEIYEDPLAFNPWRWK-  396

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL   SK FMAFGG  R C GA+F KL MAI LH LVTKYK + +  GN+VR PGL F 
Sbjct  397   LELTGGSKNFMAFGGGLRFCVGADFTKLQMAIFLHCLVTKYKCRAIRGGNMVRTPGLGFP  456

Query  1341  DGFKVQ  1358
             DG+ +Q
Sbjct  457   DGYHIQ  462


 Score =   196 bits (497),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 136/197 (69%), Gaps = 1/197 (1%)
 Frame = +1

Query  37   FLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGS  216
             L I +  W YRWRNP+C G LP GSMG P+IGE++QFFT ++   +PPF+++R+ +YG 
Sbjct  6    LLAIWLIQWAYRWRNPRCSGRLPAGSMGLPLIGETLQFFTPNATSDVPPFVKERMKKYGP  65

Query  217  LFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLR  396
            +F+TS+VG+ ++VSTD E+NHF+FQQEGKL   WY ++  +I G       HG  +KYL+
Sbjct  66   VFKTSLVGRPLVVSTDPELNHFVFQQEGKLFQSWYPDTFTEIFGRDNVGSLHGFMYKYLK  125

Query  397  NLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDE  576
            +L L L GPE+LK+ LL +++++    L  W+   ++++K+AT  M+F L A K++SYD 
Sbjct  126  SLVLRLFGPESLKENLLHDVEKSVSNSLSSWSGQPSVELKEATSKMIFDLTAKKLISYDP  185

Query  577  KKAME-LRKYYKAFMEG  624
              + E LRK + AF+ G
Sbjct  186  SSSSENLRKNFVAFIRG  202



>ref|XP_010545882.1| PREDICTED: cytochrome P450 87A3-like [Tarenaya hassleriana]
Length=472

 Score =   273 bits (698),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 127/246 (52%), Positives = 170/246 (69%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR   +K++K  L ERR +   +    DF DY++ E+ KE T +TE+IA+ +I +L+FA
Sbjct  223   KGRDMAMKMLKNMLKERREN--PRNNPSDFFDYVMEELQKEGTAMTEEIAIALIFLLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+ HP VLK+L EEHE I+  RE   S +TW EYRSM +T   IN
Sbjct  281   SFETTSLALTLAVKFLSDHPSVLKRLTEEHEAILRNREASHSGLTWEEYRSMTYTFQFIN  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RL +I PA+FRKV++D + KGYTIP GW   +CP++VHL+   YDDPL+FNPSRW G
Sbjct  341   ETTRLGNILPAVFRKVLKDTQFKGYTIPAGWKLFVCPAAVHLNPNIYDDPLAFNPSRWEG  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
                   SK F+ FGG  RLC GA+F KL MA+ LH LVTKY+W  +  G+ +R P L F 
Sbjct  401   SGTSNVSKYFLPFGGGMRLCVGADFTKLEMAVFLHCLVTKYRWHEIGGGDTIRSPVLQFP  460

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  461   NGYHVR  466


 Score =   202 bits (513),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 144/213 (68%), Gaps = 7/213 (3%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M W +  L S L I I  WVYRWRNPKC G+LPPGSM FP++GE++QF   +    IP F
Sbjct  1    MMWALSILASLLFIGITRWVYRWRNPKCNGILPPGSMAFPLVGETLQFLKPNITSDIPSF  60

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMV  366
            I++R  +YG +F+TS+ GQ VI+STD+E+N+F+FQQEG+L    Y  +  +I G Q   +
Sbjct  61   IKERTRKYGPVFKTSLFGQPVIMSTDAELNYFVFQQEGQLFQSSYPVTFTKIFGRQ---L  117

Query  367  H--HGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLF  540
            H  HG  +KYL+N+ L LVG E LK+ +L E++Q AR+ L+ W+   ++++K AT  M+F
Sbjct  118  HSLHGFMYKYLKNMVLTLVGHEGLKK-MLPEIEQVARRKLEIWSTQDSVELKDATASMIF  176

Query  541  KLAASKVLSYDEKKAME-LRKYYKAFMEGDVKM  636
               A K++SYD +K+ E LR+ + AF+ G + +
Sbjct  177  DFTAKKLISYDPEKSSENLRENFDAFIRGLISL  209



>ref|XP_011072203.1| PREDICTED: cytochrome P450 87A3 [Sesamum indicum]
Length=490

 Score =   272 bits (695),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 174/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L +RR     +K   DF DY+L E+ +E+T L E IA+D++ +L+FA
Sbjct  224   QGRKKAMKMLKTMLQQRRER--PRKIGTDFFDYVLEELQREDTLLKEAIALDLMFVLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A  LA+KFL  HP  +K+L EEHE II  RE+ +S +TW EY+SMKFT   I+
Sbjct  282   SFETTSLALILAIKFLVDHPLAIKELTEEHEAIIRRRENPDSRLTWEEYKSMKFTFQFIH  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK ++D + KGYTIP GW  M+CP +VHL+  ++ +PL FNP RW G
Sbjct  342   ETVRLANIVPGIFRKALRDTKFKGYTIPAGWAVMVCPPAVHLNPARHTNPLEFNPWRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              + + AS+ FMAFGG  R C G +F+K+ MA+ LH LVTKYKW+ +  G+I+R PGL F 
Sbjct  402   VDTNAASRNFMAFGGGMRFCVGTDFSKVQMAVFLHCLVTKYKWEAIKGGDILRTPGLQFP  461

Query  1341  DGFKVQ  1358
             +G+ + 
Sbjct  462   NGYHIH  467


 Score =   203 bits (516),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 144/196 (73%), Gaps = 2/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            LVI I HW+Y W N +C G+LPPGSMG P +GE++QFF   +   I PF+++R+ RYG +
Sbjct  12   LVIIITHWLYTWWNLRCSGVLPPGSMGCPFLGETLQFFAPSNSFDILPFVKKRIQRYGPI  71

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TS+VG++VIVSTD+++N+FIFQQEG+L   WY +S  +I G Q     HG  +KYL+N
Sbjct  72   FKTSLVGRQVIVSTDADLNYFIFQQEGQLFQSWYPDSFTEIFGRQNVGSVHGFMYKYLKN  131

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD-E  576
            + LNL GPE+LK+ +L E++Q ++Q++  W++ +++++K+AT  M+F   A K++SYD E
Sbjct  132  MVLNLFGPESLKK-MLPEVEQVSKQNIRRWSSHTSVEMKEATAQMIFDFTAKKLISYDSE  190

Query  577  KKAMELRKYYKAFMEG  624
            K +  LR+ + AF++G
Sbjct  191  KSSDNLRESFVAFIQG  206



>emb|CDY26591.1| BnaA09g46860D [Brassica napus]
Length=460

 Score =   283 bits (724),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +K+++  L ERR     +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  211   KGRENAMKMLRNMLQERRKK--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  268

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED ES +TW EY+SM +T   IN
Sbjct  269   SFETTSLALTLAIKFLSDDPEVLKRLTEEHETILRNREDAESGLTWEEYKSMTYTFQFIN  328

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK + D + K YTIP GW  M+CP +VHL+ +KY+DPL FNPSRW  
Sbjct  329   ETARLANIVPAIFRKALIDIKYKDYTIPAGWAVMVCPPAVHLNPDKYEDPLVFNPSRWEE  388

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              + + ASK FMAFGG  R C G +F KL MA+ LH LVTKY+W+ +  GNI+R PGL F 
Sbjct  389   SKSNNASKHFMAFGGGMRFCVGTDFTKLQMAVFLHSLVTKYRWEEIKGGNILRTPGLQFP  448

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  449   NGYHVK  454


 Score =   189 bits (479),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 134/205 (65%), Gaps = 14/205 (7%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +   +S L+I I HWVY WRNPKC+G LPPGSMGFP++GE+IQFF  +    IPPFI+
Sbjct  2    WALFIWVSLLLITITHWVYSWRNPKCRGKLPPGSMGFPLLGETIQFFKPNPTSDIPPFIK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            QRV ++G +F+T++VG+ VIVSTD ++++F+FQQEG+    WY ++   I G +     H
Sbjct  62   QRVKKHGPIFKTNLVGRPVIVSTDPDLSYFVFQQEGRCFQSWYPDTFTNIFGKKNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+++             +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKSM-------------MLPQVELTANKRLELWSNQESVELKDATASMIFDLTA  168

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D  K+ E LR  + AF+ G
Sbjct  169  KKLISHDPDKSSENLRANFVAFIRG  193



>ref|XP_004511600.1| PREDICTED: cytochrome P450 87A3-like isoform X2 [Cicer arietinum]
Length=442

 Score =   255 bits (651),  Expect(2) = 3e-123, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 161/222 (73%), Gaps = 2/222 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR     +K++KDF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  223   QGRKRAMKMLKNMLQERRE--MPRKQQKDFFDYVIEELRKEGTLLTEAIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+K L+ +P VL QLQEE+E I+  R++  S +TW EY+SM FT  +I 
Sbjct  281   SFETTSLALTYAIKLLSDNPSVLNQLQEENEAILKRRKNPNSGVTWQEYKSMTFTFQLIT  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I P IFRK +++   KGYTIP GW  M+CP +VHL+  KY DPL+FNPSRW G
Sbjct  341   ETARLANIVPGIFRKALREVNFKGYTIPAGWAIMVCPPAVHLNPAKYQDPLAFNPSRWEG  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYK  1286
              EL+ A+K FMAFGG  R C G +FAK+ MA+ LH LVTKY+
Sbjct  401   MELNGATKHFMAFGGGMRFCVGTDFAKVQMAVFLHSLVTKYR  442


 Score =   216 bits (550),  Expect(2) = 3e-123, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 148/204 (73%), Gaps = 3/204 (1%)
 Frame = +1

Query  19   VMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQR  198
            V+ L + ++I I HWVYRWRNP C G LPPGSMGFP++GE++QFF+ ++   IPPFI+QR
Sbjct  3    VLCLGALVIICITHWVYRWRNPSCNGKLPPGSMGFPLLGETLQFFSPNTSCDIPPFIKQR  62

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD  378
            + RYG +F+TS+VG+ V+VSTD ++N+FIFQQEGK+   WY ++  +I G Q     HG 
Sbjct  63   MKRYGPIFKTSLVGRPVVVSTDPDLNYFIFQQEGKIFQSWYPDTFTEIFGKQNVGSLHGF  122

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSN-LDIKQATEIMLFKLAAS  555
             +KYL+N+ LNL GPE+LK+ +L+E+++ A   L   +   N +++K+AT  M+F L A 
Sbjct  123  MYKYLKNMVLNLFGPESLKK-MLSEVEEAACTTLQQLSCQENCVELKEATARMIFDLTAK  181

Query  556  KVLSYDEKKAME-LRKYYKAFMEG  624
            K++SYD  K+ E LR+ + AF++G
Sbjct  182  KLISYDSTKSSENLRENFVAFIQG  205



>ref|XP_006352287.1| PREDICTED: cytochrome P450 87A3-like [Solanum tuberosum]
Length=471

 Score =   281 bits (720),  Expect(2) = 3e-123, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 181/246 (74%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK ++K++K  L ER+S    +K++ DF DY+L E+  ++T LTE IA+D++ +L+F 
Sbjct  222   QGRKKILKMLKRMLEERKSQ--PRKEQSDFFDYVLEELQSKDTILTEGIALDLMFVLLFV  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL++HP  LK+L+EEHE II  RE+    +TW EY+SMKFT   IN
Sbjct  280   SFETTSWAITLAIKFLHEHPLALKELKEEHEAIIRRRENASYGLTWQEYKSMKFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+IAPA+FRK +++   KGYTIP GW  M+   +VHL+  KY+DPL FNP RW G
Sbjct  340   ETVRLANIAPALFRKTLKEINFKGYTIPAGWAIMVYSQAVHLNPAKYEDPLQFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+ A++ FMAFGG  R C GA+FAK+ MA+ LH  VTKYKW+ V  G+IVR PGL F 
Sbjct  400   IELNGATRNFMAFGGGIRYCIGADFAKVQMAVFLHCFVTKYKWETVKGGDIVRSPGLQFP  459

Query  1341  DGFKVQ  1358
             +G+ ++
Sbjct  460   NGYHIK  465


 Score =   189 bits (481),  Expect(2) = 3e-123, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 144/210 (69%), Gaps = 6/210 (3%)
 Frame = +1

Query  7    MTWLVMYLI-SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            M  L +Y+I S LVIAI ++   WRNPK  G LPPGSMG+P++GE+I FF  ++   I P
Sbjct  1    MLSLGIYIIGSLLVIAIINY---WRNPKSNGKLPPGSMGWPLLGETIPFFAPNTSLDISP  57

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFM  363
            F+++R+ RYG +FRTS+VG  +IVSTD + N+FIFQQEGKL   WY  + A+I G Q   
Sbjct  58   FVKERMQRYGPIFRTSLVGHPIIVSTDPDFNYFIFQQEGKLFQSWYPHTFAEIMGRQNVG  117

Query  364  VHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFK  543
              HG  +KYL+N+ LNL GPE+L++ +L E+++T   +L  W+   ++++K+AT  M+F 
Sbjct  118  SLHGFMYKYLKNMVLNLFGPESLRK-MLPEVEKTTNNNLKRWSKEKSVEMKEATAKMIFD  176

Query  544  LAASKVLSYDEKKAME-LRKYYKAFMEGDV  630
            +   K++SYD + + E + + + AF++G V
Sbjct  177  ITGKKLISYDSENSTENMCENFVAFIKGLV  206



>ref|XP_004244719.1| PREDICTED: cytochrome P450 87A3-like [Solanum lycopersicum]
Length=471

 Score =   284 bits (726),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 180/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ER+S    +K++ DF DY+L E+  ++T LTE IA+D++ +L+F 
Sbjct  222   QGRKKTMKMLKRMLEERKSQ--PRKEQSDFFDYVLEELQSKDTILTEAIALDLMFVLLFV  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+QHP  LK+L+EEHE II  RE+    +TW EY+SMKFT   IN
Sbjct  280   SFETTSWAITLAIKFLHQHPQALKELKEEHEAIIRRRENASYGLTWQEYKSMKFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+IAPAIFRK +++   KGYTIP GW  M+   +VHL+  KY+DPL FNP RW G
Sbjct  340   ETVRLANIAPAIFRKTLKEINFKGYTIPAGWAIMVYSQAVHLNPTKYEDPLQFNPWRWKG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+ A++ FMAFGG  R C GA+FAK+ MA+ LH  VTKYKW+ +  G+IVR PGL F 
Sbjct  400   IELNGATRNFMAFGGGIRYCIGADFAKVQMAVFLHCFVTKYKWETIKGGDIVRSPGLQFP  459

Query  1341  DGFKVQ  1358
             +G+ ++
Sbjct  460   NGYHIK  465


 Score =   185 bits (469),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 141/208 (68%), Gaps = 6/208 (3%)
 Frame = +1

Query  7    MTWLVMYLI-SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            M  L +Y+I S +VI I H+   WRN K  G LPPGSMG+P++GE+I FF  ++   I P
Sbjct  1    MLSLGIYIIGSLVVIVILHY---WRNLKSNGKLPPGSMGWPLLGETIPFFAPNTSLDISP  57

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFM  363
            F+++R+ RYG +FRTS+VG  +IVSTD + N+FIFQQEGKL   WY  + A+I G Q   
Sbjct  58   FVKERMQRYGPIFRTSLVGHPIIVSTDPDFNYFIFQQEGKLFQSWYPHTFAEIMGRQNVG  117

Query  364  VHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFK  543
              HG  +KYL+N+ LNL GPE+L++ +L E+++T   +L  W+   ++++K+AT  M+F 
Sbjct  118  SFHGFMYKYLKNMVLNLFGPESLRK-MLPEVEKTTNNNLKRWSKQKSVEMKEATAKMIFD  176

Query  544  LAASKVLSYDEKKAME-LRKYYKAFMEG  624
            +   K++SYD + + E + + + AF++G
Sbjct  177  ITGKKLISYDSENSTENVCENFVAFVKG  204



>emb|CDY66605.1| BnaA06g38070D [Brassica napus]
Length=474

 Score =   270 bits (689),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 176/248 (71%), Gaps = 4/248 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +++++  L ERR     +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  223   KGRENAMRMLRNMLQERRKK--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFT-HMVI  977
             ++ETTS A TLA+KFL+  P VL++L EEHE I+  RED  S +TW EY+SM +T    I
Sbjct  281   SFETTSLALTLAIKFLSDDPKVLRRLTEEHETILRNREDANSGLTWEEYKSMTYTFQQFI  340

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NET RLA+I PAIFRK + D + K YTIP GW  M+CP +VHL+ +KY+DPL FNPSRW 
Sbjct  341   NETARLANIVPAIFRKALIDIKYKDYTIPAGWAVMVCPPAVHLNPKKYEDPLVFNPSRWE  400

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKV-VDEGNIVRKPGLT  1334
                 + ASK FMAFGG  R C G +F KL MA+ LH LVTKY++++ +  GNIVR PGL 
Sbjct  401   ESNANDASKHFMAFGGGMRFCVGTDFTKLQMAVFLHSLVTKYRFELEIKGGNIVRTPGLQ  460

Query  1335  FLDGFKVQ  1358
             F +G+ V+
Sbjct  461   FPNGYHVR  468


 Score =   199 bits (505),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 140/205 (68%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W +   +S LVI + HWVY WRNPKCKG LPPGSMG P++GE+IQFF  ++   IPPFI+
Sbjct  2    WALFIWVSLLVITVTHWVYSWRNPKCKGKLPPGSMGLPLLGETIQFFKPNTTSDIPPFIK  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +RV +YG +F+T++VG+ VIVS D ++++F+FQQEG+    WY ++   I G       H
Sbjct  62   ERVKKYGPIFKTNLVGRPVIVSADPDLSYFVFQQEGRRFQSWYPDTFTNIFGKNNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+++ L L G + LK+ +L +++ TA + L+ W+   ++++K AT  M+F L A
Sbjct  122  GFMYKYLKSMVLTLFGYDGLKK-MLPQVELTANKRLELWSNQESVELKDATASMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++S+D  ++ E LR  + AF++G
Sbjct  181  KKLISHDPDESSENLRANFVAFIQG  205



>ref|XP_006652661.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=513

 Score =   271 bits (693),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 176/246 (72%), Gaps = 3/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRKN +++++  + ER +    ++  +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  265   GRKNAMRVLRSMMKERMAD--PERPCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  322

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A T+ +K L ++P V+  L+EEHE II  R+D +S +TW EY+SM FT  VI E
Sbjct  323   FETTALALTIGVKLLTENPKVVDALREEHEAIIRNRKDPDSGVTWAEYKSMTFTSQVIME  382

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW G+
Sbjct  383   IVRLANIVPGIFRKALQDVEIKGYTIPAGWGIMVCPPAVHLNPEIYEDPLAFNPWRWQGK  442

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G +F+K+ MA  +H LVTKY W+ V  GNIVR PGL+F 
Sbjct  443   PEITGGTKHFMAFGGGLRFCVGTDFSKVLMATFIHCLVTKYSWRTVKGGNIVRTPGLSFP  502

Query  1341  DGFKVQ  1358
             DGF ++
Sbjct  503   DGFHIE  508


 Score =   193 bits (491),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 127/196 (65%), Gaps = 2/196 (1%)
 Frame = +1

Query  43   VIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLF  222
            V+ + HW YRWR+P+  G LPPGS+G P++GE++QFF  +    + PF+++R+ RYGS+F
Sbjct  51   VVTLLHWTYRWRHPRSNGRLPPGSLGLPLVGETLQFFAPNPTCDLSPFVKKRIKRYGSIF  110

Query  223  RTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNL  402
            +TS+VG+ V+VS D E+N+++FQQEGKL   WY ++  +I G       HG  +KYL+ L
Sbjct  111  KTSVVGRPVVVSADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKTL  170

Query  403  ALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKK  582
             L L G ENLK  LL E D   R  L  W A  ++++K+   +M+F L A K++ YD  +
Sbjct  171  VLRLYGQENLKSVLLAETDAACRGSLASWAAQPSIELKEGISMMIFDLTAKKLIGYDPSR  230

Query  583  AME--LRKYYKAFMEG  624
              +  LRK + +F+ G
Sbjct  231  PSQKNLRKNFASFIRG  246



>gb|KEH27443.1| cytochrome P450 family protein [Medicago truncatula]
Length=442

 Score =   255 bits (652),  Expect(2) = 5e-121, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 157/222 (71%), Gaps = 2/222 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K  L ERR     +K++ DF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  223   QGRKKAMKMLKNMLQERRE--MPRKQQMDFFDYVIEELRKEGTLLTEAIALDLMFVLLFA  280

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+K L+ +P V KQLQEEHE I+  RE+  S +TW EY+SM FT  +I 
Sbjct  281   SFETTSQALTYAIKLLSDNPLVFKQLQEEHEAILERRENPNSGVTWQEYKSMTFTFQLIT  340

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I P IFRK +++   KGYTIP GW  M+CP +VHL+  KY DPL FNPSRW G
Sbjct  341   ETARLANIVPGIFRKALREINFKGYTIPAGWAIMVCPPAVHLNPAKYQDPLVFNPSRWEG  400

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYK  1286
              E   A+K F+AFGG  R C G EFAK+ MA+ LH LVTKY+
Sbjct  401   MEPSGATKHFLAFGGGMRFCVGTEFAKVQMAVFLHCLVTKYR  442


 Score =   208 bits (529),  Expect(2) = 5e-121, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 145/205 (71%), Gaps = 2/205 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W++       +  I  WVYRWRNP C G LPPGSMG P++GES+QFF+ ++   IPPFI+
Sbjct  2    WVLCLGALVTICIITRWVYRWRNPSCNGKLPPGSMGLPLLGESLQFFSPNTSCDIPPFIR  61

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
            +R+ RYG +F+T++VG+ V+VSTD ++N+FIFQQEGK+   WY ++  +I G Q     H
Sbjct  62   KRMKRYGPIFKTNLVGRPVVVSTDPDLNYFIFQQEGKIFQSWYPDTFTEIFGQQNVGSLH  121

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            G  +KYL+N+ LNL GPE+LK+ +++E++Q A + L   +   ++++K+ATE M+F L A
Sbjct  122  GFMYKYLKNMMLNLFGPESLKK-MISEVEQAACRTLQQASCQDSVELKEATETMIFDLTA  180

Query  553  SKVLSYDEKKAME-LRKYYKAFMEG  624
             K++SYD  ++ E LR+ + AF++G
Sbjct  181  KKLISYDPTESSENLRENFVAFIQG  205



>ref|XP_008669007.1| PREDICTED: cytochrome P450 87A3 isoform X1 [Zea mays]
 gb|AFW59283.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=506

 Score =   267 bits (682),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 174/246 (71%), Gaps = 3/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRKN +K++K  + ER +    +++ +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  258   GRKNAMKVLKRMMKERMAD--PERRCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  315

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A TL +K L  +P V+  L+EEH+ I   R+D ++ +TW EYRSM FT+ VI E
Sbjct  316   FETTALALTLGVKLLTDNPKVVDALREEHDAIAKNRKDPDAPVTWAEYRSMTFTNQVIME  375

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYTIP GW  M+CP +VHL+ + Y+DPL+FNP RW G+
Sbjct  376   MVRLANIVPGIFRKALQDVEIKGYTIPAGWGVMVCPPAVHLNPDIYEDPLAFNPWRWQGK  435

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G + +++ MA  +H LVTKY W+ V  GNIVR PGL F 
Sbjct  436   PEITGGTKHFMAFGGGLRFCVGTDLSRVLMATFIHSLVTKYSWRTVKGGNIVRTPGLGFP  495

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  496   DGFHIQ  501


 Score =   194 bits (494),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 129/196 (66%), Gaps = 1/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            + +A+  W YRW +PK +G+LPPGSMG P++GE++QFF  +    + PF+++RV RYGS+
Sbjct  44   IFVALLLWAYRWSHPKSRGMLPPGSMGIPLLGETMQFFAPNPTYDVSPFVKERVKRYGSI  103

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TSIVG++V+VS D ++N+F+FQQEGKL   WY ++  +I G       HG  +KYL+ 
Sbjct  104  FKTSIVGRQVVVSADPDMNYFVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKT  163

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            L L L G ENLK  LL E D   R  L  W A  ++++K+    M+F L A K++ Y+  
Sbjct  164  LVLRLYGQENLKAVLLAETDAACRGSLASWAAQPSVELKEGLSTMIFDLTAKKLIGYEPS  223

Query  580  KAME-LRKYYKAFMEG  624
            K+ E LRK + AF+ G
Sbjct  224  KSSESLRKNFVAFIRG  239



>ref|XP_006647678.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=465

 Score =   271 bits (692),  Expect(2) = 4e-120, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 178/247 (72%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +K++K+ + ER +     ++ +DF D L+ E+ +E+  LTE IA+D++ +L+FA
Sbjct  216   KGRRNAMKVLKKMMRERMAE--PARQCEDFFDVLIEELRREKPVLTEAIALDLMFVLLFA  273

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TL ++ L ++P VL  L EEHE I+ AR++ ++++TW EY+SM FT  V  
Sbjct  274   SFETTSLALTLGVRLLAENPMVLDALTEEHEAIVRARKECDAALTWAEYKSMTFTSQVTL  333

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E VRLA+I P IFRK +QD E KGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW G
Sbjct  334   EIVRLANIVPGIFRKALQDIEFKGYTIPAGWGVMVCPPAVHLNPEIYEDPLAFNPWRWQG  393

Query  1161  Q-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             + E+   +K FMAFGG  R C G + +K+ MA  +H+LVTKY+WK+V  GNIVR PGL+F
Sbjct  394   KVEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHHLVTKYRWKIVKGGNIVRTPGLSF  453

Query  1338  LDGFKVQ  1358
              DGF VQ
Sbjct  454   PDGFHVQ  460


 Score =   190 bits (482),  Expect(2) = 4e-120, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 129/196 (66%), Gaps = 1/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            +V+A   W YRW +P+  G LPPGS+G P++GE++QFF  +    I PF+++R+ RYGS+
Sbjct  3    MVVASVVWAYRWSHPRANGRLPPGSLGLPLLGETLQFFAPNPTCDISPFVKERINRYGSI  62

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TS+VG+ V+V+ D E+N+++FQQEGKL   WY ++  +I G       HG  +KYL++
Sbjct  63   FKTSVVGRPVVVTADPELNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKS  122

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            L L L G ENL+  LL E D+  R  L  W A  ++++K +   M+F L A K++SY+  
Sbjct  123  LVLRLYGQENLRAVLLDETDRAFRVSLASWAARPSVELKDSISAMIFDLTAKKLISYEPS  182

Query  580  KAME-LRKYYKAFMEG  624
            K+ E LRK + AF+ G
Sbjct  183  KSSENLRKNFVAFIRG  198



>ref|XP_010275621.1| PREDICTED: cytochrome P450 87A3-like [Nelumbo nucifera]
Length=479

 Score =   267 bits (683),  Expect(2) = 5e-120, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 171/246 (70%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + R+NV+K+++  + ERR+    K+ K DFLD L+ E++KE  FLTE+  V +I +L FA
Sbjct  231   KARENVLKMLRNLIKERRNQ--PKRIKGDFLDKLIEEMEKEGAFLTEEAIVQLIFLLTFA  288

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS   TLA+KFL  HP VL  L +EHE I+ +RE  +S+ITW EY+SM FT  VIN
Sbjct  289   SFETTSLTLTLAIKFLTDHPQVLMALTDEHEAILRSRETADSAITWEEYKSMTFTSQVIN  348

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E +RL+++AP IFR+ + D ++KGYTIP GW  MICP ++H    KY DPL++NP RW G
Sbjct  349   EVLRLSNVAPGIFRRALTDIQVKGYTIPAGWTIMICPQTLHFDPSKYKDPLAYNPWRWEG  408

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
                +  SK F  FGG  RLCAGA+F+K+ M + LH+LVTKY+WK +  G IV  P  +F 
Sbjct  409   CGANTWSKNFNPFGGGMRLCAGADFSKMLMEMFLHFLVTKYRWKRIKGGEIVGNPATSFP  468

Query  1341  DGFKVQ  1358
             +GF +Q
Sbjct  469   NGFHIQ  474


 Score =   193 bits (491),  Expect(2) = 5e-120, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 134/199 (67%), Gaps = 5/199 (3%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCK-GLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGS  216
            L+I I H V +WRNPKC  G LPPGSMG P+IGE++QFF+ H    IPPF+++R+ RYGS
Sbjct  16   LIICIVHLVQKWRNPKCSTGRLPPGSMGLPLIGETLQFFSPHYSFDIPPFLKERIKRYGS  75

Query  217  LFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS-HKYL  393
            LF+T++VG+ VIVSTDSE NH+I QQEGKLV  WY +S  ++ G Q        S HK+L
Sbjct  76   LFKTNLVGRPVIVSTDSEFNHYILQQEGKLVELWYMDSFMKLLGDQVLTTSASLSIHKHL  135

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD  573
            RNL L+  GPE+LK+ ++ E+ + ARQ L  W+    +++K++TE M F   + K+ S+D
Sbjct  136  RNLVLSYFGPESLKK-MVPEVAEMARQTLHFWSTQEAIEVKKSTEDMFFDFGSRKLFSFD  194

Query  574  EKKAME--LRKYYKAFMEG  624
               + E  ++  +  F EG
Sbjct  195  LSNSTENIIKNKFADFWEG  213



>ref|XP_008663476.1| PREDICTED: cytochrome P450 87A3-like [Zea mays]
 gb|AFW59150.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=508

 Score =   266 bits (679),  Expect(2) = 5e-120, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 173/246 (70%), Gaps = 3/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRKN +K++K  + ER +    +++ +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  260   GRKNAMKVLKGMMKERMAD--PERRCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  317

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A TL +K L   P V+  L+EEH+ I   R D ++ +TW EYRSM FT+ VI E
Sbjct  318   FETTALALTLGVKLLTDSPKVVDALREEHDAIAKNRNDPDAPVTWAEYRSMTFTNQVIME  377

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYTIP GW  M+CP +VHL+ + Y+DPL+FNP RW G+
Sbjct  378   MVRLANIVPGIFRKALQDVEIKGYTIPAGWGVMVCPPAVHLNPDIYEDPLAFNPWRWQGK  437

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G + +++ MA  +H+LVTKY W+ V  GN+VR PGL F 
Sbjct  438   PEITGGTKHFMAFGGGLRFCVGTDLSRVLMATFIHHLVTKYSWRTVKGGNVVRTPGLGFP  497

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  498   DGFHIQ  503


 Score =   195 bits (495),  Expect(2) = 5e-120, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 128/194 (66%), Gaps = 1/194 (1%)
 Frame = +1

Query  46   IAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFR  225
            +A+ HW YRW +P+ +G LPPGSMG P++GE++QFF  +    + PF+++RV RYGS+F+
Sbjct  48   VALLHWAYRWSHPRSRGRLPPGSMGIPLLGETMQFFAPNPTCDVSPFVKERVRRYGSIFK  107

Query  226  TSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLA  405
            TSIVG++V+VS D ++N+F+FQQEGKL   WY ++  +I G       HG  +KYL+ L 
Sbjct  108  TSIVGRQVVVSADPDMNYFVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKTLV  167

Query  406  LNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKA  585
            L L G ENLK  LL E D   R  L  W A  ++++K+    M+F L A K++ Y+  K+
Sbjct  168  LRLYGQENLKAVLLAETDAACRGSLASWAAQPSVELKEGLSTMIFDLTAKKLIGYEPSKS  227

Query  586  ME-LRKYYKAFMEG  624
             E LRK + AF+ G
Sbjct  228  SESLRKNFVAFIRG  241



>ref|XP_006366247.1| PREDICTED: cytochrome P450 87A3-like [Solanum tuberosum]
Length=471

 Score =   283 bits (723),  Expect(2) = 6e-120, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 179/246 (73%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK ++K++K  L ER+S  +K++   DF DY+L E+  ++T LTE IA+D++ +L+FA
Sbjct  222   QGRKKILKMLKRMLEERKSQPRKEQS--DFFDYVLEELQSKDTILTETIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL++HP VLK+L EEHE I   RE+    +TW EY+SMKFT   IN
Sbjct  280   SFETTSLAITLAIKFLHEHPKVLKELTEEHEAINRRRENASYGLTWKEYKSMKFTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+IAP IFRK ++D   K YTIP GW  M+ P +VHL+  KY+DPL FNP RW G
Sbjct  340   ETVRLANIAPVIFRKALKDINFKEYTIPAGWAVMVSPPAVHLNPAKYEDPLQFNPWRWEG  399

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +E++ AS+ FMAFGG  R C G +F K+ MA+ LH  VTKYKW+ +  G+IVR PGL F 
Sbjct  400   KEINGASRNFMAFGGGMRFCVGTDFTKVQMAVFLHCFVTKYKWETIKGGDIVRIPGLQFP  459

Query  1341  DGFKVQ  1358
             +G+ ++
Sbjct  460   NGYHIK  465


 Score =   177 bits (450),  Expect(2) = 6e-120, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 136/208 (65%), Gaps = 6/208 (3%)
 Frame = +1

Query  7    MTWLVMYLI-SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            M  L +Y+I S LVI I H     R PK  G LPPGSMG+P++GE+IQFF  ++   I P
Sbjct  1    MLSLGIYIIGSLLVIVIIH---NLRYPKNNGKLPPGSMGWPLLGETIQFFAPNTSFDISP  57

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFM  363
            F+++R+ RYG +FRTS+VG+ VIVSTD   N+FIFQQEGKL   WY  +  +I G Q   
Sbjct  58   FVKERMQRYGPIFRTSLVGRPVIVSTDPNFNYFIFQQEGKLFQSWYPYTFTEIFGRQNVG  117

Query  364  VHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFK  543
              HG  +KYL+N+ LNL GPE+LK  +L E+++ A  +L  W   +++++K+A+  M+F 
Sbjct  118  SLHGFMYKYLKNMVLNLFGPESLKN-MLPEVEKIANNNLKRWLGQTSIEMKEASAKMIFD  176

Query  544  LAASKVLSYD-EKKAMELRKYYKAFMEG  624
            +   K++S+D E     + + + AF++G
Sbjct  177  ITGKKLISFDSENSTGNVSENFVAFIKG  204



>ref|XP_004976534.1| PREDICTED: cytochrome P450 87A3-like [Setaria italica]
Length=511

 Score =   268 bits (686),  Expect(2) = 6e-120, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 176/246 (72%), Gaps = 3/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRKN +K++K  + ER +    +++ +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  263   GRKNAMKVLKSMMKERMAD--PERRCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  320

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A TL +K L ++P V+  L+EEH+ I   R+D ++ +TW EYRSM FT+ VI E
Sbjct  321   FETTALALTLGVKLLTENPKVVDALREEHDAIARNRKDPDAPVTWAEYRSMTFTNQVIME  380

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYTIP GW  M+CP +VHL+A+ Y+DPL+FNP RW  +
Sbjct  381   MVRLANIVPGIFRKALQDVEIKGYTIPAGWGIMVCPPAVHLNADIYEDPLAFNPWRWQDK  440

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G +F+++ MA  +H LVTKY W+ V  GNIVR PGL F 
Sbjct  441   PEITGGTKHFMAFGGGLRFCVGTDFSRVLMATFIHSLVTKYSWRTVKGGNIVRTPGLGFP  500

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  501   DGFHIQ  506


 Score =   192 bits (487),  Expect(2) = 6e-120, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 124/190 (65%), Gaps = 1/190 (1%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
             W YRW +PK KG LPPGSMG P+IGE++QFF  +    + PF+++RV RYGS+F+TSIV
Sbjct  55   RWAYRWNHPKSKGRLPPGSMGIPLIGETLQFFAPNPTCDVSPFVKERVRRYGSIFKTSIV  114

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G++V+VS D ++N+F+FQQEGKL   WY ++  +I G       HG  +KYL+ L L L 
Sbjct  115  GRQVVVSADPDMNYFVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKTLVLRLY  174

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME-L  594
            G ENLK  L+ E D   R  L  W A  ++++K+    M+F L A K++ Y+  K+ E L
Sbjct  175  GQENLKAALVAETDAACRGSLTAWAAQPSVELKEGLSTMIFDLTAKKLIGYEPSKSSECL  234

Query  595  RKYYKAFMEG  624
            RK + AF+ G
Sbjct  235  RKNFVAFIRG  244



>ref|XP_002448362.1| hypothetical protein SORBIDRAFT_06g025820 [Sorghum bicolor]
 gb|EES12690.1| hypothetical protein SORBIDRAFT_06g025820 [Sorghum bicolor]
Length=517

 Score =   265 bits (676),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 174/246 (71%), Gaps = 3/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRK  +K+++  + ER +    +++  DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  269   GRKKAMKVLRGMMKERMAD--PERRCDDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  326

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A TL +K L ++P V+  L+EEH+ I   R+D ++ +TW EYRSM FT+ VI E
Sbjct  327   FETTALALTLGVKLLTENPKVVDALREEHDAIAKNRKDPDAPVTWAEYRSMTFTNQVIME  386

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYTIP GW  M+CP +VHL+ + Y+DPL+FNP RW G+
Sbjct  387   MVRLANIVPGIFRKALQDVEIKGYTIPAGWGVMVCPPAVHLNPDIYEDPLAFNPWRWQGK  446

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G + +++ MA  +H LVTKY W+ V  GNIVR PGL+F 
Sbjct  447   PEITGGTKHFMAFGGGLRFCVGTDLSRVLMATFIHTLVTKYSWRTVKGGNIVRTPGLSFP  506

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  507   DGFHIQ  512


 Score =   195 bits (495),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 126/190 (66%), Gaps = 1/190 (1%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
             W YRW +PKC+G LPPGSMG P++GE++QFF  +    + PF+++RV RYGS+F+TS+V
Sbjct  61   RWAYRWSHPKCRGRLPPGSMGVPLLGETMQFFAPNPSCDVSPFVKERVRRYGSIFKTSVV  120

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G++V+VS D ++N+F+FQQEGKL   WY ++  +I G       HG  +KYL+ L L L 
Sbjct  121  GRQVVVSADPDMNYFVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKTLVLRLY  180

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME-L  594
            G ENLK  LL E D   R+ L  W A  ++++K+    M+F L A K++ Y+  K+ E L
Sbjct  181  GQENLKAVLLAETDAACRRSLASWAAQPSVELKEGLSTMIFDLTAKKLIGYEPSKSSESL  240

Query  595  RKYYKAFMEG  624
            RK + AF+ G
Sbjct  241  RKNFVAFIRG  250



>ref|XP_003580352.1| PREDICTED: cytochrome P450 87A3 [Brachypodium distachyon]
Length=511

 Score =   263 bits (671),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 173/246 (70%), Gaps = 3/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRK  +K+++  + ER +    ++K +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  263   GRKKAMKVLRGMMKERMAD--PERKCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  320

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A TL +K L ++P V+  L EEHE I+  RED ++++TW EY+SM FT  VI E
Sbjct  321   FETTALALTLGVKLLTENPKVVDALTEEHEAIVRNREDPDAAVTWAEYKSMTFTSQVIME  380

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFR+ ++D EIKGYTIP GW  M+CP +VHL+ + Y+DPL+FNP RW G+
Sbjct  381   IVRLANIVPGIFRRALEDIEIKGYTIPAGWGIMVCPPAVHLNPDIYEDPLAFNPWRWQGK  440

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G +  K+ MA  +H LVTKY+W+ V  GNIVR PGL F 
Sbjct  441   PEITGGTKHFMAFGGGLRFCVGTDLTKVLMATFIHNLVTKYRWRTVKGGNIVRTPGLGFP  500

Query  1341  DGFKVQ  1358
             DGF + 
Sbjct  501   DGFDIH  506


 Score =   196 bits (498),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 124/195 (64%), Gaps = 1/195 (1%)
 Frame = +1

Query  43   VIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLF  222
            V++I HW YRW +PK  G LPPGSMG P+IGE++QFF  +   G+ PF+++RV RYGS+F
Sbjct  50   VLSILHWAYRWSHPKSSGTLPPGSMGIPLIGETLQFFAPNPTCGLSPFVRERVKRYGSMF  109

Query  223  RTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNL  402
            +TSIVG+ V+VS D E+NH++FQ EGKL   WY ++  +I G       HG  +KYL+ L
Sbjct  110  KTSIVGRPVVVSADPEVNHYVFQNEGKLFESWYPDTFTEIFGRDNVGSLHGFIYKYLKTL  169

Query  403  ALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKK  582
             L L G ENLK  LL E D   R  L  W    ++DIK     M+F L A K++ Y+  K
Sbjct  170  VLRLYGQENLKAVLLAETDAACRGSLASWAKQPSVDIKHGLSTMIFDLTAKKLIGYEPSK  229

Query  583  AME-LRKYYKAFMEG  624
            + E L + + AF+ G
Sbjct  230  SSESLMENFTAFIRG  244



>emb|CAH67038.1| OSIGBa0139P06.11 [Oryza sativa Indica Group]
 emb|CAH67275.1| OSIGBa0111L12.2 [Oryza sativa Indica Group]
 gb|EAY95213.1| hypothetical protein OsI_17032 [Oryza sativa Indica Group]
Length=480

 Score =   270 bits (690),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 174/246 (71%), Gaps = 3/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRKN +K+++  + ER +    ++  +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  232   GRKNAMKVLRGMMKERMAE--PERPCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  289

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A T+ +K L ++P V+  L+EEHE II  R+D  S +TW EY+SM FT  VI E
Sbjct  290   FETTALALTIGVKLLTENPKVVDALREEHEAIIRNRKDPNSGVTWAEYKSMTFTSQVIME  349

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW G+
Sbjct  350   IVRLANIVPGIFRKALQDVEIKGYTIPAGWGIMVCPPAVHLNPEIYEDPLAFNPWRWQGK  409

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G + +K+ MA  +H LVTKY W+ V  GNIVR PGL+F 
Sbjct  410   PEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHALVTKYSWRTVKGGNIVRTPGLSFP  469

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  470   DGFHIQ  475


 Score =   186 bits (473),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 121/191 (63%), Gaps = 2/191 (1%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
             W YRW +P+  G LPPGS+G P+IGE++QFF  +    + PF+++R+ RYGS+F+TS+V
Sbjct  23   RWAYRWSHPRSNGRLPPGSLGLPVIGETLQFFAPNPTCDLSPFVKERIKRYGSIFKTSVV  82

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G+ V+VS D E+N+++FQQEGKL   WY ++  +I G       HG  +KYL+ L L L 
Sbjct  83   GRPVVVSADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKTLVLRLY  142

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKA--ME  591
            G ENLK  LL E D   R  L  W +  ++++K+    M+F L A K++ YD  K   + 
Sbjct  143  GQENLKSVLLAETDAACRGSLASWASQPSVELKEGISTMIFDLTAKKLIGYDPSKPSQVN  202

Query  592  LRKYYKAFMEG  624
            LRK + AF+ G
Sbjct  203  LRKNFGAFIRG  213



>ref|XP_004953429.1| PREDICTED: cytochrome P450 87A3-like [Setaria italica]
Length=478

 Score =   270 bits (689),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 177/247 (72%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN +K++K+ + ER +   K ++ +DF D L+ E+ +E+  +TE IA+D++ +L+FA
Sbjct  229   QGRKNAMKVLKKMMRERIAD--KGRQSEDFFDVLIEELRREKPVMTEAIALDLMFVLLFA  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETT+ A TL +K L ++P VL+ L EEHE I++ R+D+++ +TW +Y+SM FT  VI 
Sbjct  287   SFETTALALTLGVKLLAENPRVLQALTEEHEAIVSNRKDRDAELTWADYKSMTFTSQVIL  346

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E VRLA+I P IFRK +QD E KGYTIP GW  M+CP +VHLS E YDDPL+FNP RW  
Sbjct  347   EIVRLANIVPGIFRKALQDIEFKGYTIPAGWGVMVCPPAVHLSPEIYDDPLAFNPWRWQD  406

Query  1161  Q-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             + E+   +K FMAFGG  R C G + +K+ MA  +H LVTKY W+ +  GNIVR PGL+F
Sbjct  407   KAEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHCLVTKYSWRTIKGGNIVRTPGLSF  466

Query  1338  LDGFKVQ  1358
              DGF VQ
Sbjct  467   PDGFHVQ  473


 Score =   186 bits (473),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 125/196 (64%), Gaps = 1/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            +V+    W YRW +PK  G LPPGS+G P++GE++QFF  +    + PF+++R+ RYG++
Sbjct  16   MVMTFIMWAYRWSHPKANGRLPPGSLGLPLLGETLQFFAPNPTCDVSPFVKERLGRYGNI  75

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TSIVG+ V+VS D ++N+F+FQQEGKL   WY ++  +I G       HG  +KYL+ 
Sbjct  76   FKTSIVGRSVVVSADPDLNYFVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKT  135

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            L L L G ENL+  LL E D+     L  W    ++++K A   M+F L A K++SY+  
Sbjct  136  LVLRLYGQENLRAVLLAETDRACHASLSSWARRPSVELKDAISTMIFDLTAKKLISYEPS  195

Query  580  KAME-LRKYYKAFMEG  624
            K+ E LRK + AF+ G
Sbjct  196  KSSENLRKNFVAFIRG  211



>ref|NP_001053599.1| Os04g0570000 [Oryza sativa Japonica Group]
 sp|Q7XU38.3|C87A3_ORYSJ RecName: Full=Cytochrome P450 87A3 [Oryza sativa Japonica Group]
 emb|CAD30852.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF15513.1| Os04g0570000 [Oryza sativa Japonica Group]
Length=514

 Score =   270 bits (690),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 174/246 (71%), Gaps = 3/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRKN +K+++  + ER +    ++  +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  266   GRKNAMKVLRGMMKERMAE--PERPCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  323

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A T+ +K L ++P V+  L+EEHE II  R+D  S +TW EY+SM FT  VI E
Sbjct  324   FETTALALTIGVKLLTENPKVVDALREEHEAIIRNRKDPNSGVTWAEYKSMTFTSQVIME  383

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW G+
Sbjct  384   IVRLANIVPGIFRKALQDVEIKGYTIPAGWGIMVCPPAVHLNPEIYEDPLAFNPWRWQGK  443

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G + +K+ MA  +H LVTKY W+ V  GNIVR PGL+F 
Sbjct  444   PEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHSLVTKYSWRTVKGGNIVRTPGLSFP  503

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  504   DGFHIQ  509


 Score =   185 bits (470),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 121/191 (63%), Gaps = 2/191 (1%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
             W YRW +P+  G LPPGS+G P+IGE++QFF  +    + PF+++R+ RYGS+F+TS+V
Sbjct  57   RWAYRWSHPRSNGRLPPGSLGLPVIGETLQFFAPNPTCDLSPFVKERIKRYGSIFKTSVV  116

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G+ V+VS D E+N+++FQQEGKL   WY ++  +I G       HG  +KYL+ L L L 
Sbjct  117  GRPVVVSADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKTLVLRLY  176

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKA--ME  591
            G ENLK  LL E D   R  L  W +  ++++K+    M+F L A K++ YD  K   + 
Sbjct  177  GQENLKSVLLAETDAACRGSLASWASQPSVELKEGISTMIFDLTAKKLIGYDPSKPSQVN  236

Query  592  LRKYYKAFMEG  624
            LRK + AF+ G
Sbjct  237  LRKNFGAFICG  247



>emb|CAD41584.3| OSJNBa0088I22.16 [Oryza sativa Japonica Group]
Length=480

 Score =   270 bits (690),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 174/246 (71%), Gaps = 3/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRKN +K+++  + ER +    ++  +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  232   GRKNAMKVLRGMMKERMAE--PERPCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  289

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A T+ +K L ++P V+  L+EEHE II  R+D  S +TW EY+SM FT  VI E
Sbjct  290   FETTALALTIGVKLLTENPKVVDALREEHEAIIRNRKDPNSGVTWAEYKSMTFTSQVIME  349

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW G+
Sbjct  350   IVRLANIVPGIFRKALQDVEIKGYTIPAGWGIMVCPPAVHLNPEIYEDPLAFNPWRWQGK  409

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G + +K+ MA  +H LVTKY W+ V  GNIVR PGL+F 
Sbjct  410   PEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHSLVTKYSWRTVKGGNIVRTPGLSFP  469

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  470   DGFHIQ  475


 Score =   185 bits (470),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 121/191 (63%), Gaps = 2/191 (1%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
             W YRW +P+  G LPPGS+G P+IGE++QFF  +    + PF+++R+ RYGS+F+TS+V
Sbjct  23   RWAYRWSHPRSNGRLPPGSLGLPVIGETLQFFAPNPTCDLSPFVKERIKRYGSIFKTSVV  82

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G+ V+VS D E+N+++FQQEGKL   WY ++  +I G       HG  +KYL+ L L L 
Sbjct  83   GRPVVVSADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKTLVLRLY  142

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKA--ME  591
            G ENLK  LL E D   R  L  W +  ++++K+    M+F L A K++ YD  K   + 
Sbjct  143  GQENLKSVLLAETDAACRGSLASWASQPSVELKEGISTMIFDLTAKKLIGYDPSKPSQVN  202

Query  592  LRKYYKAFMEG  624
            LRK + AF+ G
Sbjct  203  LRKNFGAFICG  213



>ref|XP_008448964.1| PREDICTED: cytochrome P450 87A3 isoform X2 [Cucumis melo]
Length=449

 Score =   288 bits (736),  Expect(2) = 4e-118, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 181/246 (74%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  ++++K  L ERR++   +K++ DF D++L E++K+ T LTE+IA+D++ +L+FA
Sbjct  202   QGRKKAMRMLKNMLQERRAN--PRKQRIDFFDFVLEELEKDGTLLTEEIALDLMFVLLFA  259

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+KFL  +PHVL++L  EHE I+  RE  +S +TW EY+SM FT   IN
Sbjct  260   SFETTSLAITAAIKFLLNNPHVLEELTAEHEGILKRREISDSGLTWGEYKSMTFTFQFIN  319

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK ++D + KGYTIP GW  M+CP +VHL+ EKY DPL+FNP RW  
Sbjct  320   ETVRLANIVPGIFRKALKDIQFKGYTIPSGWAVMVCPPAVHLNPEKYVDPLAFNPWRWEK  379

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+ ASK FMAFGG  R C G +F K+ MA+ LH LVTKY++K +  GNIVR PGL F 
Sbjct  380   SELNGASKHFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYRFKAIKGGNIVRTPGLQFP  439

Query  1341  DGFKVQ  1358
             DGF VQ
Sbjct  440   DGFHVQ  445


 Score =   166 bits (421),  Expect(2) = 4e-118, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 125/185 (68%), Gaps = 5/185 (3%)
 Frame = +1

Query  73   WRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKVI  252
            W    C   L  GSMG P++GE++QFF  ++   IPPFI++R+ RYG +FRTS+VG+ +I
Sbjct  4    WDGAPC---LEEGSMGLPLLGETLQFFAPNTSSDIPPFIRKRMDRYGPIFRTSLVGRPLI  60

Query  253  VSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPENL  432
            VSTD ++N+FIFQQEG+L   WY ++  +I G Q     HG  +KYL+N+ L+L GPE+L
Sbjct  61   VSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGFMYKYLKNMVLHLFGPESL  120

Query  433  KQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME-LRKYYK  609
            K+ ++ E++  A + L  W++ + +++K  T  M+F L A K++SYD + + E LR  + 
Sbjct  121  KK-MIPEVEAVATRRLKQWSSHNPVELKDKTASMIFDLTAKKLISYDSESSSENLRDNFV  179

Query  610  AFMEG  624
            AF++G
Sbjct  180  AFIQG  184



>ref|XP_008669008.1| PREDICTED: cytochrome P450 87A3 isoform X2 [Zea mays]
Length=500

 Score =   258 bits (658),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 171/246 (70%), Gaps = 9/246 (4%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRKN +K++K  + ER +    +++ +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  258   GRKNAMKVLKRMMKERMAD--PERRCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  315

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A TL +K L  +P      +EEH+ I   R+D ++ +TW EYRSM FT+ VI E
Sbjct  316   FETTALALTLGVKLLTDNP------KEEHDAIAKNRKDPDAPVTWAEYRSMTFTNQVIME  369

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYTIP GW  M+CP +VHL+ + Y+DPL+FNP RW G+
Sbjct  370   MVRLANIVPGIFRKALQDVEIKGYTIPAGWGVMVCPPAVHLNPDIYEDPLAFNPWRWQGK  429

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G + +++ MA  +H LVTKY W+ V  GNIVR PGL F 
Sbjct  430   PEITGGTKHFMAFGGGLRFCVGTDLSRVLMATFIHSLVTKYSWRTVKGGNIVRTPGLGFP  489

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  490   DGFHIQ  495


 Score =   194 bits (494),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 129/196 (66%), Gaps = 1/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            + +A+  W YRW +PK +G+LPPGSMG P++GE++QFF  +    + PF+++RV RYGS+
Sbjct  44   IFVALLLWAYRWSHPKSRGMLPPGSMGIPLLGETMQFFAPNPTYDVSPFVKERVKRYGSI  103

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TSIVG++V+VS D ++N+F+FQQEGKL   WY ++  +I G       HG  +KYL+ 
Sbjct  104  FKTSIVGRQVVVSADPDMNYFVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKT  163

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            L L L G ENLK  LL E D   R  L  W A  ++++K+    M+F L A K++ Y+  
Sbjct  164  LVLRLYGQENLKAVLLAETDAACRGSLASWAAQPSVELKEGLSTMIFDLTAKKLIGYEPS  223

Query  580  KAME-LRKYYKAFMEG  624
            K+ E LRK + AF+ G
Sbjct  224  KSSESLRKNFVAFIRG  239



>ref|XP_002274332.3| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
Length=447

 Score =   283 bits (725),  Expect(2) = 6e-117, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 175/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K I+  L+ERR+S   +++ KD++D++L E+ K++T LTE+I +D++  L FA
Sbjct  189   QGRKRAMKTIRNMLDERRAS--PEREDKDYIDFVLEEMQKDQTILTEEIVLDLLFALPFA  246

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              YETTSSA  LA+++L  HP  L ++ +EHE I+ +RE  +S ITWNEY+SM FT MVIN
Sbjct  247   TYETTSSALVLAIQYLGSHPSALAEITKEHESILRSRERVDSGITWNEYKSMNFTMMVIN  306

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRL +I P IFRKV +D EIKGYTIP GWM MI P +VH +   Y DPL FNP RW  
Sbjct  307   ETVRLGNIVPGIFRKVAKDIEIKGYTIPAGWMVMISPPAVHFNPTLYKDPLVFNPWRWQC  366

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             QE +  S+ FM FGG  R C GAEF KL MAI LH+L+TKY+W V+  G+ V KPGL F 
Sbjct  367   QEPNAGSRNFMGFGGGIRQCVGAEFVKLQMAIFLHHLLTKYRWTVIKGGDTVWKPGLVFP  426

Query  1341  DGFKVQ  1358
              GF VQ
Sbjct  427   KGFHVQ  432


 Score =   167 bits (422),  Expect(2) = 6e-117, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 114/171 (67%), Gaps = 1/171 (1%)
 Frame = +1

Query  115  MGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQ  294
            MG PI+GE++QFF  ++   + PFI++R+ RYG LFRTS+VG  +++STD +++ FI QQ
Sbjct  1    MGLPILGETLQFFAPNTALDVAPFIRERMNRYGPLFRTSLVGWPLVISTDPDLSRFILQQ  60

Query  295  EGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQ  474
            EGKLVH WYTES   + G Q  +   G  HK LRNL LN  G E+LK   LT++++   +
Sbjct  61   EGKLVHSWYTESFDNVVGKQNVLSAKGAMHKCLRNLILNQFGSESLKTRFLTQVEELVLK  120

Query  475  HLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME-LRKYYKAFMEG  624
            HL  W+  +++++K+A   M+F   A K+  YDE +  E LR+ Y AF++G
Sbjct  121  HLQLWSNCTSVELKEAIASMIFGFTAKKLFDYDESRTPEKLRENYAAFLDG  171



>gb|EEC73772.1| hypothetical protein OsI_08447 [Oryza sativa Indica Group]
Length=480

 Score =   258 bits (660),  Expect(2) = 7e-117, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 172/249 (69%), Gaps = 5/249 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +K++K+ + ER       ++ +DF D L+ E+ +E+  LTE IA+D++ +L+FA
Sbjct  229   KGRRNAMKVLKKMMRERMEE--PGRQCEDFFDVLIEELGREKPVLTEGIALDLMFVLLFA  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAARED--KESSITWNEYRSMKFTHMV  974
             ++ETTS A TL ++ L ++P VL  L EEHE I+  R++    + +TW EY+SM FT  V
Sbjct  287   SFETTSLALTLGVRLLAENPTVLDALTEEHEAIVRGRKEGCDAAGLTWAEYKSMTFTSQV  346

Query  975   INETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW  1154
               E VRLA+I P IFRK +QD E KGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW
Sbjct  347   TLEMVRLANIVPGIFRKALQDIEFKGYTIPAGWGVMVCPPAVHLNPEIYEDPLAFNPWRW  406

Query  1155  NGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGL  1331
               + E+   SK FMAFGG  R C G + +K+ +A  +H+LVTKY+WK V  GNIVR PGL
Sbjct  407   QDKVEITGGSKHFMAFGGGLRFCVGTDLSKVLIATFIHHLVTKYRWKTVKGGNIVRTPGL  466

Query  1332  TFLDGFKVQ  1358
             +F DGF VQ
Sbjct  467   SFPDGFHVQ  475


 Score =   191 bits (486),  Expect(2) = 7e-117, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 130/196 (66%), Gaps = 1/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            +V+A   W YRW +P+  G LPPGS+G P++GE++QFF  ++   I PF+++R+ RYGS+
Sbjct  16   MVVASVMWAYRWSHPRANGRLPPGSLGLPLLGETLQFFAPNTTCDISPFVKERLNRYGSI  75

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TS+VG+ V+V+ D E+N+++FQQEGKL   WY ++  +I G       HG  +KYL++
Sbjct  76   FKTSVVGRPVVVTADPELNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKS  135

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            L L L G ENL+  LL E D+  R  L  W A  ++++K +   M+F L A K++SY+  
Sbjct  136  LVLRLYGQENLRAVLLDETDRACRASLASWAAQPSVELKDSISAMIFDLTAKKLISYEPS  195

Query  580  KAME-LRKYYKAFMEG  624
            K+ E LRK + AF+ G
Sbjct  196  KSSENLRKNFVAFIRG  211



>ref|XP_003570092.1| PREDICTED: cytochrome P450 87A3-like [Brachypodium distachyon]
Length=478

 Score =   267 bits (683),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 175/247 (71%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K++K  + ER +     ++++DFLD ++ E+ +E+  LTE +A+D++ +L+FA
Sbjct  229   KGRREAMKVLKRMMRERMAD--PSRQREDFLDVMIEELRREKPVLTEAVALDLMFVLLFA  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETT+ A TL +K L ++P VL+ L EEHE I+  RED ++ +TW EY+SM FT+ V  
Sbjct  287   SFETTALALTLGIKLLTENPRVLEALTEEHEAIVRDREDPDAGLTWAEYKSMTFTYQVTL  346

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW-N  1157
             E VRLA+I P IFRK +QD E KGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW N
Sbjct  347   EIVRLANIVPGIFRKALQDIEFKGYTIPAGWAVMVCPPAVHLNPEIYEDPLAFNPWRWQN  406

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
               E+   +K FMAFGG  R C G + +K+ MA  +H LVTKY+W+ V  GNIVR PGL+F
Sbjct  407   KIEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHSLVTKYRWRTVKGGNIVRTPGLSF  466

Query  1338  LDGFKVQ  1358
              DGF +Q
Sbjct  467   PDGFHIQ  473


 Score =   182 bits (462),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 127/209 (61%), Gaps = 1/209 (0%)
 Frame = +1

Query  1    SEMTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIP  180
            + + W V  + S +V+A   W YRW +PK  G LPPGS+G P++GE++QFF  +    + 
Sbjct  3    TTLCWAVWAVASAMVVASILWAYRWSHPKVNGRLPPGSLGLPLLGETMQFFAPNPTCDVS  62

Query  181  PFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGF  360
             F++ R+ RYG++F+TS+VG+ ++VS D ++NH++FQQEGKL   WY  +  +I G    
Sbjct  63   SFVKDRMNRYGAIFKTSVVGRPMVVSADPDLNHYVFQQEGKLFESWYPVTFTEIFGRDNV  122

Query  361  MVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLF  540
               HG  +KYL+ L L L G ENL+  LL E     R  L  W  L ++++K     M+F
Sbjct  123  GSLHGFMYKYLKTLVLRLYGQENLRAVLLAETHTACRATLASWAGLPSVELKDGLSTMIF  182

Query  541  KLAASKVLSYDEKKAME-LRKYYKAFMEG  624
             + A K++ Y+  K+ E LRK + AF+ G
Sbjct  183  DITAKKLIGYEPTKSSENLRKNFVAFIRG  211



>gb|EAZ31605.1| hypothetical protein OsJ_15749 [Oryza sativa Japonica Group]
Length=480

 Score =   258 bits (658),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 172/249 (69%), Gaps = 5/249 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +K++K+ + ER       ++ +DF D L+ E+ +E+  LTE IA+D++ +L+FA
Sbjct  229   KGRRNAMKVLKKMMRERMEE--PGRQCEDFFDVLIEELGREKPVLTEGIALDLMFVLLFA  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAARED--KESSITWNEYRSMKFTHMV  974
             ++ETTS A TL ++ L ++P VL  L EEHE I+  R++    + +TW +Y+SM FT  V
Sbjct  287   SFETTSLALTLGVRLLAENPTVLDALTEEHEAIVRGRKEGCDAAGLTWADYKSMTFTSQV  346

Query  975   INETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW  1154
               E VRLA+I P IFRK +QD E KGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW
Sbjct  347   TLEMVRLANIVPGIFRKALQDIEFKGYTIPAGWGVMVCPPAVHLNPEIYEDPLAFNPWRW  406

Query  1155  NGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGL  1331
               + E+   SK FMAFGG  R C G + +K+ +A  +H+LVTKY+WK V  GNIVR PGL
Sbjct  407   QDKVEITGGSKHFMAFGGGLRFCVGTDLSKVLIATFIHHLVTKYRWKTVKGGNIVRTPGL  466

Query  1332  TFLDGFKVQ  1358
             +F DGF VQ
Sbjct  467   SFPDGFHVQ  475


 Score =   191 bits (485),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 130/196 (66%), Gaps = 1/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            +V+A   W YRW +P+  G LPPGS+G P++GE++QFF  ++   I PF+++R+ RYGS+
Sbjct  16   MVVASVMWAYRWSHPRANGRLPPGSLGLPLLGETLQFFAPNTTCDISPFVKERLNRYGSI  75

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TS+VG+ V+V+ D E+N+++FQQEGKL   WY ++  +I G       HG  +KYL++
Sbjct  76   FKTSVVGRPVVVTADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKS  135

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            L L L G ENL+  LL E D+  R  L  W A  ++++K +   M+F L A K++SY+  
Sbjct  136  LVLRLYGQENLRAVLLDETDRACRTSLASWAAQPSVELKDSISAMIFDLTAKKLISYEPS  195

Query  580  KAME-LRKYYKAFMEG  624
            K+ E LRK + AF+ G
Sbjct  196  KSSENLRKNFVAFIRG  211



>ref|XP_002452760.1| hypothetical protein SORBIDRAFT_04g032020 [Sorghum bicolor]
 gb|EES05736.1| hypothetical protein SORBIDRAFT_04g032020 [Sorghum bicolor]
Length=482

 Score =   265 bits (678),  Expect(2) = 3e-116, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 174/247 (70%), Gaps = 1/247 (0%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K+++  + ER +    +++ +DF D L+ E+ +E+  +TE IA+D++ +L+FA
Sbjct  231   QGRKKAMKVLRTMMRERMADRPGRQQSEDFFDVLIEELRREKPVMTEAIALDLMFVLLFA  290

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETT+ A TL +K L ++P VL+ L EEHE I++ R+D+++ +TW EY+SM FT  V  
Sbjct  291   SFETTALALTLGVKLLAENPRVLRALTEEHEAIVSNRKDRDAGLTWAEYKSMTFTSQVTL  350

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E VRLA+I P IFRK +QD E KGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW  
Sbjct  351   EIVRLANIVPGIFRKALQDIEFKGYTIPAGWGVMVCPPAVHLNPEIYEDPLAFNPWRWQD  410

Query  1161  Q-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             + E+   +K FMAFGG  R C G + +K+ MA  +H LVTKY W+ +  GNIVR PGL+F
Sbjct  411   KVEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHCLVTKYSWRTIKGGNIVRTPGLSF  470

Query  1338  LDGFKVQ  1358
              DG+ VQ
Sbjct  471   PDGYHVQ  477


 Score =   182 bits (463),  Expect(2) = 3e-116, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 129/200 (65%), Gaps = 5/200 (3%)
 Frame = +1

Query  40   LVIAIAH--WVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            L +A+A   W YRW +PK  G LPPGS+GFP++GE++QFF  +    + PF+++R+ RYG
Sbjct  14   LAMAMASILWTYRWNHPKANGQLPPGSLGFPLLGETLQFFAPNPTSDVSPFVKKRLDRYG  73

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYL  393
            ++F+TSIVG+ V+VS D E+N+++FQQEGKL   WY ++  +I G       HG  +KYL
Sbjct  74   NIFKTSIVGRSVVVSADPELNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYL  133

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTAL--SNLDIKQATEIMLFKLAASKVLS  567
            + L L L G ENL+  LL +  +  R  L  W +   S +++K A   M+F L A K++S
Sbjct  134  KTLVLRLYGQENLRAVLLADAHRACRASLAAWASRPSSVVELKDAISTMIFDLTAKKLIS  193

Query  568  YDEKKAME-LRKYYKAFMEG  624
            Y+  K+ E LRK + AF+ G
Sbjct  194  YEASKSSEDLRKNFVAFIRG  213



>ref|XP_010473544.1| PREDICTED: cytochrome P450 87A3-like [Camelina sativa]
Length=473

 Score =   274 bits (700),  Expect(2) = 4e-116, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K++++ L ER      ++   DF DY++ E++KE T LTE+IA+D++ +L+FA
Sbjct  224   KGRERAMKMLRDMLQERYEK--PRENPSDFFDYVIEELNKEGTPLTEEIALDLMFVLVFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS + TLA+KFL+  P +LK+L EEHE I+  RED +S +TW EY+SM +T   IN
Sbjct  282   SFETTSFSLTLAIKFLSDDPSILKRLTEEHEAILRNREDADSGLTWKEYKSMTYTFQCIN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA++APAIFRK + D + +GY IP GW  M+CP ++HL+ E Y+DPL FNPSRW G
Sbjct  342   ETARLANLAPAIFRKALVDTQYEGYLIPAGWTVMVCPPAIHLNPEIYEDPLVFNPSRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              +   ASK FMAFGG  R C G +F+KL MA+ LH LVTKY+W+ +  GN+ R PGL F 
Sbjct  402   SKYTNASKTFMAFGGGMRFCIGTDFSKLQMAVFLHSLVTKYRWEEISGGNVRRSPGLQFP  461

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  462   NGYHVK  467


 Score =   174 bits (440),  Expect(2) = 4e-116, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 132/207 (64%), Gaps = 2/207 (1%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M W    L+S LV  +  WVY+WRNPKC+G LPPGSMG P++GE+I FF  ++   I PF
Sbjct  1    MLWAFCILVSLLVTRVTTWVYKWRNPKCRGKLPPGSMGIPLLGETISFFKPYTNSDIQPF  60

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMV  366
            I++RV +YG +F TS+VG  VIV+TD + ++F+  QEG+    WY ++  +I G Q    
Sbjct  61   IKERVVKYGPIFETSLVGIPVIVATDPDFSYFVLNQEGQCFKNWYPDTFTEIFGKQNLAT  120

Query  367  HHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKL  546
             HG  +KYL+++ L+L G E+ K+ +L E++Q   + L+ W+  +++++K +T  ++   
Sbjct  121  LHGFLYKYLKHMILSLFGHESRKK-MLPEIEQNVCKKLELWSTQNSIELKDSTASLILDR  179

Query  547  AASKVLSYDEKKAME-LRKYYKAFMEG  624
               K++ +    + E L++ + AF++G
Sbjct  180  TTKKLMGHSPGNSSENLKECFAAFIDG  206



>ref|XP_004298750.1| PREDICTED: cytochrome P450 87A3-like [Fragaria vesca subsp. vesca]
Length=480

 Score =   270 bits (690),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 179/252 (71%), Gaps = 6/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   +GR  V+  +K+ L ERR++ +K+    DF DY+L E+DKE T LTE+I  D++
Sbjct  216   AFHKCLQGRDRVLSRLKDMLQERRATSRKQPI--DFFDYVLQELDKEGTVLTEEICFDLM  273

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
              +L++ ++ETTS+A TL LKF+++HP VLKQL EEHEKII  RE+  S +TW EY+SMKF
Sbjct  274   FLLLYTSFETTSTAMTLLLKFVSEHPPVLKQLTEEHEKIIKRRENANSGLTWEEYKSMKF  333

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T  VINETVRLA   P IFRK +++ + KGYTIP GW  ++C    HL+ EKY+DPL+FN
Sbjct  334   TLQVINETVRLASQVPGIFRKAIKEVQFKGYTIPEGWSVLVCFQPQHLNPEKYEDPLAFN  393

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW G+E   ASK FMAFGG  R C GAEF K+ MA+ +H+LVTKY+W+V+  G  VR 
Sbjct  394   PWRWEGKE-SGASKDFMAFGGGLRSCVGAEFGKVKMAVFVHFLVTKYRWEVIG-GKTVRN  451

Query  1323  PGLTFLDGFKVQ  1358
               + F  GF ++
Sbjct  452   YTIQFPGGFHIR  463


 Score =   174 bits (441),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 127/204 (62%), Gaps = 2/204 (1%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            L + +++ + I I HWVYRWRNP+C G LPPGSMG+P+IGE++Q+   +S   +PPFI+ 
Sbjct  2    LGVCIVALVAIGITHWVYRWRNPRCNGKLPPGSMGWPLIGETLQYLAPNSSFDVPPFIKT  61

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R  RYG +F++ ++G   IVSTD E+N ++FQQ+ KL    Y +S  +I G Q     H 
Sbjct  62   RRERYGPIFKSQLMGAPFIVSTDPELNMYVFQQDDKLFQSGYPDSVQKIFGKQQMGNVHV  121

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              +KYL+ + LNL+GPE+LK+  L E++Q     +  W+     D+K+A   M+F L+A 
Sbjct  122  LVYKYLKRMTLNLIGPESLKKA-LPEIEQAIHTSMQQWSFQDTTDVKEAAADMIFSLSAK  180

Query  556  KVL-SYDEKKAMELRKYYKAFMEG  624
            +++       +  LR  + AF +G
Sbjct  181  RLMSYDSSNSSDNLRANFSAFADG  204



>ref|XP_006302176.1| hypothetical protein CARUB_v10020186mg [Capsella rubella]
 gb|EOA35074.1| hypothetical protein CARUB_v10020186mg [Capsella rubella]
Length=493

 Score =   269 bits (687),  Expect(2) = 9e-115, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 175/245 (71%), Gaps = 2/245 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GR+  +K++++ L ERR +   ++   DF DY++ E+ KE + LTE+IA+D++ +LIFA+
Sbjct  245   GRERAMKMLRDMLQERREN--PRENPSDFFDYVIEELKKEGSLLTEEIALDLMFVLIFAS  302

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETTS + TLA+KFL+ +P +L++L EEHE I+  RED  S +TW EY+SM +T   INE
Sbjct  303   FETTSYSLTLAIKFLSDNPLILERLTEEHEAILRNREDANSGLTWKEYKSMTYTFQFINE  362

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
             T RLA++AP IFRK + D +  GY IP GW  ++CP ++HL+ + Y+DPL F+PSRW G 
Sbjct  363   TARLANLAPGIFRKALIDTQYDGYLIPAGWTVVVCPPAIHLNPDIYEDPLVFDPSRWEGS  422

Query  1164  ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLD  1343
             +   ASK FMAFGG  R C G +F+KL MA+ LH LVTKY+W+ +  GNI R PGL F +
Sbjct  423   KYTNASKTFMAFGGGMRFCIGTDFSKLQMAVFLHSLVTKYRWEEISGGNICRSPGLQFPN  482

Query  1344  GFKVQ  1358
             G+ V+
Sbjct  483   GYHVK  487


 Score =   174 bits (441),  Expect(2) = 9e-115, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 132/207 (64%), Gaps = 2/207 (1%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M+W +   +S LV +   WVY+WRNPKC G LPPGSMG P++GE+I +F  ++   I PF
Sbjct  21   MSWALCIWVSLLVTSFTTWVYKWRNPKCSGKLPPGSMGLPLLGETISYFKPNTTSDIQPF  80

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMV  366
            I+ R+ +YG +F+TSIVG  VIV+TD + ++F+  QEG+    WY ++  +I G Q    
Sbjct  81   IKDRIKKYGPIFKTSIVGIPVIVATDPDFSYFVLNQEGQCFKNWYPDTFTKIFGNQNLAT  140

Query  367  HHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKL  546
             HG  +KYL+++ L+L G E+ K+ +L E+++     L+ W+  ++ ++K +T  ++  L
Sbjct  141  LHGFVYKYLKHMILSLFGHESRKK-MLPEIEENVCNKLELWSTQNSTELKDSTASLILDL  199

Query  547  AASKVLSYDEKKAME-LRKYYKAFMEG  624
             A K++  +  K+ E LR  + +F++G
Sbjct  200  TAKKLMGLNPGKSSENLRDCFASFVDG  226



>ref|XP_004171985.1| PREDICTED: cytochrome P450 87A3-like [Cucumis sativus]
Length=471

 Score =   276 bits (706),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 180/247 (73%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK V+++++  L ER+ +   ++++ D+ D+++ E+ K+ T LT+++A+D+I +L+FA
Sbjct  222   QGRKRVMRMLENMLKERQQN--PREQQVDYFDFVIQELKKDGTPLTQQVALDLIFLLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL  HPHVL QL  EHE I+  R++K   I+WNEY+SM FT   +N
Sbjct  280   SHETTSIALTLAIKFLTDHPHVLNQLTAEHEGILKKRKNKSDKISWNEYKSMTFTFKFMN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN-  1157
             ET+RLA+IAP IFR+ ++D E KGYTIP GW  M+CP ++HL  + + DPL+FNP RW+ 
Sbjct  340   ETLRLANIAPGIFRRALRDVEFKGYTIPEGWAVMVCPPAIHLDPKAFADPLAFNPWRWDE  399

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
              Q    ASK FMAFGG  R C GA+FAKL MA+ LH+LVT YK K +  GNIVR PG+ F
Sbjct  400   EQRCDGASKNFMAFGGGIRFCIGADFAKLQMAVFLHHLVTNYKLKPIKGGNIVRTPGVQF  459

Query  1338  LDGFKVQ  1358
              DGF VQ
Sbjct  460   PDGFHVQ  466


 Score =   165 bits (417),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 132/206 (64%), Gaps = 5/206 (2%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W ++  I  L  ++  WVY  +NPK  G LP GSMGFP +GES QFF  +    + PFI+
Sbjct  2    WFIIGAI--LSFSVTIWVYALKNPKYNGKLPKGSMGFPFVGESTQFFAPNPSFDLSPFIK  59

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
             R+ +YG +F+T +VG+ +I+S D+E+NH IFQ+E +L  CWY E+  +I G +     H
Sbjct  60   HRILKYGPIFKTRLVGKPLIISADAELNHIIFQKEEELFECWYPETFRKIFGVKSVGSLH  119

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNL-DIKQATEIMLFKLA  549
            G  HKYL+N+  N+ G E+LK  +++E++ T+   L  W + +++ ++K     M+F L+
Sbjct  120  GFMHKYLKNMITNVFGIESLK-NMISEVEVTSTTRLKKWASHNDIVELKDEIANMIFDLS  178

Query  550  ASKVLSYDEKKAME-LRKYYKAFMEG  624
            A +++SYD +K  E +R+ + AF++G
Sbjct  179  AKRLISYDPEKCGENMRENFVAFIQG  204



>ref|XP_006300459.1| hypothetical protein CARUB_v10020228mg [Capsella rubella]
 gb|EOA33357.1| hypothetical protein CARUB_v10020228mg [Capsella rubella]
Length=473

 Score =   269 bits (688),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 173/245 (71%), Gaps = 2/245 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GR+  +K++++ L ERR +   ++   DF DY++ E+ KE+T LTE+IA+D++ +LIF +
Sbjct  225   GRERAMKMLRDMLQERREN--PRENPSDFFDYVIEELKKEDTLLTEEIALDLMFVLIFTS  282

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETTS + TLA+KFL+  P +LK L EEHE I+  RED  S +TW EY+SM +T   INE
Sbjct  283   FETTSYSLTLAIKFLSDDPSILKSLTEEHEAILRNREDANSGLTWKEYKSMTYTLQFINE  342

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
             T RLA++A  IFRK + D E +GY IP GW  M+CP ++HL+ + Y+DPL F+PSRW G 
Sbjct  343   TARLANLAIGIFRKALVDTEYEGYIIPAGWTVMVCPPAIHLNPDIYEDPLVFDPSRWEGS  402

Query  1164  ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLD  1343
             +   ASK FMAFGG  R C G +F+KL MA+ LH LVTKYKW+ +  GNI R PGL F +
Sbjct  403   KYTNASKTFMAFGGGMRFCIGTDFSKLQMAVFLHSLVTKYKWEEISGGNIRRTPGLHFPN  462

Query  1344  GFKVQ  1358
             G+ V+
Sbjct  463   GYHVK  467


 Score =   172 bits (435),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 133/207 (64%), Gaps = 2/207 (1%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M+W +   +S LV +I  WVY+WRNPKC G LPPGSMG P++GE+I FF  +S   I PF
Sbjct  1    MSWALCIWVSLLVTSITTWVYKWRNPKCSGKLPPGSMGLPLLGETIAFFKPYSNLDIQPF  60

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMV  366
            I++R+ +YG +F+TS VG  VIV+TD + ++F+  QEG+    WY ++  +I G Q    
Sbjct  61   IKERIKKYGPIFKTSFVGIPVIVATDPDFSYFVLNQEGQCFKNWYPDTFTKIFGNQNLAT  120

Query  367  HHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKL  546
             HG  +K+L+++ L+L G E+ K+ +L E+++   + L  W+  +++++K +T  ++  L
Sbjct  121  LHGFVYKHLKHMILSLFGHESRKK-MLPEIEENVCKKLKLWSTQNSVELKGSTASLILDL  179

Query  547  AASKVLSYDEKK-AMELRKYYKAFMEG  624
               K++  D+ K + +LR  + AF +G
Sbjct  180  TTKKLMGLDQGKYSDKLRDCFAAFNDG  206



>ref|XP_004141154.1| PREDICTED: cytochrome P450 87A3-like [Cucumis sativus]
 gb|KGN59780.1| hypothetical protein Csa_3G845470 [Cucumis sativus]
Length=471

 Score =   276 bits (706),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 180/247 (73%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK V+++++  L ER+ +   ++++ D+ D+++ E+ K+ T LT+++A+D+I +L+FA
Sbjct  222   QGRKRVMRMLENILKERQQN--PREQQVDYFDFVIQELKKDGTPLTQQVALDLIFLLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL  HPHVL QL  EHE I+  R++K   I+WNEY+SM FT   +N
Sbjct  280   SHETTSIALTLAIKFLTDHPHVLNQLTAEHEGILKKRKNKSDKISWNEYKSMTFTFKFMN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN-  1157
             ET+RLA+IAP IFR+ ++D E KGYTIP GW  M+CP ++HL  + + DPL+FNP RW+ 
Sbjct  340   ETLRLANIAPGIFRRALRDVEFKGYTIPEGWAVMVCPPAIHLDPKAFADPLAFNPWRWDE  399

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
              Q    ASK FMAFGG  R C GA+FAKL MA+ LH+LVT YK K +  GNIVR PG+ F
Sbjct  400   EQRCDGASKNFMAFGGGIRFCIGADFAKLQMAVFLHHLVTNYKLKPIKGGNIVRTPGVQF  459

Query  1338  LDGFKVQ  1358
              DGF VQ
Sbjct  460   PDGFHVQ  466


 Score =   165 bits (417),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 132/206 (64%), Gaps = 5/206 (2%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQ  192
            W ++  I  L  ++  WVY  +NPK  G LP GSMGFP +GES QFF  +    + PFI+
Sbjct  2    WFIIGAI--LSFSVTIWVYALKNPKYNGKLPKGSMGFPFVGESTQFFAPNPSFDLSPFIK  59

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH  372
             R+ +YG +F+T +VG+ +I+S D+E+NH IFQ+E +L  CWY E+  +I G +     H
Sbjct  60   HRILKYGPIFKTRLVGKPLIISADAELNHIIFQKEEELFECWYPETFRKIFGVKSVGSLH  119

Query  373  GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNL-DIKQATEIMLFKLA  549
            G  HKYL+N+  N+ G E+LK  +++E++ T+   L  W + +++ ++K     M+F L+
Sbjct  120  GFMHKYLKNMITNVFGIESLK-NMISEVEVTSTTRLKKWASHNDIVELKDEIANMIFDLS  178

Query  550  ASKVLSYDEKKAME-LRKYYKAFMEG  624
            A +++SYD +K  E +R+ + AF++G
Sbjct  179  AKRLISYDPEKCGENMRENFVAFIQG  204



>dbj|BAJ97484.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93628.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=473

 Score =   259 bits (661),  Expect(2) = 6e-114, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 173/247 (70%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +K++K  + ER +   + ++++DFLD ++ E+ +E+  LTE +A+D++ +L+FA
Sbjct  224   KGRRNAMKVLKRMMRERMAD--QGRQRQDFLDVMIEELRREKPVLTETVALDLMFVLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETT+ A TL ++ + ++P VL  L EEHE I+  R+D ++ +TW EY+SM FT  V  
Sbjct  282   SFETTALALTLGIRLITENPRVLDALTEEHEAIVRDRKDPDAGLTWAEYKSMTFTSQVTL  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R+A+I P IFRK +QD E KGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW  
Sbjct  342   EIARIANIVPGIFRKALQDIEFKGYTIPAGWAVMVCPPAVHLNPEIYEDPLAFNPWRWQD  401

Query  1161  Q-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             + E+   +K FMAFGG  R C G + +K+ MA  +H LVTKY+WK V  GN +R PGL+F
Sbjct  402   KMEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHCLVTKYRWKTVKGGNTMRTPGLSF  461

Query  1338  LDGFKVQ  1358
              DGF +Q
Sbjct  462   PDGFHIQ  468


 Score =   181 bits (459),  Expect(2) = 6e-114, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 123/198 (62%), Gaps = 3/198 (2%)
 Frame = +1

Query  40   LVIAIAH--WVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            L +A+A   W YRW +PK  G LPPGS+G P++GE++QFF  +    + PF++ RV RYG
Sbjct  9    LAMAVASILWAYRWSHPKANGRLPPGSLGLPLLGETMQFFAPNPTCDVSPFVKDRVNRYG  68

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYL  393
            ++F+TS+VG+ V+VS D ++NH+IFQQEGKL   WY  +  +I G       HG  +KYL
Sbjct  69   TIFKTSVVGRAVVVSADPDLNHYIFQQEGKLFESWYPATFTEIFGRDNVGSLHGFMYKYL  128

Query  394  RNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD  573
            + L L L G ENL+  LL + D   R  L  W    ++++K     M+F + A K++ Y+
Sbjct  129  KTLVLRLYGQENLRAVLLADTDTACRATLASWAGQPSVELKDGLSTMIFDITAKKLIGYE  188

Query  574  EKKAME-LRKYYKAFMEG  624
              K+ + LRK + AF+ G
Sbjct  189  PTKSSKSLRKNFVAFIRG  206



>dbj|BAD29475.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAD29524.1| putative cytochrome P450 [Oryza sativa Japonica Group]
Length=506

 Score =   249 bits (635),  Expect(2) = 6e-114, Method: Compositional matrix adjust.
 Identities = 124/275 (45%), Positives = 172/275 (63%), Gaps = 31/275 (11%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N +K++K+ + ER       ++ +DF D L+ E+ +E+  LTE IA+D++ +L+FA
Sbjct  229   KGRRNAMKVLKKMMRERMEE--PGRQCEDFFDVLIEELGREKPVLTEGIALDLMFVLLFA  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAARED--KESSITWNEYRSMKFTHMV  974
             ++ETTS A TL ++ L ++P VL  L EEHE I+  R++    + +TW +Y+SM FT  V
Sbjct  287   SFETTSLALTLGVRLLAENPTVLDALTEEHEAIVRGRKEGCDAAGLTWADYKSMTFTSQV  346

Query  975   INETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW  1154
               E VRLA+I P IFRK +QD E KGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW
Sbjct  347   TLEMVRLANIVPGIFRKALQDIEFKGYTIPAGWGVMVCPPAVHLNPEIYEDPLAFNPWRW  406

Query  1155  NGQ---------------------------ELHPASKKFMAFGGVQRLCAGAEFAKLAMA  1253
               Q                           E+   SK FMAFGG  R C G + +K+ +A
Sbjct  407   QMQLTLVVLMLSGLSVGLIPKIYRVQQDKVEITGGSKHFMAFGGGLRFCVGTDLSKVLIA  466

Query  1254  IMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGFKVQ  1358
               +H+LVTKY+WK V  GNIVR PGL+F DGF VQ
Sbjct  467   TFIHHLVTKYRWKTVKGGNIVRTPGLSFPDGFHVQ  501


 Score =   191 bits (485),  Expect(2) = 6e-114, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 130/196 (66%), Gaps = 1/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            +V+A   W YRW +P+  G LPPGS+G P++GE++QFF  ++   I PF+++R+ RYGS+
Sbjct  16   MVVASVMWAYRWSHPRANGRLPPGSLGLPLLGETLQFFAPNTTCDISPFVKERLNRYGSI  75

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TS+VG+ V+V+ D E+N+++FQQEGKL   WY ++  +I G       HG  +KYL++
Sbjct  76   FKTSVVGRPVVVTADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKS  135

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            L L L G ENL+  LL E D+  R  L  W A  ++++K +   M+F L A K++SY+  
Sbjct  136  LVLRLYGQENLRAVLLDETDRACRTSLASWAAQPSVELKDSISAMIFDLTAKKLISYEPS  195

Query  580  KAME-LRKYYKAFMEG  624
            K+ E LRK + AF+ G
Sbjct  196  KSSENLRKNFVAFIRG  211



>gb|KFK43534.1| hypothetical protein AALP_AA1G139200 [Arabis alpina]
Length=441

 Score =   286 bits (732),  Expect(2) = 7e-114, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K++++ L ERR +   +K   DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  188   KGREKAMKMLRDMLQERRKN--PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFA  245

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+  P VLK+L EEHE I+  RED  S +TW EY+SM +T   IN
Sbjct  246   SFETTSLALTLAIKFLSDDPEVLKRLTEEHETILRNREDANSGLTWEEYKSMTYTFQFIN  305

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK ++D + K YTIP GW  M+CP +VHL+ +KY DPL FNPSRW G
Sbjct  306   ETARLANIVPAIFRKALRDIKFKDYTIPAGWAVMVCPPAVHLNPDKYKDPLLFNPSRWEG  365

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              +   ASK FMAFGG  R C G +F KL MA+ LH LVTKY+W+ +  GNIVR PGL F 
Sbjct  366   SKASDASKHFMAFGGGMRFCVGTDFTKLQMAVFLHSLVTKYRWEEIKGGNIVRTPGLQFP  425

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  426   NGYHVR  431


 Score =   154 bits (388),  Expect(2) = 7e-114, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = +1

Query  115  MGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQ  294
            MGFP++GESIQFF  ++   IPPF+++RV +YG +F+T++VG+ VIVSTD ++++F+FQQ
Sbjct  1    MGFPLLGESIQFFKPNTTSDIPPFVKERVKKYGPIFKTNLVGRPVIVSTDPDLSYFVFQQ  60

Query  295  EGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQ  474
            EG+    WY ++  QI G +     HG  +KYL+++ L L G + LK+ +L +++ TA +
Sbjct  61   EGRCFQSWYPDTFTQIFGRKNVGSLHGFMYKYLKSMVLTLFGYDGLKK-MLPQVELTANK  119

Query  475  HLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME-LRKYYKAFMEG  624
             L+ W+   ++++K AT  M+F L A K++S+D  K+ E LR  + AF++G
Sbjct  120  RLELWSNQESVELKDATASMIFDLTAKKLISHDPDKSSENLRSNFVAFIQG  170



>ref|NP_001053601.1| Os04g0570600 [Oryza sativa Japonica Group]
 dbj|BAF15515.1| Os04g0570600 [Oryza sativa Japonica Group]
 gb|EEE61529.1| hypothetical protein OsJ_15833 [Oryza sativa Japonica Group]
Length=486

 Score =   252 bits (644),  Expect(2) = 8e-114, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 174/254 (69%), Gaps = 8/254 (3%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkk-----kkkkkDFLDYLLSEVDKEETFLTEKIAVDVIC  785
             +GR+  + ++++ L ER+ S         ++  DFLDY++ E+ KE+  +TEK+A+D++ 
Sbjct  228   QGRRRAMVVLEQVLEERKQSTGLQRGGEAQQHGDFLDYVIQEITKEKPVMTEKMALDLMF  287

Query  786   MLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAARE--DKESSITWNEYRSMK  959
             +L+FA++ TTS A TLA+K L  HP VL++L  EHE I+  RE   +   ITW EY+SM 
Sbjct  288   VLLFASFHTTSLALTLAVKLLADHPLVLEELTVEHETILKDREAGSELDRITWKEYKSMA  347

Query  960   FTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSF  1139
             FT  VINETVRLA+IAP IFRK ++D    GYTIP GW  M+CP +VHL+   Y DPL+F
Sbjct  348   FTSQVINETVRLANIAPVIFRKALKDIRFNGYTIPAGWGVMVCPPAVHLNPYIYPDPLTF  407

Query  1140  NPSRWNGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIV  1316
              PSR+  + E++  SK FMAFGG  R C GA+F+KL +AI LH+LVTKY+W  +    +V
Sbjct  408   IPSRFKDKPEINRGSKHFMAFGGGLRFCVGADFSKLQLAIFLHFLVTKYRWIPLGASRVV  467

Query  1317  RKPGLTFLDGFKVQ  1358
             R PGL F DG++++
Sbjct  468   RTPGLEFPDGYRIK  481


 Score =   187 bits (476),  Expect(2) = 8e-114, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 122/189 (65%), Gaps = 0/189 (0%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
            H   RWRNP+C G LPPGSMG P++GE+ QFF+S +   IPPFI+ R+ RYG +F+TS+V
Sbjct  22   HQARRWRNPRCGGQLPPGSMGLPLVGETFQFFSSDASLDIPPFIRHRLARYGPIFKTSLV  81

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G  V+VS D E+NH +FQQEG+L   WY +S  +I G        G   +YL+N+ L   
Sbjct  82   GHPVVVSADEELNHMVFQQEGQLFQSWYPDSFVEILGKDNVGEQQGAMFRYLKNMVLRYF  141

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAMELR  597
            GPE+LK+ ++ ++++     L  W+ L  +++K+A   M+F LAASK+L  +  ++  LR
Sbjct  142  GPESLKEGIIRDVERAVSSSLCTWSTLPAVELKEAVSTMVFDLAASKLLGLEPSRSKILR  201

Query  598  KYYKAFMEG  624
            K +  F+ G
Sbjct  202  KSFFDFVRG  210



>emb|CAH67278.1| OSIGBa0111L12.5 [Oryza sativa Indica Group]
 gb|EEC77825.1| hypothetical protein OsI_17035 [Oryza sativa Indica Group]
Length=484

 Score =   252 bits (644),  Expect(2) = 8e-114, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 174/254 (69%), Gaps = 8/254 (3%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkk-----kkkkkDFLDYLLSEVDKEETFLTEKIAVDVIC  785
             +GR+  + ++++ L ER+ S         ++  DFLDY++ E+ KE+  +TEK+A+D++ 
Sbjct  226   QGRRRAMVVLEQVLEERKQSTGLQRGGEAQQHGDFLDYVIQEITKEKPVMTEKMALDLMF  285

Query  786   MLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAARE--DKESSITWNEYRSMK  959
             +L+FA++ TTS A TLA+K L  HP VL++L  EHE I+  RE   +   ITW EY+SM 
Sbjct  286   VLLFASFHTTSLALTLAVKLLADHPLVLEELTVEHETILKDREAGSELDRITWKEYKSMA  345

Query  960   FTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSF  1139
             FT  VINETVRLA+IAP IFRK ++D    GYTIP GW  M+CP +VHL+   Y DPL+F
Sbjct  346   FTSQVINETVRLANIAPVIFRKALKDIRFNGYTIPAGWGVMVCPPAVHLNPYIYPDPLTF  405

Query  1140  NPSRWNGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIV  1316
              PSR+  + E++  SK FMAFGG  R C GA+F+KL +AI LH+LVTKY+W  +    +V
Sbjct  406   IPSRFKDKPEINRGSKHFMAFGGGLRFCVGADFSKLQLAIFLHFLVTKYRWIPLGASRVV  465

Query  1317  RKPGLTFLDGFKVQ  1358
             R PGL F DG++++
Sbjct  466   RTPGLEFPDGYRIK  479


 Score =   187 bits (476),  Expect(2) = 8e-114, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 122/189 (65%), Gaps = 0/189 (0%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
            H   RWRNP+C G LPPGSMG P++GE+ QFF+S +   IPPFI+ R+ RYG +F+TS+V
Sbjct  20   HQARRWRNPRCGGQLPPGSMGLPLVGETFQFFSSDASLDIPPFIRHRLARYGPIFKTSLV  79

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G  V+VS D E+NH +FQQEG+L   WY +S  +I G        G   +YL+N+ L   
Sbjct  80   GHPVVVSADEELNHMVFQQEGQLFQSWYPDSFVEILGKDNVGEQQGAMFRYLKNMVLRYF  139

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAMELR  597
            GPE+LK+ ++ ++++     L  W+ L  +++K+A   M+F LAASK+L  +  ++  LR
Sbjct  140  GPESLKEGIIRDVERAVSSSLCTWSTLPAVELKEAVSTMVFDLAASKLLGLEPSRSKILR  199

Query  598  KYYKAFMEG  624
            K +  F+ G
Sbjct  200  KSFFDFVRG  208



>ref|XP_008646050.1| PREDICTED: cytochrome P450 87A3-like [Zea mays]
 gb|AFW72785.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=475

 Score =   264 bits (674),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 173/247 (70%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K+++  + ER       ++ +DF D L+ E+ +E+  +TE IA+D++ +L+FA
Sbjct  226   QGRKKAMKVLRTMMRERMPH--PGRQNEDFFDVLIEELRREKPVMTEAIALDLMFVLLFA  283

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETT+ A TL +K L Q+P VL+ L EEHE I+++R+D+++ +TW EY+SM FT  V  
Sbjct  284   SFETTALALTLGIKLLAQNPRVLRALTEEHEAIVSSRKDRDAGLTWAEYKSMTFTSQVTL  343

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E VRLA+I P IFRK +QD E KGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW  
Sbjct  344   EIVRLANIVPGIFRKALQDIEFKGYTIPAGWGVMVCPPAVHLNPEIYEDPLAFNPWRWQD  403

Query  1161  Q-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             + E+   +K FMAFGG  R C G + +K+ MA  +H LVTKY W+ +  GNIVR PGL+F
Sbjct  404   KVEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHCLVTKYSWRTIRGGNIVRTPGLSF  463

Query  1338  LDGFKVQ  1358
              DGF VQ
Sbjct  464   PDGFHVQ  470


 Score =   175 bits (443),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 126/197 (64%), Gaps = 4/197 (2%)
 Frame = +1

Query  40   LVIAIAHWVYRW-RNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGS  216
            L +A+A W YRW  +PK  G LPPGS+GFP++GE++QFF  +    + PF++ R+ RYG+
Sbjct  14   LAVAMA-WAYRWWSHPKANGQLPPGSLGFPLLGETLQFFAPNPTCDVSPFVKDRLDRYGN  72

Query  217  LFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLR  396
            +F+TSIVG+ V+VS D  +N+++FQQEGKL   WY ++  +I G       HG  +KYL+
Sbjct  73   IFKTSIVGRSVVVSADL-LNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFLYKYLK  131

Query  397  NLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDE  576
             L L L G ENL+  LL E  +  R  L  W    ++++K A   M+F L A K++SY+ 
Sbjct  132  TLVLRLYGQENLRAVLLAETHRACRASLASWATRPSVELKDAISTMIFDLTAKKLISYEP  191

Query  577  KKAME-LRKYYKAFMEG  624
             K+ E LRK + AF+ G
Sbjct  192  SKSSEDLRKNFVAFIRG  208



>ref|XP_010662510.1| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
 emb|CBI31825.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   244 bits (622),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 166/248 (67%), Gaps = 4/248 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+   K ++  L ER +S   +++ KD +D+++ E+ K++T LTE+IAVD++  L F 
Sbjct  228   KGRERARKTLRNRLLERLAS--PEREHKDIMDFIIQEMKKDDTILTEEIAVDLLFGLPFG  285

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A ETTSS   LA+++L  HP  L ++  EHE I+  R+ K+S ITW EY+SM FT MV+N
Sbjct  286   ANETTSSTLILAVQYLGSHPSALAEITREHESILRNRKQKDSGITWEEYKSMSFTMMVVN  345

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVR+  I P+IFRKV +D EIKGYTIP GWM ++ P + H +   + DP  FNP RW G
Sbjct  346   ETVRMGSILPSIFRKVDKDIEIKGYTIPAGWMVLVSPPAAHFNPNVHKDPHVFNPWRWQG  405

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIV--RKPGLT  1334
             QE    S   M FGG  +LCAG +FAKL +AI LH+LVTKY+W+V+  G +V  +  G  
Sbjct  406   QEPTSGSNALMGFGGGIKLCAGVDFAKLEIAIFLHHLVTKYRWEVIKGGEVVWRQSTGPI  465

Query  1335  FLDGFKVQ  1358
             F +GF V+
Sbjct  466   FPNGFHVR  473


 Score =   192 bits (488),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 133/200 (67%), Gaps = 1/200 (1%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTR  207
            +++ L++ I HW+  WR P+C G LPPGSMG+PI+GE++QF T ++ +G+ PFI++R+ R
Sbjct  11   IVTLLLVCIPHWLRSWRKPQCNGKLPPGSMGWPILGETLQFSTPYTNRGVSPFIRKRMDR  70

Query  208  YGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHK  387
            YG LFRT ++G   ++S D +++ F+ QQEGKL HCWY ES   + GPQ  +   G  HK
Sbjct  71   YGPLFRTKLLGWPFVISADPDVSRFVLQQEGKLFHCWYMESFDNLFGPQNVLSSQGALHK  130

Query  388  YLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
             LR+L L+  G E+L+  +L+++++   + L  W+  +++D+K+    M+F   A  + +
Sbjct  131  CLRSLILSQFGSESLRTRVLSQVEELVLKKLQLWSNHTSVDLKEGITSMMFDFTAKMICN  190

Query  568  YDEKKAME-LRKYYKAFMEG  624
            YDE K  E LR+ Y AF+ G
Sbjct  191  YDESKTPEKLRENYSAFLSG  210



>ref|XP_006653691.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=485

 Score =   259 bits (662),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 180/254 (71%), Gaps = 8/254 (3%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkk-----DFLDYLLSEVDKEETFLTEKIAVDVIC  785
             +GR+  + ++++ L ER+ S + +   +     DFLDY++ E+ KE+  +TEK+A+D++ 
Sbjct  227   QGRRRAMVVLEQVLEERKRSTELQHGGQAKHHGDFLDYVIQEITKEKPVMTEKMALDLMF  286

Query  786   MLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAARE--DKESSITWNEYRSMK  959
             +L+FA++ TTS A TLA+K L  +P VL++L EEH+ I+  RE   +   ITW EY+SM 
Sbjct  287   VLLFASFHTTSLALTLAVKLLADYPLVLEELTEEHDTILMGREGGSEPDGITWKEYKSMA  346

Query  960   FTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSF  1139
             FT  VINETVRLA+IAP IFRK ++D + KGYTIP GW  M+CP +VHL+ + Y DPL+F
Sbjct  347   FTSQVINETVRLANIAPVIFRKALKDIQFKGYTIPAGWGVMVCPPAVHLNPDIYPDPLTF  406

Query  1140  NPSRW-NGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIV  1316
             +P+R+ + Q++   SK FMAFGG  R C GA+F+KL +A+ LH+LVTKY+W  +    +V
Sbjct  407   SPARFKDKQDVSRGSKHFMAFGGGLRFCVGADFSKLQLAVFLHFLVTKYRWIPLGTSKVV  466

Query  1317  RKPGLTFLDGFKVQ  1358
             R PGL F DG+++Q
Sbjct  467   RSPGLEFPDGYRIQ  480


 Score =   176 bits (446),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 123/191 (64%), Gaps = 2/191 (1%)
 Frame = +1

Query  58   HWVYRWRNPKCK--GLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            H V RWRNP+ +  G LPPGSMG P++GE++QFF+  +   IPPFI+ R+ RYG +F+TS
Sbjct  19   HQVRRWRNPRPRDGGRLPPGSMGLPLVGETLQFFSPDASFDIPPFIRHRLARYGPIFKTS  78

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALN  411
            +VG  V+VS D E+NH +FQQEG+L   WY +S  +I G        G   +YL+N+ L 
Sbjct  79   LVGHPVVVSADEELNHMVFQQEGQLFQSWYPDSFVEILGRDNVGEQQGAMFRYLKNMVLR  138

Query  412  LVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME  591
              GPE+LK+ ++ ++++     L  W+ L  +++K+A   M+F LAA+K+L  +  ++  
Sbjct  139  YFGPESLKEGIIRDVERAVCSSLCTWSTLPAVELKEAVSTMVFDLAANKLLGLEPSRSKI  198

Query  592  LRKYYKAFMEG  624
            LR+ +  F+ G
Sbjct  199  LRRSFFDFVRG  209



>emb|CDP09801.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   275 bits (704),  Expect(2) = 7e-112, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 175/245 (71%), Gaps = 4/245 (2%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             K  +K++K  L ERR+    ++ + DF DY+L E+ +++T LTE IA+D++ +L+FA++E
Sbjct  205   KKAMKMLKSMLEERRAK--PREHQSDFFDYVLQELGRKDTILTEAIALDLMFVLLFASFE  262

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETV  989
             TTS A TLA+K L +HP  LK+L EEHE I+  RE  +S++TW+EY+SM FT  +INETV
Sbjct  263   TTSLALTLAVKLLAEHPAALKELTEEHEAIVRKRETPDSALTWSEYKSMTFTFQIINETV  322

Query  990   RLADIAPAIFRKVVQDFE--IKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
             RLA+I P IFRK +QD      GYTIP GW  M+CP +VHL+  +Y DPL FNP RW G 
Sbjct  323   RLANIVPGIFRKALQDCNNIGAGYTIPAGWGVMVCPPAVHLNPSRYRDPLEFNPWRWEGF  382

Query  1164  ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLD  1343
             EL+ A++ FMAFGG  R C G EF K+ MA+ LH LVTKYKW+ +  G+I+R PGL F +
Sbjct  383   ELNGATRNFMAFGGGMRFCVGTEFTKVQMALFLHCLVTKYKWQGIKGGDILRTPGLQFPN  442

Query  1344  GFKVQ  1358
             GF VQ
Sbjct  443   GFHVQ  447


 Score =   158 bits (399),  Expect(2) = 7e-112, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = +1

Query  115  MGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQ  294
            MG+P++GE+++FF+  +   + PF+++R+ R+G +FRTS+VG+ +IVSTDS++N++IFQQ
Sbjct  1    MGWPLLGETLKFFSPSTTFDVHPFVKERMKRHGPIFRTSLVGRPIIVSTDSDLNYYIFQQ  60

Query  295  EGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQ  474
            EG+L   WY ++  +I G Q     HG  +KYL+N+ LNL GPE LK+ +L +++Q A +
Sbjct  61   EGQLFQSWYPDTFTEIFGRQNVGSLHGFMYKYLKNMVLNLFGPEALKK-MLPDVEQAATR  119

Query  475  HLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME-LRKYYKAFMEG  624
             L  W++  ++D+K+AT  ++F L   K++S+D +K+ E LR+ + AF++G
Sbjct  120  KLKRWSSQKSVDMKEATASLIFDLTTKKLISHDPEKSSENLRENFVAFIQG  170



>emb|CAE04091.3| OSJNBa0088I22.12 [Oryza sativa Japonica Group]
Length=492

 Score =   252 bits (643),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 174/254 (69%), Gaps = 8/254 (3%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkk-----kkkkkDFLDYLLSEVDKEETFLTEKIAVDVIC  785
             +GR+  + ++++ L ER+ S         ++  DFLDY++ E+ KE+  +TEK+A+D++ 
Sbjct  234   QGRRRAMVVLEQVLEERKQSTGLQRGGEAQQHGDFLDYVIQEITKEKPVMTEKMALDLMF  293

Query  786   MLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAARE--DKESSITWNEYRSMK  959
             +L+FA++ TTS A TLA+K L  HP VL++L  EHE I+  RE   +   ITW EY+SM 
Sbjct  294   VLLFASFHTTSLALTLAVKLLADHPLVLEELTVEHETILKDREAGSELDRITWKEYKSMA  353

Query  960   FTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSF  1139
             FT  VINETVRLA+IAP IFRK ++D    GYTIP GW  M+CP +VHL+   Y DPL+F
Sbjct  354   FTSQVINETVRLANIAPVIFRKALKDIRFNGYTIPAGWGVMVCPPAVHLNPYIYPDPLTF  413

Query  1140  NPSRWNGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIV  1316
              PSR+  + E++  SK FMAFGG  R C GA+F+KL +AI LH+LVTKY+W  +    +V
Sbjct  414   IPSRFKDKPEINRGSKHFMAFGGGLRFCVGADFSKLQLAIFLHFLVTKYRWIPLGASRVV  473

Query  1317  RKPGLTFLDGFKVQ  1358
             R PGL F DG++++
Sbjct  474   RTPGLEFPDGYRIK  487


 Score =   181 bits (458),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 122/195 (63%), Gaps = 6/195 (3%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVT------RYGSL  219
            H   RWRNP+C G LPPGSMG P++GE+ QFF+S +   IPPFI+ R+       RYG +
Sbjct  22   HQARRWRNPRCGGQLPPGSMGLPLVGETFQFFSSDASLDIPPFIRHRLASLGCKFRYGPI  81

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TS+VG  V+VS D E+NH +FQQEG+L   WY +S  +I G        G   +YL+N
Sbjct  82   FKTSLVGHPVVVSADEELNHMVFQQEGQLFQSWYPDSFVEILGKDNVGEQQGAMFRYLKN  141

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            + L   GPE+LK+ ++ ++++     L  W+ L  +++K+A   M+F LAASK+L  +  
Sbjct  142  MVLRYFGPESLKEGIIRDVERAVSSSLCTWSTLPAVELKEAVSTMVFDLAASKLLGLEPS  201

Query  580  KAMELRKYYKAFMEG  624
            ++  LRK +  F+ G
Sbjct  202  RSKILRKSFFDFVRG  216



>gb|EMS46312.1| Cytochrome P450 87A3 [Triticum urartu]
Length=447

 Score =   265 bits (676),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 173/246 (70%), Gaps = 3/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRK  +K++K  + ER +    ++K +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  199   GRKKAMKVLKGMMQERMAD--PERKCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  256

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A TL +K L ++P V+  L EEHE I+  RED ++++TW EY+SM FT  VI E
Sbjct  257   FETTALALTLGVKLLTENPRVVDALTEEHEAIVRNREDPDAAVTWAEYKSMTFTAQVIME  316

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYT+P GW  M+CP +VHL+ + Y+DPL+FNP RW  +
Sbjct  317   IVRLANIVPGIFRKALQDVEIKGYTVPAGWGIMVCPPAVHLNPDIYEDPLAFNPWRWQDK  376

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E+   +K FMAFGG  R C G +  K+ MA  +H LVTKY+WK V  GNIVR PGL F 
Sbjct  377   PEITGGTKHFMAFGGGLRFCVGTDLTKVLMATFIHNLVTKYRWKTVKGGNIVRTPGLGFP  436

Query  1341  DGFKVQ  1358
             DGF +Q
Sbjct  437   DGFDIQ  442


 Score =   167 bits (423),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 111/190 (58%), Gaps = 32/190 (17%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
            HWVYRWR+PKC G LPPGSMG PIIGE++QFF  +   G+ PF++ RV RYGS+F+TSIV
Sbjct  22   HWVYRWRHPKCAGTLPPGSMGIPIIGETLQFFAPNPTCGLSPFVRDRVRRYGSMFKTSIV  81

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G+ V+VS D ++NH++FQ EGKL   WY ++  +I G       HG  +KYL+ L L L 
Sbjct  82   GRPVVVSADPDVNHYVFQNEGKLFESWYPDTFTEIFGRDNVGSLHGFIYKYLKTLVLRLY  141

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME-L  594
            G ENLK                                M+F L A K++ Y+  K+ E L
Sbjct  142  GQENLKA-------------------------------MIFDLTAKKLIGYEPTKSSESL  170

Query  595  RKYYKAFMEG  624
            R+ + AF+ G
Sbjct  171  RENFTAFIRG  180



>ref|NP_001288455.1| cytochrome P450 87A3-like [Zea mays]
 ref|XP_008669005.1| PREDICTED: cytochrome P450 87A3-like [Zea mays]
 gb|ACG34279.1| cytochrome P450 CYP87A15 [Zea mays]
Length=495

 Score =   251 bits (640),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 176/260 (68%), Gaps = 14/260 (5%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkk-----------DFLDYLLSEVDKEETFLTEKI  767
             +GR++ +++++E L ER+   +                 DFLD ++ EV KE+  +T+++
Sbjct  231   KGRQSAMEVLQEVLAERKRLVQVPGAGGGAMETIRRHGGDFLDLVIQEVTKEKPLVTDRM  290

Query  768   AVDVICMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESS--ITWN  941
             A+D++ +L+FA++ TTS A TLA+K L  HP VL++L  EHE I+  R  +  S  ITW 
Sbjct  291   ALDLMFVLLFASFHTTSLALTLAVKLLADHPRVLEELTVEHEAILNERNARHGSDGITWM  350

Query  942   EYRSMKFTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKY  1121
             EY+SM FT  VINETVRLA+IAP IFRK ++D + +G+TIP GW  M+CP +VHL+   Y
Sbjct  351   EYKSMTFTSQVINETVRLANIAPGIFRKALKDIQFRGFTIPAGWGVMVCPPAVHLNPVIY  410

Query  1122  DDPLSFNPSRWNGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVV  1298
              DPL FNP+R+  + E++  S+ FMAFGG  R C GA+F+KL M+I LH+LVT+Y+W+ +
Sbjct  411   PDPLIFNPTRFKDKPEINRGSRHFMAFGGGLRSCVGADFSKLQMSIFLHFLVTRYRWRSL  470

Query  1299  DEGNIVRKPGLTFLDGFKVQ  1358
               G +VR PGL F DG+ +Q
Sbjct  471   GGGKVVRNPGLEFPDGYHIQ  490


 Score =   180 bits (456),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 124/187 (66%), Gaps = 0/187 (0%)
 Frame = +1

Query  64   VYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQ  243
            V+RWRNP+C G LPPGSMG P++GE++QFF+  +   +P F++ R+ RYG +F+TS+VG 
Sbjct  27   VHRWRNPRCSGRLPPGSMGLPLVGETLQFFSPEASLDVPRFVRHRLQRYGPIFKTSLVGH  86

Query  244  KVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGP  423
             V+VS D E+N+ +FQQEG+L   WY +S  +I G        G   KYL+N+ L   GP
Sbjct  87   PVVVSADEELNYMVFQQEGQLFQSWYPDSFVEILGRDNVGEQQGAMFKYLKNMVLRYFGP  146

Query  424  ENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAMELRKY  603
            E+L++++L +++      L  W+ L ++++K+A   M+F L+A+K+LS +  ++  LR+ 
Sbjct  147  ESLRESMLRDVEHAVSSSLCTWSTLPSVELKEAVSTMVFDLSANKLLSLEPSRSKILRRS  206

Query  604  YKAFMEG  624
            +  F+ G
Sbjct  207  FFDFVRG  213



>ref|XP_004976535.1| PREDICTED: cytochrome P450 87A3-like [Setaria italica]
Length=494

 Score =   267 bits (683),  Expect(2) = 5e-111, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 183/259 (71%), Gaps = 13/259 (5%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCk----------kkkkkkDFLDYLLSEVDKEETFLTEKIA  770
             +GR++ +++++E L ERR S +           +++  DFLDY++ E+ +EE  +T+K+A
Sbjct  231   KGRQSAMEVLQEVLEERRRSVQYPGGAGGDDRARRRHGDFLDYVVQEITREEPLVTDKMA  290

Query  771   VDVICMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESS--ITWNE  944
             +D++ +L+FA++ TTS A TLA+K L  HPHVL++L  EHE I+  R+    S  ITW E
Sbjct  291   LDLMFVLLFASFHTTSLALTLAVKLLADHPHVLEELTVEHETILNDRKPGRESDGITWME  350

Query  945   YRSMKFTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYD  1124
             Y+SM FT  VINETVRLA+IAP IFRK ++D + KGYTIP GW  M+CP +VHL+ + Y 
Sbjct  351   YKSMTFTSQVINETVRLANIAPGIFRKALKDIQFKGYTIPAGWGVMVCPPAVHLNPDIYP  410

Query  1125  DPLSFNPSRWNGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVD  1301
             DPL+FNPSR+  + E++  S+ FMAFGG  R C GA+F+KL M+I LH+LVT+Y+WK + 
Sbjct  411   DPLTFNPSRFKDKPEINRGSRHFMAFGGGLRFCVGADFSKLQMSIFLHFLVTRYRWKNLG  470

Query  1302  EGNIVRKPGLTFLDGFKVQ  1358
              G IVR PGL F  G+ +Q
Sbjct  471   GGKIVRTPGLEFPGGYHIQ  489


 Score =   163 bits (412),  Expect(2) = 5e-111, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 120/190 (63%), Gaps = 3/190 (2%)
 Frame = +1

Query  64   VYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQG--IPPFIQQRVTRYGSLFRTSIV  237
            V+RWRNP+C G LPPGSMG P++GE++ FF+        +P F++ R+ RYG +F+TS+V
Sbjct  24   VHRWRNPRCSGRLPPGSMGLPLVGETLHFFSPDDDDSFDVPRFVRHRLARYGPIFKTSLV  83

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G  V+VS D E+NH +FQQEG+L   WY +S  +I G        G   KYL+N+ L   
Sbjct  84   GHPVVVSADEELNHMVFQQEGQLFQSWYPDSFVEILGRDNVGEQQGAMFKYLKNMVLRYF  143

Query  418  GPENLKQ-TLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAMEL  594
            GPE+L++ T+L +++      L  W+ L  +++K+A   M+F L+A+K+L  +  ++  L
Sbjct  144  GPESLRESTMLRDVEGAVTSSLCTWSTLPAVELKEAVSTMVFDLSANKLLGLEPSRSKVL  203

Query  595  RKYYKAFMEG  624
            RK +  F+ G
Sbjct  204  RKSFFDFVRG  213



>ref|XP_002465524.1| hypothetical protein SORBIDRAFT_01g040500 [Sorghum bicolor]
 gb|EER92522.1| hypothetical protein SORBIDRAFT_01g040500 [Sorghum bicolor]
Length=481

 Score =   230 bits (586),  Expect(2) = 7e-111, Method: Compositional matrix adjust.
 Identities = 108/248 (44%), Positives = 166/248 (67%), Gaps = 4/248 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK V  ++KE L ER S+ +K+    D LD ++ ++  E+   T+K A+D I  L+FA
Sbjct  231   QGRKKVQSVLKELLKERLSAPEKRHG--DLLDIVVDDLQSEKPVATDKFAIDAIAALLFA  288

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ T +S  ++A+KFL  +P V++ L EEHE I+  RE   SSITW+EY+SM FT  V+N
Sbjct  289   SFATIASTLSVAMKFLTDNPKVVEALTEEHETILKKREGVNSSITWDEYKSMTFTAQVMN  348

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R+ ++AP IFRK ++D ++ GYTIP GW+ MI P +VHL+   ++DPL+FNP RW  
Sbjct  349   EITRVGNVAPGIFRKSLKDVQVNGYTIPAGWLVMISPMAVHLNPRLFEDPLTFNPWRWQE  408

Query  1161  QELHPAS--KKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLT  1334
              + + ++  + FM FGG  RLC GAEF+K+ +A+ +H LVT Y+W+ V  G+++R   + 
Sbjct  409   MQDNKSTLLRNFMPFGGGIRLCVGAEFSKVLIALFIHTLVTNYRWREVKGGDVLRISEIV  468

Query  1335  FLDGFKVQ  1358
             F  G+ +Q
Sbjct  469   FPQGYHIQ  476


 Score =   200 bits (509),  Expect(2) = 7e-111, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 127/199 (64%), Gaps = 1/199 (1%)
 Frame = +1

Query  31   ISFLVIA-IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTR  207
            +S LV+  + HWVY+WR+P C G LPPGSMGFPI+GE+ QFF      GIP F ++R+ R
Sbjct  15   VSTLVVGWLLHWVYKWRHPPCNGKLPPGSMGFPIVGETFQFFRPSPSLGIPVFYKERLNR  74

Query  208  YGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHK  387
            YG +FRTS+VGQ V+VS D+E+N FIFQQEGKL   WY ++   I G +    + G  H+
Sbjct  75   YGPVFRTSLVGQPVVVSLDAEVNRFIFQQEGKLFRSWYPDTSNSIFGKESINSYDGILHR  134

Query  388  YLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
            Y+R LA    G  NLK   LTEM       L  W A  ++++K+A   M+F + A K++ 
Sbjct  135  YVRGLAARDFGLNNLKGPFLTEMADVVATSLQAWAAQPSIEVKEAISNMIFDMTAKKLIG  194

Query  568  YDEKKAMELRKYYKAFMEG  624
             D  +A ELRK Y++F +G
Sbjct  195  VDVARARELRKNYESFFQG  213



>ref|XP_003581538.1| PREDICTED: cytochrome P450 87A3-like [Brachypodium distachyon]
Length=489

 Score =   239 bits (609),  Expect(2) = 8e-110, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 171/253 (68%), Gaps = 5/253 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +F+G  +GRKN+ K++K+ L ER  +   +K+  DFLD +++E+      + EK AVD++
Sbjct  227   TFYGCIQGRKNMQKVLKDLLKERLRT--PEKRHGDFLDEVVNELQSGAGMIEEKFAVDLV  284

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               L+FA++ T SS+ T+A+KFL+ HP+V++ L+EEHE I+  RE   S ITW EY+SM F
Sbjct  285   AALLFASFATVSSSLTVAMKFLSGHPNVVEALKEEHEAILKKREGASSGITWEEYKSMTF  344

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T  V NE  R++++AP IFRK + D ++KG+TIP GW+ MI P +VHL+ E ++DPL+FN
Sbjct  345   TAQVTNEIARVSNVAPGIFRKTLTDVQVKGHTIPAGWLVMISPMAVHLNPELFEDPLTFN  404

Query  1143  PSRWNGQELHPA-SKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVR  1319
             P RW  +       K FM FGG  RLC GAEF+++ +A+ LH LVTKY WK +  G++ R
Sbjct  405   PWRWQDESKRTTLLKNFMPFGGGIRLCVGAEFSRIQIALFLHTLVTKYSWKEIKGGDVQR  464

Query  1320  KPGLTFLDGFKVQ  1358
                + F  G+ +Q
Sbjct  465   ISEIVFPKGYHIQ  477


 Score =   188 bits (477),  Expect(2) = 8e-110, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 126/205 (61%), Gaps = 4/205 (2%)
 Frame = +1

Query  28   LISFLVIA---IAHWVYRWRNPKCK-GLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            L +  V+A   + H VY+W NP C  G LPPGSMGFP++GE+ QFF       +P F +Q
Sbjct  13   LCALAVVAAGWLLHCVYKWMNPPCNSGRLPPGSMGFPLVGETFQFFKPSPSLDVPSFYKQ  72

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+ RYG +F+TS+VGQ V+VS D+E+N FIFQQEGKL   WY ++   I G +    + G
Sbjct  73   RLKRYGPVFKTSLVGQPVVVSMDAEVNRFIFQQEGKLFRSWYPDTTNNIFGRESIASYDG  132

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKY R+ A  L G E+L+  LL EMD+   Q    W A   +++K A   M+F L A 
Sbjct  133  TIHKYTRSFASRLFGLESLRDVLLAEMDRNVTQSFAAWAAEPCIEVKDAVANMIFDLTAK  192

Query  556  KVLSYDEKKAMELRKYYKAFMEGDV  630
            K++ +  +K+ +LRK + AF +G V
Sbjct  193  KLIGFGPEKSRKLRKNFDAFFQGLV  217



>gb|KFK40541.1| hypothetical protein AALP_AA2G009100 [Arabis alpina]
Length=435

 Score =   280 bits (715),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 175/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+  +K++K  L +RR     +    DF DY++ E+ KE T LTE+IA+D++ +L+FA
Sbjct  188   KGRERAMKMLKNMLQKRREK--PRDNPSDFFDYVIEELKKEGTILTEEIALDLMFVLLFA  245

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+KFL+++P VLK+L  EHE I+  RED  S +TW EY+SM +T   IN
Sbjct  246   SFETTSLALTLAIKFLSENPSVLKRLTVEHEAILRNREDANSGLTWKEYKSMTYTFQFIN  305

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I PAIFRK ++D + K YTIP GW  M+CP +VHL+ +KY DPL FNPSRW G
Sbjct  306   ETARLANIVPAIFRKALRDIQYKDYTIPAGWAVMVCPPAVHLNPDKYQDPLVFNPSRWEG  365

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              E   ASK F+AFGG  R C G +F K+ MA+ LH LVTKY+W+ +  GNI+R PGL F 
Sbjct  366   SESTNASKNFLAFGGGMRFCVGTDFTKVQMAVFLHSLVTKYRWEEISGGNIIRTPGLQFP  425

Query  1341  DGFKVQ  1358
             +G+ V+
Sbjct  426   NGYHVR  431


 Score =   145 bits (367),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = +1

Query  115  MGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQ  294
            MG P++GE+I FF  ++   I  FI++RV +YG +F+T++VG+ VIVSTDS++++F+FQQ
Sbjct  1    MGLPLLGETIHFFKPNTTSDISHFIKERVKKYGPIFKTNLVGRPVIVSTDSDLSYFVFQQ  60

Query  295  EGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQ  474
            EG+    WY ++  +I G Q     HG  +KYL+++ L+L G E+LK+ LL E++Q+A +
Sbjct  61   EGRCFQSWYPDTFTEIFGKQNVGSLHGFMYKYLKHMVLSLFGHESLKKMLL-EIEQSACK  119

Query  475  HLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME-LRKYYKAFMEG  624
             L+ W+   ++++K +T  ++F L A K++S+D +K  E LR+ + AF+ G
Sbjct  120  KLELWSNQDSVELKDSTASLIFDLTAKKLISHDPEKCTENLRENFVAFIRG  170



>ref|XP_006650369.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=495

 Score =   258 bits (660),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 171/248 (69%), Gaps = 2/248 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK V+K++KE L++R+ +  ++    DF+D ++ E+ +E+  ++EK A+++I +L+FA
Sbjct  243   QGRKIVMKMLKELLDKRKKATGRQGSNIDFIDVMIEELKEEKPTISEKAALNLIFLLLFA  302

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETT+SA T  L  L  +P  L++L EEHE I   R D  S ITW EY+SMKFT  VI+
Sbjct  303   SFETTASAITAVLTLLTDNPEALQELTEEHENIQKRRGDPNSEITWEEYKSMKFTSHVIH  362

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW--  1154
             E +RLA+IAP +FRK  +D  IKG++IP+G   MICPSSVHL+   Y DP  FNP RW  
Sbjct  363   EALRLANIAPMVFRKATEDVHIKGFSIPKGSKLMICPSSVHLNPVVYKDPNIFNPWRWKD  422

Query  1155  NGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLT  1334
               +    ASK FMAFGG  RLC GA+FAKL MAI LH LVTKY+WK +  G +V  PGL 
Sbjct  423   TAEPAGGASKDFMAFGGGLRLCVGADFAKLQMAIFLHCLVTKYRWKAIKGGTMVLAPGLR  482

Query  1335  FLDGFKVQ  1358
             F +GF +Q
Sbjct  483   FPEGFHIQ  490


 Score =   167 bits (422),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 119/186 (64%), Gaps = 3/186 (2%)
 Frame = +1

Query  70   RWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKV  249
            R  +  C+  LPPGS G P++GES++FFTS     +P F ++R+ RYG +FRT++VGQ +
Sbjct  42   RKADESCR--LPPGSRGLPLLGESLEFFTSTPSLELPAFFKRRLDRYGPVFRTNMVGQDL  99

Query  250  IVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPEN  429
            IVS D E+N+F+FQQE +L   WY +S  +I G    +   G  HKY+RNL L + GPEN
Sbjct  100  IVSLDRELNNFVFQQEERLFQIWYPDSFMRIIGADSIITTLGSPHKYIRNLVLRIFGPEN  159

Query  430  LKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAM-ELRKYY  606
            L+QT+L E+ +TA+  L  W    +++ K+A   M+F + A K++SYD   +   + K Y
Sbjct  160  LRQTMLREVQRTAQASLLSWIDRPSIEFKEAISSMIFSVTAKKLISYDSVTSDGNMWKQY  219

Query  607  KAFMEG  624
             AF+ G
Sbjct  220  DAFIRG  225



>ref|XP_010480156.1| PREDICTED: cytochrome P450 708A2-like [Camelina sativa]
Length=504

 Score =   256 bits (654),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 170/240 (71%), Gaps = 2/240 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRS-SCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
              R+NV+K+IK    ERR  +     K  DF++ +++EV+KE+  + E+ +V++I  L+ A
Sbjct  253   ARRNVMKMIKRMFKERREEATSNDLKYGDFMETMINEVEKEDDTVNEERSVELILSLLLA  312

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMK-FTHMVI  977
             +YETTS+ T + +KF+ ++P VL +L+ EHE I+  R DKES +TW EYRSM  FTHMVI
Sbjct  313   SYETTSTMTAITVKFIAENPKVLMELKREHETILQNRIDKESGVTWKEYRSMMIFTHMVI  372

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NE++RL  ++PA+FRK V D EIKGYTIP GW+ ++ PS +H   + Y+ P  FNP RW 
Sbjct  373   NESLRLGSLSPAMFRKAVSDVEIKGYTIPAGWILLVIPSLLHYDPQIYEQPCEFNPWRWE  432

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             G+EL   SK FMAFGG  RLCAGAEFA+L MAI LH+LVT Y + ++++ +I+R P L F
Sbjct  433   GKELLSGSKTFMAFGGGSRLCAGAEFARLQMAIYLHHLVTTYDFSLIEKSDIIRAPLLRF  492


 Score =   169 bits (427),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 116/183 (63%), Gaps = 3/183 (2%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTR  207
            +I+ LVI I+ W+YRW NP C G LPPGSMGFP+IGE+++FF  +S   +PPF+Q+R+++
Sbjct  31   VIALLVIKISVWLYRWANPYCSGKLPPGSMGFPVIGETVEFFKPYSFNEVPPFVQKRMSK  90

Query  208  Y--GSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG-D  378
            Y  GSLFRT+I+G K IVSTD E+N  I +Q+       Y E+  +I G        G D
Sbjct  91   YGGGSLFRTNILGSKTIVSTDPEVNFEILKQDNMCFVMSYPEALVRIFGKDNLFFKQGKD  150

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             H+Y+R +AL L+GPE LKQ  + ++DQ  R+HL   +    LD+K     ++ +     
Sbjct  151  FHRYMRQIALQLLGPECLKQRFIQKLDQATREHLKAVSFQGVLDVKDTVGRLILEQMVQM  210

Query  559  VLS  567
            ++S
Sbjct  211  IIS  213



>ref|NP_001050816.1| Os03g0658800 [Oryza sativa Japonica Group]
 gb|ABF97993.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12730.1| Os03g0658800 [Oryza sativa Japonica Group]
 dbj|BAG89430.1| unnamed protein product [Oryza sativa Japonica Group]
Length=495

 Score =   257 bits (656),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 173/248 (70%), Gaps = 3/248 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN++K++KE ++ER+ +  ++    DF+D LL E+++E+  ++E +A+D+I +L+FA
Sbjct  244   QGRKNIMKMLKELIDERKEASGRRGSI-DFIDVLLEELNEEKPLISENVALDLIFLLLFA  302

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETT+SA T  ++FL  +P  L++L EEH+ I   R D  S ITW EY+SMKFT  VI+
Sbjct  303   SFETTASAITAVVRFLTDNPEALQELAEEHDNIQKRRVDLNSEITWEEYKSMKFTSHVIH  362

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW--  1154
             E +RLA+IAP +FRK  +D  IKG+ IP+G   MICPS+VHL+   Y DP  FNP RW  
Sbjct  363   EALRLANIAPVMFRKATEDVHIKGFFIPKGSKIMICPSTVHLNPMIYKDPNIFNPWRWKD  422

Query  1155  NGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLT  1334
               +    ASK FMAFGG  RLC GA+FAKL  AI LH LVTKY+WK +  G +V  PGL 
Sbjct  423   TAEPTGGASKDFMAFGGGLRLCVGADFAKLQTAIFLHCLVTKYRWKAIKGGTMVLGPGLR  482

Query  1335  FLDGFKVQ  1358
             F +GF +Q
Sbjct  483   FPEGFHIQ  490


 Score =   167 bits (423),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 132/216 (61%), Gaps = 14/216 (6%)
 Frame = +1

Query  10   TWLVMYLISFLVIAIAHWVYRWRNPK------CKG----LLPPGSMGFPIIGESIQFFTS  159
            +WLV+   +  +  +A W+ R  + K      CK      LPPGS G P++GES++FFTS
Sbjct  14   SWLVL---TAAMAVLASWLIRLVSLKWNSSHPCKADEGSRLPPGSRGLPLLGESLEFFTS  70

Query  160  HSLQGIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQ  339
             +   +P F ++R+ RYG +FRT++VGQ +IV  D E+N F+FQQE +L  CWY +S  +
Sbjct  71   STSLELPVFFKRRLNRYGPVFRTNMVGQDLIVCLDPEVNSFVFQQEERLFQCWYPDSFMR  130

Query  340  ITGPQGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQ  519
            I G    +   G SHKY+RNL L L GPENL++ +L ++ +TA+  L  W    ++++K 
Sbjct  131  IIGADNIITTLGSSHKYIRNLILRLFGPENLRRAMLQDVHRTAQASLLSWLDRPSIELKD  190

Query  520  ATEIMLFKLAASKVLSYDEKKA-MELRKYYKAFMEG  624
            A   M+F + A K++SYD   +  ++ K + AF+ G
Sbjct  191  AVSSMIFSVTAKKLISYDSLASDGKMWKQFDAFIRG  226



>emb|CDP18915.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   276 bits (706),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 180/252 (71%), Gaps = 6/252 (2%)
 Frame = +3

Query  612   FHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVIC  785
             FH   +GRK  +K+I +   ++RS        KDF+D+LL +++KE+T L E+IA D++ 
Sbjct  176   FHACLQGRKKAMKVIHDIFEKKRSG---NDTSKDFVDHLLEQIEKEDTILNEEIARDLVF  232

Query  786   MLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFT  965
             + +FAA+ETTS+A T+AL++L+ HP V+ +L+ EHE I+  RE + S+I+W EY+SM FT
Sbjct  233   LFLFAAHETTSTALTVALRYLDGHPRVMAELKREHENILKMRETEGSAISWKEYKSMTFT  292

Query  966   HMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNP  1145
             HMVINET+RLA+I P I RKVV++ E+KGYTIP GW  M+CPS+VHL    Y++P  FNP
Sbjct  293   HMVINETLRLANITPGILRKVVKEVEVKGYTIPAGWTVMVCPSTVHLDPNVYENPHEFNP  352

Query  1146  SRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKP  1325
              RW G+ELH  SK FMAF G  RLC GA++AK+ M+I LHYLVTKY W+V +    +R P
Sbjct  353   WRWEGKELHMGSKNFMAFAGGTRLCVGADYAKVQMSIFLHYLVTKYTWRVTNGAERIRTP  412

Query  1326  -GLTFLDGFKVQ  1358
              G+ +  G  ++
Sbjct  413   TGICYPKGLHME  424


 Score =   147 bits (372),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = +1

Query  205  RYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSH  384
            RYG +FRTSIVGQ V+VSTD++ N  +FQQEG     WYTES  QI G Q  + HHG  H
Sbjct  23   RYGPIFRTSIVGQPVVVSTDADFNFRVFQQEGNAFQIWYTESLFQIIGKQSVLAHHGGFH  82

Query  385  KYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVL  564
            KYL++L   LV PE L++ L+ EMD + ++ L  W+ L  LD K  T  ++FK AA K+L
Sbjct  83   KYLKSLTFKLVSPEALREKLIYEMDASTQESLSSWSKLGKLDAKDGTSELVFKYAAKKML  142

Query  565  SYDEKKAME-LRKYYKAFMEG  624
             Y+E K  + LR  YKAFM+G
Sbjct  143  GYEESKDQQKLRDSYKAFMDG  163



>gb|EMS59428.1| Cytochrome P450 87A3 [Triticum urartu]
Length=493

 Score =   242 bits (618),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 173/277 (62%), Gaps = 33/277 (12%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N + ++K  + ER +   + ++ +DFLD ++ E+ +E+  LTE +A+D++ +L+FA
Sbjct  214   KGRRNAMTVLKRMMRERMAD--EGRQPEDFLDVMIEELRREKPVLTETVALDLMFVLLFA  271

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTH----  968
             ++ETT+ A TL ++ + ++P VL+ L EEHE I+  R+D ++ +TW EY+SM FT     
Sbjct  272   SFETTALALTLGIRLITENPKVLEALTEEHEAIVRDRKDLDAGLTWAEYKSMTFTSQLGL  331

Query  969   --------------------------MVINETVRLADIAPAIFRKVVQDFEIKGYTIPRG  1070
                                        V  E  R+A+I P IFRK +QD E KGYTIP G
Sbjct  332   HYDSGKISSKNDSGKVDNPDRPNAIVQVTLEIARIANIVPGIFRKALQDIEFKGYTIPAG  391

Query  1071  WMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLA  1247
             W  M+CP +VHL+ E Y+DPL+FNP RW  + E+   +K FMAFGG  R C G + +K+ 
Sbjct  392   WAVMVCPPAVHLNPEIYEDPLAFNPWRWQDKMEITGGTKHFMAFGGGLRFCVGTDLSKVL  451

Query  1248  MAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGFKVQ  1358
             MA  +H LVTKY+WK V  GNI+R PGL+F DGF +Q
Sbjct  452   MATFIHCLVTKYRWKTVKGGNIMRTPGLSFPDGFHIQ  488


 Score =   180 bits (457),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 121/196 (62%), Gaps = 1/196 (1%)
 Frame = +1

Query  40   LVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSL  219
            + +A   W YRW +PK  G LPPGS+G P++GE++QFF  +    + PF++ RV RYG++
Sbjct  1    MAVAFILWTYRWSHPKANGRLPPGSLGLPLLGETMQFFAPNPTCDVSPFVKDRVNRYGTV  60

Query  220  FRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRN  399
            F+TS+VG+ ++VS D ++NH++FQQEGKL   WY  +  +I G       HG  +KYL+ 
Sbjct  61   FKTSVVGRAMVVSADPDLNHYVFQQEGKLFESWYPATFTEIFGRDNVGSLHGFMYKYLKT  120

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            L L L G ENL+  L  + D   R  L  W +  ++++K     M+F + A K++ Y+  
Sbjct  121  LVLRLYGQENLRAVLFADTDTACRATLASWASQPSVELKDGLSTMIFDITAKKLIGYEPT  180

Query  580  KAME-LRKYYKAFMEG  624
            K+ E LRK + AF+ G
Sbjct  181  KSSESLRKNFVAFIRG  196



>gb|EMT30405.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=521

 Score =   238 bits (608),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 173/295 (59%), Gaps = 51/295 (17%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+N + ++K  + ER +   + ++ +DFLD ++ E+ +E+  LTE +A+D++ +L+FA
Sbjct  224   KGRRNAMTVLKRMMRERMAD--EGRQPEDFLDVMIEELRREKPVLTETVALDLMFVLLFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETT+ + TL ++ + ++P VL+ L EEHE I+  R+D ++ +TW EY+SM FT  V  
Sbjct  282   SFETTALSLTLGIRLITENPKVLEALTEEHEAIVRDRKDPDAGLTWAEYKSMTFTSQVTL  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW--  1154
             E  R+A+I P IFRK +QD E KGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW  
Sbjct  342   EIARIANIVPGIFRKALQDIEFKGYTIPAGWAVMVCPPAVHLNPEIYEDPLAFNPWRWQC  401

Query  1155  -----------------------------------------------NGQELHPASKKFM  1193
                                                            +  E+   +K FM
Sbjct  402   HANDYIYKSYPKFDHSNQIHLCAVKSDSRAAYCQMILNPHCSVDKEQDKMEITGGTKHFM  461

Query  1194  AFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGFKVQ  1358
             AFGG  R C G + +K+ MA  +H LVTKY+WK V  GNI+R PGL+F DGF +Q
Sbjct  462   AFGGGLRFCVGTDLSKVLMATFIHCLVTKYRWKTVKGGNIMRTPGLSFPDGFHIQ  516


 Score =   182 bits (462),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 127/208 (61%), Gaps = 4/208 (2%)
 Frame = +1

Query  4    EMTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            E  W+V  +++   +A   W YRW +PK  G LPPGS+G P++GE++QFF  +    + P
Sbjct  2    EALWVVALVMA---VAFILWAYRWSHPKANGRLPPGSLGLPLLGETMQFFAPNPTCDVSP  58

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFM  363
            F++ RV RYG++F+TS+VG+ ++VS D ++NH++FQQEGKL   WY  +  +I G     
Sbjct  59   FVKDRVNRYGTIFKTSVVGRAMVVSADPDLNHYVFQQEGKLFESWYPATFTEIFGRDNVG  118

Query  364  VHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFK  543
              HG  +KYL+ L L L G ENL+  LL + D   R  L  W    ++++K     M+F 
Sbjct  119  SLHGFMYKYLKTLVLRLYGQENLRAVLLADTDTACRATLASWADQPSVELKDGLSTMIFD  178

Query  544  LAASKVLSYDEKKAME-LRKYYKAFMEG  624
            + A K++ Y+  K+ E LRK + AF+ G
Sbjct  179  ITAKKLIGYEPTKSSESLRKNFVAFIRG  206



>ref|NP_001053600.1| Os04g0570500 [Oryza sativa Japonica Group]
 emb|CAC81901.1| cytochrome P450 [Oryza sativa]
 dbj|BAF15514.1| Os04g0570500 [Oryza sativa Japonica Group]
 dbj|BAG96026.1| unnamed protein product [Oryza sativa Japonica Group]
Length=482

 Score =   219 bits (558),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 157/246 (64%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV   + + + ER S+  KK    D +D ++ E+  E+  + E  A+D +  L+F 
Sbjct  234   QGRRNVRNTLTDIMKERLSAPGKKYG--DLVDLIVEELQSEKPMIDENFAIDALAALLFT  291

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ T SS  T+A K+L  +P V+++L+EEH  I+  RE   S  TW EYRS+KF+  V+N
Sbjct  292   SFATLSSTLTVAFKYLTDNPKVVEELKEEHGTILKKREGVNSGFTWEEYRSLKFSTQVMN  351

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R++++ P +FRK + D ++KGYTIP GW+ MI P +VHL+ + ++DPL F+P RW  
Sbjct  352   EITRISNVTPGVFRKTLTDVQVKGYTIPSGWLVMISPMAVHLNPKLFEDPLKFDPWRWRE  411

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             ++     K +M FGG  RLC GAEF+KL +A+ LH LVT+Y W  ++ G ++R   + F 
Sbjct  412   EKRSSMLKNYMPFGGGVRLCLGAEFSKLFIALFLHILVTEYSWTEIEGGEVLRISEIMFP  471

Query  1341  DGFKVQ  1358
              G+ +Q
Sbjct  472   QGYHIQ  477


 Score =   200 bits (508),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 130/200 (65%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   ISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRY  210
            ++ ++  +AHWVY+W NP C G LPPGSMGFPIIGE+ QFF +     +P + +QR+ RY
Sbjct  19   VTLIIGWLAHWVYKWMNPPCIGRLPPGSMGFPIIGETFQFFRASPSIDMPSYYKQRLERY  78

Query  211  GSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKY  390
            G LF+TS+VG+ VI+S D E+N FIFQQEGKL   WY E+   I G +    ++G  HK+
Sbjct  79   GPLFKTSLVGRPVIISLDPEVNRFIFQQEGKLFQSWYPETAINIFGKKSLTTYNGTIHKF  138

Query  391  LRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSY  570
            +R +A  L G ENLK++LL E++ + R+    WT   +++++     M+F L A K++  
Sbjct  139  IRGVAAKLFGLENLKESLLPELENSMRESFASWTGKPSVEVQDGVSDMIFDLVAKKLIGL  198

Query  571  DEKKAMELRKYYKAFMEGDV  630
            D   + ELRK ++ F +G V
Sbjct  199  DVTNSRELRKNFQDFFQGMV  218



>emb|CBI18863.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   233 bits (595),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 165/252 (65%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + +K VIKLI++ L ER+ S   + +K DFLD ++ ++ KE+ FL++   V V+
Sbjct  258   TFHKCLKNQKEVIKLIRDILKERKVS--PESRKGDFLDQIVDDIKKEK-FLSDDFIVLVM  314

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++ A++ET S+  TLA+K L ++P V+++L EEHE I+  RE+  S I+W EY+SM F
Sbjct  315   FGILLASFETISATLTLAVKLLIENPSVMQELIEEHEAILKNRENSNSGISWKEYKSMTF  374

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             TH VINE +RLA +AP I R+ ++D ++ GYTIP GW  M+ P+++ LS + + DPL+FN
Sbjct  375   THQVINEALRLASVAPGILRRAIKDIQVNGYTIPAGWTIMVVPAALQLSPDAFVDPLAFN  434

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             PSRW    +   +K F+ FGG  RLCAGAEF K+ M    H LVT Y+   +  G I R 
Sbjct  435   PSRWKDMGVGVVAKNFIPFGGGSRLCAGAEFTKVLMTTFFHVLVTNYRLTKIKGGQIARS  494

Query  1323  PGLTFLDGFKVQ  1358
             P LTF +G  + 
Sbjct  495   PALTFGNGLHIN  506


 Score =   186 bits (471),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 124/198 (63%), Gaps = 3/198 (2%)
 Frame = +1

Query  7    MTWLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            M W V + ++S  + +I HWVY+WRNPKC G LPPGSMGFP+IGE+IQFF       +  
Sbjct  37   MYWSVWLCVVSLFIASIIHWVYKWRNPKCNGKLPPGSMGFPLIGETIQFFIPSKSLDVSS  96

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG--  357
            FI++R+ +YG LF T++VG+ V+VS+D + N++IFQQEG+LV  WY +S A++ G     
Sbjct  97   FIRKRMKKYGPLFCTNLVGRPVVVSSDPDFNYYIFQQEGRLVEIWYLDSFARLVGQDASQ  156

Query  358  FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIML  537
                 G  HKYLRNL L   G E LK  LL++ +   R  L  W+ L  L+ K     M+
Sbjct  157  STAASGYVHKYLRNLVLAHFGTEVLKDKLLSKAEDMIRTRLHDWSKLPALEFKTCVSSMI  216

Query  538  FKLAASKVLSYDEKKAME  591
            F   A+++ SYD KK  E
Sbjct  217  FDFTANELFSYDIKKMGE  234



>emb|CAH67277.1| OSIGBa0111L12.4 [Oryza sativa Indica Group]
 gb|EEC77824.1| hypothetical protein OsI_17034 [Oryza sativa Indica Group]
Length=482

 Score =   219 bits (558),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 157/246 (64%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV   + + + ER S+  KK    D +D ++ E+  E+  + E  A+D +  L+F 
Sbjct  234   QGRRNVRNTLTDIMKERLSAPGKKYG--DLVDLIVEELQSEKPMIDENFAIDALAALLFT  291

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ T SS  T+A K+L  +P V+++L+EEH  I+  RE   S  TW EYRS+KF+  V+N
Sbjct  292   SFATLSSTLTVAFKYLTDNPKVVEELKEEHGTILKKREGVNSGFTWEEYRSLKFSTQVMN  351

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R++++ P +FRK + D ++KGYTIP GW+ MI P +VHL+ + ++DPL F+P RW  
Sbjct  352   EITRISNVTPGVFRKTLTDVQVKGYTIPSGWLVMISPMAVHLNPKLFEDPLKFDPWRWRE  411

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             ++     K +M FGG  RLC GAEF+KL +A+ LH LVT+Y W  ++ G ++R   + F 
Sbjct  412   EKRSSMLKNYMPFGGGVRLCLGAEFSKLFIALFLHILVTEYSWTEIEGGEVLRISEIMFP  471

Query  1341  DGFKVQ  1358
              G+ +Q
Sbjct  472   QGYHIQ  477


 Score =   199 bits (507),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 130/200 (65%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   ISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRY  210
            ++ ++  +AHW+Y+W NP C G LPPGSMGFPIIGE+ QFF +     +P + +QR+ RY
Sbjct  19   VTLIIGWLAHWIYKWMNPPCIGRLPPGSMGFPIIGETFQFFRASPSIDMPSYYKQRLERY  78

Query  211  GSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKY  390
            G LF+TS+VG+ VI+S D E+N FIFQQEGKL   WY E+   I G +    ++G  HK+
Sbjct  79   GPLFKTSLVGRPVIISLDPEVNRFIFQQEGKLFQSWYPETAINIFGKKSLTTYNGTIHKF  138

Query  391  LRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSY  570
            +R +A  L G ENLK++LL E++ + R+    WT   +++++     M+F L A K++  
Sbjct  139  IRGVAAKLFGLENLKESLLPELENSMRESFASWTGKPSVEVQDGVSDMIFDLVAKKLIGL  198

Query  571  DEKKAMELRKYYKAFMEGDV  630
            D   + ELRK ++ F +G V
Sbjct  199  DVTNSRELRKNFQDFFQGMV  218



>ref|XP_002284844.1| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
Length=476

 Score =   233 bits (594),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 165/252 (65%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + +K VIKLI++ L ER+ S   + +K DFLD ++ ++ KE+ FL++   V V+
Sbjct  222   TFHKCLKNQKEVIKLIRDILKERKVS--PESRKGDFLDQIVDDIKKEK-FLSDDFIVLVM  278

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++ A++ET S+  TLA+K L ++P V+++L EEHE I+  RE+  S I+W EY+SM F
Sbjct  279   FGILLASFETISATLTLAVKLLIENPSVMQELIEEHEAILKNRENSNSGISWKEYKSMTF  338

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             TH VINE +RLA +AP I R+ ++D ++ GYTIP GW  M+ P+++ LS + + DPL+FN
Sbjct  339   THQVINEALRLASVAPGILRRAIKDIQVNGYTIPAGWTIMVVPAALQLSPDAFVDPLAFN  398

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             PSRW    +   +K F+ FGG  RLCAGAEF K+ M    H LVT Y+   +  G I R 
Sbjct  399   PSRWKDMGVGVVAKNFIPFGGGSRLCAGAEFTKVLMTTFFHVLVTNYRLTKIKGGQIARS  458

Query  1323  PGLTFLDGFKVQ  1358
             P LTF +G  + 
Sbjct  459   PALTFGNGLHIN  470


 Score =   186 bits (471),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 124/198 (63%), Gaps = 3/198 (2%)
 Frame = +1

Query  7    MTWLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            M W V + ++S  + +I HWVY+WRNPKC G LPPGSMGFP+IGE+IQFF       +  
Sbjct  1    MYWSVWLCVVSLFIASIIHWVYKWRNPKCNGKLPPGSMGFPLIGETIQFFIPSKSLDVSS  60

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG--  357
            FI++R+ +YG LF T++VG+ V+VS+D + N++IFQQEG+LV  WY +S A++ G     
Sbjct  61   FIRKRMKKYGPLFCTNLVGRPVVVSSDPDFNYYIFQQEGRLVEIWYLDSFARLVGQDASQ  120

Query  358  FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIML  537
                 G  HKYLRNL L   G E LK  LL++ +   R  L  W+ L  L+ K     M+
Sbjct  121  STAASGYVHKYLRNLVLAHFGTEVLKDKLLSKAEDMIRTRLHDWSKLPALEFKTCVSSMI  180

Query  538  FKLAASKVLSYDEKKAME  591
            F   A+++ SYD KK  E
Sbjct  181  FDFTANELFSYDIKKMGE  198



>ref|XP_002448363.1| hypothetical protein SORBIDRAFT_06g025830 [Sorghum bicolor]
 gb|EES12691.1| hypothetical protein SORBIDRAFT_06g025830 [Sorghum bicolor]
Length=494

 Score =   251 bits (642),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 178/259 (69%), Gaps = 13/259 (5%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCk----------kkkkkkDFLDYLLSEVDKEETFLTEKIA  770
             +GR++ +++++E L ER+ S +            ++  DFLD ++ E+ KE+  +T+++A
Sbjct  231   KGRQSAMEVLQEVLEERKRSVQLPGAGGGAMETTRRHGDFLDLVIQEMTKEKPLVTDRMA  290

Query  771   VDVICMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESS--ITWNE  944
             +D++ +L+FA++ TTS A TLA+K L  HP VL++L  EHE I++ R+    S  ITW E
Sbjct  291   LDLMFVLLFASFHTTSLALTLAVKLLADHPRVLEELTVEHETILSGRKACHGSDGITWME  350

Query  945   YRSMKFTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYD  1124
             Y+SM FT  VINETVRLA+IAP IFRK ++D   KG+TIP GW  M+CP +VHL+   Y 
Sbjct  351   YKSMTFTSQVINETVRLANIAPGIFRKALKDIRFKGFTIPAGWGVMVCPPAVHLNPVIYP  410

Query  1125  DPLSFNPSRWNGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVD  1301
             DPL FNP+R+  + E+   S+ FMAFGG  R C GA+F+KL M+I LH+LVT+Y+WK + 
Sbjct  411   DPLIFNPTRFKDKPEIDRGSRHFMAFGGGLRSCVGADFSKLQMSIFLHFLVTRYRWKNLW  470

Query  1302  EGNIVRKPGLTFLDGFKVQ  1358
              G IVR PGL F DG+ +Q
Sbjct  471   GGKIVRNPGLEFSDGYHIQ  489


 Score =   166 bits (421),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 122/188 (65%), Gaps = 2/188 (1%)
 Frame = +1

Query  67   YRWRNPKCKG-LLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQ  243
            +RWRNP+C G  LPPGSMG P++GE++QFF+  +   +P F++ R+ RYG +F+TS+VG 
Sbjct  26   HRWRNPRCSGGRLPPGSMGLPLVGETLQFFSPDASLDVPRFVRHRLARYGPIFKTSLVGH  85

Query  244  KVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGP  423
             V+VS D E+N+ +FQQEG+L   WY +S  +I G        G   K+L+N+ L  +GP
Sbjct  86   PVVVSADEELNYMVFQQEGRLFQSWYPDSFVEILGRDNVGEQQGAMFKHLKNMVLRYLGP  145

Query  424  ENLKQ-TLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAMELRK  600
            E+L++ ++L +++      L  W+ L  +++K+A   M+F L+A+K+L  +  ++  LRK
Sbjct  146  ESLRESSMLRDVEHAVGSSLCTWSTLPAVELKEAVSTMVFDLSANKLLGLEPSRSKILRK  205

Query  601  YYKAFMEG  624
             +  F+ G
Sbjct  206  SFFDFVRG  213



>ref|XP_006657536.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=482

 Score =   219 bits (557),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 159/246 (65%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV   +   + ER S+    KK  D +D ++ ++  E+  + E  A+D +  ++F 
Sbjct  234   QGRRNVRNTLANLMKERLSA--PGKKHGDLVDLIVQDLQGEKPVIDENFAIDALAAILFT  291

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             +Y T SS  T+ALKFL  +P ++++L+EEHE I+  RE   S  TW EY+S+KFT  V+N
Sbjct  292   SYATLSSTLTVALKFLTDNPKIVEELKEEHETILKKREGVTSGFTWEEYKSLKFTTQVMN  351

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R++++AP +FRK + D ++ GYTIP GW+ MI P +VHL+ + +++PL F+P RW  
Sbjct  352   EITRISNVAPGVFRKTLTDVQVNGYTIPSGWLVMISPMAVHLNPKLFENPLKFDPWRWTE  411

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             ++     K +M FGG  RLC GA+F+KL +++ LH LVT+Y+W  ++ G +VR   + F 
Sbjct  412   EKRSSLLKNYMPFGGGIRLCLGADFSKLFISLFLHILVTEYRWNEIEGGEVVRISEIMFP  471

Query  1341  DGFKVQ  1358
              G+ +Q
Sbjct  472   QGYHIQ  477


 Score =   197 bits (502),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 128/193 (66%), Gaps = 0/193 (0%)
 Frame = +1

Query  52   IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            + HWVYRW NP C G LPPGSMGFP++GE++QFF +     +P + + R+ RYG LF+TS
Sbjct  26   LVHWVYRWTNPPCNGRLPPGSMGFPVVGETLQFFKASPSIDMPSYYKSRLERYGPLFKTS  85

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALN  411
            +VGQ +++S D E+N F+FQQEGKL   WY E+  +I G +    + G  H+++R+++  
Sbjct  86   LVGQPLVISLDPEVNRFVFQQEGKLFRSWYPETANRIFGKRSLTTYSGAFHRFIRSVSAR  145

Query  412  LVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME  591
            L GPENLK++LL E++ + R+    W    ++++++    M+F L A K++S +  ++ E
Sbjct  146  LFGPENLKESLLPELESSMRESFASWATQPSVEVREGISDMIFDLVAKKMISLNVAQSRE  205

Query  592  LRKYYKAFMEGDV  630
            LRK +  F +G V
Sbjct  206  LRKNFNEFFQGMV  218



>ref|XP_002510669.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52856.1| cytochrome P450, putative [Ricinus communis]
Length=479

 Score =   234 bits (596),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 108/246 (44%), Positives = 164/246 (67%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + +K  IK+I +   ERRS+ +  K   DFLD ++ ++ K ++F TE+ A+ V+  L  A
Sbjct  231   KNQKRAIKVITKLFEERRSNPEINKG--DFLDQIVEDM-KTDSFWTEEFAIYVMFGLNLA  287

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ET SS   LA+KFL  +P V+ +L EE+E I+  RE+ +S ++W EY+SM +TH V+N
Sbjct  288   SFETISSTLALAIKFLTDNPSVVDRLTEENEAILKNRENADSGLSWKEYKSMTYTHQVVN  347

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E++RLA +AP I R+ + D E+ GYTIP+GW  M+ P++V L+   Y DPL+F+PSRW  
Sbjct  348   ESLRLASVAPGILRRAITDIEVDGYTIPKGWTIMVVPAAVQLNPNTYKDPLAFDPSRWEN  407

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
                   +K F+AFGG  R CAGAEF+++ MA+  H  VTKY+W  +  G++VR P L F 
Sbjct  408   MGSVAMAKNFIAFGGGSRSCAGAEFSRVLMAVFFHVFVTKYRWVKIKGGDMVRSPALGFG  467

Query  1341  DGFKVQ  1358
             +GF ++
Sbjct  468   NGFHIK  473


 Score =   181 bits (460),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 129/199 (65%), Gaps = 5/199 (3%)
 Frame = +1

Query  10   TWLVMYL--ISFLVIAIAHW-VYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIP  180
            TW + +L  +SF+VI+  H+ +Y+W NPKC G LPPGSMGFP+IGE+I+F        +P
Sbjct  3    TWSIYWLSFLSFIVISATHYLIYKWSNPKCNGKLPPGSMGFPLIGETIEFLIPSKSLDVP  62

Query  181  PFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQIT--GPQ  354
             FI++R+ +YG LFRT++VG+ V VS+D + N+++ QQEGKLV  WY +S +++      
Sbjct  63   NFIKKRMRKYGPLFRTNLVGRPVAVSSDPDFNYYLLQQEGKLVERWYMDSFSKLLHHDVT  122

Query  355  GFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIM  534
              +  HG  HKYLRNL L   GPE LK+ LL +++   RQ L  W+   +++ K A+  M
Sbjct  123  QVISKHGSIHKYLRNLVLGHFGPEPLKEKLLPQLETGIRQRLQIWSKQPSIEAKSASSAM  182

Query  535  LFKLAASKVLSYDEKKAME  591
            +F   A  + SYD +K+ E
Sbjct  183  IFDFTAKVLFSYDPEKSKE  201



>emb|CBI40704.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   234 bits (597),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 164/252 (65%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + +K ++KLI + L E+++S   K  + DFLD ++ ++ KE+ FL++   V V+
Sbjct  329   TFHKCLKDQKEIMKLIHDALKEKKAS--PKTLQGDFLDQMIDDMKKEK-FLSDDFVVFVM  385

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++ET SS  TLA+K L +HP V++QL EEHE I+  RED  S I+W EY+SM F
Sbjct  386   FGILFASFETISSTLTLAIKLLIEHPLVMQQLIEEHEAILKNREDPNSGISWKEYKSMTF  445

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             TH VINE +RL  +AP I R+ ++D ++ GYTIP GW  M+ P+++ L+ + + DPL+FN
Sbjct  446   THQVINEVLRLGSVAPGILRRAIKDIQVNGYTIPAGWTIMVVPAALQLNPDTFVDPLTFN  505

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW    +   +K F+ FGG  RLC GAEFAK+ M    H LVT Y+   + EG I R 
Sbjct  506   PWRWKDMGVGVVAKNFIPFGGGSRLCIGAEFAKVLMTTFFHVLVTNYRLTKIKEGQIARS  565

Query  1323  PGLTFLDGFKVQ  1358
             P LTF +G  + 
Sbjct  566   PVLTFGNGLHIN  577


 Score =   181 bits (458),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 119/192 (62%), Gaps = 3/192 (2%)
 Frame = +1

Query  7    MTWLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            M W V + ++S  + +I HWVY+WRNPKC G LPPGSMGFPIIGE+IQFF       +  
Sbjct  108  MYWSVWLCVVSLFIASITHWVYKWRNPKCNGKLPPGSMGFPIIGETIQFFIPSKSLDVSS  167

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITG--PQG  357
            FI++R+ +YG LF T++ G+ V+VS+D + N++IFQQEGKLV  WY +S A++ G     
Sbjct  168  FIKKRMKKYGPLFCTNLAGRPVVVSSDPDFNYYIFQQEGKLVELWYMDSIAKLVGLDTSQ  227

Query  358  FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIML  537
             +   G  HKYLRNLAL   G E LK  LL + +   R  L  W+ L  L+ K     M+
Sbjct  228  SIAATGYVHKYLRNLALAHFGTEALKGRLLAKAEDMIRTRLHDWSKLPALEFKSCVSSMI  287

Query  538  FKLAASKVLSYD  573
            F   A+ +  YD
Sbjct  288  FDFTATILFGYD  299



>ref|XP_008448965.1| PREDICTED: cytochrome P450 87A3 isoform X3 [Cucumis melo]
Length=409

 Score =   288 bits (737),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 181/246 (74%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  ++++K  L ERR++   +K++ DF D++L E++K+ T LTE+IA+D++ +L+FA
Sbjct  162   QGRKKAMRMLKNMLQERRAN--PRKQRIDFFDFVLEELEKDGTLLTEEIALDLMFVLLFA  219

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+KFL  +PHVL++L  EHE I+  RE  +S +TW EY+SM FT   IN
Sbjct  220   SFETTSLAITAAIKFLLNNPHVLEELTAEHEGILKRREISDSGLTWGEYKSMTFTFQFIN  279

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRK ++D + KGYTIP GW  M+CP +VHL+ EKY DPL+FNP RW  
Sbjct  280   ETVRLANIVPGIFRKALKDIQFKGYTIPSGWAVMVCPPAVHLNPEKYVDPLAFNPWRWEK  339

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              EL+ ASK FMAFGG  R C G +F K+ MA+ LH LVTKY++K +  GNIVR PGL F 
Sbjct  340   SELNGASKHFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYRFKAIKGGNIVRTPGLQFP  399

Query  1341  DGFKVQ  1358
             DGF VQ
Sbjct  400   DGFHVQ  405


 Score =   126 bits (316),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 97/141 (69%), Gaps = 2/141 (1%)
 Frame = +1

Query  205  RYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSH  384
            RYG +FRTS+VG+ +IVSTD ++N+FIFQQEG+L   WY ++  +I G Q     HG  +
Sbjct  5    RYGPIFRTSLVGRPLIVSTDPDLNYFIFQQEGQLFQSWYPDTFTEIFGRQNVGSLHGFMY  64

Query  385  KYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVL  564
            KYL+N+ L+L GPE+LK+ ++ E++  A + L  W++ + +++K  T  M+F L A K++
Sbjct  65   KYLKNMVLHLFGPESLKK-MIPEVEAVATRRLKQWSSHNPVELKDKTASMIFDLTAKKLI  123

Query  565  SYDEKKAME-LRKYYKAFMEG  624
            SYD + + E LR  + AF++G
Sbjct  124  SYDSESSSENLRDNFVAFIQG  144



>ref|XP_002272031.1| PREDICTED: cytochrome P450 87A3 [Vitis vinifera]
Length=476

 Score =   233 bits (595),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 164/252 (65%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + +K ++KLI + L E+++S   K  + DFLD ++ ++ KE+ FL++   V V+
Sbjct  222   TFHKCLKDQKEIMKLIHDALKEKKAS--PKTLQGDFLDQMIDDMKKEK-FLSDDFVVFVM  278

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++ET SS  TLA+K L +HP V++QL EEHE I+  RED  S I+W EY+SM F
Sbjct  279   FGILFASFETISSTLTLAIKLLIEHPLVMQQLIEEHEAILKNREDPNSGISWKEYKSMTF  338

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             TH VINE +RL  +AP I R+ ++D ++ GYTIP GW  M+ P+++ L+ + + DPL+FN
Sbjct  339   THQVINEVLRLGSVAPGILRRAIKDIQVNGYTIPAGWTIMVVPAALQLNPDTFVDPLTFN  398

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW    +   +K F+ FGG  RLC GAEFAK+ M    H LVT Y+   + EG I R 
Sbjct  399   PWRWKDMGVGVVAKNFIPFGGGSRLCIGAEFAKVLMTTFFHVLVTNYRLTKIKEGQIARS  458

Query  1323  PGLTFLDGFKVQ  1358
             P LTF +G  + 
Sbjct  459   PVLTFGNGLHIN  470


 Score =   180 bits (457),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 119/192 (62%), Gaps = 3/192 (2%)
 Frame = +1

Query  7    MTWLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            M W V + ++S  + +I HWVY+WRNPKC G LPPGSMGFPIIGE+IQFF       +  
Sbjct  1    MYWSVWLCVVSLFIASITHWVYKWRNPKCNGKLPPGSMGFPIIGETIQFFIPSKSLDVSS  60

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITG--PQG  357
            FI++R+ +YG LF T++ G+ V+VS+D + N++IFQQEGKLV  WY +S A++ G     
Sbjct  61   FIKKRMKKYGPLFCTNLAGRPVVVSSDPDFNYYIFQQEGKLVELWYMDSIAKLVGLDTSQ  120

Query  358  FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIML  537
             +   G  HKYLRNLAL   G E LK  LL + +   R  L  W+ L  L+ K     M+
Sbjct  121  SIAATGYVHKYLRNLALAHFGTEALKGRLLAKAEDMIRTRLHDWSKLPALEFKSCVSSMI  180

Query  538  FKLAASKVLSYD  573
            F   A+ +  YD
Sbjct  181  FDFTATILFGYD  192



>ref|XP_007158462.1| hypothetical protein PHAVU_002G154400g [Phaseolus vulgaris]
 gb|ESW30456.1| hypothetical protein PHAVU_002G154400g [Phaseolus vulgaris]
Length=405

 Score =   219 bits (558),  Expect(2) = 7e-106, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + L + ++I I HWVYRWRNP C G LPPGSMG P++GE++QFF+ ++   IPPFI+QR+
Sbjct  4    LCLAALVIIGITHWVYRWRNPSCHGKLPPGSMGLPLLGETLQFFSPNTSSDIPPFIKQRM  63

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG +F+T++VG+ ++VSTD ++N+FIFQQEG++   WY ++  +I G Q     HG  
Sbjct  64   KRYGPIFKTNLVGRPIVVSTDPDLNYFIFQQEGQVFQSWYPDTFTEIFGRQNVGSLHGFM  123

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            +KYL+NL LNL GPE+LK+ +L+E++QTA + L+ W+   ++++K+AT  M+F L A K+
Sbjct  124  YKYLKNLVLNLFGPESLKK-MLSEVEQTACRTLEKWSFEDSVELKEATARMIFDLTAKKL  182

Query  562  LSYDEKKAME-LRKYYKAFMEG  624
            +SYD  K+ E LR  + AF++G
Sbjct  183  ISYDSTKSSENLRDNFVAFIQG  204


 Score =   194 bits (493),  Expect(2) = 7e-106, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 132/178 (74%), Gaps = 2/178 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +K++K+ L ERR    K+K++KDF DY++ E+ KE T LTE IA+D++ +L+FA
Sbjct  222   QGRKKAMKMLKKMLQERRG--MKRKEQKDFFDYVIEELKKEGTVLTEAIALDLMFVLLFA  279

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A T A+K L+ +P VLKQLQEEHE I+  RED  S ITW EY+SM +T   IN
Sbjct  280   SFETTSLALTYAIKVLSDNPLVLKQLQEEHEAILKRREDPNSGITWKEYKSMTYTFQFIN  339

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW  1154
             ETVRLA+I P IFRK +++   KGYTIP GW  M+CP +VHL+  KY DPL+FNP RW
Sbjct  340   ETVRLANIVPGIFRKALREINFKGYTIPAGWAVMVCPPAVHLNPAKYQDPLTFNPQRW  397



>gb|EMT26562.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=480

 Score =   244 bits (622),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 169/249 (68%), Gaps = 6/249 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKNV+K+++E LNER+    ++    DF+D L++++ ++ T + EKIA+D++ +L+FA
Sbjct  230   QGRKNVMKILQEMLNERKKETHRESV--DFIDLLINDMKEKNTIMNEKIALDLLFLLLFA  287

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +ETTSS  T ALKFL   P  L++L EEH  I   R D +S ITW EY+SMKFT  VI+
Sbjct  288   GFETTSSGITAALKFLADDPKALQELIEEHNNIRKRRIDPDSEITWEEYKSMKFTSHVIH  347

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E +RLA+IAP +FRK +++  IKGYT+P+G   M+ PSS+HL    Y DP  FNP RW  
Sbjct  348   EALRLANIAPLMFRKAIEEVHIKGYTLPKGSKIMVNPSSIHLDPTVYKDPTVFNPWRWK-  406

Query  1161  QELHPA---SKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGL  1331
                 PA   SK+FMAFGG  RLC GA+FAKL MAI LH LVTKY W  V  G +   PGL
Sbjct  407   DTTEPAGGSSKEFMAFGGGLRLCVGADFAKLQMAIFLHCLVTKYSWTAVKGGTMALSPGL  466

Query  1332  TFLDGFKVQ  1358
              F DGF +Q
Sbjct  467   QFPDGFHIQ  475


 Score =   169 bits (427),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 134/212 (63%), Gaps = 6/212 (3%)
 Frame = +1

Query  7    MTWLVMYLISFLVIA--IAHWVYRWR-NPKCKG--LLPPGSMGFPIIGESIQFFTSHSLQ  171
            M W+V+  ++  ++A  + H V RW   P+C    LLPPGS G P++GE+++FF  +   
Sbjct  1    MPWVVLVAVAVGMLAAWLIHLVMRWNMGPRCSAGALLPPGSRGLPLLGETLEFFARNPSL  60

Query  172  GIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGP  351
             + PF+++R+ RYG +FRT+++G+ +IVS D E+N+ +FQ+E KL   WY ES  +I G 
Sbjct  61   ELSPFLKRRLDRYGPIFRTNLIGEDLIVSMDPELNNLVFQKEEKLFQIWYPESIMRIMGA  120

Query  352  QGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEI  531
               +   G  HK+LR L L L GPENL+  LL E+ QTA+  L  W    ++++K+A   
Sbjct  121  DCIIATLGTFHKHLRTLVLRLFGPENLRLVLLHEVQQTAQASLLSWLDHPSIEVKEAISS  180

Query  532  MLFKLAASKVLSYDEKKA-MELRKYYKAFMEG  624
            M+F + A +++SYD  ++  +L K + AF++G
Sbjct  181  MIFSITARRLISYDSSRSDGKLWKQFDAFLQG  212



>gb|EMT05251.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=588

 Score =   229 bits (583),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 156/223 (70%), Gaps = 3/223 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKNV K++K+ L ER S+   +K+  DFLD +++E+      + EK AVD++  L+FA
Sbjct  368   QGRKNVQKVLKDLLKERLSA--PEKRHGDFLDEVVNELQSGRGVVDEKFAVDLMAALLFA  425

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ T SS+ T+A+KFL+ HP+V++ L+EEHE I+  RED  S ITW EY+SM FT  V N
Sbjct  426   SFATVSSSLTVAMKFLSGHPNVVESLKEEHEAILKKREDGRSGITWEEYKSMTFTAQVTN  485

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R++++AP IFRK + D ++KGYTIP GW+ MI P +VHL+ E + DPL+FNP RW  
Sbjct  486   EIARVSNVAPGIFRKTLTDVQVKGYTIPAGWLVMISPMAVHLNPELFKDPLTFNPWRWQD  545

Query  1161  QELHPA-SKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYK  1286
             +       K FM FGG  RLC GAEF+++ +A+ LH LVTKY+
Sbjct  546   ESKKSTLLKNFMPFGGGIRLCVGAEFSRIQIALFLHALVTKYR  588


 Score =   184 bits (467),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 122/194 (63%), Gaps = 1/194 (1%)
 Frame = +1

Query  52   IAHWVYRWRNPKCK-GLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRT  228
            +AH VY+W NP C  G LPPGS+G P++GE+ QFF       +P F ++R+ RYG +F+T
Sbjct  159  LAHCVYKWTNPACSTGRLPPGSVGLPLVGETFQFFKPSPSLDVPVFYKERLKRYGPVFKT  218

Query  229  SIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLAL  408
            S+VGQ V+VS D+E+N  IFQQEGKL   WY ++   I G +    + G  HKY+R+ A 
Sbjct  219  SLVGQPVVVSMDAEVNRIIFQQEGKLFRSWYPDTTNNIFGKESIASYDGSFHKYIRSFAS  278

Query  409  NLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAM  588
             L G E+L+  LL EMD+  +  L  W A   +++K A   M+F L A K++ +  +K+ 
Sbjct  279  RLFGLESLRDVLLAEMDRNVKHSLAAWAAEPAIEVKDAVANMVFDLTAKKLIGFGPEKSR  338

Query  589  ELRKYYKAFMEGDV  630
            +LRK + AF +G V
Sbjct  339  KLRKNFDAFFQGLV  352



>gb|EMS52130.1| Cytochrome P450 87A3 [Triticum urartu]
Length=481

 Score =   232 bits (591),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 111/253 (44%), Positives = 163/253 (64%), Gaps = 5/253 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +F+G  +GRK +  ++K+ L ER S+   + +  DFLD ++ E+      + EK AVD +
Sbjct  225   TFYGCIQGRKKLQNVLKDLLKERLST--PQMRHGDFLDEVVDELRSGTGTMNEKFAVDFV  282

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               L+F  + T SSA  + +K L+ HP+V++ L+EEHE I+  RED  + ITW+EY+SM F
Sbjct  283   AALLFGTFATISSALAVGMKLLSDHPNVVESLKEEHEAILKKREDGRTGITWDEYKSMTF  342

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T  V NE VR+++++P IFRK + D  +KGYTIP GW+ MI P ++HL+ E Y+DPL+FN
Sbjct  343   TAQVTNEIVRISNVSPGIFRKALTDVPVKGYTIPAGWLVMISPMAIHLNPELYEDPLTFN  402

Query  1143  PSRWNGQELHPA-SKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVR  1319
             P RW  +       K FM FGG  R C GAEF+K+ +AI LH LVT Y+WK +  G++ R
Sbjct  403   PWRWQDESKKSTLLKNFMPFGGGTRHCVGAEFSKIQIAIFLHTLVTNYRWKEIKGGDVQR  462

Query  1320  KPGLTFLDGFKVQ  1358
                + F  G+ +Q
Sbjct  463   ITEVVFPTGYHIQ  475


 Score =   181 bits (458),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 123/202 (61%), Gaps = 5/202 (2%)
 Frame = +1

Query  40   LVIAIAHW----VYRWRNPKCK-GLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVT  204
            L + +A W    VY+WRNP C  G LPPGSMGFP++GE+ QF        IP F +QR+ 
Sbjct  14   LAVVVAGWLLHCVYKWRNPPCNIGRLPPGSMGFPLVGETFQFLRPSPSLDIPAFYKQRLE  73

Query  205  RYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSH  384
            RYG LF+T++VG  V+VS D+E+N FIFQQEGKL   WY ++   + G +  + + G  H
Sbjct  74   RYGRLFKTNLVGHPVVVSMDAEVNRFIFQQEGKLFRSWYPDTTNDLFGKESMVYYDGSVH  133

Query  385  KYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVL  564
            KY+R+ A  L G ++L+  L  EM+ +  Q+L  W     +++K A   M+F   A K++
Sbjct  134  KYVRSFAARLFGIDSLRDVLFAEMEHSVTQNLAAWATEPFIEVKDAVATMIFDHMAKKLI  193

Query  565  SYDEKKAMELRKYYKAFMEGDV  630
             +   K+ +LRK + AF +G V
Sbjct  194  GFGPDKSRKLRKNFDAFFQGMV  215



>gb|KFK35547.1| hypothetical protein AALP_AA4G004900 [Arabis alpina]
Length=484

 Score =   247 bits (630),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 118/242 (49%), Positives = 168/242 (69%), Gaps = 3/242 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRS--SCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLI  794
             + R+  + +IKE   ERR   +  K  +  DF++ ++ EV+KE   + E+ +V++I  L+
Sbjct  228   KARRIAMNMIKEMFKERRERVTSNKVLRYGDFMEIMIDEVEKEGDTVNEERSVELILSLL  287

Query  795   FAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSM-KFTHM  971
              A+YETTS+ T + +KF+ ++P VL +L+ EHE I+  R D E  +TW EYRSM  FTHM
Sbjct  288   IASYETTSTMTAITVKFIAENPKVLMELKREHETILRNRGDTEFEVTWKEYRSMMSFTHM  347

Query  972   VINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSR  1151
             VINE++RL  ++PA+FRK V D EIKGYTIP+GW+ ++ PS +H  ++ Y++P  FNP R
Sbjct  348   VINESLRLGSLSPAMFRKAVSDVEIKGYTIPKGWIVLVVPSVLHYDSQIYENPCEFNPWR  407

Query  1152  WNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGL  1331
             W G+EL   SK FMAFGG  RLCAGAEFA+L +AI LH+LVTKY + V+ + +I R P L
Sbjct  408   WEGKELLSGSKTFMAFGGGARLCAGAEFARLQIAIFLHHLVTKYDFSVIGKPDITRAPVL  467

Query  1332  TF  1337
              F
Sbjct  468   RF  469


 Score =   166 bits (419),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 1/181 (1%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTR  207
            +I+ +V  I+ W+YRW NP     LPPGSMG P+IGE+I+FF  +    IPPF+++R+++
Sbjct  9    VIALVVGKISIWLYRWANPNLSSKLPPGSMGLPVIGETIEFFKPYDFDEIPPFVKKRMSK  68

Query  208  YGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG-DSH  384
            +GSLFRTSI+G K IVSTD E+N+ IF+QE K     Y E+  +I G        G D H
Sbjct  69   HGSLFRTSILGSKTIVSTDPEVNYEIFKQENKCFTMSYPEALVRIFGKDNLFFKQGKDFH  128

Query  385  KYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVL  564
            +Y+R +AL L+GPE LKQ  L ++D   R+HL+  ++   LD+K     ++ +    +++
Sbjct  129  RYMRQIALQLLGPECLKQRFLHKIDLATREHLESESSQGILDVKDTIGRLIMEQMIQRII  188

Query  565  S  567
            S
Sbjct  189  S  189



>gb|EMT10534.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=444

 Score =   260 bits (664),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 174/255 (68%), Gaps = 12/255 (5%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRK  +K++K  + ER +    ++K +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  187   GRKKAMKVLKGMMQERMAD--PERKCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  244

Query  804   YETTSSATTLALKFLNQHPHVLKQL---------QEEHEKIIAAREDKESSITWNEYRSM  956
             +ETT+ A TL +K L ++P V+  L         QEEHE I+  RED +++ITW EY+SM
Sbjct  245   FETTALALTLGVKLLTENPRVVDALTTLTERAREQEEHEAIVRNREDPDAAITWAEYKSM  304

Query  957   KFTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLS  1136
              FT  VI E VRLA+I P IFRK +QD EIKGYT+P GW  M+CP +VHL+ + Y+DPL+
Sbjct  305   TFTAQVIMEIVRLANIVPGIFRKALQDVEIKGYTVPAGWGIMVCPPAVHLNPDIYEDPLA  364

Query  1137  FNPSRWNGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNI  1313
             FNP RW  + E+   +K FMAFGG  R C G +  K+ MA  +H LVTKY+WK V  GNI
Sbjct  365   FNPWRWQDKPEITGGTKHFMAFGGGLRFCVGTDLTKVLMATFIHNLVTKYRWKTVKGGNI  424

Query  1314  VRKPGLTFLDGFKVQ  1358
             VR PGL F DGF +Q
Sbjct  425   VRTPGLGFPDGFDIQ  439


 Score =   152 bits (383),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 104/190 (55%), Gaps = 44/190 (23%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
            HWVYRWR+PKC G LPPGSMG PIIGE++QFF  +   G+ PF++ RV RYGS+F+TSIV
Sbjct  22   HWVYRWRHPKCAGTLPPGSMGIPIIGETLQFFAPNPTCGLSPFVRDRVKRYGSMFKTSIV  81

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G+ V+VS D ++NH++FQ EGKL   WY ++  +I G       HG  +KYL+ L     
Sbjct  82   GRPVVVSADPDVNHYVFQNEGKLFESWYPDTFTEIFGRDNVGSLHGFIYKYLKTL-----  136

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME-L  594
                                                  M+F L A K++ Y+  K+ E L
Sbjct  137  --------------------------------------MIFDLTAKKLIGYEPTKSSESL  158

Query  595  RKYYKAFMEG  624
            R+ + AF+ G
Sbjct  159  RENFTAFIRG  168



>emb|CDP18913.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   264 bits (674),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 123/252 (49%), Positives = 174/252 (69%), Gaps = 6/252 (2%)
 Frame = +3

Query  612   FHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVIC  785
             FH   +GRK  +K+I +   ++RS        KDF+D+LL +++KE+T L E+IA D++ 
Sbjct  176   FHACLQGRKKAMKVIHDIFEKKRSG---NDTSKDFVDHLLEQIEKEDTILNEEIARDLVF  232

Query  786   MLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFT  965
             + +      TS+A T+AL++L+ HP V+ +L+ EHE I+  RE + S+I+W EY+SM FT
Sbjct  233   LFVLCNSSHTSTALTVALRYLDGHPRVMAELKREHENILQMRETEGSAISWKEYKSMTFT  292

Query  966   HMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNP  1145
             HMVINET+RLA+I P I RKVV++ E+KGYTIP GW  M+CPS+VHL    Y++P  FNP
Sbjct  293   HMVINETLRLANITPGILRKVVKEVEVKGYTIPAGWTVMVCPSTVHLDPNVYENPHEFNP  352

Query  1146  SRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKP  1325
              RW G+ELH  SK FMAF G  RLC GA++AK+ M+I LHYLVTKY W+V +    +R P
Sbjct  353   WRWEGKELHMGSKNFMAFAGGTRLCVGADYAKVQMSIFLHYLVTKYTWRVTNGVERIRTP  412

Query  1326  -GLTFLDGFKVQ  1358
              G+ +  G  ++
Sbjct  413   TGICYPKGLHME  424


 Score =   147 bits (372),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = +1

Query  205  RYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSH  384
            RYG +FRTSIVGQ V+VSTD++ N  +FQQEG     WYTES  QI G Q  + HHG  H
Sbjct  23   RYGPIFRTSIVGQPVVVSTDADFNFRVFQQEGNAFQIWYTESLFQIIGKQSVLAHHGGFH  82

Query  385  KYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVL  564
            KYL++L   LV PE L++ L+ EMD + ++ L  W+ L  LD K  T  ++FK AA K+L
Sbjct  83   KYLKSLTFKLVSPEALREKLIYEMDASTQESLSSWSKLGKLDAKDGTSELVFKYAAKKML  142

Query  565  SYDEKKAME-LRKYYKAFMEG  624
             Y+E K  + LR  YKAFM+G
Sbjct  143  GYEESKDQQKLRDSYKAFMDG  163



>ref|XP_009400635.1| PREDICTED: cytochrome P450 87A3-like [Musa acuminata subsp. malaccensis]
Length=411

 Score =   288 bits (737),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 179/247 (72%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKNV+K++K  L ERR+S   +K+  DF D L+ E++KE + +TE IA+D++ +L+FA
Sbjct  162   QGRKNVMKVLKNMLKERRNS--PRKQHGDFFDSLIEELNKERSLITETIALDLMFVLLFA  219

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS A TLA+K L  HP+VL++L EEH+ II  RED  S +TW EYRSM FT  VI 
Sbjct  220   SFETTSLALTLAIKLLTDHPNVLEKLTEEHDTIIKNREDPLSGVTWMEYRSMTFTFQVIT  279

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET RLA+I P IFRK ++D +I GYTIP GW  M+CP +VHL+ E Y DPL+F+P RW  
Sbjct  280   ETARLANIVPGIFRKALKDIQINGYTIPSGWRVMVCPPAVHLNPEIYKDPLTFDPWRWKE  339

Query  1161  Q-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             + EL+  SK FMAFGG  R C G EF KL MAI LH LVTKY+W+ +  GNIVR PGL F
Sbjct  340   RPELNGGSKHFMAFGGGMRFCVGTEFTKLQMAIFLHCLVTKYRWRAIRGGNIVRTPGLGF  399

Query  1338  LDGFKVQ  1358
              DG+ +Q
Sbjct  400   PDGYHIQ  406


 Score =   122 bits (307),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = +1

Query  205  RYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSH  384
            RYG +FRTS++G  V+VSTD E+N F+FQQEG+L   WY E+  +I G       HG  +
Sbjct  4    RYGPVFRTSLIGLPVVVSTDPELNRFVFQQEGRLFESWYPETFTEIFGRSNVGSLHGFMY  63

Query  385  KYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVL  564
            KYL++L L L GPE+LK  LL +++  A  +L  W+ LS++++K+AT  M+F L A K++
Sbjct  64   KYLKSLVLKLFGPESLKDLLLRDVETAACANLSSWSRLSSIELKEATSNMIFDLTAKKLI  123

Query  565  -SYDEKKAMELRKYYKAFMEG  624
                   +  LRK + AF+ G
Sbjct  124  SYESSSSSESLRKNFVAFIRG  144



>ref|XP_003572191.2| PREDICTED: cytochrome P450 87A3-like isoform X1 [Brachypodium 
distachyon]
Length=478

 Score =   246 bits (627),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 171/248 (69%), Gaps = 4/248 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKNV+++++E L ER+ +   +++  DF+D L+ ++ +EE  + E++A+D++ +L+FA
Sbjct  228   QGRKNVMRVLRELLEERKKA--PRRESTDFIDLLIEDLKEEEHLMNERVALDLLFLLLFA  285

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +ETTSS  T AL+FL   P  L++L EEH+ I   R D +S ITW EY+SMKFT  VI+
Sbjct  286   GFETTSSGITAALRFLTDDPKALQELTEEHDNIRKRRADPDSEITWEEYKSMKFTSHVIH  345

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW--  1154
             E +RL +IAP +FRK  +D  IKGYTIP+G   M+ PSSVH     Y DP +FNP RW  
Sbjct  346   EALRLGNIAPVMFRKAKEDVHIKGYTIPKGSKVMVSPSSVHFDPTVYKDPNAFNPWRWKD  405

Query  1155  NGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLT  1334
               + +  ASK+FMAFGG  RLC GA+FAKL MAI LH LVTKY+WK +  G +V  PGL 
Sbjct  406   TAEPVGGASKEFMAFGGGLRLCVGADFAKLQMAIFLHCLVTKYRWKAIKGGTMVLAPGLQ  465

Query  1335  FLDGFKVQ  1358
             F  GF +Q
Sbjct  466   FPGGFHIQ  473


 Score =   163 bits (413),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 126/206 (61%), Gaps = 12/206 (6%)
 Frame = +1

Query  40   LVIAI--AHWVYRW---RNPKCKG-----LLPPGSMGFPIIGESIQFFTSHSLQGIPPFI  189
            LV+A+   H  +RW   R P CK      LLPPGS GFP IGES QFF   +   + PF+
Sbjct  6    LVVALLMIHMAFRWNSGRRP-CKATGARLLLPPGSRGFPFIGESFQFFAGSASLELLPFL  64

Query  190  QQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVH  369
            ++R+ RYG +FRT+++G+ +IVS D E+N+ +FQQE KL   WY ES  +I G    +  
Sbjct  65   KRRLDRYGPIFRTNLLGEDLIVSLDQELNNLVFQQEEKLFQIWYPESLMRILGADCIIAT  124

Query  370  HGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLA  549
             G  HK+LR L L L GPENL+  LL ++ +TA+  L  W    +++ K+AT  M+F + 
Sbjct  125  LGSFHKHLRTLVLRLFGPENLRLVLLQDVQRTAQASLLSWLDQPSIEAKEATSSMIFSVT  184

Query  550  ASKVLSYDEKKA-MELRKYYKAFMEG  624
            A +++SYD   +  +L K + AF+ G
Sbjct  185  AKRLISYDSSNSDGKLWKQFDAFLRG  210



>gb|KDP43441.1| hypothetical protein JCGZ_16728 [Jatropha curcas]
Length=475

 Score =   228 bits (581),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 166/246 (67%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + R+ ++K++++TL +R SS      + DFLD  + ++D E+ FLT      +I  ++ A
Sbjct  228   KDREAMLKMLRDTLKQRLSS--PDTHRGDFLDQAIDDMDTEK-FLTGDCIPQLIFGILLA  284

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +ETT++  TLA KFL +HP VL++L  EHEKI++ RE+ ES +TW+EY+SM FTH VIN
Sbjct  285   GFETTATTLTLAFKFLAEHPLVLEELTAEHEKILSKRENLESPLTWDEYKSMTFTHHVIN  344

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+RLA+  P + RK ++D ++K YTIP GW  M+  S++ L+ E Y DPL+FNP RW  
Sbjct  345   ETLRLANFLPGLLRKALKDIQVKNYTIPAGWTIMVVKSAMQLNPEIYKDPLAFNPWRWKD  404

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              + +  SK FM FGG  R CAGA+++KL M I LH LVTKY+W+ +  G+I R P L F 
Sbjct  405   LDSYTVSKNFMPFGGGSRQCAGADYSKLFMTIFLHVLVTKYRWRKIKGGDIARNPILGFG  464

Query  1341  DGFKVQ  1358
             DG  ++
Sbjct  465   DGLHIE  470


 Score =   181 bits (459),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 128/194 (66%), Gaps = 5/194 (3%)
 Frame = +1

Query  13   WLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFT-SHSLQGIPPF  186
            W++ +   S LVI   H+ Y+WRNPKCKG+LPPGSMG PIIGE++Q    S+SL    PF
Sbjct  2    WIIGLCFASLLVIYCTHFFYKWRNPKCKGVLPPGSMGLPIIGETLQLIIPSYSLDH-HPF  60

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG--F  360
            IQ+R+ RYG +FRT++VG+ VIVS D E+N +IFQQEG  V  WY ++ A+I    G   
Sbjct  61   IQKRIQRYGPIFRTNLVGRPVIVSADPEVNQYIFQQEGNSVEMWYLDAYAKIFQLDGESR  120

Query  361  MVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLF  540
            +   G  HKY+R++ LN  G ENLK+ LL ++     Q L  W+  +++D+KQA  +M+F
Sbjct  121  LSAVGRVHKYIRSITLNNFGIENLKENLLPQIQDLVNQSLQKWSNKASVDVKQAASVMVF  180

Query  541  KLAASKVLSYDEKK  582
             L A ++ SY  +K
Sbjct  181  NLTAKQMFSYGVEK  194



>ref|XP_010227227.1| PREDICTED: cytochrome P450 87A3-like [Brachypodium distachyon]
Length=462

 Score =   254 bits (649),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 178/259 (69%), Gaps = 13/259 (5%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkk--------DFLDYLLSEVDKEETFLTEKIAVD  776
             +GR + +++++E L+ER+ S   +  +         DFLDY++ E+ KE+  +TE++A+D
Sbjct  198   QGRMSAMEVLQEVLDERKRSVLDQVLQGGEESRRHGDFLDYVVQEITKEKPVMTERMALD  257

Query  777   VICMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKII----AAREDKESSITWNE  944
             ++ +L+FA++ TTS   TLA+K L  HP VL++L+ EHE I+    A  E   + +TW E
Sbjct  258   LMFVLLFASFHTTSLVLTLAVKLLADHPGVLEELKVEHETILNQREAGGESDSTGVTWKE  317

Query  945   YRSMKFTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYD  1124
             Y+SM  T  VI+ETVRLA+IAP IFRK ++D + KGYTIP GW  ++CP +VHL+ + Y 
Sbjct  318   YKSMTLTSQVISETVRLANIAPCIFRKALKDVQFKGYTIPAGWGVIVCPLAVHLNPDIYP  377

Query  1125  DPLSFNPSRWNGQ-ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVD  1301
             DPL+FNPSR+  + E++  S+ FMAFGG  R C GA+F+KL MAI +H LVTKY+W  + 
Sbjct  378   DPLTFNPSRFKDKAEINRGSRHFMAFGGGMRFCVGADFSKLQMAIFIHCLVTKYRWIQLG  437

Query  1302  EGNIVRKPGLTFLDGFKVQ  1358
              G IVR PGL F DG+ +Q
Sbjct  438   GGKIVRSPGLEFPDGYHIQ  456


 Score =   154 bits (389),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 109/187 (58%), Gaps = 25/187 (13%)
 Frame = +1

Query  64   VYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQ  243
            V+RW+NP+C G LPPGSMG P++GE+ QFF+  +   IPPFI+ R+TRYG +F+TS+VG 
Sbjct  19   VHRWKNPRCNGRLPPGSMGLPLVGETFQFFSPDASFDIPPFIRHRLTRYGPIFKTSLVGH  78

Query  244  KVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGP  423
             V+VS D E+NH +FQQEG+L   WY  S  +I G        G   +YL+N+ L  +GP
Sbjct  79   PVVVSADEELNHMVFQQEGQLFQSWYPNSFVEILGRDNVGEQQGTMFRYLKNMVLRHLGP  138

Query  424  ENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAMELRKY  603
            E+L+++ +                            M+F+L A+K+L  +  ++  LRK 
Sbjct  139  ESLRESSM-------------------------LRDMVFELTANKLLGLEPSRSKVLRKS  173

Query  604  YKAFMEG  624
            +  F+ G
Sbjct  174  FFDFVRG  180



>gb|AAL73972.1|AF466201_1 putative cytochrome P450-like protein [Sorghum bicolor]
Length=481

 Score =   263 bits (671),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 181/247 (73%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKNV+K++K+ L+ERR+  ++K    DF D ++ E+DK  + ++E IA++++ +L+FA
Sbjct  232   QGRKNVMKVLKQQLDERRNGAERKTV--DFFDLVIDELDKPNSIMSESIALNLLFLLLFA  289

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS   T+ LKFL  +P  L++L EEHEKI+  R D +S ITW EY+SMKFT  VI+
Sbjct  290   SHETTSMGLTVILKFLTDNPKSLQELTEEHEKIMERRVDPDSDITWEEYKSMKFTSHVIH  349

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW-N  1157
             E++RLA+IAP +FR+  QD  IKGYTIP G   MICPS+ HL+++ Y+DPL+FNP RW +
Sbjct  350   ESLRLANIAPVVFRQANQDVHIKGYTIPEGSKIMICPSAAHLNSKVYEDPLAFNPWRWKD  409

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
               E    SK FMAFGG  RLC GAEFAKL MA+ LHYLVT Y+WK + +G ++  PGL F
Sbjct  410   TPEPVGGSKDFMAFGGGLRLCVGAEFAKLQMAMFLHYLVTNYRWKALSKGTMMLYPGLRF  469

Query  1338  LDGFKVQ  1358
              DGF +Q
Sbjct  470   PDGFHIQ  476


 Score =   144 bits (363),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 119/212 (56%), Gaps = 6/212 (3%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKG-----LLPPGSMGFPIIGESIQFFTSHSLQ  171
            M +L    ++ L   +  W ++W N    G     LLPPGS G P +GE+++FF +    
Sbjct  3    MHYLAALSVTLLGAILLRWAFKWMNYGRTGGEEGMLLPPGSRGLPFLGETLEFFAASPTL  62

Query  172  GIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGP  351
             + PF ++R+ R+G +FRT+IVG+ +IVS D E+N  + QQE +    WY  S  +I G 
Sbjct  63   ELVPFFKRRLERFGPIFRTNIVGEDMIVSLDPELNARVLQQEERGFQIWYPSSFMRILGA  122

Query  352  QGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEI  531
               +   G  H+++RNL L L GPE L+  LL ++ ++AR  L  W     ++++ AT  
Sbjct  123  DNMVSMLGPLHRHIRNLVLRLFGPEALRLVLLRDVQRSARDELRSWLDRPEVEVRTATSR  182

Query  532  MLFKLAASKVLSYDE-KKAMELRKYYKAFMEG  624
            M+F + A K++S+D+      L K + A+ +G
Sbjct  183  MIFGVTAKKLISHDDVASGGSLWKCFDAWTKG  214



>gb|EEE61527.1| hypothetical protein OsJ_15830 [Oryza sativa Japonica Group]
Length=531

 Score =   221 bits (563),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 151/220 (69%), Gaps = 8/220 (4%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRKN +K+++  + ER +    ++  +DF D+++ E+ +E+  LTE IA+D++ +L+FA+
Sbjct  232   GRKNAMKVLRGMMKERMAE--PERPCEDFFDHVIQELRREKPLLTETIALDLMFVLLFAS  289

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINE  983
             +ETT+ A T+ +K L ++P V+  L+EEHE II  R+D  S +TW EY+SM FT  VI E
Sbjct  290   FETTALALTIGVKLLTENPKVVDALREEHEAIIRNRKDPNSGVTWAEYKSMTFTSQVIME  349

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
              VRLA+I P IFRK +QD EIKGYTIP GW  M+CP +VHL+ E Y+DPL+FNP RW G+
Sbjct  350   IVRLANIVPGIFRKALQDVEIKGYTIPAGWGIMVCPPAVHLNPEIYEDPLAFNPWRWQGK  409

Query  1164  -ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTK  1280
              E+   +K FMAFGG  R C G + +KL      HY V +
Sbjct  410   PEITGGTKHFMAFGGGLRFCVGTDLSKLQ-----HYTVVE  444


 Score =   185 bits (469),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 121/191 (63%), Gaps = 2/191 (1%)
 Frame = +1

Query  58   HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
             W YRW +P+  G LPPGS+G P+IGE++QFF  +    + PF+++R+ RYGS+F+TS+V
Sbjct  23   RWAYRWSHPRSNGRLPPGSLGLPVIGETLQFFAPNPTCDLSPFVKERIKRYGSIFKTSVV  82

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G+ V+VS D E+N+++FQQEGKL   WY ++  +I G       HG  +KYL+ L L L 
Sbjct  83   GRPVVVSADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYKYLKTLVLRLY  142

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKA--ME  591
            G ENLK  LL E D   R  L  W +  ++++K+    M+F L A K++ YD  K   + 
Sbjct  143  GQENLKSVLLAETDAACRGSLASWASQPSVELKEGISTMIFDLTAKKLIGYDPSKPSQVN  202

Query  592  LRKYYKAFMEG  624
            LRK + AF+ G
Sbjct  203  LRKNFGAFICG  213



>ref|XP_002271954.1| PREDICTED: cytochrome P450 87A3 [Vitis vinifera]
Length=476

 Score =   222 bits (565),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 108/252 (43%), Positives = 158/252 (63%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + +K  +KLI++ L E+++S K  +   DFLD ++ ++ K E FL++   V V+
Sbjct  222   TFHKCLKDQKEAMKLIRDVLKEKKASSKTLEG--DFLDQMVDDM-KNEKFLSDDFVVFVV  278

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
                + A++ET SS  TLA+K L +HP V+++L EEHE I+  RED  S I+W EY+SM F
Sbjct  279   FGFLLASFETISSTLTLAIKLLIEHPLVMQELIEEHEAILKNREDPNSGISWKEYKSMTF  338

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             TH VINE +RL  +AP I R+ ++D ++ GYTIP GW  M+ P+++ L+   + DPL+FN
Sbjct  339   THQVINEALRLGSVAPGILRRAIKDIQVNGYTIPAGWTIMVVPAALQLNPNTFVDPLAFN  398

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW    +   +K F+ FGG  RLC GAEF K+ M    H LVT Y+   +  G I R 
Sbjct  399   PWRWKDMGVGVVAKNFIPFGGGSRLCVGAEFTKVLMTTFFHVLVTNYRLTKIKGGQIARS  458

Query  1323  PGLTFLDGFKVQ  1358
             P LTF +G  + 
Sbjct  459   PALTFGNGLHIN  470


 Score =   182 bits (463),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 122/194 (63%), Gaps = 3/194 (2%)
 Frame = +1

Query  7    MTWLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            M W V + ++S  + +I HWVY+WRNPKC G LPPGSMGFP+IGE+IQFF       +  
Sbjct  1    MYWSVWLCVVSLFIASITHWVYKWRNPKCNGKLPPGSMGFPLIGETIQFFIPSKSLDVSS  60

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITG--PQG  357
            FI++R+ +YG LF T++ G+ V+VS+D + N++IFQQEGKLV  WY +S A++ G  P  
Sbjct  61   FIKKRMKKYGPLFCTNLAGRPVVVSSDPDFNYYIFQQEGKLVELWYMDSFARLVGLDPSQ  120

Query  358  FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIML  537
             +   G  HKY++NLAL  +G E LK  LL++ +   R  L  W+ L   + K     M+
Sbjct  121  SITSTGYIHKYVKNLALAHIGTEALKDGLLSKAEDMIRTRLHDWSKLPAFEFKACVSSMI  180

Query  538  FKLAASKVLSYDEK  579
            F   A+ +  YD K
Sbjct  181  FDFTATSLFGYDFK  194



>ref|XP_011046283.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=476

 Score =   243 bits (621),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 112/246 (46%), Positives = 168/246 (68%), Gaps = 2/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + + + + +++ TL ER +S   + +  DFLD +++++DKE+ FLTE   V++I  ++FA
Sbjct  227   KDKDSTLSILRNTLKERMNS-PAESRGGDFLDQIIADMDKEK-FLTEDFTVNLIFGILFA  284

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++E+ S+A TL+LK +  HP VL++L  EHE I+  RE+ +S +TW EY SM F+  VIN
Sbjct  285   SFESISAALTLSLKLIGDHPSVLEELTVEHEAILKNRENPDSPLTWAEYNSMTFSLQVIN  344

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+RL ++AP + R+ +QD ++KGYTIP GW+ M+  S++HL+   + DPL FNP RW  
Sbjct  345   ETLRLGNVAPGLLRRALQDMQVKGYTIPAGWVIMVVNSALHLNPATFKDPLEFNPWRWKD  404

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              + +  SK  M FGG +R CAG+EF KL MAI LH LVTKY+W ++ +GNI R P L F 
Sbjct  405   FDSYAVSKNLMPFGGGRRQCAGSEFTKLFMAIFLHKLVTKYRWNIIKQGNIGRNPILGFG  464

Query  1341  DGFKVQ  1358
             DG  + 
Sbjct  465   DGIHIS  470


 Score =   161 bits (408),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 118/195 (61%), Gaps = 7/195 (4%)
 Frame = +1

Query  55   AHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSI  234
             HW+ +WRNP C G+LPPGSMG PIIGE+++         + PFI++R+ RYG +FRT+I
Sbjct  17   THWINKWRNPTCNGVLPPGSMGLPIIGETLELIIPSYSLDLHPFIKKRIQRYGPIFRTNI  76

Query  235  VGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--GDSHKYLRNLAL  408
            +G+  +VS D EIN +IFQ EGKLV  WY ++ +++    G    +  G  HKY R+L L
Sbjct  77   LGRPAVVSADPEINSYIFQNEGKLVEMWYMDTFSKLFAQSGESRTNAFGIIHKYARSLTL  136

Query  409  NLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD-----  573
               G E+LK+ LL +++    + L  W++ +++D+K A  IM+    A ++  YD     
Sbjct  137  THFGSESLKERLLPQVENIVSKSLQMWSSDASVDVKPAVSIMVCDFTAKQLFGYDAENSS  196

Query  574  EKKAMELRKYYKAFM  618
            +K + +  K   AFM
Sbjct  197  DKISEKFTKVIDAFM  211



>ref|XP_010472066.1| PREDICTED: cytochrome P450 708A2-like [Camelina sativa]
Length=478

 Score =   241 bits (615),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 158/240 (66%), Gaps = 4/240 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             R  +N  KLIK+ L +R+      +K  DFLD +L E++KE  F  +  A + I  + FA
Sbjct  230   RAHRNGTKLIKDVLTKRK---IVGEKYGDFLDTMLEELEKEGCFWNQDSAANHIFFMSFA  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRS-MKFTHMVI  977
             A ETT  AT LA+KFL+++P V+ +L+ EHE I+ +REDKES ITW EYR  M FT+MVI
Sbjct  287   AQETTPKATCLAVKFLSENPKVVAELKREHEAILESREDKESGITWEEYRQKMSFTNMVI  346

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NET+RL +  P +FRK V D EIKGYTIP GW+  +    VH   + Y++P  FNP RW 
Sbjct  347   NETLRLINFVPFLFRKAVTDVEIKGYTIPAGWIVFVAAQVVHYDPKTYENPFEFNPWRWE  406

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
              Q+L   SK FM FGG  R C GAEFA+L MAI LHYLVT Y + + ++  ++RKPGL F
Sbjct  407   RQDLRSGSKMFMGFGGGVRQCVGAEFARLQMAIFLHYLVTTYDFSMAEDCAVLRKPGLLF  466


 Score =   162 bits (411),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 116/185 (63%), Gaps = 1/185 (1%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            + M +I+ +V+ I+HW++RW NPKC G LPPGSMGFPIIGES+ F   H    I PF+++
Sbjct  7    VAMLIIALVVVRISHWLFRWSNPKCNGKLPPGSMGFPIIGESMDFCKPHRFDEISPFLKK  66

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+ +YG LFRT+I G + IVSTDS++N  I +QE K     Y E   +  G    +   G
Sbjct  67   RMLKYGPLFRTNIFGSQTIVSTDSDVNFEILRQENKSFILSYPEVLVKRLGKDSLVSKDG  126

Query  376  DSHKYLRNLA-LNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            + HK+++N    +L+G E LKQ ++ +MD+  R+HL+       LD++ +   ++  L A
Sbjct  127  NIHKHMKNFTHQHLLGSEGLKQKMIRDMDRVTREHLESKADSGILDVRDSVASLVVALMA  186

Query  553  SKVLS  567
             K++S
Sbjct  187  PKMIS  191



>ref|XP_002514563.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF47669.1| cytochrome P450, putative [Ricinus communis]
Length=475

 Score =   227 bits (578),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 166/246 (67%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + +K ++KLI + L +RR S   KK+K+D LD ++ ++ K+ETF T+  A+ V+  ++ A
Sbjct  227   KNQKRILKLIADELGKRRES--PKKQKEDMLDQIVEDM-KKETFWTDDFAIYVMFGILLA  283

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ET SS   + + FL  +P ++++L EEHE+++  RE+K S ++W EY+SM +TH V+ 
Sbjct  284   SFETISSTLAVCINFLTDNPSMVQKLTEEHEELVKNRENKNSGLSWEEYKSMTYTHHVVK  343

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E++RLA +AP I R+ ++D E+ GYTIP+GW  ++ P++V L+   Y+DPL+FNPSRW  
Sbjct  344   ESLRLASVAPGILRRALKDIEVDGYTIPKGWAILVVPAAVQLNPNTYEDPLAFNPSRWEN  403

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
                   +K F+AFGG  R C GAEF+K+ MA+ LH  VTKY+   +  G ++R P L F 
Sbjct  404   MGEVATAKNFIAFGGGSRSCTGAEFSKVLMAVFLHVFVTKYRLTKIKGGEMIRCPVLAFG  463

Query  1341  DGFKVQ  1358
             DG  VQ
Sbjct  464   DGLHVQ  469


 Score =   176 bits (446),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 131/208 (63%), Gaps = 7/208 (3%)
 Frame = +1

Query  25   YLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVT  204
            Y+++ +V+ I HWVYRW+NPKC G LPPGSMGFP+IGE+I+F  +     + PF+++R+ 
Sbjct  7    YVVALVVVGITHWVYRWKNPKCNGKLPPGSMGFPLIGETIEFLRTSKSLDVSPFMKKRMK  66

Query  205  RYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG---FMVHHG  375
            +YGSLF+T++ G+ V+VS++ + ++F+ QQEGKLV  WY +S A++          VH+ 
Sbjct  67   KYGSLFKTNLAGRPVVVSSNPDFSYFLLQQEGKLVERWYLDSLAKLLRQDVTSIISVHY-  125

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYLRNL L+  G E LK  LL  ++      L  W+ L  +++K     M+F   A 
Sbjct  126  -IHKYLRNLILSHFGSERLKAELLPGLENAISGSLQDWSELPRVEVKSVISNMIFDFTAR  184

Query  556  KVLSYDEKKAME--LRKYYKAFMEGDVK  633
            ++  Y+  K+ E  L + +  F+EG +K
Sbjct  185  RLFGYEVAKSSEKDLAQSFTNFLEGLMK  212



>ref|XP_011022913.1| PREDICTED: cytochrome P450 87A3-like isoform X3 [Populus euphratica]
Length=445

 Score =   201 bits (512),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 132/195 (68%), Gaps = 1/195 (1%)
 Frame = +1

Query  43   VIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLF  222
            ++ +  W+Y+WR PKCKG LPPGSMGFP++GE+IQFF  +    I PFI +++ RYGS+F
Sbjct  19   ILCVTQWIYKWRKPKCKGKLPPGSMGFPLLGETIQFFAPYKANNISPFITKKMERYGSIF  78

Query  223  RTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNL  402
            +T +VG ++I+STD+  N FIFQQEGKL  C Y +S ++I G +  +   G  HKYLRNL
Sbjct  79   KTHLVGHRLIISTDAGFNSFIFQQEGKLFQCCYPKSFSEIAGRESIVSAGGFLHKYLRNL  138

Query  403  ALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKK  582
             +NLVG E++KQ L+ ++++   +HL  W   +++++++A   M F   A  +LSY E K
Sbjct  139  VMNLVGNESMKQKLIPKVEKMVCEHLQSWCGQASIELREAVTKMAFSFGAKILLSYSESK  198

Query  583  AME-LRKYYKAFMEG  624
            + + LRK Y  F  G
Sbjct  199  SSKNLRKAYADFQRG  213


 Score =   201 bits (510),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 144/197 (73%), Gaps = 6/197 (3%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +++IK  L E R +  +K+++KDFLD ++ E+ K  + +TE +A+D++ +L+FA
Sbjct  231   QGRKKAVEIIKSIL-EERCATPRKRQEKDFLDLVIEEIKKNGSLMTEAMALDLLFVLVFA  289

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A+ETTS   TLA+K + +HP VL++L +EHE I+  R++ ES ITW EY+SM FTH VI+
Sbjct  290   AFETTSITLTLAVKNVCEHPKVLEELIKEHEAILRNRKNIESGITWQEYKSMNFTHAVIH  349

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW--  1154
             ETVRLA+I P IFRKV++D +IKGYTIP GW+ M+CP +VH++ ++YDDP +FNP RW  
Sbjct  350   ETVRLANIVPGIFRKVLKDVDIKGYTIPAGWIVMVCPPAVHMNPKQYDDPFTFNPWRWQV  409

Query  1155  ---NGQELHPASKKFMA  1196
                 G+  H  S  +++
Sbjct  410   ESDQGRRYHQNSSCYVS  426



>gb|EEE68447.1| hypothetical protein OsJ_26826 [Oryza sativa Japonica Group]
Length=504

 Score =   207 bits (527),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 152/243 (63%), Gaps = 3/243 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV K + + L ER S+    +K  D +D ++ E+  E   +    AVDV+  L+FA
Sbjct  234   QGRRNVHKTLTDLLKERLSA--PGEKYNDLIDQIIEELQSENPVIDVNFAVDVLSALLFA  291

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ T SS  ++  KFL  +P V+K+L+EEH  I+  R    S  TW EY+S+ FT  V++
Sbjct  292   SFATLSSTLSVGFKFLTDNPKVVKELKEEHTTILNKRGSLNSGFTWEEYKSLMFTSQVVH  351

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R++++AP IFRK + D ++KGYTIP GW+ MI P +V L+   ++DPL FNP RW  
Sbjct  352   EITRISNVAPGIFRKTLADVKVKGYTIPAGWLVMISPMAVDLNPTLFEDPLEFNPWRWTD  411

Query  1161  QELHPA-SKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             +       + +M FGG  RLC GAEF+KL +A+ +H LVT+Y+WK +  G+++R   + F
Sbjct  412   KTKQSELLRNYMPFGGGIRLCLGAEFSKLFIALFIHVLVTEYRWKEIKGGDVLRISEVIF  471

Query  1338  LDG  1346
               G
Sbjct  472   PQG  474


 Score =   193 bits (491),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 129/200 (65%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   ISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRY  210
            ++F+    AHWVYRW NP+C G LPPGSMG P++GE+ +FF + +   +P + ++R+ RY
Sbjct  19   VAFVTGWFAHWVYRWMNPQCDGKLPPGSMGLPLVGETFRFFRASASIDMPSYYKERLKRY  78

Query  211  GSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKY  390
            G +F+TS+VGQ +++S D E+N F+FQQEGKL   WY E+   I G +    + G  +K+
Sbjct  79   GPIFKTSLVGQPLVISLDPEVNRFVFQQEGKLFRSWYPETTNTIFGKKSLTTYSGAVNKF  138

Query  391  LRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSY  570
            +R+ A  L GP NLK++LL E++   R+    W    ++++K     M+F L A K++ +
Sbjct  139  VRSFASKLFGPTNLKESLLPELESAVRESFATWVMNPSIEVKDGISNMIFDLVAKKLIGF  198

Query  571  DEKKAMELRKYYKAFMEGDV  630
            +  K+ ELRK ++ F +G V
Sbjct  199  NPTKSRELRKNFQEFFQGMV  218



>gb|AEM42983.1| cytochrome P450 [Siraitia grosvenorii]
Length=479

 Score =   218 bits (555),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 156/245 (64%), Gaps = 3/245 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + +K ++ ++K  + ERR +      + DFLD  L ++D E+ FLTE+  V+++  ++FA
Sbjct  232   KAQKKLVNMLKGLVKERRQA-NSTAARGDFLDQALRDIDNEQ-FLTEEFVVNLLFGILFA  289

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             +  + S + TL  K L  +P V+++L  EHE  +  RED +S ITW EY+SM FT  V+N
Sbjct  290   S-GSVSGSLTLMFKLLADNPSVVRELTAEHEAFLKQREDPQSPITWEEYKSMTFTIQVVN  348

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+RL++  P + R+ V+D  IKGYTIP GW  M+  S++HL+ + + DPL+FNP RW  
Sbjct  349   ETLRLSNALPFLLRRTVKDVNIKGYTIPAGWTLMVANSALHLNPDTHKDPLAFNPWRWKE  408

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             Q+ +  SK    FGG  R CAGA+++++ MAI LH LVTKY+W  V  G I R P L F 
Sbjct  409   QDQYSISKNLQPFGGGARQCAGADYSRVFMAIFLHTLVTKYRWTKVKGGEICRSPILKFG  468

Query  1341  DGFKV  1355
             DG  +
Sbjct  469   DGIHI  473


 Score =   181 bits (460),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 130/200 (65%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    SEMTWLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGI  177
            S++ W   + +++  VI + H +YRWRNPKC G+LPPGSMGFP+IGE+IQ         +
Sbjct  3    SQLMWTPGLAIVAVAVICVTHLIYRWRNPKCNGVLPPGSMGFPLIGETIQLIAPGYTLDL  62

Query  178  PPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG  357
            PPFI++RV RYG +FRTS++G+ ++V+ D EIN+FI+QQEG+ V  WY +S +++    G
Sbjct  63   PPFIKKRVQRYGPIFRTSLLGRPIVVTADPEINNFIYQQEGRSVELWYLDSISKVFKQDG  122

Query  358  --FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEI  531
                   G  HKYLR++ LN  G E++KQ LL ++ +   + L  W+   ++++++ T  
Sbjct  123  EARTTAGGVIHKYLRSITLNHFGSESIKQKLLPDIQRYVNKVLHQWSKQPSVEVQRGTLA  182

Query  532  MLFKLAASKVLSYDEKKAME  591
            ML+   A K+  YD +K+ E
Sbjct  183  MLYDFNAEKMFGYDAEKSSE  202



>ref|XP_010428975.1| PREDICTED: cytochrome P450 708A2-like [Camelina sativa]
 ref|XP_010428976.1| PREDICTED: cytochrome P450 708A2-like [Camelina sativa]
 ref|XP_010428977.1| PREDICTED: cytochrome P450 708A2-like [Camelina sativa]
Length=478

 Score =   238 bits (606),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 158/240 (66%), Gaps = 4/240 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             R  ++  KLIK+ L +R+      +K  DFLD +L E++KE  F  +  A + I  + FA
Sbjct  230   RAHRDGTKLIKDVLTKRK---MVGEKYGDFLDTMLEELEKEGCFWNQDSAANHIFFMSFA  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRS-MKFTHMVI  977
               ETT  AT LA+KFL+++P V+ +L+ EHE I+ +REDKES ITW EYR  M FT+MVI
Sbjct  287   FQETTPKATCLAVKFLSENPKVVAELKREHEAILESREDKESGITWEEYRQKMSFTNMVI  346

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NET+RL +  P +FRK V D EIKGYTIP GW+  +    VH   + Y++P  FNP RW 
Sbjct  347   NETLRLINFVPFLFRKAVNDVEIKGYTIPAGWIVFVAAQVVHYDPKTYENPFEFNPWRWE  406

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
              Q+L   SK FM FGG  R C GAEFA+L MAI LHYLVT Y++ + ++  ++RKPGL F
Sbjct  407   RQDLRSGSKMFMGFGGGVRQCVGAEFARLQMAIFLHYLVTTYEFSMAEDCAVLRKPGLLF  466


 Score =   161 bits (408),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 120/197 (61%), Gaps = 5/197 (3%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            + M +I+ +V+ I+HW++RW NP C G LPPGSMGFPIIGESI F   H   GI PF+++
Sbjct  7    VAMLIIALVVVRISHWLFRWSNPTCNGKLPPGSMGFPIIGESIDFCKPHRFDGISPFLKK  66

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+ +YG LFRT+I G   IVSTDS++N  I +QE K     Y E   +  G    +   G
Sbjct  67   RMLKYGPLFRTNIFGSHTIVSTDSDVNLEILRQENKSFILSYPEVLVKRLGKDSLVSKDG  126

Query  376  DSHKYLRNLA-LNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAA  552
            + HK+++ +   +L+G E LKQ ++ +MD+  R+HL+       LD++ +   ++  L A
Sbjct  127  NIHKHMKKITHQHLLGSEGLKQKMIRDMDRVTREHLESKADSGILDVRDSVASLVVALMA  186

Query  553  SKVLSY----DEKKAME  591
             K++S      +KK ME
Sbjct  187  PKMISSLKPETQKKFME  203



>ref|XP_002272143.2| PREDICTED: cytochrome P450 87A3 [Vitis vinifera]
 emb|CBI40705.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   221 bits (562),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 112/255 (44%), Positives = 159/255 (62%), Gaps = 11/255 (4%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERR---SSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAV  773
             SFH   + +K   +LI++ L ER+    SCK      D LD L+ +  KE+ FL++   V
Sbjct  221   SFHECLKNQKEAKRLIRDLLIERKVTLESCKG-----DLLDKLVDDAKKEK-FLSDDYIV  274

Query  774   DVICMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRS  953
               +  ++ A++ET S+ATTLALKFL +HP  +++L EEHE I+  +E+  S I+W EY+S
Sbjct  275   IFVFGILLASFETISTATTLALKFLTEHPLAMQELIEEHEAILKNKENPNSGISWKEYKS  334

Query  954   MKFTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPL  1133
             M FTH VINET+RLA+I P I R+ ++D ++ GYTIP GW+ ++ P+++ L    + DPL
Sbjct  335   MTFTHQVINETLRLANIVPGILRRAIKDIQVNGYTIPAGWIILLYPAALQLDPNTFADPL  394

Query  1134  SFNPSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNI  1313
             +FNP RW        +K FM FG   R CAGAEF K+ MA  LH LVT Y+   +  G I
Sbjct  395   TFNPWRWKDIGAGVRAKNFMPFGCSSRSCAGAEFTKVLMATFLHVLVTNYRLTKIKGGKI  454

Query  1314  VRKPGLTFLDGFKVQ  1358
              R P L F +GF + 
Sbjct  455   ARSPSLIFENGFHIN  469


 Score =   179 bits (453),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 117/186 (63%), Gaps = 1/186 (1%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTR  207
            +++  +  I HWVY+WRNPKC G LPPGSMG P+IGE+IQFF       +P FI++R+ +
Sbjct  9    VVTLFIAGITHWVYKWRNPKCNGKLPPGSMGLPLIGETIQFFIPSKSLDVPNFIKKRMKK  68

Query  208  YGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITG-PQGFMVHHGDSH  384
            YG LF T++VG+ V+VS+D + N++IFQQEGKLV  WY +S A++ G         G  H
Sbjct  69   YGPLFCTNLVGRPVVVSSDPDFNYYIFQQEGKLVEFWYLDSFAKLVGLDPSSNAATGYVH  128

Query  385  KYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVL  564
            KY RNL L  +G E LK  LL++ +   R  L  W+ L   +IK     M+F L   +VL
Sbjct  129  KYARNLILAYLGTEVLKDKLLSKAEDLIRTRLHDWSKLPAFEIKACLSSMVFDLTGMEVL  188

Query  565  SYDEKK  582
            S D KK
Sbjct  189  SDDFKK  194



>ref|XP_008235946.1| PREDICTED: cytochrome P450 87A3-like [Prunus mume]
Length=476

 Score =   221 bits (563),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 158/244 (65%), Gaps = 3/244 (1%)
 Frame = +3

Query  627   RKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAY  806
             +KNV  ++++ L ERR S   + ++ DFLD +  +++KE+ FL+E  +V ++   +FA +
Sbjct  230   QKNVTTMLRDMLKERRIS--PETRRGDFLDQISIDMEKEK-FLSEDFSVQLVFGGLFATF  286

Query  807   ETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINET  986
             E+ S+   LA   L +HP V+++L  EHE I+  RE+  SS+TW+EY+SM FT  VINE 
Sbjct  287   ESISAIIALAFSLLAEHPSVVEELTAEHEAILKNRENPNSSLTWDEYKSMTFTLQVINEI  346

Query  987   VRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQE  1166
             +RL ++AP + R+ ++D  +KG+TIP GW  M+  S++ LS   ++DPL FNP RW   +
Sbjct  347   LRLGNVAPGLLRRALKDIPVKGFTIPEGWTIMVVTSALQLSPNTFEDPLEFNPWRWKDLD  406

Query  1167  LHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDG  1346
              +  SK FM FGG  R CAGAE++++ +A  LH LVTKY+W  +    I R P L F DG
Sbjct  407   SYAVSKNFMPFGGGMRQCAGAEYSRVFLATFLHVLVTKYRWTTIKAARIARNPILGFGDG  466

Query  1347  FKVQ  1358
               ++
Sbjct  467   IHIK  470


 Score =   177 bits (450),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 137/214 (64%), Gaps = 15/214 (7%)
 Frame = +1

Query  10   TWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFI  189
            T + + L++ LVI   HW+ +WRNPKC G+LPPGSMG P+IGE++          + PFI
Sbjct  3    TLVGLSLVALLVIYFTHWIIKWRNPKCNGVLPPGSMGLPLIGETLNLIIPSYSLDLHPFI  62

Query  190  QQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVH  369
            ++R+ RYG +FRTS+ G+ V+V+ D E N+++FQQEG++V  WY ++ ++I       VH
Sbjct  63   KKRLQRYGPIFRTSLAGRPVVVTADPEFNNYLFQQEGRMVELWYLDTFSKI------FVH  116

Query  370  HGDS--------HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQAT  525
             G+S        HKY+R+  LN  G E LK+ LL ++++   + L  W++ +++++K A 
Sbjct  117  EGESKTNAVGMVHKYVRSTFLNHFGAERLKEKLLPQIEEFVNKSLCAWSSKASVEVKHAG  176

Query  526  EIMLFKLAASKVLSYD-EKKAMELRKYYKAFMEG  624
             +M+F  +A +++SYD EK + +L + Y   ++G
Sbjct  177  SVMVFNFSAKQMISYDAEKSSDDLSEKYTKIIDG  210



>ref|XP_004290050.1| PREDICTED: cytochrome P450 87A3-like [Fragaria vesca subsp. vesca]
Length=482

 Score =   215 bits (548),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 153/244 (63%), Gaps = 3/244 (1%)
 Frame = +3

Query  627   RKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAY  806
             +K V  + ++ L ER  S   + +  DFLD + +++DKE+ FL+E  +V ++   +FA +
Sbjct  230   QKKVTTMFRDMLKERHDS--PETQHGDFLDQIANDMDKEK-FLSEDFSVQLVFGGLFATF  286

Query  807   ETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINET  986
             E+ S+   LA   L+ +P VL++L  EHE I+  RED  S +TW+EY+SM FT  VINET
Sbjct  287   ESISAVLALAFSLLSDNPSVLQELTAEHEAIVKNREDPNSPLTWDEYKSMTFTLQVINET  346

Query  987   VRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQE  1166
             +RL ++AP + R+ ++D  +KG+TIP GW  M+  S++ LS   ++DP+ FNP RW   +
Sbjct  347   LRLGNVAPGLLRRSLKDISVKGFTIPEGWTIMVVTSALQLSPNTFEDPIKFNPWRWKDID  406

Query  1167  LHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDG  1346
                 SK FM FGG  R CAGAE++++ ++   H LVTKY+W  +    + R P L F DG
Sbjct  407   SQSVSKNFMPFGGGMRQCAGAEYSRVFLSAFFHVLVTKYRWTTIKAAPVARNPILGFGDG  466

Query  1347  FKVQ  1358
               ++
Sbjct  467   IHIK  470


 Score =   182 bits (463),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 133/210 (63%), Gaps = 15/210 (7%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + L +FLVI I HW  +WRNPKC G+LPPGSMGFPIIGE++          + PFI++R+
Sbjct  7    LCLAAFLVIYITHWTMKWRNPKCLGVLPPGSMGFPIIGETLSLIIPSYSLDLHPFIKKRL  66

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG +FRTS+ G+ V+VS D E N ++FQQEG+ V  WY ++ ++I       VH GDS
Sbjct  67   ERYGPIFRTSLAGRPVVVSADPEFNSYLFQQEGRSVELWYLDTFSKI------FVHEGDS  120

Query  382  --------HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIML  537
                    HKY+R++ LN  G E LK+ LL E+ +   ++L  W++  ++++K A  +M+
Sbjct  121  KTNAVGIVHKYVRSIFLNHFGAERLKEKLLPEIQEFVTKNLCSWSSQESVEVKHAGSVMV  180

Query  538  FKLAASKVLSYD-EKKAMELRKYYKAFMEG  624
            F  +A +++SYD EK   +L + Y   ++G
Sbjct  181  FNFSAKQMISYDAEKSTDDLSEKYTKIIDG  210



>ref|XP_004955876.1| PREDICTED: cytochrome P450 87A3-like isoform X1 [Setaria italica]
Length=477

 Score =   223 bits (569),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 154/247 (62%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN+ K++ + L++R +      K  DFLD ++ E+   +  + EK A D +  L+F 
Sbjct  220   QGRKNMQKIMSDLLSKRLTR--PDVKHGDFLDLIVEELQSGKPTIDEKFATDALVALLFT  277

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ T +    LA KFL  +P VLK L+EEHE I+  R D  S  TW EY+S+ FT MV+N
Sbjct  278   SFVTLAPILILAFKFLGNNPKVLKALKEEHEAIVRNRGDANSGFTWEEYKSLTFTTMVVN  337

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R+++  P +FRK V D ++ GYTIP GWM M+CP +VHL+ E ++DPL+FNP RW  
Sbjct  338   ELTRMSNATPGVFRKTVTDVQLNGYTIPTGWMVMVCPMAVHLNPEVFEDPLTFNPWRWQD  397

Query  1161  QELHPA-SKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             +       K FM FG   R C  A+F+KL  AI LH LVT Y+WK +++G + R   + F
Sbjct  398   ESQRSTLLKNFMPFGLGIRTCPAADFSKLFTAIFLHVLVTNYRWKEINDGEVARMGVIIF  457

Query  1338  LDGFKVQ  1358
              +G+K+Q
Sbjct  458   PNGYKIQ  464


 Score =   174 bits (442),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 118/198 (60%), Gaps = 11/198 (6%)
 Frame = +1

Query  34   SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFF-TSHSLQGIPPFIQQRVTRY  210
            + L+  + HWVY+W NP CKG  PPGSMG PI+GESIQFF  S+SL  IP F + R+ RY
Sbjct  15   TLLIAWLLHWVYKWMNPPCKGTSPPGSMGLPIVGESIQFFKISYSLD-IPDFYKLRLKRY  73

Query  211  GSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKY  390
            G +F+TS+VGQ ++VS D E+N FIFQQEGKL   WY E+   I G +     HG  HK+
Sbjct  74   GPIFKTSLVGQPLVVSADPEVNRFIFQQEGKLFRSWYPEAANIIIGEETIDGFHGPPHKF  133

Query  391  LRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSY  570
            +RN    L G E LK  LL E++   R +   W     +D+  +T           +++ 
Sbjct  134  IRNSIYKLFGLEYLKHNLLPELEAAIRDNFAEWATKYVIDVHDST---------PDLVNL  184

Query  571  DEKKAMELRKYYKAFMEG  624
            D  ++ EL K Y AF++G
Sbjct  185  DPSESRELTKNYSAFLQG  202



>gb|EMT22412.1| Cytochrome P450 87A3 [Aegilops tauschii]
Length=476

 Score =   221 bits (562),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 153/223 (69%), Gaps = 4/223 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKNV K++K+ L ER S+   +K+  DFLD ++ E+      L EK A+D++  L+FA
Sbjct  234   QGRKNVQKVLKDLLKERLSA--PQKRHGDFLDEVVDELQSGPGMLNEKFAIDLVGALLFA  291

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESS-ITWNEYRSMKFTHMVI  977
             ++ T SS+ T+A+KFL+  P V++ L+EEHE I+  R    +S ITW EY+SM FT  V 
Sbjct  292   SFATVSSSLTVAMKFLSDQPSVVEALKEEHEAILKKRAGANTSAITWEEYKSMAFTAQVT  351

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NE VRL+++AP IFRK + D ++KGYTIP GW+ MI P SV+L+ E Y+DPL+FNP RW 
Sbjct  352   NEIVRLSNVAPGIFRKTLTDVQVKGYTIPAGWLVMISPISVNLNPELYEDPLAFNPWRWQ  411

Query  1158  GQELHPA-SKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKY  1283
              +       K FM FGG  RLC GAEF+++ +A+ LH LVTKY
Sbjct  412   DESKKSTLLKNFMPFGGGLRLCVGAEFSRIQIALFLHTLVTKY  454


 Score =   176 bits (447),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 124/204 (61%), Gaps = 3/204 (1%)
 Frame = +1

Query  28   LISFLVIAIAHW-VYRWRNPKCK-GLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            L   L + +A W VYRW +P C  G LPPGSMGFP+IGE+ +FF       IP F +QR+
Sbjct  15   LCGALAVIVAGWLVYRWMSPPCNTGRLPPGSMGFPLIGETFRFFKPSPSIDIPAFYKQRL  74

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG LF+T++VGQ ++VS D+E+N FIFQQEGKL   WY ++   I G +      G  
Sbjct  75   KRYGPLFKTNLVGQPLVVSMDAEVNRFIFQQEGKLFRSWYPDTTNIIFGKESLASCDGSL  134

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTA-LSNLDIKQATEIMLFKLAASK  558
            HK++R+ A  L G ++L+  LL EM+Q   +    W A  + +++K A   M+F L A K
Sbjct  135  HKFVRSFAARLFGVDSLRDMLLAEMEQNVARSFAAWAAEPAGIEVKDAVSTMIFDLMAKK  194

Query  559  VLSYDEKKAMELRKYYKAFMEGDV  630
            ++ +  +K+ +LRK    F +G V
Sbjct  195  LIGFGPEKSRKLRKNLDVFFQGMV  218



>ref|XP_006653690.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=482

 Score =   209 bits (531),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 152/233 (65%), Gaps = 2/233 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV   +   +  R S+   +KK  D LD ++ E+  E+  + E  A+DV+ +L+F 
Sbjct  234   KGRRNVHSALTNVMKVRLSA--PEKKFGDLLDLIIDELRSEKPMIDENFAIDVLVILLFT  291

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             +  T S   T+A+KFL  +P ++++L+EEHE I+  RE   S  TW EY+S+KFT  V+N
Sbjct  292   SIATLSPTLTVAIKFLTDNPKIVEELKEEHETIMKKREGVNSGFTWEEYKSLKFTIQVMN  351

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R++++AP IFRK + D ++ GYTIP GW+ MI P++VHL+ E ++DPL F+P RW  
Sbjct  352   EIGRISNVAPGIFRKTLTDVQVNGYTIPSGWLVMISPAAVHLNPELFEDPLKFDPWRWKE  411

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVR  1319
             ++     + ++ FGG  R C  A+F+KL +A+ LH LVT+Y+WK +  G I+R
Sbjct  412   EKRSSLLRNYIPFGGGIRQCLAADFSKLFIALFLHILVTEYRWKEIGGGKIMR  464


 Score =   187 bits (474),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 126/200 (63%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   ISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRY  210
            ++ ++  +AHW Y+W NP C G LPPGSMGFPI+GE+  FF +     +P + ++R+ RY
Sbjct  19   VTLIIGWLAHWAYKWMNPSCNGRLPPGSMGFPIVGETFDFFRASPSIDMPGYYKKRMKRY  78

Query  211  GSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKY  390
             +LF+TS+VG+ V+VS D E+N FIFQQEGKL   WY ++   I G +    +    HK+
Sbjct  79   ETLFKTSLVGRPVVVSLDPEVNRFIFQQEGKLFQSWYPDTTMNIFGKKSITTYDRTVHKF  138

Query  391  LRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSY  570
            +R+L   L+GPENLK++LL E++ + R+    W    ++++K     M+F L + K++S 
Sbjct  139  IRSLTAKLLGPENLKESLLPELELSMRESFVSWIGKPSIEVKDGVSNMVFDLLSKKLISL  198

Query  571  DEKKAMELRKYYKAFMEGDV  630
            D   + ELR  ++ F  G V
Sbjct  199  DTTNSRELRNNFQEFFMGMV  218



>ref|NP_177970.1| cytochrome P450, family 708, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
 gb|AAL38249.1| similar to cytochrome P450 [Arabidopsis thaliana]
 gb|AAP31953.1| At1g78490 [Arabidopsis thaliana]
 gb|AEE36112.1| cytochrome P450, family 708, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
Length=479

 Score =   227 bits (578),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 163/236 (69%), Gaps = 4/236 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + R+  I+++K+ L  R+ +   ++K++DFL+ LL E++K+ +F  +  A+++I +L FA
Sbjct  229   KSREEAIQVMKDVLMMRKET---REKQEDFLNTLLEELEKDGSFFDQGSAINLIFLLAFA  285

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVI  977
               E TSS T LA+KF+++ P VL +L+ EH+ I+  R+DKE+ ++W EYR +M FT+MV 
Sbjct  286   LREGTSSCTALAVKFISKDPKVLAELKREHKAIVDNRKDKEAGVSWEEYRHNMTFTNMVS  345

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NE +RLA+  P +FRK VQD EIKGYTIP GW+  + PS+VH     Y++P  FNP RW 
Sbjct  346   NEVLRLANTTPLLFRKAVQDVEIKGYTIPAGWIVAVAPSAVHFDPAIYENPFEFNPWRWE  405

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKP  1325
             G+E+   SK FMAFG   RLC GAEF++L MAI LH+LV  Y + +V +  I+R P
Sbjct  406   GKEMIWGSKTFMAFGYGVRLCVGAEFSRLQMAIFLHHLVAYYDFSMVQDSEIIRSP  461


 Score =   166 bits (421),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 115/184 (63%), Gaps = 0/184 (0%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            + M +++ +V+ I+HW+YRW NPKC G LPPGSMGFPIIGE++ FF    ++GIP F+++
Sbjct  7    VAMLMVALVVVRISHWLYRWSNPKCPGKLPPGSMGFPIIGETLDFFKPCGVEGIPTFVKK  66

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+ RYG LFRT+I G K +VSTD ++ H IF+QE       Y +   ++ G     +   
Sbjct  67   RMIRYGPLFRTNIFGSKTVVSTDPDVIHQIFRQENTSFELGYPDIFVKVFGKDNLFLKEV  126

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYL+ + + ++G E LKQT+L  MD+  R H+    +  + ++++  E ++      
Sbjct  127  FIHKYLQKITMQILGSEGLKQTMLGNMDKATRDHIRSIASQGSFNVRKEVENLVVAYMTP  186

Query  556  KVLS  567
            K++S
Sbjct  187  KLIS  190



>ref|XP_010111721.1| Cytochrome P450 87A3 [Morus notabilis]
 gb|EXC31560.1| Cytochrome P450 87A3 [Morus notabilis]
Length=475

 Score =   211 bits (537),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 153/246 (62%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + +K +I ++++ L ERR+S   +  + DFLD +  ++DKE+ FL+E   V +I   +FA
Sbjct  228   KDQKKIIAMLRDMLKERRAS--PETNRGDFLDQISKDMDKEK-FLSEDFVVQLIFGGLFA  284

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +E+ S+   L    L++HP VL+++  EHE I+  RE   S + W EY+SM FT  VIN
Sbjct  285   TFESVSAVLALGFMLLSEHPSVLEEMIAEHETILKNREHPNSLLAWGEYKSMTFTLQVIN  344

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+RL ++AP + RK ++D  +KG+TIP+GW  M+  S++ LS   + +PL FNP RW  
Sbjct  345   ETLRLGNVAPGLLRKALKDIRVKGFTIPKGWAIMMVTSALQLSPSTFKNPLEFNPWRWKD  404

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              +    SK FM FG   R CAGAE+++  MA   H L+TKY+W  +  GN+ R P L F 
Sbjct  405   LDSLVISKNFMPFGRGMRQCAGAEYSRAFMATFFHVLLTKYRWTTIKVGNVSRNPILRFG  464

Query  1341  DGFKVQ  1358
             +G  ++
Sbjct  465   NGIHIK  470


 Score =   181 bits (459),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 135/206 (66%), Gaps = 3/206 (1%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            + + ++  +VI I++W+ RWRNPKC G+LPPGSMGFP+IGE++          + PFI+ 
Sbjct  5    ICLSVVGLVVIWISNWIRRWRNPKCNGVLPPGSMGFPLIGETLPLIIPTYSLDLHPFIKN  64

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGF--MVH  369
            R+ RYGS+FRTSIVG+ V++S D E N+F+FQQEG LV  +Y ++ ++I   +G      
Sbjct  65   RLQRYGSIFRTSIVGRPVVISADPEFNNFLFQQEGSLVELYYLDTFSKIFVHEGVSRTNE  124

Query  370  HGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLA  549
             G  HKY+R++ LN  G E LK+ LL E++Q   + L  W+  +++++K A  +++   +
Sbjct  125  FGVVHKYIRSIFLNHFGAERLKEKLLPEIEQMVNKTLSAWSTQASVEVKHAASVLVLDFS  184

Query  550  ASKVLSYDEKKAME-LRKYYKAFMEG  624
            A +++SYD KK+ E L + Y   ++G
Sbjct  185  AKQIISYDAKKSSESLSETYTRIIQG  210



>ref|XP_006651656.1| PREDICTED: cytochrome P450 87A3-like [Oryza brachyantha]
Length=504

 Score =   251 bits (640),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 172/255 (67%), Gaps = 5/255 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRS-SCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDV  779
             +FH   +GRKNV+K++KE  +ERR  + ++  +  DF+D LL E+ +E+  L+E  A+++
Sbjct  245   AFHKCMQGRKNVMKMLKELFDERRGKTARRPAESIDFIDVLLEELKQEKPALSESTALEL  304

Query  780   ICMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMK  959
             I +L+FA++ET +SATT  L FL  +P  L++L EEH+ I   R D+ S ITW EY+SMK
Sbjct  305   IFLLLFASFETIASATTAVLTFLTDNPEALQELTEEHDYIQKRRADRSSKITWEEYKSMK  364

Query  960   FTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSF  1139
             FT  VI+E +RLA++AP +FR   +D  IKG+ IP+G   M+C +SVHL+   Y DP  F
Sbjct  365   FTSHVIHEALRLANVAPGMFRTATEDVHIKGFAIPKGSKIMVCSASVHLNPAVYKDPNIF  424

Query  1140  NPSRW--NGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNI  1313
             NP RW    +     SK FMAFGG  RLC G++FAKL MA+ LH LVTKY+WK +  G +
Sbjct  425   NPWRWKDTAEPAGGGSKDFMAFGGGVRLCVGSDFAKLHMAVFLHCLVTKYRWKAIKGGKM  484

Query  1314  VRKPGLTFLDGFKVQ  1358
                PGL F +GF++Q
Sbjct  485   TLSPGLRFPEGFRIQ  499


 Score =   140 bits (354),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 106/173 (61%), Gaps = 1/173 (1%)
 Frame = +1

Query  100  LPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINH  279
            LPPGS G P +GE++QFF       +  F ++R+ RYG +FRT+IVG+ +IVS D E+N+
Sbjct  58   LPPGSRGLPFLGETLQFFAQSPSLELHGFFKRRMDRYGPVFRTNIVGEDLIVSLDPEVNN  117

Query  280  FIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMD  459
            F+FQQEG+L   WY  S  +I G        G  H+ +R+L L  +GPE L+Q++L E+ 
Sbjct  118  FVFQQEGRLFQLWYPYSVMRIFGIPTIATTLGPLHRLMRSLVLRFLGPEALRQSVLHEVQ  177

Query  460  QTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAMELR-KYYKAF  615
            +TA   L  W    +++ K+A   M+F + A K++SYD + +  +  K+Y  F
Sbjct  178  KTAEAALLSWLDQPSIECKEALSSMIFSVTAKKIISYDSETSDGMMWKHYDTF  230



>ref|XP_008235945.1| PREDICTED: cytochrome P450 87A3-like [Prunus mume]
Length=478

 Score =   211 bits (537),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 156/245 (64%), Gaps = 3/245 (1%)
 Frame = +3

Query  627   RKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAY  806
             +KNV  ++++ L ERR S  +  ++ DFL  +  +++KE+  L+E  +V ++    FA +
Sbjct  230   QKNVTTMLRDMLKERRIS-PETTQRGDFLHQINIDMEKEKV-LSEDFSVQLVFGGFFATF  287

Query  807   ETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINET  986
             E+ S+   LA   L +HP V+++L  EHE I+  RE+  SS+TW+EY+SM FT  VINE 
Sbjct  288   ESISAVLALAFSLLAEHPSVVEELTAEHEAILKNRENPNSSLTWDEYKSMTFTLQVINEI  347

Query  987   VRLADIAPAIFRKVVQDFEIKG-YTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQ  1163
             +RL ++AP + R+ ++D  +KG +TIP GW  M+  S++ LS   ++DPL FNP RW   
Sbjct  348   LRLGNVAPGLLRRALKDIPVKGRFTIPEGWTIMVVTSALQLSPNTFEDPLEFNPWRWKDL  407

Query  1164  ELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLD  1343
             + +  SK FM FGG  R CAGAE++++ +A  LH LVTKY+W  +   +I R P L F D
Sbjct  408   DSYAVSKNFMPFGGGMRQCAGAEYSRVFLATFLHVLVTKYRWTTIKAAHIARNPILGFGD  467

Query  1344  GFKVQ  1358
             G  ++
Sbjct  468   GIHIK  472


 Score =   180 bits (456),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 139/214 (65%), Gaps = 15/214 (7%)
 Frame = +1

Query  10   TWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFI  189
            T + + L++ L+I   HW+ +WRNPKC G+LPPGSMG P+IGE++          + PFI
Sbjct  3    TLVGLSLVALLIIYFTHWIIKWRNPKCNGVLPPGSMGLPLIGETLNLIIPSYSLDLHPFI  62

Query  190  QQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVH  369
            ++R+ RYG +FRTS+ G++V+++ D E N++IFQQEG++V  WY ++ ++I       VH
Sbjct  63   KKRLQRYGPIFRTSLAGRQVVITADPEFNNYIFQQEGRMVELWYLDTFSKI------FVH  116

Query  370  HGDS--------HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQAT  525
             G+S        HKY+R++ LN  G E LK+ LL ++++   + L  W++ +++++K A 
Sbjct  117  EGESKTNAVGMVHKYVRSIFLNHFGAERLKEKLLPQIEEFVNKSLCAWSSKASVEVKHAA  176

Query  526  EIMLFKLAASKVLSYD-EKKAMELRKYYKAFMEG  624
             +M+F  +A +++SYD EK + +L + Y   ++G
Sbjct  177  SVMVFNFSAKQMISYDAEKSSDDLSEKYTKIIDG  210



>ref|XP_008644631.1| PREDICTED: cytochrome P450 87A3-like [Zea mays]
 gb|AFW68082.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=482

 Score =   252 bits (643),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 178/247 (72%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKNV+K++K+ L+ERR++ +++    DF D ++ E++K +  + E IA+D++ +L+FA
Sbjct  233   QGRKNVMKILKQQLDERRNTAERRTV--DFFDLVIDELNKPDPIMNENIALDLLFLLLFA  290

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS   T  LKFL  +P  L++L EEHEKI+  R D +S ITW EY+SM+FT  VI+
Sbjct  291   SHETTSMGLTAILKFLTDNPKALQELTEEHEKIVETRVDPDSDITWEEYKSMRFTSHVIH  350

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW-N  1157
             E++RLA+IAP +FR+  QD  IKGYTIP G   MICPS+ HL+++ Y+DP +FNP RW +
Sbjct  351   ESLRLANIAPVVFRQANQDVYIKGYTIPEGSKIMICPSAAHLNSKVYEDPTAFNPWRWKD  410

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
               E    SK FMAFGG  RLC GA+FAKL MA+ +H LVTKY WK + +G +V  PGL F
Sbjct  411   TPEPVGGSKDFMAFGGGLRLCVGADFAKLQMAMFIHCLVTKYSWKPISKGTMVFYPGLRF  470

Query  1338  LDGFKVQ  1358
              +GF +Q
Sbjct  471   PEGFHIQ  477


 Score =   138 bits (348),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 115/190 (61%), Gaps = 2/190 (1%)
 Frame = +1

Query  61   WVYRWRNPKCKG-LLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIV  237
            W+   R  K +G +LPPGS G P++GE+++FF +     + PF ++R+ R+G +FRT+IV
Sbjct  26   WMNGARTGKDEGRMLPPGSRGLPLLGETLEFFAASPTLELVPFFKRRLERFGPIFRTNIV  85

Query  238  GQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLV  417
            G+ +IVS D E+N  + QQE +    WY  S  ++ G    +   G  H+++RNL L L 
Sbjct  86   GEDLIVSLDPELNARVLQQEERGFQIWYPSSFMRVFGDDNIISALGPLHRHIRNLVLRLF  145

Query  418  GPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKA-MEL  594
            GPE L+  LL ++ ++AR  L  W    +++++ AT  M+F + A K++S+D+  +   L
Sbjct  146  GPEALRLVLLRDVQRSARDELRSWLDHPDVEVRTATSRMIFAVTAKKLISHDDAASGGSL  205

Query  595  RKYYKAFMEG  624
             K + A+ +G
Sbjct  206  WKCFDAWTKG  215



>gb|KDP43049.1| hypothetical protein JCGZ_25235 [Jatropha curcas]
Length=466

 Score =   214 bits (545),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 110/252 (44%), Positives = 163/252 (65%), Gaps = 6/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + +K ++K I++T+ ERR+      +++DFL  L+ E+ K E  L + +   VI
Sbjct  208   AFHKCMQNQKKILKTIRKTIEERRAC--PGTRREDFLGRLIEEM-KAENLLNDDLVSFVI  264

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               L+ A  ET  S  TLA+K L +HP V+++L +E+E+II  RE+KE+ +TW EY+SM F
Sbjct  265   FALLLATSETVPSTLTLAIKLLTEHPLVMQELVKENEEIICNRENKETGLTWKEYKSMTF  324

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T  VINE +R++  +  I R+ ++D +I GYTIP+GW  MI PSS+HL+ + Y DPL+FN
Sbjct  325   TMHVINEALRMSG-SVGILRRTIEDIDINGYTIPKGWTIMIVPSSLHLNPDIYKDPLAFN  383

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW     +  +K F+ FGG  R C GAEF+K+ +A+ LH  VTKY+   V EG IVR 
Sbjct  384   PWRWKDLGPNVRAKNFIPFGGGMRSCGGAEFSKVLVAVFLHAFVTKYRLTNVKEGEIVRT  443

Query  1323  PGLTFLDGFKVQ  1358
             P L F +G  ++
Sbjct  444   PMLGFGNGHYIK  455


 Score =   176 bits (446),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 122/194 (63%), Gaps = 3/194 (2%)
 Frame = +1

Query  52   IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            I +WVY+WRNP C G LPPGSMGFP+IGE+IQFF       +PPF++ R+ +YG +F+TS
Sbjct  3    IGNWVYKWRNPPCNGTLPPGSMGFPLIGETIQFFIPSKSLDMPPFVKNRIKKYGPMFKTS  62

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--GDSHKYLRNLA  405
            + G+ V+VS+D++ N+FI QQEGKLV  WY +S A++ G  G +     G  HK+L+ + 
Sbjct  63   LAGRPVVVSSDADFNYFILQQEGKLVELWYLDSFAELLGQNGSLKEGFIGYIHKHLKKVI  122

Query  406  LNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD-EKK  582
                GPE LK  LL ++++     L  WT   ++++K     M+    +  + SYD EK+
Sbjct  123  SEHFGPERLKGKLLPQLEEMVNHSLQAWTMQESVEVKHECSKMILDFTSKLLFSYDSEKQ  182

Query  583  AMELRKYYKAFMEG  624
               L + + +F++G
Sbjct  183  GKSLSETFASFIQG  196



>ref|XP_007016226.1| Cytochrome P450, putative isoform 1 [Theobroma cacao]
 gb|EOY33845.1| Cytochrome P450, putative isoform 1 [Theobroma cacao]
Length=476

 Score =   224 bits (571),  Expect(2) = 7e-99, Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 154/244 (63%), Gaps = 1/244 (0%)
 Frame = +3

Query  627   RKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAY  806
             ++ V+ LI + L ERR S  +     DFL  L+  + KE  FLT +   +VI  L+ A  
Sbjct  228   QQKVLTLISQLLEERRKSYSQGCNNGDFLGQLVEGMGKE-AFLTPEFVSNVIFGLLAATI  286

Query  807   ETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINET  986
             +T SSA TLA+K +   P  L+QL EEHE+I+  RE     ++W EY+SM FTH VI E 
Sbjct  287   DTISSAVTLAIKCVLDDPSALQQLTEEHEEILKKREGTNLGLSWEEYKSMTFTHYVIKEA  346

Query  987   VRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQE  1166
             +RLA +AP IFR+V+ D  I GYTIP+GW+ +I P+++ L+   Y+DPL+FNPSRW    
Sbjct  347   LRLASVAPGIFRRVITDIHIDGYTIPKGWILLIIPAALQLNPNIYEDPLTFNPSRWKNMG  406

Query  1167  LHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDG  1346
                 +K F+ FGG  R CAGAE +K+ MA++LH  VTKY+   +  G++ R P L F +G
Sbjct  407   GISIAKNFVPFGGGNRTCAGAELSKVLMAVLLHVWVTKYRLTRIRGGDVARTPVLEFTNG  466

Query  1347  FKVQ  1358
             F V+
Sbjct  467   FFVK  470


 Score =   166 bits (420),  Expect(2) = 7e-99, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 130/207 (63%), Gaps = 2/207 (1%)
 Frame = +1

Query  4    EMTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            EM  L ++LISFL++++  W+Y WRNP C G LPPGSMG P+IGE+  F  +     I P
Sbjct  2    EMWSLWLFLISFLIVSVTTWIYWWRNPSCNGRLPPGSMGLPLIGETFNFLVTSKSIDIHP  61

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFM  363
            FI++R+ RYG LF+TS+ G+ V+VS+D + N+F+ QQE KLV  +Y ++ A++   +  +
Sbjct  62   FIKERMERYGPLFKTSLAGRSVVVSSDPDFNYFVLQQEDKLVELYYMDTFAKLVHKEN-V  120

Query  364  VHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFK  543
               G  HKYL+ + L+ +GPE LK+ LL++ ++     L  WT  S +++K  +  M   
Sbjct  121  NEGGYLHKYLKRVLLSCIGPECLKEKLLSQSEEIINHELHEWTKQSEVEVKAQSAAMTHG  180

Query  544  LAASKVLSYDEKKAME-LRKYYKAFME  621
              +  ++  + + + E L +Y+ +F++
Sbjct  181  FISKILMGCELENSEENLSEYFCSFLQ  207



>ref|XP_004974765.1| PREDICTED: cytochrome P450 87A3-like [Setaria italica]
Length=437

 Score =   227 bits (578),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 160/247 (65%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV +++ + L ER S+  KK    D +D L+ E+  E+  + E  A+D +  ++F 
Sbjct  188   KGRRNVHRILSDILKERLSTPGKKHG--DIVDLLVEELRSEKPLIDENFAIDALAAILFG  245

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ T S+A T+  KFL  +P V++ L+EEHE I+  REDK S  TW EY+S+ FT  V+N
Sbjct  246   SFVTASAALTIGFKFLTDNPKVVETLKEEHEIILKKREDKNSGFTWEEYKSLTFTTQVMN  305

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R+ +IAP IFRK ++D ++ GYTIP GW+ MI P +VHL+ + ++DPL FNP RW+ 
Sbjct  306   EITRMGNIAPGIFRKTLKDVQVNGYTIPAGWLVMISPMTVHLNPKFFEDPLKFNPWRWSD  365

Query  1161  QELHPASKK-FMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             +    A K+ FM FGG  RLC GA+F+KL +++ LH LVTKY+W  +  G + R   +  
Sbjct  366   EAKQIAQKRNFMPFGGGIRLCLGADFSKLLISLFLHVLVTKYRWIEIKGGEVFRAAEMVI  425

Query  1338  LDGFKVQ  1358
               G+ +Q
Sbjct  426   PQGYHIQ  432


 Score =   162 bits (411),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 108/170 (64%), Gaps = 0/170 (0%)
 Frame = +1

Query  115  MGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQ  294
            MGFPI+GE+ Q F      GIP + QQR+ RYG+LF+TS+ GQ+V+VS D E+NHFIFQ+
Sbjct  1    MGFPIVGETFQLFKPSPSIGIPSYYQQRLKRYGTLFKTSLAGQRVVVSLDPEVNHFIFQE  60

Query  295  EGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQ  474
            EGKL   WYTE+   I G +     + + HK++R+ A  L G ENL++ L+ E++   RQ
Sbjct  61   EGKLFRSWYTEATNNIFGKKSVTKFNANVHKFVRSFASKLFGVENLREVLIRELEDAIRQ  120

Query  475  HLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAMELRKYYKAFMEG  624
                W A  ++++K     M+F L A K++S +  ++ ELRK ++ F  G
Sbjct  121  SFAAWAAKPSIEVKDGVADMIFDLVAKKMISMEPGESRELRKNFEDFFRG  170



>ref|XP_007016260.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY33879.1| Cytochrome P450, putative [Theobroma cacao]
Length=476

 Score =   228 bits (580),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 160/246 (65%), Gaps = 1/246 (0%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + ++  +K++ + L ERR S  +   K DFL  ++ +++KE  FLT++  V+V+  L+ A
Sbjct  226   KTQRKAVKVMSQLLEERRKSYSQGCNKGDFLGQIVEDMEKE-AFLTKEFVVNVMFGLLLA  284

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             + ET SS   LA+K L  +P  L+QL EEHE+I+  RE     ++W EY+SM FTH VIN
Sbjct  285   SVETVSSTAALAIKCLLDNPSALQQLTEEHEEILKKRESTNLGLSWEEYKSMTFTHYVIN  344

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E +R+  +AP I R+V+ D  I GYTIP+GW  +I P+++ L+   Y+DPL+FNPSRW  
Sbjct  345   EALRIGSVAPGILRRVIADIHINGYTIPKGWNLLIVPATLQLNPNTYEDPLTFNPSRWKN  404

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
                   +K F+ FGG  R CAGAEF+K+ MA++LH  VTKY++  +  G++ R P L F 
Sbjct  405   MGSISTAKNFIPFGGGNRSCAGAEFSKVLMAVLLHVWVTKYRFTKIRGGDVGRTPILEFT  464

Query  1341  DGFKVQ  1358
             +GF ++
Sbjct  465   NGFFIK  470


 Score =   161 bits (407),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 123/201 (61%), Gaps = 2/201 (1%)
 Frame = +1

Query  25   YLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVT  204
            ++I FLV+++A W+  WRNP C G LPPGSMG P+IGE++ F  +     I PFI++R+ 
Sbjct  9    FVIPFLVVSVATWISWWRNPSCNGRLPPGSMGLPLIGETLNFLVTSKSIDIHPFIKERMK  68

Query  205  RYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSH  384
            RYG LF+TS+ G+ V+VS+D + N F+ QQE KLV  +Y +S A +   +  +   G  H
Sbjct  69   RYGPLFKTSLAGRPVVVSSDPDFNFFVLQQEEKLVELYYMDSFANLVHKEN-INEGGYVH  127

Query  385  KYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVL  564
            KYLR+  L+  G E LK+ LL + +         WT  + + +K  +  M+F   +  ++
Sbjct  128  KYLRHAILSHFGFEALKEKLLCQAENVINHGFHEWTKQTEVAVKGQSAAMIFGFTSKILM  187

Query  565  SYDEKKAME-LRKYYKAFMEG  624
            SY+ +K+ E L +Y  +F++G
Sbjct  188  SYESEKSEENLSEYLCSFLQG  208



>ref|XP_006369644.1| hypothetical protein POPTR_0001s27730g [Populus trichocarpa]
 gb|ERP66213.1| hypothetical protein POPTR_0001s27730g [Populus trichocarpa]
Length=474

 Score =   221 bits (564),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 105/252 (42%), Positives = 166/252 (66%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             SFH   + R+ ++K++K+TL ER +   K++   DFLD  + ++ K E FLTE     ++
Sbjct  221   SFHKCMQDREKMLKMLKDTLMERLNDPSKRRG--DFLDQAIDDM-KTEKFLTEDFIPQLM  277

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++E+ S+  TL  KFL ++P V+++L+ EHE I+  RE+  S +TW EYRSM F
Sbjct  278   FGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIVKKRENPNSRLTWEEYRSMTF  337

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T MV+NET+R+++I P +FRK ++DF++KGYT+P GW  M+   +  L+ + + DP++FN
Sbjct  338   TQMVVNETLRISNIPPGLFRKALKDFQVKGYTVPAGWTVMLVTPATQLNPDTFKDPVTFN  397

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAE++KL ++  LH LVT Y +  +  G++ R 
Sbjct  398   PWRWQELDQVTISKNFMPFGGGTRQCAGAEYSKLVLSTFLHILVTNYSFTKIRGGDVSRT  457

Query  1323  PGLTFLDGFKVQ  1358
             P ++F DG  ++
Sbjct  458   PIISFGDGIHIK  469


 Score =   167 bits (423),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 126/192 (66%), Gaps = 2/192 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +++ +VI   H +++WR+PK +G+LPPGSMG+P+IGE++QF +      + PF+++R+
Sbjct  6    LVVVALVVIYYTHMIFKWRSPKIEGVLPPGSMGWPLIGETLQFISPGKSLDLHPFVKKRM  65

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--G  375
             +YG +F+TS+VG+ +IVSTD E+N +I Q EG LV  WY +S A+    +G    +  G
Sbjct  66   EKYGPIFKTSLVGRPIIVSTDYEMNKYILQHEGTLVELWYLDSFAKFFALEGETRVNAIG  125

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYLR++ LN  G E+LK++LL +++     +L  W +   +D+KQ   +M+F   A+
Sbjct  126  TVHKYLRSITLNHFGVESLKESLLPKIEDMLHTNLAKWASQGPVDVKQVISVMVFNFTAN  185

Query  556  KVLSYDEKKAME  591
            K+  YD + + E
Sbjct  186  KIFGYDAENSKE  197



>ref|XP_002299955.2| hypothetical protein POPTR_0001s27750g [Populus trichocarpa]
 gb|EEE84760.2| hypothetical protein POPTR_0001s27750g [Populus trichocarpa]
Length=474

 Score =   222 bits (566),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 166/252 (66%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             SFH   + R+ ++KL+K+TL ER +   K++   DFLD  + ++ K E FLTE     ++
Sbjct  221   SFHKCMQDREKMLKLLKDTLMERLNDPSKRRG--DFLDQAIDDM-KTEKFLTEDFIPQLM  277

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++E+ S+  TL  KFL ++P V+++L+ EHE I+  RE+  S +TW EYRSM F
Sbjct  278   FGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIVKKRENPNSRLTWEEYRSMTF  337

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T MV+NET+R+++I P +FRK ++DF++KGYT+P GW  M+   +  L+ + + DP++FN
Sbjct  338   TQMVVNETLRISNIPPGLFRKALKDFQVKGYTVPAGWTVMLVTPATQLNPDTFKDPVTFN  397

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAE++KL ++  LH LVT Y +  +  G++ R 
Sbjct  398   PWRWQELDQVTISKNFMPFGGGTRQCAGAEYSKLVLSTFLHILVTNYSFTKIRGGDVSRT  457

Query  1323  PGLTFLDGFKVQ  1358
             P ++F DG  ++
Sbjct  458   PIISFGDGIHIK  469


 Score =   166 bits (421),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 125/192 (65%), Gaps = 2/192 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +++ +VI   H +++WR+PK +G+LPPGSMG+P+IGE++QF        + PF+++R+
Sbjct  6    LVVVALVVIYYTHMIFKWRSPKIEGVLPPGSMGWPLIGETLQFIIPGKSLDLHPFVKKRM  65

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--G  375
             +YG +F+TS+VG+ +IVSTD E+N +I Q EG LV  WY +S A+    +G    +  G
Sbjct  66   QKYGPIFKTSLVGRPIIVSTDYEMNKYILQHEGTLVELWYLDSFAKFFALEGETRVNAIG  125

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYLR++ LN  G E+LK++LL +++     +L  W +   +D+KQ   +M+F   A+
Sbjct  126  TVHKYLRSITLNHFGVESLKESLLPKIEDMLHTNLAKWASQGPVDVKQVISVMVFNFTAN  185

Query  556  KVLSYDEKKAME  591
            K+  YD + + E
Sbjct  186  KIFGYDAENSKE  197



>ref|XP_006369643.1| hypothetical protein POPTR_0001s27720g [Populus trichocarpa]
 gb|ERP66212.1| hypothetical protein POPTR_0001s27720g [Populus trichocarpa]
Length=474

 Score =   221 bits (564),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 105/252 (42%), Positives = 166/252 (66%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             SFH   + R+ ++K++K+TL ER +   K++   DFLD  + ++ K E FLTE     ++
Sbjct  221   SFHKCMQDREKMLKMLKDTLMERLNDPSKRRG--DFLDQAIDDM-KTEKFLTEDFIPQLM  277

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++E+ S+  TL  KFL ++P V+++L+ EHE I+  RE+  S +TW EYRSM F
Sbjct  278   FGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIVKKRENPNSRLTWEEYRSMTF  337

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T MV+NET+R+++I P +FRK ++DF++KGYT+P GW  M+   +  L+ + + DP++FN
Sbjct  338   TQMVVNETLRISNIPPGLFRKALKDFQVKGYTVPAGWTVMLVTPATQLNPDTFKDPVTFN  397

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAE++KL ++  LH LVT Y +  +  G++ R 
Sbjct  398   PWRWQELDQVTISKNFMPFGGGTRQCAGAEYSKLVLSTFLHILVTNYSFTKIRGGDVSRT  457

Query  1323  PGLTFLDGFKVQ  1358
             P ++F DG  ++
Sbjct  458   PIISFGDGIHIK  469


 Score =   167 bits (423),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 126/192 (66%), Gaps = 2/192 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +++ +VI   H +++WR+PK +G+LPPGSMG+P+IGE++QF +      + PF+++R+
Sbjct  6    LVVVALVVIYYTHMIFKWRSPKIEGVLPPGSMGWPLIGETLQFISPGKSLDLHPFVKKRM  65

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--G  375
             +YG +F+TS+VG+ +IVSTD E+N +I Q EG LV  WY +S A+    +G    +  G
Sbjct  66   QKYGPIFKTSLVGRPIIVSTDYEMNKYILQHEGTLVELWYLDSFAKFFALEGETRVNAIG  125

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYLR++ LN  G E+LK++LL +++     +L  W +   +D+KQ   +M+F   A+
Sbjct  126  TVHKYLRSITLNHFGVESLKESLLPKIEDMLHTNLAKWASQGPVDVKQVISVMVFNFTAN  185

Query  556  KVLSYDEKKAME  591
            K+  YD + + E
Sbjct  186  KIFGYDAENSKE  197



>ref|XP_002526164.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF36240.1| cytochrome P450, putative [Ricinus communis]
Length=487

 Score =   206 bits (524),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 159/248 (64%), Gaps = 7/248 (3%)
 Frame = +3

Query  627   RKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAY  806
             RK + K+I++T+ ER  +C + +++ DFLD+L+ ++ K E  LTE +    I  L+ A +
Sbjct  237   RKKIFKMIRDTIQER-CTCPEARRE-DFLDHLIDDM-KTENLLTENLITFAIFALLLATF  293

Query  807   ETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESS-ITWNEYRSMKFTHMVINE  983
             ET  S   LA+K L +HP V+++L +EH++II +R ++ S+ I W E ++M FT  VINE
Sbjct  294   ETIPSTLALAIKLLAEHPTVVQELLKEHKEIIESRGNEASAGIIWKENKAMTFTMRVINE  353

Query  984   TVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG-  1160
             ++R++  A  I RK +QD    GY IP+GW  ++ PS++HL+ + Y DPL FNP RW   
Sbjct  354   SLRISSAAVGILRKSIQDIHANGYVIPKGWTIIVLPSAIHLNPQTYQDPLHFNPWRWKVI  413

Query  1161  QELHP--ASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLT  1334
               + P  ++K F+ FGG  R C GAEF+K+ MA   H LVTKY+W  V  G IVR P L 
Sbjct  414   TRIGPNVSAKNFIPFGGGLRSCGGAEFSKVLMAAFFHVLVTKYRWIKVKGGEIVRGPSLG  473

Query  1335  FLDGFKVQ  1358
             F +G+ ++
Sbjct  474   FGNGYYIK  481


 Score =   181 bits (460),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 131/211 (62%), Gaps = 7/211 (3%)
 Frame = +1

Query  13   WLVMYLISFLVIAIAHWVYRWRNPKCK-GLLPPGSMGFPIIGESIQFFTSHSLQGIPPFI  189
            W++ + ++ ++IA+ HW+Y+WRNPKC  G LPPGSMG P+IGE+IQFF       IP F 
Sbjct  7    WVLFHAVALIIIAMTHWIYKWRNPKCSSGKLPPGSMGLPLIGETIQFFIPSKSVDIPSFA  66

Query  190  QQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVH  369
            + R+ R+G +F+TS+ G+ V+VS+D++ +HFI QQEGKLV  WY +S A++ G  G +  
Sbjct  67   KNRIKRFGPVFKTSLAGRPVVVSSDADFSHFILQQEGKLVELWYMDSFAKLLGQYGSLQE  126

Query  370  H-----GDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIM  534
                  G  HK ++ L  +  GPENLK+ LL E+++ A Q L  W+   ++++K     M
Sbjct  127  GSTNVIGAFHKNIKKLISDYFGPENLKEKLLPELEEMANQTLSTWSCQDSVEVKLECSKM  186

Query  535  LFKLAASKVLSYDE-KKAMELRKYYKAFMEG  624
            +    A  +  YD  K  +++ + +  F +G
Sbjct  187  ILNFTARHLFGYDPIKYGIDISEMFTVFTQG  217



>ref|XP_011101634.1| PREDICTED: cytochrome P450 87A3-like [Sesamum indicum]
Length=483

 Score =   215 bits (548),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 156/240 (65%), Gaps = 7/240 (3%)
 Frame = +3

Query  642   KLIKETLNE--RRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYETT  815
             K ++E + E  R+   + +++  D LD+++ E    E+FL E   V ++  L+F   ++ 
Sbjct  238   KKVREMMREVVRKRVAESERRHGDLLDHII-EDKNTESFLNEDFIVQLMFGLLFVTSDSI  296

Query  816   SSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETVRL  995
             S+   LA KFL +HP VL++L  EHE I+  R D +S++TWNEY+SM FT  VINE +RL
Sbjct  297   STTLALAFKFLAEHPLVLEELTAEHETILKNRADSDSTLTWNEYKSMTFTLQVINEVLRL  356

Query  996   ADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQELHP  1175
              +IAP  FR+ ++D  I GYTIP GW+ MI  + +HL+  +++DPL FNP RW  +E+ P
Sbjct  357   GNIAPGFFRRALKDIPINGYTIPAGWVIMIATAGLHLNDNQFEDPLKFNPWRW--KEIQP  414

Query  1176  AS--KKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGF  1349
             ++  K FM FG   + CAGAE++++ +A  LH LVTKY+W +V  G IVR P + F DGF
Sbjct  415   STVAKCFMPFGSGMKQCAGAEYSRVLLATFLHVLVTKYRWALVKGGKIVRSPIIRFPDGF  474


 Score =   172 bits (436),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 124/208 (60%), Gaps = 6/208 (3%)
 Frame = +1

Query  4    EMTWLVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPP  183
            +M+ +V  + + + I I+HW+YRWRNPKC G LPPGSMG P++GE+IQ     +   +PP
Sbjct  15   DMSSVVFLVGTLITIYISHWIYRWRNPKCNGALPPGSMGLPLVGETIQLVIPSASLDLPP  74

Query  184  FIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFM  363
            FI+ R+ RYG +FRT++ G+ VI++ D E NHF+ +Q+GKLV  W  ++ A++     F 
Sbjct  75   FIKSRMKRYGPIFRTNVAGRPVIITADPEFNHFLLRQDGKLVDTWSMDTFAEV-----FD  129

Query  364  VHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFK  543
                 S KY RNL LN  G E LK  LL +M+   ++ L  W+   ++++K     M   
Sbjct  130  QASQSSRKYTRNLTLNYFGVEALKGKLLPQMEVMVQKTLSTWSTQESVEVKSEAVTMSID  189

Query  544  LAASKVLSYD-EKKAMELRKYYKAFMEG  624
             AA ++ S D E   +++   +   +EG
Sbjct  190  FAARQIFSGDLENAPLKISDMFNDLVEG  217



>gb|EYU19885.1| hypothetical protein MIMGU_mgv1a020752mg [Erythranthe guttata]
Length=481

 Score =   209 bits (532),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 151/240 (63%), Gaps = 3/240 (1%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             K V +++++ + +R S  ++K    D LD+++ E  K E+F+ E   V ++  L F   +
Sbjct  236   KKVREMMRDVVTKRLSETERKNG--DLLDHII-EDKKTESFINEDFIVQLMFGLFFVTSD  292

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETV  989
             + S+   LA K L +HP VL++L  EHE I+  RE  +S++ WNEY+SM FT  VINE +
Sbjct  293   SISTTLALAFKLLAEHPLVLEELTAEHEAILKKREKSDSNLMWNEYKSMTFTLQVINEVL  352

Query  990   RLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQEL  1169
             RL +IAP  FR+ + D  + GYTIP GW+ MI  + +HL + +++DPL FNP RW   + 
Sbjct  353   RLGNIAPGFFRRALTDIPVNGYTIPSGWVIMIATAGLHLDSSQFEDPLKFNPWRWKEIQA  412

Query  1170  HPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGF  1349
                +K FM FG   + CAGAE++++ +A  +H LVTKY+W +V  G IVR P + F DGF
Sbjct  413   SVVAKCFMPFGSGMKQCAGAEYSRVLLATFIHVLVTKYRWGLVKGGKIVRSPIIRFPDGF  472


 Score =   178 bits (451),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 127/204 (62%), Gaps = 6/204 (3%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            L++ + + L I+I HW+YRWRNPK  G+LPPGSMGFP+IGE+IQ     +   +PPFI+ 
Sbjct  17   LILLVGTLLSISITHWIYRWRNPKTNGVLPPGSMGFPLIGETIQLVIPSASLDLPPFIKS  76

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+ RYGS+FRT+I G+ V+ + D E NHF+ +Q+GKLV  W  ++ A++     F     
Sbjct  77   RIKRYGSIFRTNIAGRPVVFTADLEFNHFLLRQDGKLVDTWSMDTFAEV-----FDQASQ  131

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
             S KY RNL LN  G E LK  LL +++   R+ L  W++L ++++K  +  M    AA 
Sbjct  132  SSRKYTRNLTLNHFGVEALKGKLLPQIEVMVRKTLSSWSSLDSVEVKSESVTMAIDFAAK  191

Query  556  KVLSYD-EKKAMELRKYYKAFMEG  624
            ++ S D E   +++   ++  +EG
Sbjct  192  QIFSGDLENAPLKMSDMFRDLVEG  215



>gb|KFK26105.1| hypothetical protein AALP_AA8G203400 [Arabis alpina]
Length=477

 Score =   229 bits (583),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 163/241 (68%), Gaps = 4/241 (2%)
 Frame = +3

Query  639   IKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYETTS  818
             ++L+K+    R++S   K+K  DFL+  + E+ K+ + + + + + +I  L+    +TTS
Sbjct  235   MQLMKDIYMRRKTS---KEKYDDFLNTAMEELGKDGSLVNDDVIISLIFTLLCITQDTTS  291

Query  819   SATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVINETVRL  995
              AT +ALKF++++P VL +L+ EHE I+A+REDKES +TW EYR  M FT MVINE++RL
Sbjct  292   KATCMALKFVSENPKVLAELKREHEAILASREDKESGVTWEEYRHKMTFTSMVINESLRL  351

Query  996   ADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQELHP  1175
              ++AP +FRK V+D EIKGYTIP GW+ M+ PS VH     Y++P  FNP RW G+EL  
Sbjct  352   TNLAPMMFRKAVKDVEIKGYTIPAGWIVMVIPSVVHFDPIIYENPFEFNPWRWEGKELRS  411

Query  1176  ASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGFKV  1355
              SK FM FG   R CAG+EFA+L ++I LH+LVT Y + + ++  ++R PG  F +G  +
Sbjct  412   GSKTFMVFGAGIRQCAGSEFARLQISIFLHHLVTTYNFSLSEDCEVIRVPGALFPNGISM  471

Query  1356  Q  1358
              
Sbjct  472   N  472


 Score =   158 bits (400),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 117/199 (59%), Gaps = 1/199 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +I+ +V+ I+HW YRW NPK  G LPPGSMGFPIIGE+  +F  H    I PF+++++
Sbjct  9    LLVIALVVVRISHWWYRWSNPKSNGKLPPGSMGFPIIGETFDYFKPHGFYEISPFLKKKM  68

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG LFRT+I G K +VSTD ++N  I +QE K     Y +   +  G     +  G+ 
Sbjct  69   LRYGPLFRTNIFGVKTVVSTDMDVNMEILRQENKSFKLSYPDGFVKPLGKDSLFLQTGNI  128

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            HK+++ +++ L+G ENLK+ ++ +MD+  R+HL         D+K A   ++      KV
Sbjct  129  HKHIKQISMRLLGSENLKRKIIKDMDRVTREHLSLKANKGKFDVKDAVSSLITSHLTPKV  188

Query  562  LS-YDEKKAMELRKYYKAF  615
            +S    +   +L   +KAF
Sbjct  189  ISNLKPETQAKLVDNFKAF  207



>ref|XP_010425706.1| PREDICTED: cytochrome P450 708A2-like [Camelina sativa]
Length=479

 Score =   225 bits (574),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 160/247 (65%), Gaps = 4/247 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             R  ++ +KL+ E  ++R +S +K     DFL+ ++ E++KE + +T+   V +I +L   
Sbjct  230   RACRDGMKLLNEVYSKRNASTEKHD---DFLNTVMEELEKEGSLVTQDAIVSLIFVLSCV  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVI  977
               E T      A+KFL+++P VL +L+ EHE I+ +REDKE  +TW EYR  M FT+MVI
Sbjct  287   TQELTVKTICFAVKFLSENPKVLAELKREHEAILESREDKEGGVTWEEYRHKMTFTNMVI  346

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NET+RLA++AP +FRK V+D EI GYTIP GW+ ++  S VH  +E Y++P  FNP RW 
Sbjct  347   NETLRLANMAPVVFRKAVEDVEINGYTIPAGWVVLVATSVVHFDSEVYENPFEFNPWRWE  406

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             G+E+   SK FM FGG  R C GAEFA+L ++I LH+L+T Y + +     ++R P + F
Sbjct  407   GKEVRSGSKTFMVFGGGVRQCVGAEFARLQISIFLHHLITTYDFSLFKGSEVIRAPAVFF  466

Query  1338  LDGFKVQ  1358
              +G  + 
Sbjct  467   PEGISIN  473


 Score =   160 bits (406),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 125/207 (60%), Gaps = 2/207 (1%)
 Frame = +1

Query  1    SEMTWLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGI  177
            S++ W+  + +I+ +V+ I+HW YRW NPK  G LPPGSMGFPIIGE+  F+  H    I
Sbjct  2    SDLLWITGLCVIALVVVRISHWWYRWSNPKFNGKLPPGSMGFPIIGETFHFYKPHGFYEI  61

Query  178  PPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG  357
             PF ++R+++YG LFRT+I+G K +VSTD ++N  I +QE K  +  Y +   +  G + 
Sbjct  62   SPFFKKRMSKYGPLFRTNILGFKTVVSTDKDVNMEILRQENKSFNLSYPDGLVKSLGKES  121

Query  358  FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIML  537
                 G+ HK+++ +++ LVG ENLK+ +L +MD+  R+HL    +    D++ A   M+
Sbjct  122  IFFKTGNIHKHIKLISMQLVGSENLKRNILKDMDRVTREHLSLKASQGRFDVRDAVFSMI  181

Query  538  FKLAASKVLS-YDEKKAMELRKYYKAF  615
                  K++S    +   +L   +KAF
Sbjct  182  TAHLTPKMISNLKPETQAKLMDNFKAF  208



>ref|XP_009588273.1| PREDICTED: cytochrome P450 87A3-like [Nicotiana tomentosiformis]
Length=486

 Score =   216 bits (549),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 160/240 (67%), Gaps = 1/240 (0%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             K V + +++ L +R SS  +K+ ++D +D+LL ++D  + FLTE   V ++  L+F   +
Sbjct  239   KKVRETMRDVLTKRLSSSAEKRTEEDLVDHLLRDMD-SQNFLTEDYIVQMMFGLLFVTSD  297

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETV  989
             + S+   L  K L +H  VL++L  EH+ I+  +E+ +  +TWN+Y+SM FT  VINE +
Sbjct  298   SISTTLALCFKLLAEHADVLEELIAEHDSILKNKENLDDPLTWNDYKSMTFTLQVINEVL  357

Query  990   RLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQEL  1169
             RL +IAP +FR+ ++D  + GYTIP GW+ MI  +++HL++++++DPLSFNP RW   + 
Sbjct  358   RLGNIAPGLFRRALKDIPVNGYTIPAGWVIMIATAALHLNSDQFEDPLSFNPWRWKEIQQ  417

Query  1170  HPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGF  1349
               A+K FM FG   + CAGAE++++ +A  LH LVTKY+W +V  G I+R P + F DGF
Sbjct  418   SCAAKNFMPFGSGMKQCAGAEYSRVFLATFLHVLVTKYRWTMVKGGKIIRAPIIRFPDGF  477


 Score =   170 bits (430),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 126/202 (62%), Gaps = 8/202 (4%)
 Frame = +1

Query  25   YLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQF-FTSHSLQGIPPFIQQRV  201
            ++++ L I +  W+YRWRNPKC G+LPPGSMGFP+IGE++Q  F SHSL  +PPF++ R+
Sbjct  23   FVVTLLTIYVTQWIYRWRNPKCNGVLPPGSMGFPLIGETLQLIFPSHSLD-LPPFLKNRI  81

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG +F+T++ G+ VI+S D E N FI +Q+GKLV  W  ++ A++     F  +   S
Sbjct  82   KRYGQMFKTNVAGRPVIISADPEFNSFILRQDGKLVETWSLDTFAEV-----FEQNTHSS  136

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
             KY R+L LN  G E LK+ LL +M+   +  L +W+   +L++K A   +    AA ++
Sbjct  137  RKYTRHLTLNHFGVEALKERLLPQMEDFIKSTLSNWSNHESLEVKSAAIKVTVDFAAKQI  196

Query  562  LSYDEKKA-MELRKYYKAFMEG  624
             S D   A   +   ++  +EG
Sbjct  197  FSGDLDNAPFNISYMFRDLVEG  218



>ref|XP_011025041.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
 ref|XP_011025043.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=474

 Score =   219 bits (559),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 105/252 (42%), Positives = 165/252 (65%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             SFH   + R+ ++KL+K+TL ER +   K++   DFLD  + ++ K E FLT      ++
Sbjct  221   SFHKCMQDREKMLKLLKDTLMERLNDPSKRRG--DFLDQAIDDM-KTEKFLTVDFIPQLM  277

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++E+ S+  TL  KFL ++P V+++L+ EHE I+  RE+  S +TW EYRSM F
Sbjct  278   FGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIVKKRENPNSRLTWEEYRSMTF  337

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T MV+NET+R+++I P +FRK ++DF++KGYT+P GW  M+   +  L+ + + DP++FN
Sbjct  338   TQMVVNETLRISNIPPGLFRKALKDFQVKGYTVPAGWTVMLVTPATQLNPDTFKDPVTFN  397

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAE++KL ++  LH L TKY +  +  G++ R 
Sbjct  398   PWRWQELDQVTISKNFMPFGGGTRQCAGAEYSKLVLSTFLHILATKYSFTKIRGGDVSRT  457

Query  1323  PGLTFLDGFKVQ  1358
             P ++F DG  ++
Sbjct  458   PIISFGDGIHIK  469


 Score =   166 bits (419),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 125/192 (65%), Gaps = 2/192 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +++ +VI   H +++WR+PK +G+LPPGSMG+P+IGE++QF        + PF+++R+
Sbjct  6    LVVVALVVIYYTHLLFKWRSPKIEGVLPPGSMGWPLIGETLQFIIPGKSLDLHPFVKKRM  65

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--G  375
             +YG +F+TS+VG+ +IVSTD E+N +I Q EG LV  WY +S A+    +G    +  G
Sbjct  66   QKYGPIFKTSLVGRPIIVSTDYEMNKYILQHEGTLVELWYLDSFAKFFALEGETRVNAIG  125

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYLR++ LN  G E+LK++LL +++     +L  W +   +D+KQ   +M+F   A+
Sbjct  126  KVHKYLRSITLNHFGVESLKESLLPKIEDMLHTNLAKWASQGPVDVKQVISVMVFNFTAN  185

Query  556  KVLSYDEKKAME  591
            K+  YD + + E
Sbjct  186  KIFGYDAENSKE  197



>ref|XP_009125591.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 708A2 [Brassica 
rapa]
Length=480

 Score =   238 bits (606),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 116/237 (49%), Positives = 164/237 (69%), Gaps = 4/237 (2%)
 Frame = +3

Query  639   IKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYETTS  818
             ++L+K+    R++S   ++K  DFL+  L E++KE + + E + V +I  L     +TTS
Sbjct  235   MQLMKDIYARRKTS---REKYDDFLETTLDELEKEGSLVNEDVIVSLIFTLCCITQDTTS  291

Query  819   SATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVINETVRL  995
              AT +ALKF++++P VL +L+ EHE I+A+REDKE  +TW EYR  M FT+MVINE++RL
Sbjct  292   KATCMALKFVSENPKVLAELKREHEAILASREDKEGGVTWEEYRHKMTFTNMVINESLRL  351

Query  996   ADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQELHP  1175
              ++AP +FRKVV+D EIKGYTIP GW+ M+ PS VHL  E Y++P  FNP RW G+EL  
Sbjct  352   TNLAPMMFRKVVKDVEIKGYTIPAGWIVMVIPSVVHLDPEIYENPFEFNPWRWEGKELRS  411

Query  1176  ASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDG  1346
              SK FM FG   R CAG+EFA+L ++I LH+LVT Y + +  +  +VR PG  F +G
Sbjct  412   GSKTFMVFGAGIRQCAGSEFARLQISIFLHHLVTTYDFSLSKDCEVVRVPGALFPNG  468


 Score =   147 bits (370),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 118/203 (58%), Gaps = 2/203 (1%)
 Frame = +1

Query  13   WLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFI  189
            W+V +++I+ +V  I+HW Y+  NPK  G LPPGSMGFPIIGE+  +F  H    + P +
Sbjct  5    WIVGLWVIALVVARISHWWYQXSNPKSNGKLPPGSMGFPIIGETFGYFKPHGFYELSPIL  64

Query  190  QQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVH  369
            ++++ RYG LFRT+I+G K +VSTD ++N  I + E K     Y +   +  G       
Sbjct  65   KKKMLRYGPLFRTNILGVKTVVSTDMDVNMDILRHENKFFSLSYPDGLVKPLGKDSLFFK  124

Query  370  HGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLA  549
             G+ HK+++++++ L+G ENLKQ ++ +MD+  ++HL         D+K A   ++    
Sbjct  125  TGNIHKHIKHISMRLLGSENLKQKIIKDMDRVTQEHLSLKANQERFDVKDAVSSLIISHL  184

Query  550  ASKVLS-YDEKKAMELRKYYKAF  615
              KV+S    +   +L K + AF
Sbjct  185  TPKVISNLKPETQSKLMKNFNAF  207



>ref|XP_004292300.1| PREDICTED: cytochrome P450 87A3-like [Fragaria vesca subsp. vesca]
Length=476

 Score =   228 bits (580),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 109/243 (45%), Positives = 162/243 (67%), Gaps = 3/243 (1%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             K V+ ++K+ L ERR S   + ++ DFLD+L+ +++KEE F+T+  AV ++   +FA YE
Sbjct  231   KEVVTMLKDMLKERRVS--PETRRGDFLDHLIVDMEKEE-FMTDDFAVQLVFGGLFANYE  287

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETV  989
             + S    L L  L +HP VL+QL  EHE I+  R + +S +TW+EY+SM FT  V+NET+
Sbjct  288   SVSPVLALCLSLLAKHPLVLQQLTAEHETILNNRTNLDSPLTWDEYKSMTFTLQVVNETL  347

Query  990   RLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQEL  1169
             RLA++AP + R+V++D E+KG TIP GW  M+  S++ ++   + DPL FNP RW   + 
Sbjct  348   RLANVAPGLLRRVLKDIEVKGVTIPAGWTVMVVNSALQMNPSIFKDPLEFNPWRWKDLDG  407

Query  1170  HPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGF  1349
             H  SK FM FGG  R CAGAE+++  +A  LH LVTKY+W ++  G+IVR P L F +G 
Sbjct  408   HVISKNFMPFGGGTRQCAGAEYSRAFLATFLHVLVTKYRWILIKGGSIVRNPMLGFGNGI  467

Query  1350  KVQ  1358
              ++
Sbjct  468   HIK  470


 Score =   156 bits (394),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 126/203 (62%), Gaps = 5/203 (2%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQF-FTSHSLQGIPPFIQQRVT  204
            L   L+I    W+ +WR+PKC G+LPPGSMG P+IGE++   F S+SL  + PFI++R+ 
Sbjct  9    LAPLLIIYATGWIMKWRHPKCNGILPPGSMGLPLIGETLSLIFPSYSLD-LHPFIKKRLK  67

Query  205  RYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG--FMVHHGD  378
            +YG +FRTSI  + V++S D EIN+++ QQEGKL+  WY ++ ++I   +G   M   G 
Sbjct  68   KYGLIFRTSIAFRPVVISADPEINNYLIQQEGKLLEVWYLDTFSKIFKQEGDSRMNAAGK  127

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             HKYLR++ L+  G E LK+ LLT+++    + L  W++   +++K A  +M     A  
Sbjct  128  VHKYLRHIFLDHFGAEILKEKLLTQIEACVNKSLCSWSSQEFVEVKHAASVMGLNFGAEH  187

Query  559  VLSYD-EKKAMELRKYYKAFMEG  624
            ++ Y+ E  +  L + Y   +EG
Sbjct  188  MIGYNAENSSGNLSQKYTRVIEG  210



>ref|XP_011025046.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
 ref|XP_011025047.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=474

 Score =   222 bits (566),  Expect(2) = 6e-97, Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 166/252 (66%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             SFH   + R+ ++K++K+TL ER +   K++   DFLD  + ++ K E FLT      ++
Sbjct  221   SFHKCMQDREKMLKMLKDTLMERLNDPSKRRG--DFLDQAIDDM-KTEKFLTVDFIPQLM  277

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++E+ S+  TL  KFL ++P V+++L+ EHE I+  RE+  S +TW EYRSM F
Sbjct  278   FGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAILNKRENPNSGLTWEEYRSMTF  337

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T MV+NET+R+++I P +FRK ++DF+ KGYT+P GW  M+   ++ L+ E + DP++FN
Sbjct  338   TQMVVNETLRISNIPPGLFRKALKDFQFKGYTVPAGWTVMLVTPAIQLNPETFKDPVTFN  397

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAE++KL ++  LH LVTKY +  V  G++ R 
Sbjct  398   PWRWKDLDQVTISKNFMPFGGGTRQCAGAEYSKLVLSTFLHVLVTKYSFTKVKGGDVSRT  457

Query  1323  PGLTFLDGFKVQ  1358
             P ++F DG  ++
Sbjct  458   PIISFGDGIHIK  469


 Score =   161 bits (407),  Expect(2) = 6e-97, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 119/184 (65%), Gaps = 2/184 (1%)
 Frame = +1

Query  46   IAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFR  225
            I   H +++WR+PK +G+LPPGSMG+P+IGE++QF        + PF+++R+ +YG +F+
Sbjct  14   IYYTHLLFKWRSPKIEGVLPPGSMGWPLIGETLQFIIPGKSLDLHPFVKKRMQKYGPIFK  73

Query  226  TSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--GDSHKYLRN  399
            TS+VG+ +IVSTD E+N +I Q EG LV  WY +S A+    +G    +  G  HKYLR+
Sbjct  74   TSLVGRPIIVSTDYEMNKYILQHEGTLVELWYLDSFAKFFALEGETRVNAIGTVHKYLRS  133

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            + LN  G E+LK++LL +++     +L  W +   +D+KQ   +M+F   A+K+  YD +
Sbjct  134  ITLNHFGVESLKESLLPKIEDMLHTNLAKWASQGPVDVKQVISVMVFNFTANKIFGYDAE  193

Query  580  KAME  591
             + E
Sbjct  194  NSKE  197



>ref|XP_006290340.1| hypothetical protein CARUB_v10017128mg [Capsella rubella]
 gb|EOA23238.1| hypothetical protein CARUB_v10017128mg [Capsella rubella]
Length=479

 Score =   224 bits (570),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 159/244 (65%), Gaps = 4/244 (2%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             ++ ++L+ +  ++R +S   K+K  DFL+ ++ E++KE   +T+   V +I +L     E
Sbjct  233   RDGMRLLNDVYSKRNAS---KEKHDDFLNTVMEELEKEGNLVTQDAIVSLIFVLSCVTQE  289

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVINET  986
              T      A+KFL+++P VL +L+ EHE I+ +REDKE  +TW EYR  M FT+MVINET
Sbjct  290   LTVKTICFAVKFLSENPKVLAELKREHEAILGSREDKEGGVTWEEYRHKMTFTNMVINET  349

Query  987   VRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQE  1166
             +RLA++AP +FRK V+D EI GYTIP GW+ ++  S VH  +E Y++P  FNP RW G+E
Sbjct  350   LRLANMAPVVFRKAVEDVEINGYTIPAGWVVLVATSVVHFDSEIYENPFEFNPWRWEGKE  409

Query  1167  LHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDG  1346
             +   SK FM FGG  R C GAEFA+L +++ LHYL+T Y + +     ++R P + F +G
Sbjct  410   VRSGSKTFMVFGGGVRQCVGAEFARLQISLFLHYLITNYDFSLFKGSKVIRAPAVFFPEG  469

Query  1347  FKVQ  1358
               + 
Sbjct  470   ISIN  473


 Score =   159 bits (401),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 122/207 (59%), Gaps = 2/207 (1%)
 Frame = +1

Query  1    SEMTWLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGI  177
            S++ W+  + +I+ +V+ I+HW YRW NPK  G LPPGSMGFPIIGE+  F+  H    I
Sbjct  2    SDLLWISGLCVIALVVVRISHWCYRWSNPKFNGKLPPGSMGFPIIGETFDFYKPHGFYEI  61

Query  178  PPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG  357
             PF ++R++RYG LFRT+++G K +VSTD ++N  I +QE K  +  Y +   +  G + 
Sbjct  62   SPFFKKRMSRYGPLFRTNLLGFKTVVSTDKDVNMEILRQENKSFNLSYPDGLVKSLGKES  121

Query  358  FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIML  537
                 G  HK ++ +++ LVG ENLK+ ++ +MD+  R+HL    +    D++     M+
Sbjct  122  IFFKTGSIHKNIKLISMQLVGSENLKRNMIKDMDRVTREHLSSKASQGRFDVRDTVFSMI  181

Query  538  FKLAASKVLS-YDEKKAMELRKYYKAF  615
                  K++S    +   +L   +KAF
Sbjct  182  TAHLTPKMISNLKPETQAKLMDNFKAF  208



>ref|XP_004974764.1| PREDICTED: cytochrome P450 87A3-like [Setaria italica]
Length=437

 Score =   227 bits (578),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 161/247 (65%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV +++ + L ER S+  KK    D +D L+ E+  E+  + E  A+D +  ++F 
Sbjct  188   KGRRNVHRILSDILKERLSTPGKKHG--DLVDLLVEELRSEKPLIDENFAIDALAAILFG  245

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ T S+A T+  KFL  +P V++ L+EEHE I+  REDK S  TW EY+S+ FT  V+N
Sbjct  246   SFVTASAALTIGFKFLTDNPKVVETLKEEHEIILKKREDKNSGFTWEEYKSLTFTTQVMN  305

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R+ +IAP IFRK ++D ++ GYTIP GW+ MI P +VHL+ + ++DPL FNP RW+ 
Sbjct  306   EITRMGNIAPGIFRKTLKDVQVNGYTIPAGWLVMISPMTVHLNPKFFEDPLKFNPWRWSD  365

Query  1161  QELHPASKK-FMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             +    A K+ FM FGG  RLC GA+F+KL +++ LH LVTKY+W  +  G ++R   +  
Sbjct  366   EAKQIAQKRNFMPFGGGIRLCLGADFSKLFISLFLHVLVTKYRWIEIKGGEVLRAAEMVI  425

Query  1338  LDGFKVQ  1358
               G+ +Q
Sbjct  426   PQGYHIQ  432


 Score =   155 bits (393),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 105/170 (62%), Gaps = 0/170 (0%)
 Frame = +1

Query  115  MGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQ  294
            MGFPI+GE+ Q F       IP + +QR+ RYG+LF+TS+ GQ+V+VS D E+NHFIFQ+
Sbjct  1    MGFPIVGETFQLFKPSPSFDIPSYYRQRLERYGTLFKTSLAGQRVVVSLDPEVNHFIFQE  60

Query  295  EGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQ  474
            EGKL   WY E+   I G +     +   HK++R+ A  L G ENL++ L+ E++   RQ
Sbjct  61   EGKLFRSWYPEAANNIFGKKSVTKFNATVHKFVRSFASKLFGVENLREVLIRELEDAIRQ  120

Query  475  HLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAMELRKYYKAFMEG  624
                W A  ++++K     M+F L A K++S +  ++ ELRK ++ F  G
Sbjct  121  SFAAWAAKPSIEVKDGVADMIFDLVAKKMISMEPGESRELRKNFEDFFRG  170



>ref|XP_002313286.1| hypothetical protein POPTR_0009s06920g [Populus trichocarpa]
 gb|EEE87241.1| hypothetical protein POPTR_0009s06920g [Populus trichocarpa]
Length=474

 Score =   223 bits (568),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 169/252 (67%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             SFH   + R+ ++K++K TL ER +   K++   DFLD  + +++ E+ FLT      ++
Sbjct  221   SFHQCMQDREKMLKMLKNTLMERLNDPSKRRG--DFLDQAIDDMETEK-FLTVDFIPQLM  277

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++E+ S+  TL  KFL+++P V+++L  EH+ I+  RE+  S +TW EYRSM F
Sbjct  278   FGILFASFESMSTTLTLTFKFLSENPRVVEELAAEHDAIVKNRENPNSRLTWEEYRSMTF  337

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T MV+NET+R+++I P +FRK ++DF++KGYT+P GW  MI   ++ L+ E + DP++FN
Sbjct  338   TQMVVNETLRISNIPPGLFRKALKDFQVKGYTVPAGWTVMIVTPAIQLNPETFKDPVTFN  397

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAE++KL ++  LH LVTKY++  V  G++ R 
Sbjct  398   PWRWKELDQVTISKNFMPFGGGTRQCAGAEYSKLVLSTFLHILVTKYRFTKVKGGDVSRT  457

Query  1323  PGLTFLDGFKVQ  1358
             P ++F DG +++
Sbjct  458   PIISFGDGIQIK  469


 Score =   159 bits (403),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 116/181 (64%), Gaps = 2/181 (1%)
 Frame = +1

Query  55   AHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSI  234
            +H + +W+NPK  G+LPPGSMG+P+IGE++QF        + PF+++R+ +YG +F+TS+
Sbjct  17   SHLISKWKNPKIDGVLPPGSMGWPLIGETLQFIIPGRSLDLHPFVKKRMQKYGPIFKTSL  76

Query  235  VGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--GDSHKYLRNLAL  408
            VG+ +IVSTD E+N +I Q EG LV  WY +S A++   +G    +  G  H+YLR++ L
Sbjct  77   VGRPIIVSTDYEMNKYILQHEGTLVELWYLDSFAKVFALEGETRVNAIGKVHRYLRSITL  136

Query  409  NLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAM  588
            N  G E+LK++LL +++      L  W     +D+KQ   +M+F   A+K+  YD + + 
Sbjct  137  NHFGVESLKESLLPKIEDMLHTSLAKWATQGPVDVKQVISVMVFNFTANKIFGYDAENSR  196

Query  589  E  591
            E
Sbjct  197  E  197



>ref|XP_011007350.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=474

 Score =   223 bits (568),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 169/252 (67%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             SFH   + R+ ++K++K TL ER +   K++   DFLD  + +++ E+ FLT      ++
Sbjct  221   SFHQCMQDREKMLKMLKNTLMERLNDPSKRRG--DFLDQTIDDMETEK-FLTVDFIPQLM  277

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++E+ S+  TL  KFL+++P V+++L  EH+ I+  RE+  S +TW EYRSM F
Sbjct  278   FGILFASFESMSTTLTLTFKFLSENPRVVEELAAEHDAIVKKRENPTSRLTWEEYRSMTF  337

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T MV+NET+R+++I P +FRK ++DF++KGYT+P GW  MI   ++ L+ E + DP++FN
Sbjct  338   TQMVVNETLRISNIPPGLFRKALKDFQVKGYTVPAGWTVMIVTPAIQLNPETFKDPVTFN  397

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAE++KL ++  LH LVTKY++  V  G++ R 
Sbjct  398   PWRWKELDQVTISKNFMPFGGGTRQCAGAEYSKLVLSTFLHILVTKYRFTKVKGGDVSRT  457

Query  1323  PGLTFLDGFKVQ  1358
             P ++F DG +++
Sbjct  458   PIISFGDGIQIK  469


 Score =   159 bits (402),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 116/181 (64%), Gaps = 2/181 (1%)
 Frame = +1

Query  55   AHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSI  234
            +H + +W+NPK  G+LPPGSMG+P+IGE++QF        + PF+++R+ +YG +F+TS+
Sbjct  17   SHLISKWKNPKIDGVLPPGSMGWPLIGETLQFIIPGRSLDLHPFVKKRMQKYGPIFKTSL  76

Query  235  VGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--GDSHKYLRNLAL  408
            VG+ +IVSTD E+N +I Q EG LV  WY +S A+    +G    +  G  H+YLR++ L
Sbjct  77   VGRPIIVSTDYEMNKYILQHEGTLVELWYLDSFAKFFALEGETRVNAIGKVHRYLRSITL  136

Query  409  NLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAM  588
            N  G E+LK++LL +++     +L  W     +D+KQ   +M+F   A+K+  YD + + 
Sbjct  137  NHFGVESLKESLLPKIEDMLHTNLAKWATQGPVDVKQVISVMVFNFTANKIFGYDAENSR  196

Query  589  E  591
            E
Sbjct  197  E  197



>ref|XP_010502926.1| PREDICTED: cytochrome P450 708A2-like [Camelina sativa]
Length=479

 Score =   221 bits (562),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 105/247 (43%), Positives = 159/247 (64%), Gaps = 4/247 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             R  ++ +KL+ +  ++R +S +K     DFL+ ++ E++KE + +T+   V +I +L   
Sbjct  230   RACRDGMKLLNDVYSKRNASTEKHD---DFLNTVMEELEKEGSLVTQDAIVSLIFVLSCV  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVI  977
               E T      A+KFL+++P VL +L+ EH  I+ +REDKE  +TW EYR  M FT+MVI
Sbjct  287   TQELTVKTICFAVKFLSENPKVLAELKREHVGILESREDKEGGVTWEEYRHKMTFTNMVI  346

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NET+RLA++AP +FRK V+D EI GYTIP GW+ ++  S VH  +E Y++P  FNP RW 
Sbjct  347   NETLRLANMAPVVFRKAVEDVEINGYTIPAGWVVLVATSVVHFDSEVYENPFEFNPWRWE  406

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             G+E+   SK FM FGG  R C GAEFA+L ++I LH+L+T Y + +     ++R P + F
Sbjct  407   GKEVRSGSKTFMVFGGGVRQCVGAEFARLQISIFLHHLITTYDFSLFKGSEVIRAPAVFF  466

Query  1338  LDGFKVQ  1358
              +G  + 
Sbjct  467   PEGISIN  473


 Score =   160 bits (406),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 125/207 (60%), Gaps = 2/207 (1%)
 Frame = +1

Query  1    SEMTWLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGI  177
            S++ W+  + +I+ +V+ I+HW YRW NPK  G LPPGSMGFPIIGE+  F+  H    I
Sbjct  2    SDLLWITGLCVIALVVVRISHWWYRWSNPKFNGKLPPGSMGFPIIGETFHFYKPHGFYEI  61

Query  178  PPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG  357
             PF ++R+++YG LFRT+I+G K +VSTD ++N  I +QE K  +  Y +   +  G + 
Sbjct  62   SPFFKKRMSKYGPLFRTNILGFKTVVSTDKDVNMEILRQENKSFNLSYPDGLVKSLGKES  121

Query  358  FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIML  537
                 G+ HK+++ +++ LVG ENLK+ +L +MD+  R+HL    +    D++ A   M+
Sbjct  122  IFFKTGNIHKHIKLISMQLVGSENLKRNILKDMDRVTREHLSLKASQGRFDVRDAVFSMI  181

Query  538  FKLAASKVLS-YDEKKAMELRKYYKAF  615
                  K++S    +   +L   +KAF
Sbjct  182  TAHLTPKMISNLKPETQAKLMDNFKAF  208



>ref|XP_004237161.1| PREDICTED: cytochrome P450 87A3-like [Solanum lycopersicum]
Length=487

 Score =   217 bits (552),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 165/241 (68%), Gaps = 2/241 (1%)
 Frame = +3

Query  630   KNVIKLIKETLNER-RSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAY  806
             K V + +++ L +R  SS KK+K ++D +D+LL ++D ++ FLT+   V ++  L+F   
Sbjct  239   KKVRETMRDVLKKRIESSTKKRKGEEDLVDHLLKDMDSQK-FLTQDYIVQMMFGLLFVTS  297

Query  807   ETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINET  986
             ++ S+   L+ K L +HPHVL++L  EH+ I+  +E+ ++ +TWN+Y+SM FT  VINE 
Sbjct  298   DSISTTLALSFKLLVEHPHVLEELIVEHDLILKNKENLDAPLTWNDYKSMTFTLQVINEV  357

Query  987   VRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQE  1166
             +RL +IAP +FR+ ++D  I GYTIP GW+ MI  +++HL++++++DPLSFNP RW    
Sbjct  358   LRLGNIAPGLFRRALKDIPINGYTIPAGWVIMIATAALHLNSDQFEDPLSFNPWRWKKIR  417

Query  1167  LHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDG  1346
             L   +K FM FG   + CAGAE++++ +A  LH LVTKY+W +V  G I+R P + F DG
Sbjct  418   LSGGAKNFMPFGYGMKQCAGAEYSRVFLATFLHVLVTKYRWTMVKGGKIIRAPIIRFPDG  477

Query  1347  F  1349
             F
Sbjct  478   F  478


 Score =   164 bits (416),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 120/202 (59%), Gaps = 8/202 (4%)
 Frame = +1

Query  25   YLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQF-FTSHSLQGIPPFIQQRV  201
            ++++ L I +  W+YRWRNPKC G+LPPGSMG P IGE++Q    SHSL  +PPF++ R+
Sbjct  23   FVLTILTIYVTKWIYRWRNPKCNGILPPGSMGLPFIGETLQLILPSHSLD-LPPFLKNRI  81

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             +YG +F+T+I G+ VI+S D E N FI +Q+GKLV  W  ++ A++     F  +   S
Sbjct  82   KKYGQMFKTNIAGRPVIISADPEFNSFILKQDGKLVETWSLDTFAEV-----FEQNTHSS  136

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
             KY R+L LN  G E LK  LL +M+      L  W+   +L++K A   M    AA ++
Sbjct  137  RKYTRHLTLNHFGVEALKDKLLPQMENFVNLVLQKWSTHESLEVKSAATKMTVDFAAKQI  196

Query  562  LSYD-EKKAMELRKYYKAFMEG  624
             S D E     +   ++  +EG
Sbjct  197  FSGDLENAPFNISDMFRDLVEG  218



>ref|XP_008459936.1| PREDICTED: cytochrome P450 87A3-like [Cucumis melo]
Length=483

 Score =   213 bits (541),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 152/245 (62%), Gaps = 3/245 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + +K ++ + K TL + R        + DFLD  L +++ E+ FLTE+  V+++  ++FA
Sbjct  236   KAQKKLVNMFK-TLVKERHQASVAAARGDFLDQALRDIENEQ-FLTEEFVVNLLFGILFA  293

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             +  + S + TL  K L ++P V+++L  EHEK +  R+D ES ITW EY+SM FT  VI 
Sbjct  294   S-GSVSGSLTLMFKLLAENPSVVEELTAEHEKFLKQRKDPESPITWEEYKSMTFTLYVIY  352

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  RL++  P + R+  +D  I+GYTIP GW  M+  S++HL+ E + DPL FNP RW  
Sbjct  353   EIFRLSNAMPFLLRRTTKDVNIRGYTIPAGWTIMVANSALHLNPETHKDPLDFNPWRWKD  412

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             Q+ +  SK    FGG  R CAGA+++++ MAI LH LVTKY WKVV  G + R P L F 
Sbjct  413   QDQYSVSKNLQPFGGGTRQCAGADYSRVFMAIFLHTLVTKYSWKVVKGGEVSRSPILKFG  472

Query  1341  DGFKV  1355
             DG  V
Sbjct  473   DGIHV  477


 Score =   169 bits (427),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 117/184 (64%), Gaps = 2/184 (1%)
 Frame = +1

Query  46   IAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFR  225
            I + + VYRWRNPKC G+LPPGSMGFP+IGE++Q         +PPFI++RV +YG +FR
Sbjct  23   IGLTYLVYRWRNPKCNGVLPPGSMGFPLIGETLQLIAPGYTLDLPPFIKKRVQKYGPIFR  82

Query  226  TSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG--FMVHHGDSHKYLRN  399
            TS+VG+ ++V+ D EIN FI+ QEG+ V  WY +S +++    G       G  HKYLR+
Sbjct  83   TSLVGRSIVVTADPEINSFIYNQEGRTVELWYLDSISKVFKQDGEAKTTAGGAIHKYLRS  142

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            + LN  G E+LK  LL ++ +   + L  W+   ++++++ T  ML+   A  +  YD +
Sbjct  143  ITLNHFGSESLKSKLLADIQRYVDKVLIQWSNQPSVEVQRGTLTMLYDFNADVMFGYDPE  202

Query  580  KAME  591
            K+ E
Sbjct  203  KSNE  206



>ref|NP_001067707.1| Os11g0289700 [Oryza sativa Japonica Group]
 gb|ABA92826.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28070.1| Os11g0289700 [Oryza sativa Japonica Group]
 gb|EAZ18110.1| hypothetical protein OsJ_33657 [Oryza sativa Japonica Group]
Length=484

 Score =   201 bits (511),  Expect(2) = 3e-96, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 139/233 (60%), Gaps = 2/233 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV   +   + +R S+     K  D +D ++ E+  E   + E  A+D +  L+FA
Sbjct  236   QGRRNVWTTLTNVMKKRLSA--PGNKFGDLVDLIVEELRSENPTIDESFAIDTLSGLLFA  293

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++   S   T   KFLN +P V  +L+EEHE I+  RE   S  TW EY+S+KF+  V+N
Sbjct  294   SFAPLSCTLTTTFKFLNDNPEVFDKLKEEHEMILKKREGANSGFTWEEYKSLKFSTQVVN  353

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R+  + P  FRK + D ++ GYTIP GW+ MI P  VHL+ + ++DPL F+P RW  
Sbjct  354   EINRITTVIPGGFRKALTDVQVNGYTIPSGWLVMISPMGVHLNPKLFEDPLKFDPWRWTE  413

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVR  1319
             ++     + FM FGG  R+C  AEF KL + + LH +VT+Y+WK +D GN+ R
Sbjct  414   EKRISMQRNFMPFGGGIRMCPAAEFNKLFITLFLHIVVTEYRWKDIDGGNVKR  466


 Score =   180 bits (457),  Expect(2) = 3e-96, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 120/190 (63%), Gaps = 0/190 (0%)
 Frame = +1

Query  52   IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            +AHWVYRW NP C G LPPGSMGFPI+GE+ QFF +     +P + ++R+ RYG +F+T+
Sbjct  26   LAHWVYRWINPPCNGRLPPGSMGFPIVGETFQFFRTSPSIDMPIYYKRRLERYGPIFKTN  85

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALN  411
            I GQ V++S D E+N FIFQQEGKL   W+ E+   I G +    ++  +HK +R+    
Sbjct  86   IGGQHVVISLDPEVNQFIFQQEGKLFQSWFPETTLNIFGKKTLTTYNRTAHKLIRSFVCK  145

Query  412  LVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME  591
            L GPEN+K++LL E++ + R+ L  W    ++++      M+F LAA  ++  D   + E
Sbjct  146  LYGPENVKKSLLPELENSMRESLASWIGKPSVEVNDGVSNMIFGLAAKHLIGLDITNSGE  205

Query  592  LRKYYKAFME  621
            L+K ++   +
Sbjct  206  LKKNFQEIFQ  215



>ref|XP_002464219.1| hypothetical protein SORBIDRAFT_01g014350 [Sorghum bicolor]
 gb|EER91217.1| hypothetical protein SORBIDRAFT_01g014350 [Sorghum bicolor]
Length=481

 Score =   251 bits (640),  Expect(2) = 3e-96, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 172/247 (70%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKNV+K++K+ L ERR++ +++    DF D ++ E++K    + +  A+D++  ++FA
Sbjct  232   QGRKNVMKVLKQQLGERRNAAERETV--DFFDLVIDELNKPNPMMDKSTALDLLFAMLFA  289

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS   T+ LK+L  +P  L++L EEHE+I+  R D++S ITW EY+SMKFT  VI+
Sbjct  290   SHETTSMVLTVILKYLTDNPKALQELTEEHERILERRVDRDSDITWEEYKSMKFTSHVIH  349

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW-N  1157
             E++RLA+IA  +FRK  QD    GYTIP+G   MICP + HL+ + Y+DP  FNP RW N
Sbjct  350   ESLRLANIALVMFRKADQDVHTNGYTIPKGSKIMICPLASHLNMKVYEDPSVFNPWRWKN  409

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
               E   ASK FMAFGG  RLCAGA+F+K+ MA+ LHYLV  Y+WK V  G +V  PGL F
Sbjct  410   IPEPVGASKDFMAFGGGLRLCAGADFSKMQMAMFLHYLVRNYRWKTVSGGTMVFYPGLQF  469

Query  1338  LDGFKVQ  1358
              DGF +Q
Sbjct  470   PDGFHIQ  476


 Score =   130 bits (327),  Expect(2) = 3e-96, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 114/195 (58%), Gaps = 5/195 (3%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAI-AHWVYRWRN--PKCKGL-LPPGSMGFPIIGESIQFFTSHSLQG  174
            M +LV   ++ L + + A  V R RN    C+G  LPPGS G P IGE++ +  + S  G
Sbjct  3    MHYLVSVSVTCLALGVGAILVLRRRNGGRTCEGARLPPGSRGLPFIGETLHYLAASSTLG  62

Query  175  I-PPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGP  351
            + PPF ++R+ RYG +FRTS+VG+ ++VS D+E+N  I +QE +    WY  S  ++ G 
Sbjct  63   LLPPFFEKRLERYGPIFRTSLVGEDLVVSLDAELNAHILKQEERGFQIWYPPSFMRVFGA  122

Query  352  QGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEI  531
                   G  H+++R L L L G + ++  LL ++ ++AR  L  W    +++++ A   
Sbjct  123  DNITSKIGVLHRHMRTLVLRLFGHQTIRSVLLHDVQRSARDELRSWLDRPDVEVRTAISR  182

Query  532  MLFKLAASKVLSYDE  576
            M+F + A K++S+D+
Sbjct  183  MIFGVTAKKLISHDD  197



>gb|EEC68024.1| hypothetical protein OsI_35831 [Oryza sativa Indica Group]
Length=484

 Score =   201 bits (510),  Expect(2) = 4e-96, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 138/233 (59%), Gaps = 2/233 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV   +   + +R S+     K  D +D ++ E+  E   + E  A+D +  L+FA
Sbjct  236   QGRRNVWTTLTNVMKKRLSA--PGNKFGDLVDLIVEELRSENPTIDESFAIDTLSGLLFA  293

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++   S   T   KFLN +P V  +L+EEHE I+  RE   S  TW EY+S+KF+  V+N
Sbjct  294   SFAPLSCTLTTTFKFLNDNPEVFDKLKEEHEMILKKREGANSGFTWEEYKSLKFSTQVVN  353

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R+  + P  FRK + D E+ GYTIP GW+ MI P  VHL+ + ++DPL F+P RW  
Sbjct  354   EINRITTVIPGGFRKALTDVEVNGYTIPSGWLVMISPMGVHLNPKLFEDPLKFDPWRWTE  413

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVR  1319
             ++     + FM FGG  R+C   EF KL + + LH +VT+Y+WK +D GN+ R
Sbjct  414   EKRISMQRNFMPFGGGIRMCPAVEFNKLFITLFLHIVVTEYRWKDIDGGNVKR  466


 Score =   180 bits (457),  Expect(2) = 4e-96, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 125/200 (63%), Gaps = 2/200 (1%)
 Frame = +1

Query  28   LISFLVIA--IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            L +F +I   +AHWVYRW NP C G LPPGSMGFPI+GE+ QFF +     +P + ++R+
Sbjct  16   LCAFTLIIGWLAHWVYRWINPPCNGRLPPGSMGFPIVGETFQFFRTSPSIDMPIYYKRRL  75

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG +F+T+I GQ V++S D E+N FIFQQEGKL   W+ E+   I G +    ++  +
Sbjct  76   ERYGPIFKTNIGGQHVVISLDPEVNQFIFQQEGKLFQSWFPETTLNIFGKKTLTTYNRTA  135

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            HK +R+    L GPEN+K++LL E++ + R+ L  W    ++++      M+F LAA  +
Sbjct  136  HKLIRSFVCKLYGPENVKKSLLPELENSMRESLASWIGKPSVEVNDGVSNMIFGLAAKHL  195

Query  562  LSYDEKKAMELRKYYKAFME  621
            +  D   + EL+K ++   +
Sbjct  196  IGLDITNSGELKKNFQEIFQ  215



>ref|XP_007199625.1| hypothetical protein PRUPE_ppa016466mg [Prunus persica]
 gb|EMJ00824.1| hypothetical protein PRUPE_ppa016466mg [Prunus persica]
Length=492

 Score =   209 bits (531),  Expect(2) = 4e-96, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 158/260 (61%), Gaps = 19/260 (7%)
 Frame = +3

Query  627   RKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAY  806
             +KNV  ++++ L ER+ S   + ++ DFLD +  +++KE+ FL+E  +V ++   +FA +
Sbjct  230   QKNVTTMLRDMLKERQIS--PETRRGDFLDQISIDMEKEK-FLSEDFSVQLVFGGLFATF  286

Query  807   ETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINET  986
             E+ S+   LA   L +HP V+++L  EHE I+  RE+  SS+TW+EY+SM FT  VINE 
Sbjct  287   ESISAVLALAFSLLAEHPSVVEELTAEHEAILKNRENLNSSLTWDEYKSMTFTLQVINEI  346

Query  987   VRLADIAPAIFRKVVQDFEIKG----------------YTIPRGWMFMICPSSVHLSAEK  1118
             +RL ++AP + R+ ++D  +KG                +TIP GW  M+  S++ LS   
Sbjct  347   LRLGNVAPGLLRRALKDIPVKGKSSITNSVGLLFLTARFTIPEGWTIMVVTSALQLSPNT  406

Query  1119  YDDPLSFNPSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVV  1298
             ++DPL FNP RW   + +  SK FM FGG  R CAGAE++++ +A  LH LVTKY+W  +
Sbjct  407   FEDPLEFNPWRWKDLDSYAVSKNFMPFGGGMRQCAGAEYSRVFLATFLHVLVTKYRWTTI  466

Query  1299  DEGNIVRKPGLTFLDGFKVQ  1358
                 I R P L F DG  ++
Sbjct  467   KAARIARNPILGFGDGIHIK  486


 Score =   172 bits (436),  Expect(2) = 4e-96, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 130/202 (64%), Gaps = 15/202 (7%)
 Frame = +1

Query  46   IAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFR  225
            I   HW+ +WRNPKC G+LPPGSMG P IGE++          + PFI++R+ RYG +FR
Sbjct  15   IYFTHWIIKWRNPKCNGVLPPGSMGLPFIGETLNLIIPSYSLDLHPFIKKRLQRYGPIFR  74

Query  226  TSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS--------  381
            TS+ G++V+V+ D E N+++FQQEG++V  WY ++ ++I       VH G+S        
Sbjct  75   TSLAGRQVVVTADPEFNNYLFQQEGRMVELWYLDTFSKI------FVHEGESKTNAVGMV  128

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            HKY+R++ LN  G E LK+ LL ++++   + L  W++ +++++K A  +M+F  +A ++
Sbjct  129  HKYVRSIFLNHFGAERLKEKLLPQIEEFVNKSLCAWSSKASVEVKHAGSVMVFNFSAKQM  188

Query  562  LSYD-EKKAMELRKYYKAFMEG  624
            +SYD EK + +L + Y   ++G
Sbjct  189  ISYDAEKSSDDLSEKYTKIIDG  210



>gb|KFK26103.1| hypothetical protein AALP_AA8G203400 [Arabis alpina]
Length=468

 Score =   222 bits (566),  Expect(2) = 5e-96, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 158/230 (69%), Gaps = 4/230 (2%)
 Frame = +3

Query  639   IKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYETTS  818
             ++L+K+    R++S   K+K  DFL+  + E+ K+ + + + + + +I  L+    +TTS
Sbjct  235   MQLMKDIYMRRKTS---KEKYDDFLNTAMEELGKDGSLVNDDVIISLIFTLLCITQDTTS  291

Query  819   SATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVINETVRL  995
              AT +ALKF++++P VL +L+ EHE I+A+REDKES +TW EYR  M FT MVINE++RL
Sbjct  292   KATCMALKFVSENPKVLAELKREHEAILASREDKESGVTWEEYRHKMTFTSMVINESLRL  351

Query  996   ADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQELHP  1175
              ++AP +FRK V+D EIKGYTIP GW+ M+ PS VH     Y++P  FNP RW G+EL  
Sbjct  352   TNLAPMMFRKAVKDVEIKGYTIPAGWIVMVIPSVVHFDPIIYENPFEFNPWRWEGKELRS  411

Query  1176  ASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKP  1325
              SK FM FG   R CAG+EFA+L ++I LH+LVT Y + + ++  ++R P
Sbjct  412   GSKTFMVFGAGIRQCAGSEFARLQISIFLHHLVTTYNFSLSEDCEVIRVP  461


 Score =   158 bits (399),  Expect(2) = 5e-96, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 117/199 (59%), Gaps = 1/199 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +I+ +V+ I+HW YRW NPK  G LPPGSMGFPIIGE+  +F  H    I PF+++++
Sbjct  9    LLVIALVVVRISHWWYRWSNPKSNGKLPPGSMGFPIIGETFDYFKPHGFYEISPFLKKKM  68

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG LFRT+I G K +VSTD ++N  I +QE K     Y +   +  G     +  G+ 
Sbjct  69   LRYGPLFRTNIFGVKTVVSTDMDVNMEILRQENKSFKLSYPDGFVKPLGKDSLFLQTGNI  128

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            HK+++ +++ L+G ENLK+ ++ +MD+  R+HL         D+K A   ++      KV
Sbjct  129  HKHIKQISMRLLGSENLKRKIIKDMDRVTREHLSLKANKGKFDVKDAVSSLITSHLTPKV  188

Query  562  LS-YDEKKAMELRKYYKAF  615
            +S    +   +L   +KAF
Sbjct  189  ISNLKPETQAKLVDNFKAF  207



>ref|XP_002464218.1| hypothetical protein SORBIDRAFT_01g014340 [Sorghum bicolor]
 gb|EER91216.1| hypothetical protein SORBIDRAFT_01g014340 [Sorghum bicolor]
Length=482

 Score =   246 bits (627),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 170/247 (69%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKNV+K++K+ L ERR++ +++    DF D ++ E++K    + E  A+D++ M++F 
Sbjct  233   QGRKNVMKMLKQQLGERRNAAERETV--DFFDLVIDELNKPNPMMDESTALDLLFMMLFG  290

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS   T+ LK+L  +   L++L EEHE+I+  R D +S ITW EY+SMKFT  VI+
Sbjct  291   SHETTSMVLTVILKYLTDNRKALQELTEEHERILERRVDPDSDITWEEYKSMKFTSHVIH  350

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW-N  1157
             E++RLA+IA  +FRK  QD    GYTIP+G   MICP + HL+ + Y++P  FNP RW N
Sbjct  351   ESLRLANIALVMFRKADQDVHTNGYTIPKGSKIMICPLASHLNMKVYENPSVFNPWRWKN  410

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
               E   ASK FMAFGG  RLCAGA+F+K+ MA+ LHYLV  Y+WK V  G +V  PGL F
Sbjct  411   IPEPVGASKDFMAFGGGLRLCAGADFSKMQMAMFLHYLVRNYRWKTVSGGIMVFYPGLQF  470

Query  1338  LDGFKVQ  1358
              DGF +Q
Sbjct  471   PDGFHIQ  477


 Score =   134 bits (338),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 117/199 (59%), Gaps = 6/199 (3%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAI-AHWVYRWRN--PKCKG-LLPPGSMGFPIIGESIQFF--TSHSL  168
            M +LV   ++ L + + A  V RWRN    C+G  LPPGS G P IGE++Q+F   S +L
Sbjct  3    MHYLVAVSMTCLALGVGAILVLRWRNGGRTCEGGRLPPGSRGLPFIGETLQYFLAASSTL  62

Query  169  QGIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITG  348
              +PPF ++R+ RYG +FRTS+VG+ +IVS D+E+N  I +QE +    WY  S  ++ G
Sbjct  63   GLLPPFFKKRLERYGPIFRTSLVGEDLIVSLDAELNAHILKQEERGFQIWYPPSFMRVFG  122

Query  349  PQGFMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATE  528
                    G  H ++R L L L G + ++  LL ++ ++AR  L  W    +++++ A  
Sbjct  123  ADNITSKIGVLHLHMRTLVLRLFGHQTIQSVLLHDVQRSARDELRSWLDRPDVEVRTAIS  182

Query  529  IMLFKLAASKVLSYDEKKA  585
             M+F + A K++S+D+  +
Sbjct  183  RMIFGVTAKKLISHDDAAS  201



>gb|KFK26104.1| hypothetical protein AALP_AA8G203400 [Arabis alpina]
Length=475

 Score =   222 bits (565),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 158/231 (68%), Gaps = 4/231 (2%)
 Frame = +3

Query  639   IKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYETTS  818
             ++L+K+    R++S   K+K  DFL+  + E+ K+ + + + + + +I  L+    +TTS
Sbjct  235   MQLMKDIYMRRKTS---KEKYDDFLNTAMEELGKDGSLVNDDVIISLIFTLLCITQDTTS  291

Query  819   SATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVINETVRL  995
              AT +ALKF++++P VL +L+ EHE I+A+REDKES +TW EYR  M FT MVINE++RL
Sbjct  292   KATCMALKFVSENPKVLAELKREHEAILASREDKESGVTWEEYRHKMTFTSMVINESLRL  351

Query  996   ADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQELHP  1175
              ++AP +FRK V+D EIKGYTIP GW+ M+ PS VH     Y++P  FNP RW G+EL  
Sbjct  352   TNLAPMMFRKAVKDVEIKGYTIPAGWIVMVIPSVVHFDPIIYENPFEFNPWRWEGKELRS  411

Query  1176  ASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPG  1328
              SK FM FG   R CAG+EFA+L ++I LH+LVT Y + + ++  I R+ G
Sbjct  412   GSKTFMVFGAGIRQCAGSEFARLQISIFLHHLVTTYNFSLSEDCEITRRFG  462


 Score =   158 bits (399),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 117/199 (59%), Gaps = 1/199 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +I+ +V+ I+HW YRW NPK  G LPPGSMGFPIIGE+  +F  H    I PF+++++
Sbjct  9    LLVIALVVVRISHWWYRWSNPKSNGKLPPGSMGFPIIGETFDYFKPHGFYEISPFLKKKM  68

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG LFRT+I G K +VSTD ++N  I +QE K     Y +   +  G     +  G+ 
Sbjct  69   LRYGPLFRTNIFGVKTVVSTDMDVNMEILRQENKSFKLSYPDGFVKPLGKDSLFLQTGNI  128

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            HK+++ +++ L+G ENLK+ ++ +MD+  R+HL         D+K A   ++      KV
Sbjct  129  HKHIKQISMRLLGSENLKRKIIKDMDRVTREHLSLKANKGKFDVKDAVSSLITSHLTPKV  188

Query  562  LS-YDEKKAMELRKYYKAF  615
            +S    +   +L   +KAF
Sbjct  189  ISNLKPETQAKLVDNFKAF  207



>ref|XP_009798348.1| PREDICTED: cytochrome P450 87A3-like [Nicotiana sylvestris]
Length=486

 Score =   216 bits (549),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 165/242 (68%), Gaps = 5/242 (2%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             K V + +++ L +R SS  +K++++D +D+LL ++D ++ FLTE   V ++  L+F   +
Sbjct  239   KKVRETMRDVLTKRLSSSAEKREEEDLVDHLLRDMDSQK-FLTEDYIVQMMFGLLFVTSD  297

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETV  989
             + S+   L  K L +H  VL++L  EH+ I+  +E+ +  +TWN+Y+SM FT  VINE +
Sbjct  298   SISTTLALCFKLLAEHTDVLEELIAEHDSILKNKENLDDPLTWNDYKSMTFTLQVINEVL  357

Query  990   RLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQEL  1169
             RL +IAP +FR+ ++D  + GYTIP GW+ MI  +++HL++++++DPLSFNP RW  +E+
Sbjct  358   RLGNIAPGLFRRTLKDIPVNGYTIPAGWVIMIATAALHLNSDQFEDPLSFNPWRW--KEI  415

Query  1170  HP--ASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLD  1343
              P  A+K FM FG   + CAGAE++++ +A  LH LVTKY+W +V  G I+R P + F D
Sbjct  416   QPSCAAKNFMPFGSGMKQCAGAEYSRVFLATFLHVLVTKYRWTMVKGGTIIRAPIIRFPD  475

Query  1344  GF  1349
             GF
Sbjct  476   GF  477


 Score =   164 bits (415),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 125/202 (62%), Gaps = 8/202 (4%)
 Frame = +1

Query  25   YLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQF-FTSHSLQGIPPFIQQRV  201
            ++++ L I +  W+YRWRNPKC G+LPPGSMGFP+IGE++Q    SHSL  +PPF++ R+
Sbjct  23   FVVTLLTIYVTQWIYRWRNPKCNGVLPPGSMGFPLIGETLQLILPSHSLD-LPPFLKNRI  81

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG +F+T++ G+ VI+S + E N FI +Q+GKLV  W  ++ A++     F  +   S
Sbjct  82   KRYGHIFKTNVAGRPVIISANPEFNSFILRQDGKLVETWSLDTFAEV-----FEQNTHSS  136

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
             KY R+L LN  G E +K+ LL +M++  +  L  W+   +L++K A   +    AA ++
Sbjct  137  RKYTRHLTLNHFGVEAIKEKLLPQMEEFIKSTLSSWSNHESLEVKSAAIKVTVDFAAKQI  196

Query  562  LSYDEKKA-MELRKYYKAFMEG  624
             S D   A   +   ++  +EG
Sbjct  197  FSGDLDNAPFNISYMFRDLVEG  218



>ref|XP_002299957.1| hypothetical protein POPTR_0001s27770g [Populus trichocarpa]
 gb|EEE84762.1| hypothetical protein POPTR_0001s27770g [Populus trichocarpa]
Length=479

 Score =   220 bits (561),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 160/252 (63%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + ++ +  +++  + ER +S  K+    DFLD  L+++  E+ FLTE    ++ 
Sbjct  225   TFHKCMKDKEKMSNMVRHIIKERFNSPDKRPG--DFLDQALNDMASEK-FLTEDFIAELS  281

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FAA+E+ S+  TLA+KFL ++P VL++L  E+E ++  RE+ +S +TW EY++M F
Sbjct  282   FGILFAAFESVSTTLTLAIKFLAENPLVLEELTAENEAVLKQRENPDSQLTWEEYKTMAF  341

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T  V+NET+RL +I P + RK ++D  IKGYTIP GW  M+    VHL+ E Y DPL FN
Sbjct  342   TQSVVNETLRLMNIPPGLLRKALKDINIKGYTIPAGWTIMLVTPIVHLNPETYKDPLKFN  401

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAEF+K+ MA  LH LVTKY+W  V  G I R 
Sbjct  402   PWRWKDLDQVTLSKSFMPFGGGTRQCAGAEFSKVYMAAFLHVLVTKYRWSKVKGGRITRS  461

Query  1323  PGLTFLDGFKVQ  1358
             P L F DG  V+
Sbjct  462   PILLFPDGVHVK  473


 Score =   159 bits (402),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 121/195 (62%), Gaps = 6/195 (3%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGL---LPPGSMGFPIIGESIQFFT-SHSLQG  174
            M  +V+ L++  VI   H + +W+ PK  G+   LPPGSMGFP+IGE+IQ    S++   
Sbjct  1    MLEIVLVLVALFVIYYTHLLIKWKYPKINGVPVQLPPGSMGFPVIGETIQLLIPSYNSID  60

Query  175  IPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQ  354
            I PFI++R+ RYG +FRT++VG+ +IVS D+E+N +IF QEG LV  WY +S A++   +
Sbjct  61   IHPFIRKRIQRYGPIFRTNLVGRPIIVSADAEVNKYIFSQEGNLVEMWYLDSFAKLFAFE  120

Query  355  G--FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATE  528
            G   +   G  H+YLR + LN  G E+L++ +L ++D +   +L  W+A   +++K A  
Sbjct  121  GESKVTAIGRVHRYLRGITLNHFGGESLREKMLPQIDASINDNLRQWSAQGAVEVKSAIS  180

Query  529  IMLFKLAASKVLSYD  573
             M+F   A     YD
Sbjct  181  RMIFNFTAKVAFGYD  195



>ref|XP_010495861.1| PREDICTED: cytochrome P450 708A2-like [Camelina sativa]
Length=479

 Score =   221 bits (562),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 105/247 (43%), Positives = 159/247 (64%), Gaps = 4/247 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             R  ++ +KL+ +  ++R +S +K     DFL+ ++ E++KE + +T+   V +I +L   
Sbjct  230   RACRDGMKLLNDVYSKRNASTEKHD---DFLNTVMEELEKEGSLVTQDAIVSLIFVLSCV  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVI  977
               E T      A+KFL+++P VL +L+ EHE I+ +REDKE  +TW EYR  M FT+MVI
Sbjct  287   TQELTVKTICFAVKFLSENPKVLAELKREHEAILESREDKEGGVTWEEYRHKMTFTNMVI  346

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NET+RLA++AP +FRK V+D EI G TIP GW+ ++  S VH  +E Y++P  FNP RW 
Sbjct  347   NETLRLANMAPVVFRKAVEDVEINGCTIPAGWVVLVATSVVHFDSEVYENPFEFNPWRWE  406

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             G+E+   SK FM FGG  R C GAEFA+L ++I LH+L+T Y + +     ++R P + F
Sbjct  407   GKEVRSGSKTFMVFGGGVRQCVGAEFARLQISIFLHHLITNYDFSLFKGSEVIRAPAVFF  466

Query  1338  LDGFKVQ  1358
              +G  + 
Sbjct  467   PEGISIN  473


 Score =   159 bits (401),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 125/207 (60%), Gaps = 2/207 (1%)
 Frame = +1

Query  1    SEMTWLV-MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGI  177
            S++ W+  + +I+ +V+ I++W YRW NPK  G LPPGSMGFPIIGE+  F+  H    I
Sbjct  2    SDLLWITGLCVIALVVVKISNWWYRWSNPKFNGKLPPGSMGFPIIGETFHFYKPHGFYEI  61

Query  178  PPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG  357
             PF ++R+++YG LFRT+I+G K +VSTD ++N  I +QE K  +  Y +   +  G + 
Sbjct  62   SPFFKKRMSKYGPLFRTNILGFKTVVSTDKDVNMEILRQENKSFNLSYPDGLVKSLGKES  121

Query  358  FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIML  537
                 G+ HK+++ +++ LVG ENLK+ +L +MD+  R+HL    +    D++ A   M+
Sbjct  122  IFFKTGNIHKHIKLISMQLVGSENLKRNILKDMDRVTREHLSLKASQGRFDVRDAVFSMI  181

Query  538  FKLAASKVLS-YDEKKAMELRKYYKAF  615
                  K++S    +   +L   +KAF
Sbjct  182  TAHLTPKMISNLKPETQAKLMDNFKAF  208



>ref|XP_002299954.1| hypothetical protein POPTR_0001s27710g [Populus trichocarpa]
 gb|EEE84759.1| hypothetical protein POPTR_0001s27710g [Populus trichocarpa]
Length=473

 Score =   219 bits (559),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 166/252 (66%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             SFH   + R+ ++K++K+TL ER +   K++   DFLD  + ++ K E FLT       +
Sbjct  220   SFHKCMQDREKMLKMLKDTLMERLNDPSKRRG--DFLDQAIDDM-KTEKFLTVDFIPQQM  276

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++E+ S+  TL  KFL ++P V+++L+ EHE I+  RE+  S +TW+EYR+M F
Sbjct  277   FGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIVKKRENPNSGLTWDEYRAMTF  336

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T MV+NET+R+++I P +FRK ++DF++KGYT+P GW  M+   ++ L+ + + DP++FN
Sbjct  337   TQMVVNETLRISNIPPGLFRKALKDFQVKGYTVPAGWTVMLVTPAIQLNPDTFKDPVTFN  396

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAE++KL ++  LH LVT Y +  V  G++ R 
Sbjct  397   PWRWKDLDQVTISKNFMPFGGGTRQCAGAEYSKLVLSTFLHVLVTSYSFTKVKGGDVSRT  456

Query  1323  PGLTFLDGFKVQ  1358
             P ++F DG  ++
Sbjct  457   PIISFGDGIHIK  468


 Score =   160 bits (404),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 124/192 (65%), Gaps = 3/192 (2%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +++ +VI   H +++WR+PK +G+LPPGSMG+P+IGE++QF        + PF+++R+
Sbjct  6    LVVVALVVIYYTHLLFKWRSPKIEGVLPPGSMGWPLIGETLQFIIPGKSLDLHPFVKKRM  65

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--G  375
             +YG +F+TS+VG+ +IVSTD E+N +I Q EG LV  WY +S A+    +G    +  G
Sbjct  66   QKYGPIFKTSLVGRPIIVSTDYEMNKYILQHEGTLVELWYLDSFAKFFALEGETRVNAIG  125

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYLR++ LN  G E+LK +LL +++     +L  W +   +D+KQ   +M+F   A+
Sbjct  126  TVHKYLRSITLNHFGVESLK-SLLPKIEDMLHTNLAKWPSQGPVDVKQVISVMVFNFTAN  184

Query  556  KVLSYDEKKAME  591
            K+  YD + + E
Sbjct  185  KIFGYDAENSKE  196



>ref|XP_008235944.1| PREDICTED: cytochrome P450 87A3-like [Prunus mume]
Length=475

 Score =   215 bits (548),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 153/239 (64%), Gaps = 3/239 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + R  +I ++++ L +RR S  K +   DFLD + S++DKE+ FL+E+  V  I  ++ A
Sbjct  227   KDRDKIITMLRDMLKKRRMSPDKHRG--DFLDQISSDMDKEK-FLSEESVVYAIFGVLLA  283

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +E  SS   LA   L +HP  LK+L  E+E ++  RE+  SS+TW+EY+SM FT  V+N
Sbjct  284   GFEPVSSIMALAFSLLAEHPAALKELTAENEALLKNRENPNSSLTWDEYKSMTFTRQVVN  343

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+RL ++APA+ R+ V+D  +KG+TIP GW+ M   S++ LS   + DPL FNP RW  
Sbjct  344   ETLRLGNVAPALLRRAVKDIPVKGFTIPAGWIIMALTSALQLSPNTFKDPLEFNPWRWKD  403

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
              +    SK FM FG   R CAGAE++++ +A  LH LVTKY WK +D G +VRK  L F
Sbjct  404   LDSLVISKNFMPFGRGSRQCAGAEYSRVFLATFLHVLVTKYSWKTIDAGRMVRKNMLLF  462


 Score =   164 bits (414),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 119/181 (66%), Gaps = 1/181 (1%)
 Frame = +1

Query  52   IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            I HW+ +WRNPKC G+LPPGSMG+P++GE++   T  +   + PF+++RVT+YG +FRTS
Sbjct  17   ITHWITQWRNPKCNGVLPPGSMGWPLVGETLNAMTLSNSIDLHPFVKRRVTKYGPIFRTS  76

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGD-SHKYLRNLAL  408
            +VG+ ++VS D E N ++ QQEGKLV   + +S  +I    G +   G   HKYLR++ L
Sbjct  77   LVGRPIVVSADPEFNSYLSQQEGKLVELGFFDSFTKILKVSGEITTAGSIIHKYLRSITL  136

Query  409  NLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAM  588
            N  G E LK+ LL  ++Q   + L  W++ +++++K A+ +MLF   A  ++ YD + + 
Sbjct  137  NHFGAETLKEKLLPLIEQMVVKTLASWSSQASVEVKHASSVMLFNFGAKHMIGYDAETSS  196

Query  589  E  591
            +
Sbjct  197  D  197



>ref|XP_007041637.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOX97468.1| Cytochrome P450, putative [Theobroma cacao]
Length=474

 Score =   197 bits (500),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 144/237 (61%), Gaps = 1/237 (0%)
 Frame = +3

Query  648   IKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYETTSSAT  827
             I   L + R +   +  K D LD++L ++ K E FLTE     ++  L F ++++ S A 
Sbjct  233   ILSVLVKARRASPDRMLKGDVLDHVLEDM-KSEKFLTEDFIAQLMFGLSFVSFDSISWAA  291

Query  828   TLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETVRLADIA  1007
             TL +K L  +P VL++L  EH+ I+  RE+  SSITW EY+SM FT  VINET+RL  I+
Sbjct  292   TLLIKLLGDNPLVLEELTAEHDAILKKRENPNSSITWEEYKSMTFTLQVINETLRLGSIS  351

Query  1008  PAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQELHPASKK  1187
             P + R+  +D ++ GYTIP+GW  M+  S+V ++ + Y DPL+FNP RW   E    SK 
Sbjct  352   PGLLRRARKDIQVNGYTIPKGWAIMLVSSAVQMNPDIYKDPLAFNPWRWKDLEPSVISKN  411

Query  1188  FMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGFKVQ  1358
             +M FG   + CAG+E++KL +A  +H LVTKY+W  +  G + R P L    G  ++
Sbjct  412   YMPFGSGIKQCAGSEYSKLFLATFIHVLVTKYRWIKIRGGGVTRIPLLRLKSGLCIK  468


 Score =   182 bits (462),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 126/207 (61%), Gaps = 11/207 (5%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +++ LVI IAHWVYRWRNPKC G+LPPGSMG P+IGE++Q     +   IPPF++ R+
Sbjct  6    LSVVALLVICIAHWVYRWRNPKCNGILPPGSMGIPLIGETLQLLVPSNSFDIPPFLKTRL  65

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQI-----TGPQGFMV  366
             RYG +FRT++ G+ V+VS + E NHFIFQQ G+LV  WY +  A++       P G  V
Sbjct  66   QRYGPIFRTNVAGRAVVVSAEPEFNHFIFQQHGRLVESWYLDLFAKLFKQGENRPDGAYV  125

Query  367  HHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKL  546
                 HKY+RNLAL+  G E+LK  LL  ++   R+    W+   ++++K A   M F  
Sbjct  126  -----HKYVRNLALSHFGVESLKGKLLPLLEAMVRETFSAWSNQESIEVKDAVSAMAFNF  180

Query  547  AASKVLSYD-EKKAMELRKYYKAFMEG  624
            A  ++ S D E  +  LR  + +   G
Sbjct  181  ATREIYSSDAENFSQSLRDMFISLARG  207



>ref|NP_001140790.1| uncharacterized protein LOC100272865 [Zea mays]
 gb|ACF84628.1| unknown [Zea mays]
Length=489

 Score =   248 bits (634),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 169/247 (68%), Gaps = 1/247 (0%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK V+ ++K+ L ERR +  +++  +DF D ++ E++K +  + E  A+D++  ++FA
Sbjct  233   QGRKKVMTMLKQQLVERRRNAAERETTEDFFDLVIDELNKPDPMMDESTALDLLFTMLFA  292

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETTS   T+ LK+L  +P  L++L EEHE+I+ +R D  S +TW EYRSMKFT  VI+
Sbjct  293   SHETTSMVLTVILKYLTDNPKALQELTEEHERILESRADPGSDLTWEEYRSMKFTSHVIH  352

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E++RLA+IA A+FRK  QD  I GYTIP+G   M+C  + HL+ E Y+DP  FNP RW  
Sbjct  353   ESLRLANIALAMFRKANQDVHINGYTIPKGSKIMMCALASHLNTEVYEDPSVFNPWRWKD  412

Query  1161  -QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
               E    SK FMAFGG  RLCAGAEF+K+ MA+ LHYLVT Y WK V  G ++  PGL F
Sbjct  413   IPEPVGTSKDFMAFGGGLRLCAGAEFSKMQMAMFLHYLVTNYSWKPVSGGTMLFYPGLQF  472

Query  1338  LDGFKVQ  1358
              +GF +Q
Sbjct  473   PEGFHIQ  479


 Score =   129 bits (325),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 107/183 (58%), Gaps = 2/183 (1%)
 Frame = +1

Query  43   VIAIAHWVY-RWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGI-PPFIQQRVTRYGS  216
            ++ +  W Y R R    +  LPPGS G   +GE++ +  + S  G+ PPF Q+R+ RYG 
Sbjct  19   ILLVLRWTYCRRRTSAEEARLPPGSRGLLFLGETLHYLAASSTPGVLPPFFQRRLERYGP  78

Query  217  LFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLR  396
            +FRT++VG+ ++VS D+E+N  + +QE +    WY  S  ++ G        G  H+++R
Sbjct  79   IFRTNLVGEDLVVSLDAELNAHVLKQEERGFQIWYPPSFMRVFGADNITAKLGVLHRHMR  138

Query  397  NLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDE  576
             L L L G + ++  LL ++ ++AR  L  W    +++++ AT  M+F + A+K++S+D+
Sbjct  139  TLVLRLFGHQTVRSVLLHDVQRSARDELRSWLGRPDVEVRTATSRMIFGVTANKLISHDD  198

Query  577  KKA  585
              +
Sbjct  199  AAS  201



>ref|XP_002299956.1| hypothetical protein POPTR_0001s27760g [Populus trichocarpa]
 gb|EEE84761.1| hypothetical protein POPTR_0001s27760g [Populus trichocarpa]
Length=476

 Score =   218 bits (556),  Expect(2) = 7e-95, Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 164/243 (67%), Gaps = 3/243 (1%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             K ++K++K+TL ER +   K++   DFLD  + +++ ++ FLT      +I  ++FA+YE
Sbjct  231   KKMMKILKDTLIERLNDPSKRRG--DFLDQAIDDLETKK-FLTVDFIPQLIFGILFASYE  287

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETV  989
             + SS  TLA+KFL+++P V+++L  EHE I+  RE+  SS+ W EYRS+ +T MV+NET+
Sbjct  288   SISSTLTLAIKFLSENPQVVEKLTAEHETILKNRENPNSSLAWEEYRSLTYTQMVVNETL  347

Query  990   RLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQEL  1169
             R++++ P I R+ ++DF++KGYTIP GW  ++   ++ L+ E + DPL+F+P RW   + 
Sbjct  348   RISNLPPGIIRRALKDFQVKGYTIPSGWTVLLATPAIQLNPETFKDPLTFDPCRWKDLDQ  407

Query  1170  HPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGF  1349
                SK F+ FGG  R CAGAEF+KL M+  LH LVTKY +  V  G++ R P ++F DG 
Sbjct  408   VTISKNFIPFGGGTRHCAGAEFSKLIMSTFLHVLVTKYTFTKVKGGDVSRNPVMSFGDGI  467

Query  1350  KVQ  1358
              ++
Sbjct  468   HIK  470


 Score =   158 bits (400),  Expect(2) = 7e-95, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 125/198 (63%), Gaps = 8/198 (4%)
 Frame = +1

Query  22   MYLISFLVIAIA-----HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M+ I FLV+A+A     H + +WRNPK  G+LPPGSMG+P+IGE++QF        + PF
Sbjct  1    MWAIGFLVVALAVVYYTHLISKWRNPKIDGVLPPGSMGWPLIGETLQFIIPGRSIDLHPF  60

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG--F  360
            +++R+ +YG +F+TS++G+  ++STD+E+N +I Q EG LV  WY +S A+    +G   
Sbjct  61   VKKRMHKYGPIFKTSLLGKPTVISTDNEVNKYILQHEGTLVELWYLDSFAKFFALEGENR  120

Query  361  MVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLF  540
            +   G+ H+Y R++ LN  G E+L+++LL +++     +L  W     +D+KQA  +M+F
Sbjct  121  VSAIGEVHRYTRSITLNHFGIESLRESLLPKIENMINTNLAKWATQGPVDMKQAIAVMVF  180

Query  541  KLAASK-VLSYDEKKAME  591
               A + V  YD + + E
Sbjct  181  NFTAKEIVFGYDAENSKE  198



>ref|XP_011007291.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
 ref|XP_011040774.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=480

 Score =   214 bits (545),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 109/248 (44%), Positives = 159/248 (64%), Gaps = 4/248 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKE--ETFLTEKIAVDVICMLI  794
             + R+   + +K+ L +RR+S      + D LD ++++++KE  E FL++   + VI  L+
Sbjct  229   KDREKATEFLKDKLEKRRNS--PDMYRGDLLDQVIADLNKEDKEKFLSDDFIITVIFGLL  286

Query  795   FAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMV  974
             FA +E+ S   TL LK L  HP VL++L  EHE I+  R + +  +TW+EY+SM  T  V
Sbjct  287   FAGFESVSKILTLTLKLLADHPSVLQELIAEHEGILKNRRNSDPVLTWDEYKSMTSTLQV  346

Query  975   INETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW  1154
             INE++RL + AP + R+V++D E KG+TIP GW+ M   S+ HL+ + Y DPL+FNP+RW
Sbjct  347   INESLRLGNGAPGLLRRVLKDIEFKGFTIPAGWIIMAVTSASHLNPDVYKDPLAFNPARW  406

Query  1155  NGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLT  1334
                + +  SK FM F G  R CAGAEF+KL MA  LH L+TKY+W  +  G +VR P L 
Sbjct  407   KDMDPYLVSKNFMPFSGGTRQCAGAEFSKLLMATFLHVLLTKYEWTRIKGGRVVRGPMLA  466

Query  1335  FLDGFKVQ  1358
             F DGF V+
Sbjct  467   FRDGFHVK  474


 Score =   162 bits (410),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 122/200 (61%), Gaps = 2/200 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +I+ LVI   H V +W+NP C G+LPPGSMG P+IGE++          + PFI++R+
Sbjct  6    LCVIALLVIYCTHLVRKWKNPSCNGVLPPGSMGLPLIGETLHLIIPSYSLDLHPFIKKRI  65

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG--FMVHHG  375
             R+G +FRT+I G+ V+VSTD E+NH I QQEGKLV  WY ++ +++   +G       G
Sbjct  66   QRFGPIFRTNIFGRPVVVSTDPELNHLILQQEGKLVEMWYLDTFSKLFNQEGESRTSAVG  125

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKY+R+L+L   G E LK+ LL E++   ++ L  W+A  ++++K  + +M+F   A 
Sbjct  126  VIHKYIRSLSLTHFGVETLKKGLLPEIEDMIKKTLQMWSAQESIEVKYGSAVMVFSYIAK  185

Query  556  KVLSYDEKKAMELRKYYKAF  615
             +  YD+ +     K  + F
Sbjct  186  HMFGYDDSENTSEDKISEKF  205



>dbj|BAK03801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   223 bits (567),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 170/248 (69%), Gaps = 4/248 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK V+K++++ L+ER       ++  DFLD L+ ++ +E+  + EKIA+D++ +L+FA
Sbjct  225   QGRKCVMKILRKMLDERMR--VPHRESVDFLDLLIDDLKEEKNLMNEKIALDLLFLLLFA  282

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +ETTSSA T  +K L  +P  L++L EEHE I   R D +S ITW EY+SMKFT  VI+
Sbjct  283   GFETTSSAITATVKLLTDNPEALQELTEEHENIRKRRVDPDSEITWEEYKSMKFTSHVIH  342

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E +RL +IAP +FRK  +D  +KGY IP+G   MI PS+VHL    Y+DP +FNP RW G
Sbjct  343   EALRLINIAPIMFRKATEDVHVKGYIIPKGSKIMINPSTVHLDPTIYEDPNAFNPWRWKG  402

Query  1161  --QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLT  1334
               + +  ASK+FMAFGG  RLC G++FAKL +AI LH LVTKY+WK +  G +V  PGL 
Sbjct  403   TAEPVSGASKEFMAFGGGLRLCVGSDFAKLQVAIFLHCLVTKYRWKAIKGGTMVLSPGLQ  462

Query  1335  FLDGFKVQ  1358
             F  GF +Q
Sbjct  463   FPGGFHIQ  470


 Score =   153 bits (386),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 116/186 (62%), Gaps = 1/186 (1%)
 Frame = +1

Query  70   RWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKV  249
            RW +      LPPGS GFP+IG++++FF+      + PF ++R+ RYG +FRTS+ G+ +
Sbjct  22   RWNSKVVGARLPPGSRGFPVIGDTLEFFSQSPSLELVPFFKRRLERYGPIFRTSLFGEDL  81

Query  250  IVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPEN  429
            IVS D E+N+ +FQ+E KL   WY ES  +I G +  +   G  H+++R+L L L GPEN
Sbjct  82   IVSIDKELNNLVFQREEKLFQIWYPESVMRIFGAESIISKLGSFHRHMRSLILRLFGPEN  141

Query  430  LKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKA-MELRKYY  606
            L+  LL +  +T +  L  W    ++++K+AT  M+F + + +++SYD   +  +L K Y
Sbjct  142  LRLVLLHDAQRTVQTSLLSWLDQPSIELKEATASMIFSITSKRLISYDSSNSDGKLWKQY  201

Query  607  KAFMEG  624
             AF +G
Sbjct  202  DAFFQG  207



>ref|XP_007016259.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY33878.1| Cytochrome P450, putative [Theobroma cacao]
Length=478

 Score =   221 bits (564),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 150/232 (65%), Gaps = 1/232 (0%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + ++ V K++ E L ERR S  +     DFL  ++ ++ KE  FLT++ AV ++  L+ A
Sbjct  226   KTQRKVEKILSELLEERRKSYSQGCNNGDFLGQIVEDMGKE-AFLTKEFAVSLMFGLLLA  284

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             + ET SS  TLA+K+L  +P  L+QL EEHE+I+  RED    ++W EY+SM FTH VIN
Sbjct  285   SVETISSTATLAIKYLLDNPSALQQLTEEHEEILKKREDTSLGLSWEEYKSMTFTHYVIN  344

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+R+  +AP I R+V+ D  I GYTIP+GW  ++ P+++ L+   Y DPL+FNPSRW  
Sbjct  345   ETLRIGSVAPGILRRVIADIHINGYTIPKGWNLLVVPAALQLNPNTYKDPLTFNPSRWKN  404

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIV  1316
                   +K F+ FGG  R CAGAEF+K+ MA++LH  VTKY  K   E  ++
Sbjct  405   MGSISTAKNFIPFGGGNRTCAGAEFSKVLMAVLLHVWVTKYSIKASMENGVL  456


 Score =   154 bits (388),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 113/189 (60%), Gaps = 2/189 (1%)
 Frame = +1

Query  61   WVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVG  240
            W+  WRNP C G LPPGSMG P+IGE++ F  +     I PFI++R+ RYGSLF+TS+ G
Sbjct  21   WISWWRNPSCNGRLPPGSMGLPLIGETLNFLVTCKSIDIHPFIKERMERYGSLFKTSLAG  80

Query  241  QKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVG  420
            + V+VS D + N+F+ QQE KLV  +Y +S A +   +G     G  HKYLR + L+  G
Sbjct  81   RPVVVSLDPDFNYFVLQQEEKLVELYYMDSFANLVH-KGNANEGGYVHKYLRRVILSHFG  139

Query  421  PENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYD-EKKAMELR  597
            PE LK+ LL + +      L  WT  + + +K  +  M+    +  ++SY+ EK    L 
Sbjct  140  PEALKEKLLWQAENVINHGLHEWTKQTEVAVKGQSAAMILGFTSKILMSYELEKSKQNLS  199

Query  598  KYYKAFMEG  624
            +Y  +F++G
Sbjct  200  EYLCSFLQG  208



>ref|XP_011007351.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=479

 Score =   218 bits (554),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 110/252 (44%), Positives = 159/252 (63%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + ++ +  +++  + ER +S  K+    DFLD  ++++  E+ FLT     ++ 
Sbjct  225   TFHKCMKDKEKMSNMVRHIIKERFNSPDKRPG--DFLDQAINDMASEK-FLTVDFIAELA  281

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FAA+E+ S+  TLA+KFL ++P VL++L  E+E ++  RE+ +S +TW EY+ M F
Sbjct  282   FGILFAAFESVSTTLTLAIKFLAENPLVLEELTAENEAVLKKRENPDSLLTWEEYKEMTF  341

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T  V+NET+RL +I P + RK ++D  +KGYTIP GW  M+    VHL+ E Y DPL FN
Sbjct  342   TQSVVNETLRLMNIPPGLLRKALKDINVKGYTIPAGWTIMLVTPIVHLNPETYKDPLKFN  401

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAEF+K+ MA  LH LVTKY+WK V  G I R 
Sbjct  402   PWRWKDLDQVTLSKSFMPFGGGTRQCAGAEFSKVYMAAFLHVLVTKYRWKKVKGGRITRS  461

Query  1323  PGLTFLDGFKVQ  1358
             P L F DG  +Q
Sbjct  462   PILLFPDGVHIQ  473


 Score =   157 bits (396),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 119/195 (61%), Gaps = 6/195 (3%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGL---LPPGSMGFPIIGESIQFFT-SHSLQG  174
            M  + + L++F VI   H + +W+ PK  G+   LPPGSMG PIIGE+IQ    SH+   
Sbjct  1    MLGIGLVLVAFFVIYYTHLLIKWKYPKINGVRVQLPPGSMGLPIIGETIQLLIPSHNSID  60

Query  175  IPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQ  354
            I PF+++R+ RYG +FRT++VG+ +IVS D E+N +IF QEG LV  WY +S A++   +
Sbjct  61   IHPFVRKRIQRYGPIFRTNLVGRPIIVSADPEVNKYIFSQEGNLVEMWYLDSFAKLFAFE  120

Query  355  G--FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATE  528
            G   +   G  H+YLR + LN  G E+L++ +L +++ T   +L  W+A   +++K A  
Sbjct  121  GESKVTAIGRVHRYLRGITLNHFGGESLREKMLPQIEVTVNNNLRQWSAQGPVEVKSAIS  180

Query  529  IMLFKLAASKVLSYD  573
             M+F   A     YD
Sbjct  181  RMIFNFTAKVAFGYD  195



>ref|XP_007201108.1| hypothetical protein PRUPE_ppa024382mg [Prunus persica]
 gb|EMJ02307.1| hypothetical protein PRUPE_ppa024382mg [Prunus persica]
Length=473

 Score =   214 bits (544),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 154/246 (63%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + R+ +  ++++ L +RR+S      + DFLD + S++DKE+ FL+E   V  +   +FA
Sbjct  225   KDREKITTMLRDMLKKRRTS--PDTHRGDFLDQISSDMDKEK-FLSEDFVVYALFGALFA  281

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +   S+  +LA   L +HP  L++L  E+E ++  RE+  SS+TW+EY+SM FT  V+N
Sbjct  282   GFHPISAIMSLAFSLLAEHPAALEELTAENEALLKNRENPNSSLTWDEYKSMTFTRQVVN  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+RL ++APA+FR+V++D  + G+TIP GW  M+  S++ LS   + DPL FNP RW  
Sbjct  342   ETLRLGNVAPALFRRVLKDIPVNGFTIPAGWTIMVLTSALQLSPNTFTDPLEFNPWRWKD  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              +    SK FM FG   R CAGAE++++ +A  LH LVTKY+W  +    IVR P L F 
Sbjct  402   LDSLVVSKNFMPFGRGSRQCAGAEYSRVFLATFLHVLVTKYRWTTIKGALIVRSPMLGFG  461

Query  1341  DGFKVQ  1358
             DG  + 
Sbjct  462   DGIHIN  467


 Score =   160 bits (404),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 118/184 (64%), Gaps = 9/184 (5%)
 Frame = +1

Query  52   IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            I HW+ +WRNPKC G+LPPGSMG+P++GE++   +      + PF ++R+ +YG +FRTS
Sbjct  17   ITHWITQWRNPKCNGVLPPGSMGWPLVGETLNAMSPSYSIDLHPFFKKRLQKYGPIFRTS  76

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH----GDSHKYLRN  399
            + G+ ++VS D + N ++FQQEGKLV  WY +S  +I     F V         HKY+R+
Sbjct  77   LAGKPIVVSADPKFNSYLFQQEGKLVELWYMDSFTKI-----FKVSEEIKVAVVHKYIRS  131

Query  400  LALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEK  579
            +ALN +G E LK+ LL  +++T  + L  W++ +++++K AT +ML    A  ++ YD +
Sbjct  132  VALNHLGAETLKEKLLPLIEKTVVKTLASWSSQASVEVKHATSVMLLNFGAKHLIGYDAE  191

Query  580  KAME  591
             + +
Sbjct  192  TSSD  195



>ref|XP_011025040.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=479

 Score =   216 bits (551),  Expect(2) = 7e-94, Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 160/252 (63%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + ++ +  +++  + ER +S  K+    DFLD  L+++  E+ FLTE    ++ 
Sbjct  225   TFHKCMKDKEKMSNMVRHIIKERFNSPDKRPG--DFLDQALNDMASEK-FLTEDFIAELS  281

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FAA+E+ S+  TLA+KFL ++P VL++L  E+E ++  RE+ ++ ++W EY++M F
Sbjct  282   FGILFAAFESVSTTLTLAIKFLAENPLVLEELTAENEAVLKKRENPDAPLSWEEYKTMAF  341

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T  V+NET+RL +I P + RK ++D  +KGYTIP GW  M+    VHL+ E Y DPL FN
Sbjct  342   TQSVVNETLRLMNIPPGLLRKALKDINVKGYTIPAGWTIMLVTPIVHLNPETYKDPLKFN  401

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGAEF+K+ MA  LH LVTKY+W  V  G I R 
Sbjct  402   PWRWKDLDQVTLSKSFMPFGGGTRQCAGAEFSKVYMASFLHVLVTKYRWSKVKGGRITRS  461

Query  1323  PGLTFLDGFKVQ  1358
             P L F DG  V+
Sbjct  462   PILLFPDGVHVK  473


 Score =   157 bits (396),  Expect(2) = 7e-94, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 120/199 (60%), Gaps = 6/199 (3%)
 Frame = +1

Query  7    MTWLVMYLISFLVIAIAHWVYRWRNPKCKGL---LPPGSMGFPIIGESIQFFT-SHSLQG  174
            M  +V+ L++  VI   H + +W+ PK  G+   LPPGSMG P+IGE+IQ    S++   
Sbjct  1    MFEIVLVLVALFVIYYTHLLIKWKYPKINGVPVHLPPGSMGLPVIGETIQLLIPSYNSID  60

Query  175  IPPFIQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQ  354
            I PFI++R+ RYG +FRT++VG+ +IVS D E+N +IF QEG LV  WY +S A++   +
Sbjct  61   IHPFIRKRIQRYGPIFRTNLVGRPIIVSADPEVNKYIFSQEGNLVEMWYLDSFAKLFAFE  120

Query  355  G--FMVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATE  528
            G   +   G  H+YLR + LN  G E+L++ +L ++D +   +L  W+    +D+K A  
Sbjct  121  GESKVTAIGRVHRYLRGITLNHFGGESLREKMLPQIDASVNDNLRQWSTQGAVDVKSAIS  180

Query  529  IMLFKLAASKVLSYDEKKA  585
             M+F   A     YD + +
Sbjct  181  RMIFNFTAKVAFGYDHENS  199



>ref|XP_011025045.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=473

 Score =   218 bits (555),  Expect(2) = 8e-94, Method: Compositional matrix adjust.
 Identities = 105/252 (42%), Positives = 165/252 (65%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             SFH   + R+ ++KL+K+TL ER +   K++   DFLD  + ++ K + FLT      ++
Sbjct  220   SFHKCMQEREKMLKLLKDTLMERLNDPSKRRG--DFLDQAIDDM-KTKKFLTVDFIPQLM  276

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               ++FA++E+ S+  TL  KFL ++P V+++L+ EHE I+  RE+  S +TW EYRSM F
Sbjct  277   FGILFASFESMSTTLTLTFKFLTENPRVVEELRAEHEAIVKKRENPNSRLTWEEYRSMTF  336

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T MV+NET+R+++I P +FRK ++DF+ KGYT+P GW  MI   ++ L+ + Y DP++FN
Sbjct  337   TQMVVNETLRISNIPPGLFRKALKDFQFKGYTVPAGWTVMIVTPAIQLNPDTYKDPVTFN  396

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW   +    SK FM FGG  R CAGA+++KL ++  LH L+T Y +  V  G++ R 
Sbjct  397   PWRWRDLDQVTISKNFMPFGGGTRQCAGADYSKLVLSTFLHVLLTSYSFTKVKGGDVSRT  456

Query  1323  PGLTFLDGFKVQ  1358
             P ++F DG  ++
Sbjct  457   PIISFGDGIHIK  468


 Score =   155 bits (392),  Expect(2) = 8e-94, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 122/192 (64%), Gaps = 3/192 (2%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + +++ +VI   H +++WR+PK  G+LPPGSMG+P+IGE++QF        + PF+++R+
Sbjct  6    LVVVALVVIYYTHLLFKWRSPKI-GVLPPGSMGWPLIGETLQFIIPGKSLDLHPFVKKRM  64

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--G  375
             +YG +F+TS+VG+ +IVSTD E+N +I Q EG LV  WY +S A+    +G    +  G
Sbjct  65   QKYGPIFKTSLVGRPIIVSTDYEMNKYILQHEGTLVELWYLDSFAKFFNLEGETRVNAIG  124

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYLR++ +N  G E+LK++LL +++      L  W +   +D+KQ   +M+F   A+
Sbjct  125  AVHKYLRSITVNHFGVESLKESLLPKIEDMLHTTLAKWASQGPVDVKQVISVMVFNFTAN  184

Query  556  KVLSYDEKKAME  591
             +  YD + + E
Sbjct  185  IIFGYDAENSKE  196



>ref|XP_002865585.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41844.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=477

 Score =   229 bits (584),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 163/246 (66%), Gaps = 4/246 (2%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
              R++ +++IK+    R++S   ++   DFLD ++ E +KEE    E+ A+++I  ++  A
Sbjct  230   ARRDALQVIKDVFMRRKAS---REMCGDFLDTMVEEGEKEEVIFNEEGAINLIFAILVVA  286

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRS-MKFTHMVIN  980
              E+TSS T+LA+KFL ++   L +L+ EHE I+  R DKE+ + W EYR  M FT+MVIN
Sbjct  287   KESTSSVTSLAIKFLAENHKALAELKREHEAILQNRNDKEAGVGWEEYRHHMTFTNMVIN  346

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+R+A++AP ++RK V D EIKGYTIP GW+  + P +VH + E Y++PL FNP RW G
Sbjct  347   ETLRMANMAPIMYRKAVNDVEIKGYTIPAGWIVAVIPPAVHFNHEIYENPLEFNPWRWEG  406

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +EL   SK FM FGG  R C G EFA+L ++I +H+LVTKY + +  E + +R P   F 
Sbjct  407   KELRSGSKTFMVFGGGVRQCVGTEFARLQISIFIHHLVTKYDFSLAQEFDFIRAPLPHFP  466

Query  1341  DGFKVQ  1358
              G  ++
Sbjct  467   KGLPIK  472


 Score =   143 bits (360),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 103/171 (60%), Gaps = 0/171 (0%)
 Frame = +1

Query  55   AHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSI  234
            + W+YRW NPKC G LPPGSMG PIIGE+  FF  H L  I PF+++R+ +YG LFRT+I
Sbjct  20   SKWLYRWSNPKCNGKLPPGSMGLPIIGETCNFFEPHGLYEISPFVKKRMLKYGPLFRTNI  79

Query  235  VGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNL  414
             G   +V T+ +I   +F+QE K     Y E+  +  G +   + HG+ HK+++ ++L  
Sbjct  80   FGSNTVVLTEPDIIFEVFRQENKSFVFSYPEAFVKPFGKENVFLKHGNIHKHVKQVSLQH  139

Query  415  VGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
            +G E LK+ L+ E+D+   +HL    +  + + K+  E ++      K++S
Sbjct  140  IGSEALKKKLIGEIDRVTYEHLKSKASQGSFNAKETVESLIMAHLTPKIIS  190



>ref|XP_008382414.1| PREDICTED: cytochrome P450 87A3-like [Malus domestica]
Length=477

 Score =   211 bits (536),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 157/246 (64%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +G+K V  ++++ L ERR +  + +++ DF+  + +++DKE+ FL+E   V ++   IF 
Sbjct  229   QGQKAVTTMLRDMLRERRHATSETRRE-DFIGQISNDMDKEK-FLSEDFVVQLMFAGIFN  286

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A E+ S    LA+  L +HP  L++L  EHE I+  R+D  SS+TW+EY+SM FT  V+N
Sbjct  287   A-ESISPVLALAITLLTEHPSALQELTAEHEAILKNRKDPNSSLTWDEYKSMNFTLQVVN  345

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+RL + AP +FR+ V+D  + G+TIP GW  ++  S++HL+   + +P  FNP RW  
Sbjct  346   ETIRLINSAPGLFRRTVKDITVNGFTIPAGWSLILASSALHLNPNIFKEPAEFNPWRWKD  405

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              +    SK F AFGG  R C+GAE++K  +AI LH LVTKYKW +  +  IVR P L F 
Sbjct  406   LDSDTISKNFKAFGGGMRQCSGAEYSKAFLAICLHVLVTKYKWAMTKKAKIVRNPTLGFG  465

Query  1341  DGFKVQ  1358
             DG  ++
Sbjct  466   DGIHIK  471


 Score =   160 bits (406),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 124/203 (61%), Gaps = 3/203 (1%)
 Frame = +1

Query  25   YLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVT  204
            +L+S +VI I  W+ +WR PKC G LPPGSMG P IGE++          + PFI++RV 
Sbjct  9    FLVSLVVIFITPWIXKWRYPKCNGALPPGSMGLPFIGETLSLIIPSYSHDLLPFIKKRVR  68

Query  205  RYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--GD  378
            RYG +FRTS+  + V++STD E N +IF+Q+G+LV  WY ++ +++   +G    +  G 
Sbjct  69   RYGPIFRTSLACRSVVISTDPEFNSYIFEQDGRLVEVWYLDTFSKVFDFEGDSRRNAAGI  128

Query  379  SHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASK  558
             HKY+  +     G E LK+ L+ ++++   Q L  W++ +++++K A+  M  +  A  
Sbjct  129  IHKYISRIFTKHFGAETLKEKLIAQIEEYVNQILRSWSSQASVEVKHASSAMYLEFTAKH  188

Query  559  VLSYD-EKKAMELRKYYKAFMEG  624
            ++ YD EK  + L + Y+ F++G
Sbjct  189  MVGYDVEKSPVNLAEKYRRFIDG  211



>ref|XP_008364406.1| PREDICTED: cytochrome P450 87A3-like [Malus domestica]
Length=477

 Score =   201 bits (512),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 147/238 (62%), Gaps = 3/238 (1%)
 Frame = +3

Query  645   LIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYETTSSA  824
             +++  + ERR S   +K + DFLD ++ ++D+E+ FL+E   V +I   +FA + T S+ 
Sbjct  236   MLRNMIRERRKS--PEKXRGDFLDQVIXDIDQEK-FLSEDFCVHMIFGGLFATFGTISTV  292

Query  825   TTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETVRLADI  1004
              TL    L  HP VL++L  EHE ++  RE+  S++TW+EY+SM FT  VINET+RL++ 
Sbjct  293   LTLLFSLLADHPAVLQELTAEHEALLKNRENPNSALTWDEYKSMTFTLQVINETLRLSNX  352

Query  1005  APAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQELHPASK  1184
              P +FR  ++D  + GYTIP GW  ++   ++HL+++ + D L FNP RW   +    SK
Sbjct  353   IPGLFRXALKDIPVNGYTIPAGWTILLVTPALHLTSDTFKDHLEFNPWRWKDLDSLVISK  412

Query  1185  KFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGFKVQ  1358
              FM FGG  R CAGAE+ +  ++  LH LVTKY+W  V    I R P L F DG  ++
Sbjct  413   NFMPFGGGLRQCAGAEYTRAFLSTFLHVLVTKYRWTTVKGARISRSPMLAFGDGAHIK  470


 Score =   169 bits (429),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 125/192 (65%), Gaps = 2/192 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            + L++ LVI + +W+ +WRNPKC G+LPPGSMG P+IGE++   T      + PF+++R+
Sbjct  7    LSLVALLVIYLTYWINQWRNPKCNGVLPPGSMGLPLIGETLSLLTPXYSLDLHPFLKKRL  66

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHH--G  375
             RYG +FRTS+VG+ V+VS D E N ++ QQEG++V  WY ++ ++I   +G    +  G
Sbjct  67   QRYGPIFRTSLVGKPVLVSADPEFNKYVIQQEGRMVELWYLDTFSKIFVXEGESXXNKIG  126

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKY R++ LN  G E +K+ LL ++++T  +HL  W++  ++++K A  +M    +A 
Sbjct  127  VIHKYXRSIFLNHFGXECIKEKLLPQIEETINKHLCAWSSQESVEVKNAXSVMXLNFSAQ  186

Query  556  KVLSYDEKKAME  591
             ++ YD K A E
Sbjct  187  HMIGYDAKTAPE  198



>ref|XP_009344155.1| PREDICTED: cytochrome P450 87A3-like [Pyrus x bretschneideri]
 ref|XP_009344166.1| PREDICTED: cytochrome P450 87A3-like [Pyrus x bretschneideri]
Length=476

 Score =   210 bits (534),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 153/243 (63%), Gaps = 3/243 (1%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             K    +++  L ERRSS   +K++ DFLD ++ ++D+E+ FL+E   + +I   +FA +E
Sbjct  231   KKATTMLRAMLRERRSS--PEKRRGDFLDQIIDDLDQEK-FLSEDFCIHLIFGGLFAIFE  287

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETV  989
             + S+  TL    L  HP VL++L  EHE ++  RED  S++TW+EY+SM FT  VINET+
Sbjct  288   SISTVLTLFFSLLADHPAVLQELTAEHEALLKNREDPNSALTWDEYKSMTFTLQVINETL  347

Query  990   RLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQEL  1169
             RL + AP + R+ ++D  +KGYTIP GW  ++   ++HL++  + D L FNP RW   + 
Sbjct  348   RLVNTAPGLLRRALKDIPVKGYTIPAGWTILLVTPALHLTSNTFKDHLEFNPWRWKDLDS  407

Query  1170  HPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGF  1349
                SK FM FG   R CAGAEF++  ++  LH LVTKY+W  +    I R+P LTF DG 
Sbjct  408   LVISKNFMPFGSGLRQCAGAEFSRAYLSTFLHVLVTKYRWTTIKGARISRRPMLTFGDGA  467

Query  1350  KVQ  1358
              ++
Sbjct  468   HIK  470


 Score =   161 bits (407),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 127/209 (61%), Gaps = 13/209 (6%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            +  ++ LVI + +W+ +W+NPKC G+LPPGSMG P+IGE++          + PFI++R+
Sbjct  7    LSFVALLVIYLTYWITQWKNPKCNGVLPPGSMGLPLIGETLNLLIPSYSLDLHPFIRKRL  66

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG +FRTS+ G+ V+VS D E N+++ +QEG++V  WY ++ ++I     FM   G+ 
Sbjct  67   ERYGPIFRTSLAGKPVLVSADPEFNNYVLKQEGRMVEFWYLDTFSKI-----FMQEGGNG  121

Query  382  -------HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLF  540
                   HKY R++ LN  G E +K+ LLT+++ +  +HL  W+   ++++K+A  IM  
Sbjct  122  TNQIGVIHKYARSIFLNHFGAECIKEKLLTQIEGSINKHLRAWSNQESVEVKKAGSIMAL  181

Query  541  KLAASKVLSYDEKKAME-LRKYYKAFMEG  624
               A  ++ YD + A E L + Y    +G
Sbjct  182  NFCAEHMIGYDAETATENLGEIYHRVFQG  210



>emb|CDY38927.1| BnaA04g13480D [Brassica napus]
Length=482

 Score =   216 bits (550),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 156/236 (66%), Gaps = 4/236 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + RK  +++IKE L +R+ S   +++  DFLD LL E++KE +   E   ++++  +   
Sbjct  232   KARKGAMQVIKEALKKRKES---REQHGDFLDTLLEEMEKEGSIYDEASVINLLLTIGVI  288

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVI  977
             + +TTS AT L +  L ++P VL +L+ EHE I+  REDKE+ ++W EY+ +M FT+MVI
Sbjct  289   SKDTTSVATALMVNLLFKNPKVLTELKREHEAILQKREDKEAGVSWEEYKYNMTFTNMVI  348

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NE++RL+++   +FRK ++D EIKGYTIP GW+  + PS VH +++ Y+ PL FNP RW 
Sbjct  349   NESLRLSNLGSILFRKALKDVEIKGYTIPAGWIVAVAPSVVHYNSQIYEKPLDFNPWRWE  408

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKP  1325
             G++L   +K  M FGG  R C GA+FAKL M + LH+LVT Y + VV    + R P
Sbjct  409   GKDLRSVTKTLMVFGGGTRQCVGADFAKLQMTVFLHHLVTTYDFSVVQACEMTRTP  464


 Score =   154 bits (390),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 119/200 (60%), Gaps = 5/200 (3%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNP--KCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            +I+ +V+ I+HW+Y+W NP  +C G LPPGSMGFP+IGE++ FF       IP F Q R+
Sbjct  12   VIALVVVRISHWLYQWSNPNVRCSGKLPPGSMGFPLIGETVDFFKPCGFLEIPSFFQNRM  71

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYGSLFRT+I+G K ++ TDS++   IF+QE +     Y +   ++ G        GD 
Sbjct  72   QRYGSLFRTNIMGSKTVICTDSDVIFEIFRQENQSFEHSYPDVFVKVLGKDNLFFKTGDI  131

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            HK+L+   ++L+G E LK  ++  M+Q  RQHL+   +    D++ A   ++      K+
Sbjct  132  HKHLKKTTMHLIGSEGLKINMIRSMNQATRQHLNWKASEGTFDLRDAVSSLISSYMTPKL  191

Query  562  LSY--DEKKAMELRKYYKAF  615
            +S    E +A +L  ++KAF
Sbjct  192  ISNLKTEPRA-KLIDHFKAF  210



>gb|AIT72033.1| cytochrome P450 [Cucumis sativus]
 gb|KGN46393.1| hypothetical protein Csa_6G088710 [Cucumis sativus]
Length=481

 Score =   202 bits (515),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 147/245 (60%), Gaps = 3/245 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + +K ++   K  + ERR +     +  DFLD  L +++ E+ FLTE+   +++  ++FA
Sbjct  234   KAQKRLVNTFKALVKERRQASVAAARG-DFLDQALRDIENEQ-FLTEEFVSNLLFGVLFA  291

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             +  + S + TL  K L ++P V+K+L  EHE  +  R+D +S ITW EY+SM FT  VI 
Sbjct  292   S-GSISGSLTLMFKLLAENPSVVKELTAEHETFLKQRKDPKSPITWEEYKSMTFTLYVIY  350

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  RL++  P + R+  +D  IKGYTIP GW  M+  S++HL+ + + DPL FNP RW  
Sbjct  351   EVFRLSNAMPFLLRRTTKDVNIKGYTIPAGWTIMVANSALHLNPQTHKDPLDFNPWRWKD  410

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              + +  SK    FGG  R CAGA++ ++ MAI LH LVTKY WK V  G + R P L F 
Sbjct  411   HDQYSISKTLQPFGGGTRQCAGADYTRVFMAIFLHTLVTKYSWKKVKGGEVSRSPILKFG  470

Query  1341  DGFKV  1355
             DG  V
Sbjct  471   DGIHV  475


 Score =   168 bits (426),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 121/188 (64%), Gaps = 2/188 (1%)
 Frame = +1

Query  34   SFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG  213
            + +VI + + V+RWRNPKC G+LPPGSMGFP+IGE++Q   S     +PPFI++RV +YG
Sbjct  17   ALVVIGLTYLVHRWRNPKCNGVLPPGSMGFPLIGETLQLIASGYTLDLPPFIKKRVHKYG  76

Query  214  SLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFM--VHHGDSHK  387
             +FRTS+VG+ ++V+ D EIN FI+ QEG+ V  WY +S +++    G +     G  HK
Sbjct  77   PIFRTSLVGRSIVVTADPEINSFIYNQEGRTVELWYLDSISKVFKQDGEVKTTAGGAIHK  136

Query  388  YLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
            YLR++ LN  G E+LK  LL ++ +   +    W+   ++++++ T  ML+   A  +  
Sbjct  137  YLRSITLNHFGSESLKSKLLADIQRYVDKVFTQWSNHPSVEMQRGTLTMLYDFNAYIMFG  196

Query  568  YDEKKAME  591
            YD +K+ E
Sbjct  197  YDPEKSNE  204



>ref|XP_009344797.1| PREDICTED: cytochrome P450 87A3-like [Pyrus x bretschneideri]
Length=476

 Score =   211 bits (536),  Expect(2) = 5e-93, Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 153/243 (63%), Gaps = 3/243 (1%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             K    +++  L ERRSS   +K++ DFLD ++ ++D+E+ FL+E   + +I   +FA +E
Sbjct  231   KKATTMLRAMLRERRSS--PEKRRGDFLDQIIDDLDQEK-FLSEDFCIHLIFGGLFAIFE  287

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETV  989
             + S+  TL    L  HP VL++L  EHE ++  RED  S++TW+EY+SM FT  VINET+
Sbjct  288   SISTVLTLFFSLLADHPAVLQELTAEHEALLKNREDPNSALTWDEYKSMTFTLQVINETL  347

Query  990   RLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQEL  1169
             RLA+ AP + R+ ++D  +KGYTIP GW  ++   ++HL++  + D L FNP RW   + 
Sbjct  348   RLANTAPGLLRRALKDIPVKGYTIPAGWTILLVTPALHLTSNTFKDHLEFNPWRWKDLDS  407

Query  1170  HPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGF  1349
                SK FM FG   R CAGAEF++   +  LH LVTKY+W  +    I R+P LTF DG 
Sbjct  408   LVISKNFMPFGSGLRQCAGAEFSRAYFSTFLHVLVTKYRWTTIKGARISRRPMLTFGDGA  467

Query  1350  KVQ  1358
              ++
Sbjct  468   HIK  470


 Score =   159 bits (403),  Expect(2) = 5e-93, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 126/209 (60%), Gaps = 13/209 (6%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            +  ++ LVI + +W+ +W+NPKC G+LPPGSMG P+IGE++          + PFI++R+
Sbjct  7    LSFVALLVIYLTYWITQWKNPKCNGVLPPGSMGLPLIGETLNLLIPSYSLDLHPFIRKRL  66

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYG +FRTS+ G+ V+VS D E N+++ +QEG++V  WY ++ ++I     FM   G+ 
Sbjct  67   ERYGPIFRTSLAGKPVLVSADPEFNNYVLKQEGRMVEFWYLDTFSKI-----FMQEGGNG  121

Query  382  -------HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLF  540
                   HKY R++ LN  G E +K+ LLT+++ +  +HL  W+   ++++K+   IM  
Sbjct  122  TNQIGVIHKYARSIFLNHFGAECIKEKLLTQIEGSINKHLRAWSNQESVEVKKTGSIMAL  181

Query  541  KLAASKVLSYDEKKAME-LRKYYKAFMEG  624
               A  ++ YD + A E L + Y    +G
Sbjct  182  NFCAEHMIGYDAETATENLGEIYHRVFQG  210



>ref|XP_010092748.1| Cytochrome P450 87A3 [Morus notabilis]
 gb|EXB52093.1| Cytochrome P450 87A3 [Morus notabilis]
Length=407

 Score =   268 bits (684),  Expect(2) = 5e-93, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 174/246 (71%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + R N+ K IK+   ER++S   K K  DFL  LL E+ KE+  ++E +A D+I  ++F 
Sbjct  159   QARDNIRKAIKDIFEERKAS---KMKHGDFLYCLLEEMRKEDNIMSEALARDIIFGILFG  215

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              YET+  A T+ +KFL+QHP V+ +L++EHE II +R  ++S ITW+EY+SM FTHMVIN
Sbjct  216   TYETSRLAMTMLVKFLSQHPEVVAELKKEHEAIIESRGFEKSEITWDEYKSMTFTHMVIN  275

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+RL +I P IFRKVV+D +IKGYTIP GWM MI  + +HL  +KYDDPL+FNP RW G
Sbjct  276   ETIRLGNILPGIFRKVVKDVQIKGYTIPAGWMVMINTTVLHLDPDKYDDPLTFNPWRWGG  335

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +E+  +SK FM FG   RLC GA+ AKL MAI LHYLV  Y+W+    G+I+R+P L F 
Sbjct  336   KEMTKSSKTFMGFGLNPRLCLGADLAKLQMAIFLHYLVLNYRWEFAKGGDIIRRPWLEFP  395

Query  1341  DGFKVQ  1358
             +G  ++
Sbjct  396   NGLHIK  401


 Score =   102 bits (255),  Expect(2) = 5e-93, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 93/185 (50%), Gaps = 50/185 (27%)
 Frame = +1

Query  88   CKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVGQKVIVSTDS  267
              G LPPGSMGFP +GE+I+F  +     +PPF+Q+R+ R                    
Sbjct  9    ANGKLPPGSMGFPFVGETIEFILNREAIRVPPFVQKRLAR--------------------  48

Query  268  EINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVGPENLKQTLL  447
               H+                  +IT P       G   KY++NL L L+G ENLK+TLL
Sbjct  49   ---HY------------------KITTP-------GALFKYMKNLVLPLIGSENLKRTLL  80

Query  448  TEMDQ-TARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDE-KKAMELRKYYKAFME  621
             E+++ T R+H+  W +   +D+ +AT  M+ +  A +V+SYDE K A  L++ Y AF+ 
Sbjct  81   REINESTTRRHVQSWASHDVVDVTEATSTMILEYIAKRVISYDESKDARNLKENYNAFVR  140

Query  622  GDVKM  636
            G V +
Sbjct  141  GIVSI  145



>ref|XP_011025042.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=476

 Score =   221 bits (563),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 104/243 (43%), Positives = 165/243 (68%), Gaps = 3/243 (1%)
 Frame = +3

Query  630   KNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYE  809
             K ++K++K+TL ER +   K++   DFLD  + +++ ++ FLT      +I  ++FA+YE
Sbjct  231   KKMMKILKDTLIERLNDPSKRRG--DFLDQAIDDLETKK-FLTVDFIPQLIFGILFASYE  287

Query  810   TTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETV  989
             + SS  TLA+KFL+++P V+++L  EH+ I+  RE+  SS+ W EYRSM FT MV+NET+
Sbjct  288   SISSTLTLAIKFLSENPQVVEKLTAEHQTILKNRENPNSSLAWEEYRSMTFTQMVVNETL  347

Query  990   RLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQEL  1169
             R++++ P I R+ ++DF++KGYTIP GW  ++   ++ L+ E + DPL+F+P RW   + 
Sbjct  348   RISNLPPGIIRRALKDFQVKGYTIPSGWTVLLATPAIQLNPETFKDPLTFDPCRWKDLDQ  407

Query  1170  HPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGF  1349
                SK F+ FGG  R CAGAEF+KL M+  LH LVTKY++  V  G++ R P ++F DG 
Sbjct  408   VTISKNFIPFGGGTRHCAGAEFSKLIMSTFLHVLVTKYRFAKVKGGDVSRNPVMSFGDGI  467

Query  1350  KVQ  1358
              ++
Sbjct  468   HIK  470


 Score =   149 bits (376),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 122/198 (62%), Gaps = 8/198 (4%)
 Frame = +1

Query  22   MYLISFLVIAI-----AHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M+ I FLV+A+      H + +WRNPK  G+LPPGSMG+P+IGE++QF        + PF
Sbjct  1    MWTIGFLVVAVAVVYYTHLISKWRNPKIDGVLPPGSMGWPLIGETLQFIIPGRSIDLHPF  60

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG--F  360
            +++R+ +YG +F+TS++G+  ++STD+E+N +I Q EG LV  WY +S A+    +G   
Sbjct  61   VKKRMHKYGPIFKTSLLGKPTVISTDNEVNKYILQHEGTLVELWYLDSFAKFFALEGENR  120

Query  361  MVHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLF  540
            +   G+ H+Y R++ LN  G E+L+++LL +++      L  W     +D+KQA  +M+F
Sbjct  121  VSAVGEVHRYTRSITLNHFGVESLRESLLPKIENIINTTLAKWATQGPVDMKQAIAVMVF  180

Query  541  KLAASK-VLSYDEKKAME  591
               A + V  YD   + E
Sbjct  181  NFTAKEIVFGYDAANSKE  198



>ref|XP_009140448.1| PREDICTED: cytochrome P450 708A2-like [Brassica rapa]
Length=489

 Score =   217 bits (552),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 160/236 (68%), Gaps = 4/236 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + R+  ++LIKE L +R+ S   ++K  DFLD LL +++KE++   E   ++++ ++   
Sbjct  231   KARREAMQLIKEALKKRKES---REKHGDFLDTLLEDMEKEDSIYDEASVINLLLVIGVV  287

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVI  977
             + +TTS AT L +  L+++P VL +L+ EH  I+  R+DKE+ ++W EY+ +M FT+MVI
Sbjct  288   SKDTTSVATALMVNLLSKNPEVLAELKREHGAILQKRKDKEAELSWEEYKYNMTFTNMVI  347

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NE++RL+++   +FRK ++D EIKGYTIP GW+  + PS VH ++E Y++PL FNP RW 
Sbjct  348   NESLRLSNLGSILFRKALKDVEIKGYTIPAGWIVAVAPSVVHYNSEIYENPLEFNPWRWE  407

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKP  1325
             G++L   +K  M FGG  R C GA+FA+L M + LH+LVT Y + VV E  + R P
Sbjct  408   GKDLRSVTKTLMVFGGGTRQCVGADFARLQMTVFLHHLVTTYDFLVVQECEMTRTP  463


 Score =   153 bits (387),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 117/201 (58%), Gaps = 3/201 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNP--KCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQ  195
            + +I+ +V+ I+ W+YRW NP  +C G LPPGSMGFPIIGE+I+FF    L  IP F Q 
Sbjct  9    ILIIALVVVRISQWLYRWSNPNVRCNGKLPPGSMGFPIIGETIEFFKPCELLEIPSFFQN  68

Query  196  RVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHG  375
            R+ RYGSLFR++I+G K ++STDS++   IF+QE +     Y +   ++ G        G
Sbjct  69   RMQRYGSLFRSNIMGSKTVISTDSDVIFEIFRQENQSFELSYPDVFVRVFGKDNLFFQTG  128

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
            + HK+++   + L+G E LK+ ++  M+Q  R+ L         D++ A   ++      
Sbjct  129  NIHKHIKKSTMQLIGSEGLKRKMIQSMNQATREQLKWKANEGTFDLRNAVSSLIASYLTP  188

Query  556  KVLS-YDEKKAMELRKYYKAF  615
            K++S    +   EL  ++KAF
Sbjct  189  KLISNLKPETQAELIDHFKAF  209



>ref|XP_010237177.1| PREDICTED: cytochrome P450 87A3-like, partial [Brachypodium distachyon]
Length=415

 Score =   258 bits (658),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 176/248 (71%), Gaps = 4/248 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK V+K++ + L+ER+ + ++++   DF+D L+  + +E+  ++E  A+++I +L+FA
Sbjct  165   QGRKEVMKILNKLLDERKKAARQERV--DFIDLLIDVLTEEKPAMSENFALNLIFLLLFA  222

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +ETTSS  T A+KFL  +P VL++L +EH+ I   R   +S ITW EY+SMKFT  VI+
Sbjct  223   GFETTSSGITAAVKFLTDNPKVLQELTDEHDNIRKRRASPDSEITWEEYKSMKFTSYVIH  282

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E++RLA+IAP +F++  +D  IKGYTIP G   M+CPS+VHL+   Y DP +FNP RW  
Sbjct  283   ESLRLANIAPVLFKRAREDVHIKGYTIPEGSKVMVCPSAVHLNPTIYKDPEAFNPWRWKD  342

Query  1161  --QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLT  1334
               + L  ASK FMAFGG  RLC GA+FAKL MA+ LHYLVTKY+WK +  G++V  PGL 
Sbjct  343   TVEPLGGASKNFMAFGGGLRLCVGADFAKLQMAVFLHYLVTKYRWKAIKGGSVVFSPGLR  402

Query  1335  FLDGFKVQ  1358
             F DGF +Q
Sbjct  403   FPDGFHIQ  410


 Score =   111 bits (278),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = +1

Query  205  RYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSH  384
            RYG +F T+++ + ++VS DSE+N+ +FQQ+ KL   W+ ES  +I G +  +   G  H
Sbjct  7    RYGPIFTTNLIHEDLVVSLDSELNNLVFQQDEKLFENWWPESVMRIIGAESIIPTMGSFH  66

Query  385  KYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVL  564
            K+ + L L L GPENL+Q LL ++ +TA   L  W    ++++K+AT  M+F + A K++
Sbjct  67   KHAKTLILRLFGPENLRQVLLHDVQRTAHASLLSWLNQPSIELKEATSSMIFSVTAKKLI  126

Query  565  SYDEKKAM-ELRKYYKAFMEG  624
            SYD   +  +L K++ AF++G
Sbjct  127  SYDSSNSDGKLWKHFDAFLQG  147



>ref|XP_009140449.1| PREDICTED: cytochrome P450 708A2-like [Brassica rapa]
Length=482

 Score =   213 bits (542),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 155/236 (66%), Gaps = 4/236 (2%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + RK  +++IKE L +R+ S   +++  DFLD LL E++KE +   E   ++++  +   
Sbjct  232   KARKGAMQVIKEALKKRKES---REQHGDFLDTLLEEMEKEGSIYDEASVINLLLTIGVI  288

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVI  977
             + +TTS AT L +  L ++P VL +L+ EHE I+  REDKE+ ++W +Y+ +M FT+MVI
Sbjct  289   SKDTTSVATALMVNLLFKNPKVLTELKREHEAILQKREDKEAGVSWEDYKYNMTFTNMVI  348

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NE++RL+++   +FRK ++D EIKGY IP GW+  + PS VH +++ Y+ PL FNP RW 
Sbjct  349   NESLRLSNLGSILFRKALKDVEIKGYIIPAGWIVAVAPSVVHYNSQIYEKPLDFNPWRWE  408

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKP  1325
             G++L   +K  M FGG  R C GA+FAKL M + LH+LVT Y + VV    + R P
Sbjct  409   GKDLRSVTKTLMVFGGGTRQCVGADFAKLQMTVFLHHLVTTYDFSVVQACEMTRTP  464


 Score =   156 bits (394),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 120/200 (60%), Gaps = 5/200 (3%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNP--KCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRV  201
            +I+ +V+ I+HW+Y+W NP  +C G LPPGSMGFP+IGE++ FF       IP F Q R+
Sbjct  12   VIALVVVRISHWLYQWSNPNVRCSGKLPPGSMGFPLIGETVDFFKPCGFLEIPSFFQNRM  71

Query  202  TRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDS  381
             RYGSLFRT+I+G K ++ TDS++   IF+QE +     Y +   ++ G        GD 
Sbjct  72   QRYGSLFRTNIMGSKTVICTDSDVIFEIFRQENQSFEHSYPDVFVKVLGKDNLFFKTGDI  131

Query  382  HKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKV  561
            HK+L+   ++L+G E LK  ++  M+Q  RQHL+   +    D++ A   ++     +K+
Sbjct  132  HKHLKKTTMHLIGSEGLKINMIRSMNQATRQHLNWKASEGTFDLRDAVSSLISSYMTTKL  191

Query  562  LSY--DEKKAMELRKYYKAF  615
            +S    E +A +L  ++KAF
Sbjct  192  ISNLKTESRA-KLIDHFKAF  210



>gb|AAO23096.1| putative hydroxylase [Oryza sativa Japonica Group]
 gb|EAY91252.1| hypothetical protein OsI_12867 [Oryza sativa Indica Group]
 gb|EAZ28003.1| hypothetical protein OsJ_11970 [Oryza sativa Japonica Group]
Length=401

 Score =   257 bits (656),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 173/248 (70%), Gaps = 3/248 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRKN++K++KE ++ER+ +  ++    DF+D LL E+++E+  ++E +A+D+I +L+FA
Sbjct  150   QGRKNIMKMLKELIDERKEASGRRGSI-DFIDVLLEELNEEKPLISENVALDLIFLLLFA  208

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ETT+SA T  ++FL  +P  L++L EEH+ I   R D  S ITW EY+SMKFT  VI+
Sbjct  209   SFETTASAITAVVRFLTDNPEALQELAEEHDNIQKRRVDLNSEITWEEYKSMKFTSHVIH  268

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW--  1154
             E +RLA+IAP +FRK  +D  IKG+ IP+G   MICPS+VHL+   Y DP  FNP RW  
Sbjct  269   EALRLANIAPVMFRKATEDVHIKGFFIPKGSKIMICPSTVHLNPMIYKDPNIFNPWRWKD  328

Query  1155  NGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLT  1334
               +    ASK FMAFGG  RLC GA+FAKL  AI LH LVTKY+WK +  G +V  PGL 
Sbjct  329   TAEPTGGASKDFMAFGGGLRLCVGADFAKLQTAIFLHCLVTKYRWKAIKGGTMVLGPGLR  388

Query  1335  FLDGFKVQ  1358
             F +GF +Q
Sbjct  389   FPEGFHIQ  396


 Score =   112 bits (279),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 82/132 (62%), Gaps = 1/132 (1%)
 Frame = +1

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALN  411
            +VGQ +IV  D E+N F+FQQE +L  CWY +S  +I G    +   G SHKY+RNL L 
Sbjct  1    MVGQDLIVCLDPEVNSFVFQQEERLFQCWYPDSFMRIIGADNIITTLGSSHKYIRNLILR  60

Query  412  LVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAM-  588
            L GPENL++ +L ++ +TA+  L  W    ++++K A   M+F + A K++SYD   +  
Sbjct  61   LFGPENLRRAMLQDVHRTAQASLLSWLDRPSIELKDAVSSMIFSVTAKKLISYDSLASDG  120

Query  589  ELRKYYKAFMEG  624
            ++ K + AF+ G
Sbjct  121  KMWKQFDAFIRG  132



>ref|XP_010027150.1| PREDICTED: cytochrome P450 87A3-like [Eucalyptus grandis]
 gb|KCW61506.1| hypothetical protein EUGRSUZ_H04234 [Eucalyptus grandis]
Length=474

 Score =   207 bits (528),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 154/246 (63%), Gaps = 3/246 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             + R+  + +I+ T+ +R SS    +   DFL +++ ++ KEE FLTE   V +I  L+F 
Sbjct  226   KDRRKALSIIRRTVKDRLSS--HGRLHDDFLCHVMQDMSKEE-FLTEDFLVQLIFGLLFV  282

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
              +++ S+  TLAL FL ++P  L+++ +EHE II  RE  +S ITW EY+SM FT  VI+
Sbjct  283   TFDSVSTTLTLALMFLEENPRALQEITDEHESIIKQREISKSPITWKEYKSMPFTLQVIH  342

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E++RL +I+P +FR+   D E  GYTIP  W  +I  S++HL+ E Y D L+FNP RW  
Sbjct  343   ESLRLGNISPGLFRRTKTDVEWNGYTIPAHWGVLIATSALHLNPETYKDHLTFNPWRWKE  402

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
              +     K FM FG   + CAGAE+ +  +++ LH LVTKY+W  V +GNI R P L+  
Sbjct  403   YDSDVMLKNFMPFGSGMKQCAGAEYTRALLSMFLHILVTKYRWTNVKKGNIRRNPILSLG  462

Query  1341  DGFKVQ  1358
             DG  ++
Sbjct  463   DGLHIK  468


 Score =   160 bits (405),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 125/208 (60%), Gaps = 7/208 (3%)
 Frame = +1

Query  22   MYLISFLVIAIA-----HWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPF  186
            M++I   V+A+A     HWVYRWRNPKC G+LPPGS+G P+IGE++Q         + PF
Sbjct  1    MWVIGTCVLALAIAWLGHWVYRWRNPKCNGVLPPGSLGLPLIGETLQLMVPGDSLDLVPF  60

Query  187  IQQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQG-FM  363
            ++ R+ RYG+ FRTS+ G+ +IVS D +  HF+ QQ GKL   W  ++ A++   +G   
Sbjct  61   LKDRIQRYGTTFRTSVAGRAIIVSADPKFCHFVLQQHGKLFESWALDTFAKLFAQEGKAS  120

Query  364  VHHGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFK  543
            ++  + HKY+R   L   G E LK+ LL  M++ ++  +  W    ++D+K AT  M  +
Sbjct  121  LNVTNVHKYIRGTVLKHFGMEALKERLLPLMEEVSQATITSWLGKESIDVKYATGTMAIE  180

Query  544  LAASKVLSYD-EKKAMELRKYYKAFMEG  624
             +A  + S+D  + + +L   Y +F++G
Sbjct  181  FSAKLLFSHDPTQSSKKLGDLYSSFIQG  208



>emb|CBI38409.3| unnamed protein product [Vitis vinifera]
Length=504

 Score =   206 bits (524),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 159/252 (63%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + +K  +K+++E ++ER +S   + ++ DFLDY L E  K+E F+T+     V+
Sbjct  233   TFHKCLKNQKKTMKILREIVDERCAS--PEIRRGDFLDYFL-EGMKKEAFITKDFIAFVM  289

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               L+FA++E+     +LALK + +HP VL++L+ EHE I+  ++    ++TW +Y+SM F
Sbjct  290   FGLLFASFESIPIMLSLALKLIMEHPLVLQELKNEHEAILRNKDTSNFTLTWEDYKSMTF  349

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T  VI+ET+R+A++    FRK ++D +IKG+TIP GW  ++  S +H+    Y DPL FN
Sbjct  350   TLHVIDETLRMANVGLGNFRKALEDIKIKGHTIPAGWTILVVSSVLHMDPNIYPDPLVFN  409

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW        +K F  FGG  R C GAE +KL MAI LH  VTKY++  +  GN+VR 
Sbjct  410   PWRWKDGRSKITTKNFTPFGGGIRFCPGAELSKLTMAIFLHVAVTKYRFTKIKGGNLVRN  469

Query  1323  PGLTFLDGFKVQ  1358
             P L F DGF ++
Sbjct  470   PVLKFKDGFHIK  481


 Score =   162 bits (409),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 123/194 (63%), Gaps = 2/194 (1%)
 Frame = +1

Query  16   LVMYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQ-GIPPFIQ  192
            L + ++S ++I I +W+ RW+NP+C   LPPGS+GFP+IGESIQF  S S    + PF +
Sbjct  16   LSLCVVSLVIIWITYWIRRWKNPRCNVTLPPGSLGFPLIGESIQFLISCSNSLDLHPFFR  75

Query  193  QRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITG-PQGFMVH  369
            +R+ +YG LF+TS++G++V+V+ D E NHFI +QEGK V   Y +S AQ+ G  +     
Sbjct  76   KRIQKYGPLFKTSMLGRQVVVTADPEANHFILEQEGKSVEMCYLDSVAQLCGHDESSAGA  135

Query  370  HGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLA  549
             G  HKYLR L LN  G E L+  LL +++  A + L  W++  ++++ +AT  ++    
Sbjct  136  TGHIHKYLRTLILNHFGYERLRYKLLKKVEAMAHKSLGAWSSQPSVELNRATSQIMLDFI  195

Query  550  ASKVLSYDEKKAME  591
            + ++ SYD K   E
Sbjct  196  SKELFSYDPKGCTE  209



>ref|XP_008235974.1| PREDICTED: cytochrome P450 87A3-like, partial [Prunus mume]
Length=486

 Score =   207 bits (528),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 149/241 (62%), Gaps = 3/241 (1%)
 Frame = +3

Query  636   VIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAAYETT  815
             +  ++++ L +RR S      + DFLD + S++DKE+ FL+E+  V V+  ++FA +E  
Sbjct  245   ITTMLRDILKKRRMS--PDTHRGDFLDQISSDMDKEK-FLSEEFVVYVVFGILFAGFEPV  301

Query  816   SSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVINETVRL  995
             SS   LA   L +HP  LK+L  E+E ++  RE+  SS+TW+EY+SM FT  V+NET+RL
Sbjct  302   SSVMALAFSLLAEHPAALKELTAENEALLKNRENPNSSLTWDEYKSMTFTRQVVNETLRL  361

Query  996   ADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNGQELHP  1175
              ++ PA+ R+ ++D  +KG+TIP G   M   S++ LS   + DPL FNP RW   +   
Sbjct  362   GNVVPALLRRALKDIPVKGFTIPAGSTIMALTSALQLSPNTFKDPLEFNPWRWKDLDSLV  421

Query  1176  ASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFLDGFKV  1355
              SK FM+FG   R CAGAE+ ++ +A  LH LVTKY+W  +    I R P L F DG  +
Sbjct  422   ISKNFMSFGRGSRQCAGAEYTRVFLATFLHVLVTKYRWTTIKGARIARNPMLGFRDGILI  481

Query  1356  Q  1358
             +
Sbjct  482   K  482


 Score =   160 bits (404),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 117/180 (65%), Gaps = 0/180 (0%)
 Frame = +1

Query  52   IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            I HW+ +WRNPKC G+LPPGSMG+P++GE++   T      + PF+++R+ +YG +FRTS
Sbjct  31   ITHWIKQWRNPKCNGVLPPGSMGWPLVGETLNAMTPSYSLDLHPFVKKRLQKYGLIFRTS  90

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALN  411
            +VG+ ++VS D E N ++FQQEGKLV     +S  +I    G +      HKY+R++ LN
Sbjct  91   LVGRPIVVSADPEFNSYLFQQEGKLVELGLLDSFTKIFKFSGDVTASSIVHKYIRSITLN  150

Query  412  LVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME  591
              G E LK+ L+  +++T  + L  W++ +++++K A+ +ML    A +++ YD + + +
Sbjct  151  HFGAETLKEKLVPLIEKTVVKTLASWSSQASVEVKHASSVMLLNFGAKRMIGYDAETSSD  210



>ref|XP_002875500.1| hypothetical protein ARALYDRAFT_905214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51759.1| hypothetical protein ARALYDRAFT_905214 [Arabidopsis lyrata subsp. 
lyrata]
Length=474

 Score =   206 bits (524),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 150/246 (61%), Gaps = 9/246 (4%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
             GRK  +K+I +    R+ S +      DFL  +L     E+    EK  +D I +L  A 
Sbjct  230   GRKAAMKMINDVFVSRKESGENHG---DFLSTML-----EDDRFNEKAIMDHIFVLPVAG  281

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVIN  980
              +  S+  +LA+ F+ ++P VL +L+ EH+ I+  R+D+ S ITW EYR +M FT+MVI 
Sbjct  282   KDAISTVVSLAVNFITKNPKVLSELKREHKAILQNRDDENSGITWEEYRHNMTFTNMVIK  341

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+R+A++AP +FRK + D EIKGYTIP GWM ++  S +H     Y++P  FNP RW G
Sbjct  342   ETLRMANVAPVMFRKALNDVEIKGYTIPAGWMVVVASSVIHYDHTIYENPFEFNPWRWEG  401

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +EL   SK FM FGG  R C GAEFA+L +AI +H LVT Y + +V +  + R P  +F 
Sbjct  402   KELLNGSKTFMVFGGGVRSCIGAEFARLQIAIFIHNLVTNYDFSMVQDCEVTRTPLPSFP  461

Query  1341  DGFKVQ  1358
             +G  + 
Sbjct  462   NGVHIN  467


 Score =   161 bits (407),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 0/180 (0%)
 Frame = +1

Query  28   LISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTR  207
            + + +VI I  W YRW NP+C G LPPGSMGFPIIGE+I FF  H L  I PF+++R+ R
Sbjct  11   VTALVVIVITKWWYRWSNPQCNGKLPPGSMGFPIIGETIDFFKPHGLLEILPFVKKRMLR  70

Query  208  YGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHK  387
            YG LFRT+I G   +V+TD ++ + IF+QE K       ++  +I G    +  HGD+HK
Sbjct  71   YGPLFRTNIFGTNTVVATDPDVIYEIFRQENKSFVFSLPDNFLKIFGKDNLLSEHGDAHK  130

Query  388  YLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
            + + + LN +G E LK  ++ +MD+  R+ L    +L + D+K+A   ++      K++S
Sbjct  131  HAKQITLNFLGSEGLKHNMIGDMDKVTREELRSKASLGSFDVKEAVTSLIITHLTPKLIS  190



>ref|XP_002265422.2| PREDICTED: cytochrome P450 87A3-like [Vitis vinifera]
Length=492

 Score =   206 bits (524),  Expect(2) = 6e-92, Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 159/252 (63%), Gaps = 5/252 (2%)
 Frame = +3

Query  609   SFHG--RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVI  782
             +FH   + +K  +K+++E ++ER +S   + ++ DFLDY L E  K+E F+T+     V+
Sbjct  221   TFHKCLKNQKKTMKILREIVDERCAS--PEIRRGDFLDYFL-EGMKKEAFITKDFIAFVM  277

Query  783   CMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKF  962
               L+FA++E+     +LALK + +HP VL++L+ EHE I+  ++    ++TW +Y+SM F
Sbjct  278   FGLLFASFESIPIMLSLALKLIMEHPLVLQELKNEHEAILRNKDTSNFTLTWEDYKSMTF  337

Query  963   THMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFN  1142
             T  VI+ET+R+A++    FRK ++D +IKG+TIP GW  ++  S +H+    Y DPL FN
Sbjct  338   TLHVIDETLRMANVGLGNFRKALEDIKIKGHTIPAGWTILVVSSVLHMDPNIYPDPLVFN  397

Query  1143  PSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRK  1322
             P RW        +K F  FGG  R C GAE +KL MAI LH  VTKY++  +  GN+VR 
Sbjct  398   PWRWKDGRSKITTKNFTPFGGGIRFCPGAELSKLTMAIFLHVAVTKYRFTKIKGGNLVRN  457

Query  1323  PGLTFLDGFKVQ  1358
             P L F DGF ++
Sbjct  458   PVLKFKDGFHIK  469


 Score =   161 bits (407),  Expect(2) = 6e-92, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 122/192 (64%), Gaps = 2/192 (1%)
 Frame = +1

Query  22   MYLISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQ-GIPPFIQQR  198
            + ++S ++I I +W+ RW+NP+C   LPPGS+GFP+IGESIQF  S S    + PF ++R
Sbjct  6    LCVVSLVIIWITYWIRRWKNPRCNVTLPPGSLGFPLIGESIQFLISCSNSLDLHPFFRKR  65

Query  199  VTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITG-PQGFMVHHG  375
            + +YG LF+TS++G++V+V+ D E NHFI +QEGK V   Y +S AQ+ G  +      G
Sbjct  66   IQKYGPLFKTSMLGRQVVVTADPEANHFILEQEGKSVEMCYLDSVAQLCGHDESSAGATG  125

Query  376  DSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAAS  555
              HKYLR L LN  G E L+  LL +++  A + L  W++  ++++ +AT  ++    + 
Sbjct  126  HIHKYLRTLILNHFGYERLRYKLLKKVEAMAHKSLGAWSSQPSVELNRATSQIMLDFISK  185

Query  556  KVLSYDEKKAME  591
            ++ SYD K   E
Sbjct  186  ELFSYDPKGCTE  197



>gb|AAV85744.1| cytochrome P450 [Oryza sativa Japonica Group]
Length=535

 Score =   185 bits (470),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 130/221 (59%), Gaps = 2/221 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV   +   + +R S+     K  D +D ++ E+  E   + E  A+D +  L+FA
Sbjct  259   QGRRNVWTTLTNVMKKRLSA--PGNKFGDLVDLIVEELRSENPTIDESFAIDTLSGLLFA  316

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++   S   T   KFLN +P V  +L+EEHE I+  RE   S  TW EY+S+KF+  V+N
Sbjct  317   SFAPLSCTLTTTFKFLNDNPEVFDKLKEEHEMILKKREGANSGFTWEEYKSLKFSTQVVN  376

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             E  R+  + P  FRK + D ++ GYTIP GW+ MI P  VHL+ + ++DPL F+P RW  
Sbjct  377   EINRITTVIPGGFRKALTDVQVNGYTIPSGWLVMISPMGVHLNPKLFEDPLKFDPWRWTE  436

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKY  1283
             ++     + FM FGG  R+C  AEF KL + + LH +VT+Y
Sbjct  437   EKRISMQRNFMPFGGGIRMCPAAEFNKLFITLFLHIVVTEY  477


 Score =   180 bits (456),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 120/190 (63%), Gaps = 0/190 (0%)
 Frame = +1

Query  52   IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTS  231
            +AHWVYRW NP C G LPPGSMGFPI+GE+ QFF +     +P + ++R+ RYG +F+T+
Sbjct  49   LAHWVYRWINPPCNGRLPPGSMGFPIVGETFQFFRTSPSIDMPIYYKRRLERYGPIFKTN  108

Query  232  IVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALN  411
            I GQ V++S D E+N FIFQQEGKL   W+ E+   I G +    ++  +HK +R+    
Sbjct  109  IGGQHVVISLDPEVNQFIFQQEGKLFQSWFPETTLNIFGKKTLTTYNRTAHKLIRSFVCK  168

Query  412  LVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME  591
            L GPEN+K++LL E++ + R+ L  W    ++++      M+F LAA  ++  D   + E
Sbjct  169  LYGPENVKKSLLPELENSMRESLASWIGKPSVEVNDGVSNMIFGLAAKHLIGLDITNSGE  228

Query  592  LRKYYKAFME  621
            L+K ++   +
Sbjct  229  LKKNFQEIFQ  238



>ref|NP_190083.2| cytochrome P450 family protein [Arabidopsis thaliana]
 gb|AEE77974.1| cytochrome P450 family protein [Arabidopsis thaliana]
Length=479

 Score =   216 bits (550),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 111/255 (44%), Positives = 158/255 (62%), Gaps = 11/255 (4%)
 Frame = +3

Query  618   GRGRKNVIKLIKETLNE-------RRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVD  776
             G+G  N +   +E + E       R++S   ++K  DFL+  + E +K    L E   + 
Sbjct  221   GKGLYNTLWACREGMREIKDIYTMRKTS---EEKYDDFLNTAIEESEKAGELLNENAIIT  277

Query  777   VICMLIFAAYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-S  953
             +I  L     +TTS A  LA+KFL ++P VL +L++EHE I+ +REDKE  +TW EYR  
Sbjct  278   LIFTLSCVTQDTTSKAICLAVKFLLENPKVLAELKKEHEVILESREDKEGGVTWEEYRHK  337

Query  954   MKFTHMVINETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPL  1133
             M FT+MVINE++R+ ++AP +FRK V+D EIKGYTIP GW+ MI PS VH   E Y++P 
Sbjct  338   MTFTNMVINESLRITNLAPMLFRKAVKDVEIKGYTIPAGWIVMIIPSVVHFDPEIYENPF  397

Query  1134  SFNPSRWNGQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNI  1313
              FNP RW G+EL   SK FM FG   R CAGAEFA+L +++ LH+LVT Y + +  +  +
Sbjct  398   EFNPWRWEGKELRAGSKTFMVFGTGLRQCAGAEFARLQISVFLHHLVTTYNFSLHQDCEV  457

Query  1314  VRKPGLTFLDGFKVQ  1358
             +R P     +G  + 
Sbjct  458   LRVPAAHLPNGISIN  472


 Score =   149 bits (375),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 117/203 (58%), Gaps = 2/203 (1%)
 Frame = +1

Query  13   WLVMYLISFLVIA-IAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFI  189
            W   + +  LV+A + HW Y+W NPK  G LPPGSMGFPIIGE++ FF  +    I P++
Sbjct  5    WNTGFCVIVLVVARVGHWWYQWSNPKSNGKLPPGSMGFPIIGETLDFFKPYGFYEISPYL  64

Query  190  QQRVTRYGSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVH  369
            ++++ RYG LFRT+I+G K +VSTD ++N  I +QE K     Y +   +  G     + 
Sbjct  65   KKKMLRYGPLFRTNILGVKTVVSTDKDVNMEILRQENKSFILSYPDGLMKPLGKDSLFLK  124

Query  370  HGDSHKYLRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLA  549
             G+ HK+++ + L+L+  E LK+ +L +MD+  R+HL        LD+K A   ++    
Sbjct  125  IGNIHKHIKQITLHLLSSEGLKRKILKDMDRVTREHLSSKAKTGRLDVKDAVSKLIIAHL  184

Query  550  ASKVLS-YDEKKAMELRKYYKAF  615
              K++S    +   +L   +KAF
Sbjct  185  TPKMMSNLKPQTQAKLMGIFKAF  207



>emb|CAD41581.3| OSJNBa0088I22.13 [Oryza sativa Japonica Group]
Length=448

 Score =   200 bits (509),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 130/200 (65%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   ISFLVIAIAHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRY  210
            ++ ++  +AHWVY+W NP C G LPPGSMGFPIIGE+ QFF +     +P + +QR+ RY
Sbjct  19   VTLIIGWLAHWVYKWMNPPCIGRLPPGSMGFPIIGETFQFFRASPSIDMPSYYKQRLERY  78

Query  211  GSLFRTSIVGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKY  390
            G LF+TS+VG+ VI+S D E+N FIFQQEGKL   WY E+   I G +    ++G  HK+
Sbjct  79   GPLFKTSLVGRPVIISLDPEVNRFIFQQEGKLFQSWYPETAINIFGKKSLTTYNGTIHKF  138

Query  391  LRNLALNLVGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSY  570
            +R +A  L G ENLK++LL E++ + R+    WT   +++++     M+F L A K++  
Sbjct  139  IRGVAAKLFGLENLKESLLPELENSMRESFASWTGKPSVEVQDGVSDMIFDLVAKKLIGL  198

Query  571  DEKKAMELRKYYKAFMEGDV  630
            D   + ELRK ++ F +G V
Sbjct  199  DVTNSRELRKNFQDFFQGMV  218


 Score =   164 bits (415),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GR+NV   + + + ER S+    KK  D +D ++ E+  E+  + E  A+D +  L+F 
Sbjct  234   QGRRNVRNTLTDIMKERLSA--PGKKYGDLVDLIVEELQSEKPMIDENFAIDALAALLFT  291

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             ++ T SS  T+A K+L  +P V+++L+EEH  I+  RE   S  TW EYRS+KF+  V+N
Sbjct  292   SFATLSSTLTVAFKYLTDNPKVVEELKEEHGTILKKREGVNSGFTWEEYRSLKFSTQVMN  351

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRW  1154
             E  R++++ P +FRK + D ++KGYTIP GW+ MI P +VHL+ + ++DPL F+P RW
Sbjct  352   EITRISNVTPGVFRKTLTDVQVKGYTIPSGWLVMISPMAVHLNPKLFEDPLKFDPWRW  409



>ref|XP_010462465.1| PREDICTED: cytochrome P450 708A2-like [Camelina sativa]
Length=445

 Score =   241 bits (615),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 169/246 (69%), Gaps = 2/246 (1%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRS-SCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
              R+NV+K+IK    ERR  +     K  DF++ +++EV+KE+  + E+ +V++I  L+ A
Sbjct  194   ARRNVMKMIKRMCKERREEATSNDLKYGDFMETMINEVEKEDDTVNEERSVELILSLLIA  253

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSM-KFTHMVI  977
             +YETTS+ T + +KF+ ++P VL +L+ EH+ I+  R DKES +TW EY+SM  FTHMVI
Sbjct  254   SYETTSTMTAITVKFIAENPKVLMELKREHQTILQNRVDKESGVTWKEYKSMMSFTHMVI  313

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NE++RL  ++PA+FRK V +  IKGY IP GW+ ++ PS +H   + Y+ P  FNP RW 
Sbjct  314   NESLRLGSLSPAMFRKAVSNVVIKGYKIPAGWIVLVIPSLLHYDPQIYEQPCEFNPWRWQ  373

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             G+EL    K FMAFGG  RLCAGAEFA+L MAI LH+LVT   + ++++ +I+R P L F
Sbjct  374   GKELLSGPKTFMAFGGGARLCAGAEFARLQMAIYLHHLVTTSDFSLIEKSDIIRAPLLRF  433

Query  1338  LDGFKV  1355
              +  ++
Sbjct  434   SNPIRI  439


 Score =   123 bits (308),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 93/154 (60%), Gaps = 3/154 (2%)
 Frame = +1

Query  115  MGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYG--SLFRTSIVGQKVIVSTDSEINHFIF  288
            MGFP+IGE+++FF  +    +PPF+++R+++YG  SLFRT+I+G K IVSTD E+N  I 
Sbjct  1    MGFPVIGETVEFFKPYRFNEVPPFVKKRMSKYGGGSLFRTNILGSKTIVSTDPEVNFEIL  60

Query  289  QQEGKLVHCWYTESGAQITGPQGFMVHHG-DSHKYLRNLALNLVGPENLKQTLLTEMDQT  465
            +Q+       Y E+  +I G        G D H+Y+R +AL L+GPE LKQ  + ++DQ 
Sbjct  61   KQDNMCFVMSYPEALVRIFGKDNLFFKQGKDFHRYMRQIALQLLGPECLKQRFIQKIDQA  120

Query  466  ARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
             R+HL   +    LD+K     ++ +     ++S
Sbjct  121  TREHLKAVSFQGVLDVKDTVGRLILEQMVQMIIS  154



>ref|XP_007051917.1| Cytochrome P450 superfamily protein, putative [Theobroma cacao]
 gb|EOX96074.1| Cytochrome P450 superfamily protein, putative [Theobroma cacao]
Length=467

 Score =   225 bits (574),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 110/247 (45%), Positives = 157/247 (64%), Gaps = 3/247 (1%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +  +N++KLI ET  +R++S  K      F+D+LL E+ K +T L E IA D++ + I  
Sbjct  218   KASRNLMKLIDETFEKRKAS--KINHHDTFVDHLLEELKKGDTGLDEAIARDLVLLFIIT  275

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAR-EDKESSITWNEYRSMKFTHMVI  977
               E  + + TLA+K +  HP VL +L +EHE II +R EDKE  ITW EY+SM+FTHMVI
Sbjct  276   TSEAITLSITLAMKLIADHPKVLAELMKEHEAIIESRVEDKELEITWEEYKSMEFTHMVI  335

Query  978   NETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWN  1157
             NE VR+ ++ P + RK+ +D +I GYTIP GW  +   + +H     +D+P +FNP RW 
Sbjct  336   NEMVRVGNLVPILPRKLPKDVDINGYTIPAGWFLVADQTVLHFDPNYFDEPFAFNPWRWE  395

Query  1158  GQELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTF  1337
             G++ H  +K F+ FGG    C GA F KL +AI LH+LVTKYKW  +   +I R P L+ 
Sbjct  396   GKKGHTGTKTFIPFGGGAGFCVGANFGKLQIAIFLHHLVTKYKWSEIKRNDISRGPVLSL  455

Query  1338  LDGFKVQ  1358
              +GF V+
Sbjct  456   PNGFFVE  462


 Score =   139 bits (350),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 118/190 (62%), Gaps = 8/190 (4%)
 Frame = +1

Query  61   WVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSIVG  240
            W   W+NPK    LPPGSMGFPIIGE++++F+ +SL  I PF+++R+TRYG +FRTS+VG
Sbjct  16   WFCIWQNPKRNRKLPPGSMGFPIIGETMEYFSLYSLLEISPFMKKRITRYGPMFRTSLVG  75

Query  241  QKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNLVG  420
            QKV++ TD E+   + +QE      W+T+   +++G   F++     HKYLR+  ++ + 
Sbjct  76   QKVVMVTDPELISGMLKQEIMPPIQWFTQYSVKVSGEDQFVL-SASFHKYLRSFFMHQLS  134

Query  421  PENLKQ-TLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLSYDEKKAME-L  594
            PE+L     + E+DQ  R+HL+ W     +D +Q    M+ +  A K+  YDE  A E L
Sbjct  135  PESLMTGESIREIDQATRRHLNWWATQGAIDARQ----MVAEYVAKKI-GYDEPNAAEKL  189

Query  595  RKYYKAFMEG  624
             +  +AF++ 
Sbjct  190  SENVRAFVDN  199



>ref|XP_011016152.1| PREDICTED: cytochrome P450 87A3-like [Populus euphratica]
Length=313

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 189/246 (77%), Gaps = 1/246 (0%)
 Frame = +3

Query  621   RGRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFA  800
             +GRK  +++IK  L E R +  +K+++KDFLD ++ E+ K  + +TE +A+D++ +L+FA
Sbjct  50    QGRKKAVEIIKSIL-EERCATPRKRQEKDFLDLVIEEIKKNGSLMTEAMALDLLFVLVFA  108

Query  801   AYETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYRSMKFTHMVIN  980
             A+ETTS   TLA+K + +HP VL++L +EHE I+  R++ ES ITW EY+SM FTH VI+
Sbjct  109   AFETTSITLTLAVKNVCEHPKVLEELIKEHEAILRNRKNIESGITWQEYKSMNFTHAVIH  168

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ETVRLA+I P IFRKV++D +IKGYTIP GW+ M+CP +VH++ ++YDDP +FNP RW G
Sbjct  169   ETVRLANIVPGIFRKVLKDVDIKGYTIPAGWIVMVCPPAVHMNPKQYDDPFTFNPWRWQG  228

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             Q LH  S+KFM FGG  RLCAGAEF+K+ MAI LH+LVTKY+W+V+  G+I+R P + F 
Sbjct  229   QVLHAGSQKFMGFGGGSRLCAGAEFSKMQMAIFLHHLVTKYRWRVIKGGDIIRIPAVIFP  288

Query  1341  DGFKVQ  1358
             +GF +Q
Sbjct  289   NGFHIQ  294



>ref|NP_851153.1| cytochrome P450 708A2 [Arabidopsis thaliana]
 ref|NP_199611.2| cytochrome P450 708A2 [Arabidopsis thaliana]
 ref|NP_001032030.1| cytochrome P450 708A2 [Arabidopsis thaliana]
 ref|NP_001078732.1| cytochrome P450 708A2 [Arabidopsis thaliana]
 sp|Q8L7D5.3|THAH_ARATH RecName: Full=Cytochrome P450 708A2; AltName: Full=Thalianol 
hydroxylase; Short=AtTHAH [Arabidopsis thaliana]
 gb|AED95604.1| cytochrome P450 708A2 [Arabidopsis thaliana]
 gb|AED95605.1| cytochrome P450 708A2 [Arabidopsis thaliana]
 gb|AED95607.1| cytochrome P450 708A2 [Arabidopsis thaliana]
 gb|AED95608.1| cytochrome P450 708A2 [Arabidopsis thaliana]
Length=477

 Score =   219 bits (559),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 158/246 (64%), Gaps = 4/246 (2%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
              R+  +++IK+    R++S   ++   DFLD ++ E +KE+    E+ A+++I  ++  A
Sbjct  230   ARRYALQVIKDVFTRRKAS---REMCGDFLDTMVEEGEKEDVIFNEESAINLIFAILVVA  286

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVIN  980
              E+TSS T+LA+KFL ++   L +L+ EH  I+  R  K + ++W EYR  M FT+MVIN
Sbjct  287   KESTSSVTSLAIKFLAENHKALAELKREHAAILQNRNGKGAGVSWEEYRHQMTFTNMVIN  346

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+R+A++AP ++RK V D EIKGYTIP GW+  + P +VH +   Y++PL FNP RW G
Sbjct  347   ETLRMANMAPIMYRKAVNDVEIKGYTIPAGWIVAVIPPAVHFNDAIYENPLEFNPWRWEG  406

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +EL   SK FM FGG  R C GAEFA+L ++I +H+LVT Y + +  E   +R P   F 
Sbjct  407   KELRSGSKTFMVFGGGVRQCVGAEFARLQISIFIHHLVTTYDFSLAQESEFIRAPLPYFP  466

Query  1341  DGFKVQ  1358
              G  ++
Sbjct  467   KGLPIK  472


 Score =   144 bits (363),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 103/171 (60%), Gaps = 0/171 (0%)
 Frame = +1

Query  55   AHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSI  234
            + W+YRW NPKC G LPPGSMG PIIGE+  FF  H L  I PF+++R+ +YG LFRT+I
Sbjct  20   SKWLYRWSNPKCNGKLPPGSMGLPIIGETCDFFEPHGLYEISPFVKKRMLKYGPLFRTNI  79

Query  235  VGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNL  414
             G   +V T+ +I   +F+QE K     Y E+  +  G +   + HG+ HK+++ ++L  
Sbjct  80   FGSNTVVLTEPDIIFEVFRQENKSFVFSYPEAFVKPFGKENVFLKHGNIHKHVKQISLQH  139

Query  415  VGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
            +G E LK+ ++ E+D+   +HL       + D K+A E ++      K++S
Sbjct  140  LGSEALKKKMIGEIDRVTYEHLRSKANQGSFDAKEAVESVIMAHLTPKIIS  190



>ref|NP_851152.1| cytochrome P450 708A2 [Arabidopsis thaliana]
 dbj|BAB11064.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AED95606.1| cytochrome P450 708A2 [Arabidopsis thaliana]
Length=518

 Score =   219 bits (559),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 158/246 (64%), Gaps = 4/246 (2%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
              R+  +++IK+    R++S   ++   DFLD ++ E +KE+    E+ A+++I  ++  A
Sbjct  271   ARRYALQVIKDVFTRRKAS---REMCGDFLDTMVEEGEKEDVIFNEESAINLIFAILVVA  327

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVIN  980
              E+TSS T+LA+KFL ++   L +L+ EH  I+  R  K + ++W EYR  M FT+MVIN
Sbjct  328   KESTSSVTSLAIKFLAENHKALAELKREHAAILQNRNGKGAGVSWEEYRHQMTFTNMVIN  387

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+R+A++AP ++RK V D EIKGYTIP GW+  + P +VH +   Y++PL FNP RW G
Sbjct  388   ETLRMANMAPIMYRKAVNDVEIKGYTIPAGWIVAVIPPAVHFNDAIYENPLEFNPWRWEG  447

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +EL   SK FM FGG  R C GAEFA+L ++I +H+LVT Y + +  E   +R P   F 
Sbjct  448   KELRSGSKTFMVFGGGVRQCVGAEFARLQISIFIHHLVTTYDFSLAQESEFIRAPLPYFP  507

Query  1341  DGFKVQ  1358
              G  ++
Sbjct  508   KGLPIK  513


 Score =   144 bits (362),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 103/171 (60%), Gaps = 0/171 (0%)
 Frame = +1

Query  55   AHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSI  234
            + W+YRW NPKC G LPPGSMG PIIGE+  FF  H L  I PF+++R+ +YG LFRT+I
Sbjct  61   SKWLYRWSNPKCNGKLPPGSMGLPIIGETCDFFEPHGLYEISPFVKKRMLKYGPLFRTNI  120

Query  235  VGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNL  414
             G   +V T+ +I   +F+QE K     Y E+  +  G +   + HG+ HK+++ ++L  
Sbjct  121  FGSNTVVLTEPDIIFEVFRQENKSFVFSYPEAFVKPFGKENVFLKHGNIHKHVKQISLQH  180

Query  415  VGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
            +G E LK+ ++ E+D+   +HL       + D K+A E ++      K++S
Sbjct  181  LGSEALKKKMIGEIDRVTYEHLRSKANQGSFDAKEAVESVIMAHLTPKIIS  231



>gb|AAM96995.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AAN15443.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=477

 Score =   219 bits (558),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 157/246 (64%), Gaps = 4/246 (2%)
 Frame = +3

Query  624   GRKNVIKLIKETLNERRSSCkkkkkkkDFLDYLLSEVDKEETFLTEKIAVDVICMLIFAA  803
              R+  +++IK+    R++S   ++   DFLD ++ E +KE+    E  A+++I  ++  A
Sbjct  230   ARRYALQVIKDVFTRRKAS---REMCGDFLDTMVEEGEKEDVIFNEDSAINLIFAILVVA  286

Query  804   YETTSSATTLALKFLNQHPHVLKQLQEEHEKIIAAREDKESSITWNEYR-SMKFTHMVIN  980
              E+TSS T+LA+KFL ++   L +L+ EH  I+  R  K + ++W EYR  M FT+MVIN
Sbjct  287   KESTSSVTSLAIKFLAENHKALAELKREHAAILQNRNGKGAGVSWEEYRHQMTFTNMVIN  346

Query  981   ETVRLADIAPAIFRKVVQDFEIKGYTIPRGWMFMICPSSVHLSAEKYDDPLSFNPSRWNG  1160
             ET+R+A++AP ++RK V D EIKGYTIP GW+  + P +VH +   Y++PL FNP RW G
Sbjct  347   ETLRMANMAPIMYRKAVNDVEIKGYTIPAGWIVAVIPPAVHFNDAIYENPLEFNPWRWEG  406

Query  1161  QELHPASKKFMAFGGVQRLCAGAEFAKLAMAIMLHYLVTKYKWKVVDEGNIVRKPGLTFL  1340
             +EL   SK FM FGG  R C GAEFA+L ++I +H+LVT Y + +  E   +R P   F 
Sbjct  407   KELRSGSKTFMVFGGGVRQCVGAEFARLQISIFIHHLVTTYDFSLAQESEFIRAPLPYFP  466

Query  1341  DGFKVQ  1358
              G  ++
Sbjct  467   KGLPIK  472


 Score =   144 bits (363),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 103/171 (60%), Gaps = 0/171 (0%)
 Frame = +1

Query  55   AHWVYRWRNPKCKGLLPPGSMGFPIIGESIQFFTSHSLQGIPPFIQQRVTRYGSLFRTSI  234
            + W+YRW NPKC G LPPGSMG PIIGE+  FF  H L  I PF+++R+ +YG LFRT+I
Sbjct  20   SKWLYRWSNPKCNGKLPPGSMGLPIIGETCDFFEPHGLYEISPFVKKRMLKYGPLFRTNI  79

Query  235  VGQKVIVSTDSEINHFIFQQEGKLVHCWYTESGAQITGPQGFMVHHGDSHKYLRNLALNL  414
             G   +V T+ +I   +F+QE K     Y E+  +  G +   + HG+ HK+++ ++L  
Sbjct  80   FGSNTVVLTEPDIIFEVFRQENKSFVFSYPEAFVKPFGKENVFLKHGNIHKHVKQISLQH  139

Query  415  VGPENLKQTLLTEMDQTARQHLDHWTALSNLDIKQATEIMLFKLAASKVLS  567
            +G E LK+ ++ E+D+   +HL       + D K+A E ++      K++S
Sbjct  140  LGSEALKKKMIGEIDRVTYEHLRSKANQGSFDAKEAVESVIMAHLTPKIIS  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4113523704564