BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25212_g3_i1 len=1890 path=[3815:0-175 3991:176-190 4006:191-369
14521:370-459 @4275@!:460-727 4543:728-734 4550:735-877 4693:878-895
@4711@!:896-1342 5158:1343-1392 5208:1393-1560 5376:1561-1609
5425:1610-1889]

Length=1890
                                                                      Score     E

ref|WP_012468051.1|  hypothetical protein                               207   5e-60   
dbj|BAJ11784.1|  dehydration responsive protein                         116   1e-58   
gb|ABM53544.1|  conserved hypothetical protein                          164   2e-44   uncultured beta proteobacterium CBNPD1 BAC clone 578
ref|WP_012468052.1|  hypothetical protein                               163   8e-44   
ref|WP_021994825.1|  hypothetical protein                               140   2e-40   
ref|WP_015552221.1|  hypothetical protein                               150   2e-38   
ref|WP_001894106.1|  hypothetical protein                               142   1e-35   
ref|WP_024080208.1|  hypothetical protein                               142   1e-34   
gb|KFM94800.1|  hypothetical protein DJ90_6657                        96.7    1e-32   
gb|ACF23508.1|  hypothetical protein                                    129   6e-32   uncultured bacterium
gb|AAU50096.1|  hypothetical protein BMA1789                            124   4e-30   Burkholderia mallei
ref|XP_003637074.1|  Cell wall-associated hydrolase                     133   3e-29   
emb|CBA31922.1|  hypothetical protein Csp_D29540                        114   5e-29   Curvibacter putative symbiont of Hydra magnipapillata
emb|CEH44534.1|  hypothetical protein XAC3610_10050001                76.3    5e-27   
emb|CBA31926.1|  hypothetical protein Csp_D29560                      95.9    6e-27   Curvibacter putative symbiont of Hydra magnipapillata
emb|CEH53215.1|  hypothetical protein XACS582_11310001                76.3    6e-27   
emb|CBA31924.1|  hypothetical protein Csp_D29550                        115   6e-27   Curvibacter putative symbiont of Hydra magnipapillata
gb|EGG54196.1|  hypothetical protein HMPREF9439_01523                   115   1e-26   
gb|KDE01841.1|  hypothetical protein M837_01826                       81.6    5e-26   
gb|ADI16715.1|  hypothetical protein                                    112   7e-26   
gb|AJA38639.1|  hypothetical protein                                    117   2e-25   
gb|EQA95122.1|  hypothetical protein HPS_1373                         77.4    3e-25   
ref|WP_003529620.1|  hypothetical protein [                             111   8e-25   
ref|WP_005423973.1|  hypothetical protein [                             112   9e-25   
ref|WP_005427226.1|  hypothetical protein [                             112   2e-24   
gb|KGC54484.1|  putative serine acetyltransferase                       107   2e-24   
emb|CDW93821.1|  conserved hypothetical protein                         107   3e-24   
gb|AEQ20465.1|  hypothetical protein                                    103   1e-22   
ref|WP_021399582.1|  hypothetical protein                             71.2    3e-22   
gb|EQJ26087.1|  hypothetical protein QS5_0359                         70.9    3e-22   
gb|KHF26993.1|  hypothetical protein CM49_06689                         103   8e-22   
gb|EKK92457.1|  hypothetical protein VCHC1A2_3330                       102   1e-21   
ref|WP_001890945.1|  hypothetical protein                               102   1e-21   
gb|EDM53059.1|  conserved hypothetical protein                          102   1e-21   Vibrio cholerae MZO-2
gb|ABM53545.1|  conserved hypothetical protein                          100   6e-21   uncultured beta proteobacterium CBNPD1 BAC clone 578
ref|WP_009610708.1|  hypothetical protein                               100   7e-21   
gb|ADI16883.1|  hypothetical protein                                  97.8    1e-20   
ref|WP_001899247.1|  hypothetical protein                             99.4    1e-20   
gb|EJH48895.1|  hypothetical protein VCCP104821_0250                  99.8    2e-20   
emb|CDW61111.1|  hypothetical protein TTRE_0000953901                   101   2e-20   
gb|ADI18832.1|  hypothetical protein                                  96.3    2e-20   
gb|EGG54220.1|  hypothetical protein HMPREF9439_01518                 97.1    2e-20   
gb|ETI82480.1|  hypothetical protein Q618_VCMC00001G0061                103   3e-20   
ref|WP_007506545.1|  hypothetical protein                             99.4    3e-20   
ref|WP_005921497.1|  hypothetical protein                               101   3e-20   
ref|WP_005924044.1|  hypothetical protein                               101   4e-20   
ref|WP_005920085.1|  hypothetical protein                               100   4e-20   
gb|EEU95451.1|  hypothetical protein FAEPRAA2165_02967                  101   4e-20   Faecalibacterium prausnitzii A2-165
gb|ADI16721.1|  hypothetical protein                                  97.4    5e-20   
gb|ENV71128.1|  hypothetical protein F947_00014                       98.2    6e-20   
dbj|BAO82212.1|  hypothetical protein SRAA_2358                       94.0    1e-19   
ref|WP_004846641.1|  hypothetical protein [                           98.2    3e-19   
gb|EKE04739.1|  hypothetical protein ACD_20C00008G0002                97.4    3e-19   
gb|EBA38672.1|  hypothetical protein COLAER_02246                     79.3    3e-19   Collinsella aerofaciens ATCC 25986
gb|EEA89302.1|  hypothetical protein COLSTE_02537                     89.0    5e-19   Collinsella stercoris DSM 13279
ref|WP_005937134.1|  conserved domain protein                         97.4    5e-19   
emb|CDF98816.1|  Putative Uncharacterized protein                     96.3    6e-19   
ref|WP_001894078.1|  hypothetical protein                             95.1    6e-19   
emb|CDF98165.1|  Putative Uncharacterized protein                     96.3    6e-19   
gb|EEZ93815.1|  conserved hypothetical protein                        83.2    1e-18   Legionella longbeachae D-4968
gb|ELY20072.1|  hypothetical protein HALTITAN_3297                    76.6    1e-18   
dbj|GAL87805.1|  dehydration responsive protein                       90.9    1e-18   
gb|EJH48961.1|  hypothetical protein VCCP104821_0001                  94.4    2e-18   
gb|EEI82387.1|  hypothetical protein HMPREF0077_1527                  91.7    6e-18   Anaerococcus tetradius ATCC 35098
emb|CDW93820.1|  hypothetical protein THICB2_410075                   89.0    8e-18   
ref|WP_012468050.1|  hypothetical protein                             90.1    8e-18   
gb|EEZ33514.1|  LOW QUALITY PROTEIN: conserved hypothetical protein   91.3    9e-18   Brucella sp. 83/13
gb|ADI19371.1|  hypothetical protein                                  79.0    1e-17   
gb|EEW79285.1|  LOW QUALITY PROTEIN: conserved hypothetical protein   89.7    3e-17   Brucella abortus NCTC 8038
gb|EFG00472.1|  conserved hypothetical protein                        89.0    3e-17   
gb|AFJ95810.1|  hypothetical protein                                  82.4    4e-17   
ref|WP_016356304.1|  hypothetical protein                             88.2    5e-17   
ref|WP_022299945.1|  uncharacterized protein                          86.3    6e-17   
emb|CDN41084.1|  Uncharacterized protein BN871_AB_00820               87.8    7e-17   
gb|AAF09840.1|AE001886_6  hypothetical protein DR_0254                88.6    8e-17   Deinococcus radiodurans
ref|WP_015552220.1|  hypothetical protein                             85.9    8e-17   
gb|EJH40973.1|  serine acetyltransferase                              87.0    9e-17   
dbj|BAJ11783.1|  dehydration responsive protein                       85.9    1e-16   
emb|CBX28565.1|  hypothetical protein N47_G38890                      86.7    1e-16   
gb|ABH09321.1|  leucine rich protein                                  82.0    1e-16   Arachis hypogaea [goober]
ref|WP_013085636.1|  hypothetical protein                             88.2    2e-16   
gb|KHF27783.1|  hypothetical protein CM49_06648                       60.5    2e-16   
emb|CDG37541.1|  hypothetical protein CTHBC1_2972                     87.8    2e-16   
gb|EHI04052.1|  hypothetical protein VCHC61A1_3636                    87.8    3e-16   
ref|WP_004846158.1|  hypothetical protein [                           87.0    5e-16   
emb|CAR86202.1|  Conserved protein                                    85.9    5e-16   Lactobacillus rhamnosus GG
ref|WP_014566373.1|  hypothetical protein                             85.9    6e-16   
dbj|BAJ11781.1|  dehydration responsive protein                       82.8    7e-16   
dbj|GAD81567.1|  hypothetical protein NCAST_03_00002                  85.1    1e-15   
dbj|BAJ11779.1|  dehydration responsive protein                       82.0    2e-15   
gb|EGU94741.1|  hypothetical protein HMPREF9349_05394                 60.8    3e-15   
gb|AHQ36865.1|  hypothetical protein AV48_26720                       81.3    9e-15   
gb|AHQ99647.1|  hypothetical protein AV68_01885                       80.5    1e-14   
gb|AHS46837.1|  hypothetical protein AV15_01510                       80.5    1e-14   
gb|AHQ45912.1|  hypothetical protein AU86_26085                       80.5    1e-14   
gb|AHS49618.1|  hypothetical protein AV47_01815                       80.5    1e-14   
ref|WP_026400319.1|  hypothetical protein                             79.7    2e-14   
gb|ADI17229.1|  hypothetical protein                                  81.3    2e-14   
gb|AAX66567.1|  hypothetical protein SCH_2661                         80.1    3e-14   Salmonella enterica
gb|EFE51872.1|  hypothetical protein PROVRETT_09454                   73.9    3e-14   Providencia rettgeri DSM 1131
ref|WP_014413244.1|  hypothetical protein                             58.2    4e-14   
ref|WP_004986315.1|  hypothetical protein                             54.7    4e-14   
gb|EEW08769.1|  hypothetical protein VMD_37440                        79.7    5e-14   Vibrio mimicus VM573
gb|EDM97728.1|  hypothetical protein BACCAP_04469                     78.2    5e-14   Pseudoflavonifractor capillosus ATCC 29799
emb|CDZ23242.1|  hypothetical protein CCDG5_0096 [ [                  80.9    5e-14   
gb|AAX64155.1|  hypothetical protein SCH_0249                         80.1    6e-14   Salmonella enterica
ref|WP_014413241.1|  hypothetical protein                             79.3    7e-14   
gb|AAF11800.1|AE002057_8  hypothetical protein DR_2252                80.1    7e-14   Deinococcus radiodurans
ref|WP_004923040.1|  hypothetical protein                             73.6    8e-14   
ref|WP_005390411.1|  hypothetical protein                             77.8    1e-13   
ref|YP_007989109.1|  unnamed protein product                          78.6    1e-13   
gb|ADI18616.1|  hypothetical protein                                  78.2    1e-13   
gb|EFE07775.1|  hypothetical protein CIT292_08808                     78.6    1e-13   Citrobacter youngae ATCC 29220
dbj|GAL60545.1|  hypothetical protein EV102420_45_00015               77.8    2e-13   
gb|ABE05728.1|  hypothetical protein UTI89_C0222                      77.8    2e-13   Escherichia coli UTI89
emb|CAJ30046.1|  hypothetical protein mgI388                          79.0    2e-13   Magnetospirillum gryphiswaldense
emb|CCJ46478.1|  putative uncharacterized protein                     77.4    2e-13   
gb|ELS47047.1|  hypothetical protein C789_3192                        77.4    3e-13   
gb|ADI19336.1|  hypothetical protein                                  65.9    3e-13   
gb|EZU73576.1|  hypothetical protein U991_01373                       77.8    4e-13   
dbj|GAB83214.1|  hypothetical protein EB105725_51_00005               76.6    5e-13   
gb|EQL85868.1|  putative serine acetyltransferase                     75.5    5e-13   
gb|ADI19636.1|  hypothetical protein                                  65.1    6e-13   
ref|WP_004990863.1|  hypothetical protein                             52.8    8e-13   
gb|EEX74124.1|  hypothetical protein GCWU000323_01827                 58.9    1e-12   Leptotrichia hofstadii F0254
gb|EEH89633.1|  hypothetical protein ESAG_07158                       74.7    1e-12   Escherichia sp. 3_2_53FAA
ref|WP_011075501.1|  hypothetical protein                             78.2    2e-12   
ref|WP_012676413.1|  hypothetical protein                             77.0    2e-12   
gb|ADI17460.1|  hypothetical protein                                  74.7    2e-12   
gb|ACN99803.1|  conserved hypothetical protein                        52.4    2e-12   Sulfurihydrogenibium azorense Az-Fu1
ref|WP_003038302.1|  hypothetical protein                             76.6    3e-12   
gb|EJH40972.1|  serine acetyltransferase                              73.9    3e-12   
emb|CDW93822.1|  conserved hypothetical protein                       72.8    4e-12   
gb|EES70919.1|  hypothetical protein POTG_04460                       73.6    4e-12   Paenibacillus sp. oral taxon 786 str. D14
dbj|BAN86004.1|  23S ribosomal RNA                                    73.6    4e-12   
ref|WP_014413255.1|  hypothetical protein                             74.3    5e-12   
gb|EGG54195.1|  hypothetical protein HMPREF9439_01522                 72.8    6e-12   
emb|CDY45505.1|  BnaCnng12640D                                        55.5    7e-12   
gb|EHH01337.1|  hypothetical protein HMPREF9441_00776                 68.6    7e-12   
gb|ACN98721.1|  conserved hypothetical protein                        50.4    9e-12   Sulfurihydrogenibium azorense Az-Fu1
gb|EPS74531.1|  hypothetical protein M569_00248                       73.2    9e-12   
gb|KGC54522.1|  hypothetical protein DM75_499                         71.6    1e-11   
gb|EEX73106.1|  hypothetical protein GCWU000323_02875                 55.5    1e-11   Leptotrichia hofstadii F0254
ref|XP_003588355.1|  Mitochondrial protein, putative                  53.9    1e-11   
gb|AGC71893.1|  hypothetical protein                                  70.9    2e-11   
gb|AGC78890.1|  hypothetical protein                                  53.9    2e-11   
gb|EDM70192.1|  hypothetical protein RAZWK3B_11306                    65.9    2e-11   Roseobacter sp. AzwK-3b
gb|EPR32483.1|  hypothetical protein dsmv_3640                        67.0    2e-11   
emb|CDW90691.1|  UNKNOWN                                              63.9    2e-11   
ref|WP_014413243.1|  hypothetical protein                             72.4    2e-11   
gb|EFJ93358.1|  hypothetical protein HMPREF9531_01540                 69.3    2e-11   
ref|WP_034222476.1|  hypothetical protein                             71.6    2e-11   
dbj|BAJ11780.1|  dehydration responsive protein                       70.9    2e-11   
ref|WP_014413260.1|  hypothetical protein                             72.0    3e-11   
gb|ABV11276.1|  hypothetical protein CKO_00099                        68.9    3e-11   Citrobacter koseri ATCC BAA-895
gb|KGW37799.1|  hypothetical protein Y045_6146                        70.9    3e-11   
gb|EOQ35791.1|  hypothetical protein HMPREF1526_02587                 72.4    4e-11   
emb|CAJ55200.1|  Unknown                                              67.0    4e-11   Lawsonia intracellularis PHE/MN1-00
ref|WP_014413258.1|  hypothetical protein                             71.2    5e-11   
gb|EKI24911.1|  dehydration responsive domain protein                 52.4    6e-11   
gb|EEO40746.1|  hypothetical protein FSCG_01459                       70.5    7e-11   Fusobacterium nucleatum subsp. vincentii 4_1_13
gb|EDN75700.1|  hypothetical protein RUMGNA_03973                     70.1    7e-11   Ruminococcus gnavus ATCC 29149
gb|EDQ97287.1|  hypothetical protein CLOBAR_00774                     69.7    9e-11   Intestinibacter bartlettii DSM 16795
gb|EGB79477.1|  hypothetical protein HMPREF9532_00001                 67.0    9e-11   
gb|ELY20071.1|  hypothetical protein HALTITAN_3296                    69.3    1e-10   
gb|ADI17560.1|  hypothetical protein                                  68.6    1e-10   
ref|XP_010104771.1|  hypothetical protein L484_018823                 68.6    2e-10   
gb|EEW77470.1|  serine acetyltransferase                              65.1    2e-10   Haemophilus influenzae NT127
gb|EFX63797.1|  hypothetical protein DAPPUDRAFT_118838                69.3    2e-10   
gb|ADI19242.1|  hypothetical protein                                  69.7    3e-10   
gb|ABM53546.1|  conserved hypothetical protein                        67.0    4e-10   uncultured beta proteobacterium CBNPD1 BAC clone 578
gb|EHN78839.1|  hypothetical protein SMCF_1619                        51.2    4e-10   
gb|EHN79822.1|  hypothetical protein SMCF_600                         51.2    5e-10   
gb|EFC30233.1|  hypothetical protein C1336_000600005                  67.0    5e-10   Campylobacter jejuni subsp. jejuni 1336
ref|WP_007264782.1|  hypothetical protein                             67.4    5e-10   
dbj|BAA29291.1|  235aa long hypothetical protein                      70.1    5e-10   Pyrococcus horikoshii
gb|EHN79496.1|  hypothetical protein SMCF_951                         50.4    6e-10   
ref|WP_003714185.1|  unnamed protein product                          66.2    6e-10   
gb|AHI24017.1|  hypothetical protein H845_49                          62.4    7e-10   
gb|EKE04738.1|  hypothetical protein ACD_20C00008G0001                67.0    8e-10   
ref|WP_012673749.1|  hypothetical protein                             68.6    1e-09   
ref|WP_004595993.1|  hypothetical protein                             68.2    1e-09   
ref|WP_032941583.1|  hypothetical protein                             52.0    2e-09   
gb|EQL89715.1|  hypothetical protein D052_4663                        53.5    2e-09   
gb|EDN76706.1|  hypothetical protein RUMGNA_02966                     67.0    2e-09   Ruminococcus gnavus ATCC 29149
gb|EDN75699.1|  hypothetical protein RUMGNA_03972                     67.0    2e-09   Ruminococcus gnavus ATCC 29149
dbj|GAL60544.1|  hypothetical protein EV102420_45_00017               50.8    2e-09   
gb|ETT00906.1|  hypothetical protein HMPREF1497_2012                  67.4    2e-09   
gb|EEI46427.1|  hypothetical protein HMPREF0693_3633                  64.7    2e-09   Proteus mirabilis ATCC 29906
gb|AHO23029.1|  hypothetical protein AV75_33185                       50.8    2e-09   
ref|WP_004923043.1|  hypothetical protein                             64.3    3e-09   
gb|ADI18019.1|  hypothetical protein                                  67.0    3e-09   
gb|KGE54303.1|  hypothetical protein MGAS2111_2303                    64.7    5e-09   
gb|EEI46272.1|  hypothetical protein HMPREF0693_3788                  63.9    5e-09   Proteus mirabilis ATCC 29906
gb|KFA45294.1|  hypothetical protein EW35_3223                        65.9    5e-09   
gb|EFD68878.1|  LOW QUALITY PROTEIN: conserved hypothetical protein   64.3    6e-09   
gb|ADI18196.1|  hypothetical protein                                  63.5    7e-09   
gb|EOS28076.1|  hypothetical protein C804_03778                       63.9    8e-09   
dbj|BAJ11782.1|  dehydration responsive protein                       63.5    9e-09   
ref|WP_004984917.1|  hypothetical protein                             52.8    9e-09   
gb|EPS74533.1|  hypothetical protein M569_00250                       63.2    9e-09   
gb|EEP52421.1|  conserved hypothetical protein                        65.5    1e-08   Clostridium butyricum E4 str. BoNT E BL5262
gb|EGU94778.1|  hypothetical protein HMPREF9349_05350                 56.6    1e-08   
gb|EGG54197.1|  hypothetical protein HMPREF9439_01524                 62.8    1e-08   
emb|CDN41082.1|  Putative uncharacterized protein                     62.8    1e-08   
gb|EFE81975.1|  LOW QUALITY PROTEIN: conserved hypothetical protein   64.7    2e-08   
gb|EEH89632.1|  hypothetical protein ESAG_07157                       62.4    2e-08   Escherichia sp. 3_2_53FAA
gb|EEX24763.1|  LOW QUALITY PROTEIN: hypothetical protein HMPREF0...  63.5    2e-08   Lactobacillus fermentum 28-3-CHN
emb|CCF21089.1|  hypothetical protein NT26_3367                       62.4    2e-08   
emb|CCG06598.1|  Putative uncharacterized protein                     64.3    2e-08   
gb|EEP52383.1|  conserved hypothetical protein                        64.3    2e-08   Clostridium butyricum E4 str. BoNT E BL5262
ref|WP_014413254.1|  hypothetical protein                             63.9    2e-08   
gb|AAU06491.1|  putative salivary protein                             61.6    3e-08   Culicoides sonorensis
ref|WP_003714186.1|  unnamed protein product                          44.7    3e-08   
gb|EEP55040.1|  conserved hypothetical protein                        63.9    3e-08   Clostridium butyricum E4 str. BoNT E BL5262
ref|WP_022614577.1|  hypothetical protein                             62.4    3e-08   
gb|EDR96157.1|  hypothetical protein ANACAC_03315                     63.5    3e-08   Anaerostipes caccae DSM 14662
ref|WP_003904596.1|  hypothetical protein                             61.6    4e-08   
gb|ADI17622.1|  hypothetical protein                                  63.5    4e-08   
ref|WP_006427240.1|  hypothetical protein                             63.5    4e-08   
gb|EFQ80765.1|  hypothetical protein HMPREF0305_11076                 61.6    5e-08   
ref|WP_001894030.1|  hypothetical protein                             60.8    5e-08   
gb|EKU16681.1|  hypothetical protein D593_1495                        62.4    6e-08   
ref|XP_008481199.1|  PREDICTED: inositol monophosphatase 2-like       62.8    6e-08   
ref|WP_014250246.1|  hypothetical protein                             60.5    7e-08   
ref|WP_009232000.1|  hypothetical protein                             62.4    8e-08   
ref|WP_004850312.1|  hypothetical protein                             61.6    9e-08   
ref|WP_004846370.1|  hypothetical protein [                           60.8    1e-07   
gb|EDZ64152.1|  hypothetical protein KB13_284                         59.7    1e-07   beta proteobacterium KB13
gb|EDN75573.1|  hypothetical protein MHA_2707                         59.7    1e-07   Mannheimia haemolytica PHL213
gb|EDN76703.1|  hypothetical protein RUMGNA_02963                     61.2    1e-07   Ruminococcus gnavus ATCC 29149
gb|EMR91350.1|  IS1 transposase InsAB                                 50.8    2e-07   
gb|EDN76536.1|  hypothetical protein RUMGNA_03216                     60.8    2e-07   Ruminococcus gnavus ATCC 29149
ref|WP_014413259.1|  hypothetical protein                             60.1    2e-07   
ref|WP_038142016.1|  hypothetical protein                             59.7    3e-07   
gb|AGC71894.1|  hypothetical protein                                  58.5    3e-07   
ref|WP_004916279.1|  hypothetical protein                             58.2    4e-07   
gb|ELS47048.1|  hypothetical protein C789_3193                        60.5    5e-07   
gb|AHV65700.1|  cobalamin biosynthesis protein CbiG                   62.4    5e-07   
ref|WP_003908676.1|  predicted protein                                59.7    6e-07   
gb|EFE80054.1|  LOW QUALITY PROTEIN: conserved hypothetical protein   60.1    6e-07   
gb|EES70918.1|  hypothetical protein POTG_04459                       57.8    6e-07   Paenibacillus sp. oral taxon 786 str. D14
gb|EFQ80764.1|  hypothetical protein HMPREF0305_11075                 58.5    6e-07   
ref|WP_038199824.1|  hypothetical protein                             58.5    7e-07   
ref|WP_003714551.1|  unnamed protein product                          58.5    7e-07   
gb|ELK88170.1|  putative serine acetyltransferase                     42.4    7e-07   
gb|EAS50136.1|  hypothetical protein SI859A1_01496                    51.2    1e-06   Aurantimonas manganoxydans SI85-9A1
gb|ADI17934.1|  hypothetical protein                                  57.0    2e-06   
gb|ADI22944.1|  hypothetical protein                                  58.9    2e-06   
ref|WP_035254331.1|  hypothetical protein                             56.6    2e-06   
ref|WP_007545368.1|  hypothetical protein                             57.8    3e-06   
gb|EDP10738.1|  hypothetical protein EUBDOL_02000 [ [                 42.4    3e-06   [Eubacterium] dolichum DSM 3991
gb|EJZ85023.1|  hypothetical protein HMPREF9241_01603                 57.0    3e-06   
gb|EFT57008.1|  hypothetical protein HMPREF9610_00001                 59.3    3e-06   
gb|EQX91442.1|  hypothetical protein G939_04501                       55.5    3e-06   
gb|EEP55936.1|  conserved hypothetical protein                        57.4    3e-06   Clostridium butyricum E4 str. BoNT E BL5262
ref|WP_004846362.1|  hypothetical protein [                           53.1    4e-06   
gb|ADI17937.1|  hypothetical protein                                  55.8    4e-06   
gb|AER40616.1|  hypothetical protein MADAR_309                        54.7    4e-06   
ref|WP_036933237.1|  hypothetical protein                             56.2    4e-06   
gb|EGG54219.1|  hypothetical protein HMPREF9439_01517                 55.5    4e-06   
ref|XP_006849012.1|  hypothetical protein AMTR_s00028p00129850        57.0    5e-06   
gb|EFR51297.1|  LOW QUALITY PROTEIN: hypothetical protein BBNG_01845  57.0    5e-06   
gb|EFS54330.1|  hypothetical protein HMPREF9589_00552                 59.3    5e-06   
gb|EMX84435.1|  hypothetical protein ECBCE001MS16_4257                55.1    6e-06   
gb|KEM89333.1|  hypothetical protein AC92_3539                        55.1    6e-06   
gb|EJB90947.1|  hypothetical protein HPHPH21_1619                     57.0    6e-06   
gb|ESK57859.1|  hypothetical protein PAJL_2583                        58.9    6e-06   
gb|EMX84350.1|  hypothetical protein ECBCE001MS16_4391                55.1    6e-06   
gb|EEQ56089.1|  LOW QUALITY PROTEIN: hypothetical protein BLIG_02219  56.6    7e-06   Bifidobacterium longum subsp. infantis CCUG 52486
gb|EPR34115.1|  hypothetical protein dsat_2904                        56.6    7e-06   
gb|ADI19064.1|  hypothetical protein                                  56.2    8e-06   
gb|KEJ23865.1|  hypothetical protein AB03_3268                        53.9    1e-05   
emb|CDP93641.1|  Protein BM-SET-27, isoform c                         56.2    1e-05   
ref|WP_002664677.1|  hypothetical protein                             53.9    1e-05   
gb|EQR69632.1|  hypothetical protein G790_00051                       53.9    1e-05   
ref|WP_014198592.1|  hypothetical protein                             53.9    1e-05   
ref|WP_004846363.1|  hypothetical protein [                           52.8    1e-05   
gb|EDN71770.1|  conserved hypothetical protein                        54.7    1e-05   Beggiatoa sp. SS
gb|ERB80376.1|  hypothetical protein S11_5655                         53.5    2e-05   
gb|ABU75356.1|  hypothetical protein ESA_00050                        53.5    2e-05   
ref|WP_000421215.1|  MULTISPECIES: hypothetical protein               53.5    2e-05   
gb|ELI34475.1|  hypothetical protein WII_04366                        53.1    2e-05   
gb|EKI55767.1|  hypothetical protein ECN1_0191                        53.1    2e-05   
gb|ADI16575.1|  hypothetical protein                                  53.5    2e-05   
gb|EHV33703.1|  hypothetical protein ECDEC5D_4765                     53.1    2e-05   
gb|ADI18892.1|  hypothetical protein                                  53.5    2e-05   
gb|EHW99841.1|  hypothetical protein ECDEC11B_4367                    53.1    2e-05   
gb|KDW70234.1|  hypothetical protein AB42_5662                        52.8    3e-05   
gb|KDT78303.1|  hypothetical protein AC90_4954                        52.8    3e-05   
gb|EEY11247.1|  hypothetical protein COI_0096                         53.1    3e-05   
gb|EEH89631.1|  hypothetical protein ESAG_07156                       53.1    3e-05   
gb|EDR96159.1|  hypothetical protein ANACAC_03317                     52.8    3e-05   
dbj|GAL60548.1|  hypothetical protein EV102420_46_00001               53.1    3e-05   
gb|ETJ02548.1|  hypothetical protein Q619_VDC00001G0001               53.5    3e-05   
gb|EFE07627.1|  hypothetical protein CIT292_08961                     53.1    3e-05   
gb|ESK28747.1|  hypothetical protein G966_04608                       52.8    3e-05   
ref|WP_006427115.1|  hypothetical protein                             54.3    3e-05   
gb|EFM24372.1|  hypothetical protein HMPREF9166_0012                  52.8    3e-05   
gb|EGW66893.1|  hypothetical protein ECSTECB2F1_4090                  52.8    3e-05   
gb|KCV28850.1|  putative tRNA-i(6)A37 thiotransferase enzyme MiaB     56.6    3e-05   
gb|EDZ64311.1|  hypothetical protein KB13_443                         52.8    3e-05   
gb|KDY51111.1|  hypothetical protein AC20_5803                        52.4    4e-05   
ref|WP_006426163.1|  hypothetical protein                             54.3    4e-05   
ref|XP_003610225.1|  hypothetical protein MTR_4g129340                39.3    4e-05   
ref|WP_040446063.1|  hypothetical protein                             52.8    4e-05   
gb|EDN76538.1|  hypothetical protein RUMGNA_03218                     52.0    5e-05   
gb|ESL02575.1|  hypothetical protein GCWU000282_02230                 53.5    5e-05   
gb|EDR96165.1|  hypothetical protein ANACAC_03300                     52.4    5e-05   
ref|WP_040219472.1|  hypothetical protein                             53.1    6e-05   
gb|EDS10617.1|  hypothetical protein ANACOL_02699                     53.5    7e-05   
gb|ACU24411.1|  unknown                                               52.4    7e-05   
gb|EDS13040.1|  hypothetical protein ANACOL_00227                     53.5    7e-05   
gb|ADI21114.1|  hypothetical protein                                  51.6    9e-05   
gb|ADI22640.1|  hypothetical protein                                  51.6    9e-05   
gb|ETS31753.1|  hypothetical protein PTE_02057                        51.2    9e-05   
gb|EFE84358.1|  conserved hypothetical protein                        42.7    1e-04   
dbj|GAD81568.1|  hypothetical protein NCAST_03_00005                  51.6    1e-04   
ref|WP_004845976.1|  hypothetical protein [                           52.4    1e-04   
gb|EDM52654.1|  hypothetical protein EUBVEN_00032                     52.8    1e-04   
gb|EDM20428.1|  hypothetical protein BACCAC_02601                     52.0    1e-04   
gb|EMX59820.1|  hypothetical protein ECJURUA1811_4384                 51.2    1e-04   
gb|EJZ62527.1|  hypothetical protein HMPREF9448_02443                 53.9    1e-04   
gb|ABQ15253.1|  putative amoA protein                                 53.5    1e-04   
ref|WP_004846163.1|  hypothetical protein [                           52.0    1e-04   
gb|ADI18136.1|  hypothetical protein                                  52.0    1e-04   
emb|CDN41081.1|  hypothetical protein BN871_AB_00790                  52.4    1e-04   
gb|EEJ41387.1|  hypothetical protein HMPREF0549_0166                  51.2    1e-04   
gb|EEH89630.1|  hypothetical protein ESAG_07155                       51.6    1e-04   
ref|WP_004846639.1|  hypothetical protein [                           53.9    1e-04   
gb|EJI92553.1|  hypothetical protein Y71_3572                         50.8    1e-04   
gb|EFK16730.1|  hypothetical protein HMPREF9541_00874                 51.2    2e-04   
ref|WP_004846157.1|  hypothetical protein [                           53.5    2e-04   
gb|ENA19440.1|  hypothetical protein EC2016001_3505                   50.4    2e-04   
gb|ADI17935.1|  hypothetical protein                                  51.2    2e-04   
gb|EKN21706.1|  hypothetical protein HMPREF1075_02341                 38.5    2e-04   
gb|AGB85039.1|  hypothetical protein CHLPROCp009                      51.6    2e-04   
ref|WP_034826892.1|  hypothetical protein                             50.8    2e-04   
gb|EDM52636.1|  hypothetical protein EUBVEN_00074                     52.0    2e-04   
ref|WP_004845973.1|  hypothetical protein [                           53.5    2e-04   
gb|EHV19536.1|  hypothetical protein ECDEC4E_0059                     50.4    2e-04   
ref|XP_010112784.1|  Metal transporter Nramp5                         53.9    2e-04   
gb|EEU49048.1|  LOW QUALITY PROTEIN: hypothetical protein HMPREF0...  50.8    2e-04   
ref|WP_009189401.1|  hypothetical protein                             51.6    2e-04   
ref|WP_038097695.1|  hypothetical protein                             51.2    3e-04   
emb|CCG94050.1|  hypothetical protein MARHY0556                       50.4    3e-04   
ref|WP_001433041.1|  hypothetical protein                             49.7    3e-04   
ref|WP_028836596.1|  hypothetical protein                             50.4    3e-04   
dbj|GAK46829.1|  conserved protein                                    50.1    3e-04   
gb|ADI16622.1|  hypothetical protein                                  50.8    4e-04   
gb|EDS05859.1|  hypothetical protein CLOSCI_03039 [ [                 50.1    4e-04   
gb|EFE51943.1|  hypothetical protein PROVRETT_09374                   50.1    4e-04   
gb|ADI18618.1|  hypothetical protein                                  49.7    4e-04   
gb|EQL89717.1|  hypothetical protein D052_4665                        50.4    5e-04   
gb|EDM52639.1|  hypothetical protein EUBVEN_00054                     50.8    5e-04   
gb|EIK84247.1|  hypothetical protein CGSMWGv00703Bmash_01530          49.7    5e-04   
ref|XP_003608262.1|  hypothetical protein MTR_4g091430                50.8    6e-04   
emb|CCS42982.1|  hypothetical protein SA37_1107                       48.9    6e-04   
ref|WP_014198593.1|  hypothetical protein                             49.3    6e-04   
emb|CDM84611.1|  unnamed protein product                              50.4    6e-04   
ref|WP_009191003.1|  hypothetical protein                             50.1    6e-04   
gb|EAX46781.1|  hypothetical protein TcarDRAFT_0446                   48.9    7e-04   
gb|KDF02499.1|  hypothetical protein AF42_05465                       48.5    7e-04   
gb|EFE51939.1|  hypothetical protein PROVRETT_09378                   48.9    8e-04   
gb|EFE51938.1|  hypothetical protein PROVRETT_09379                   48.9    0.001   
gb|ADI21115.1|  hypothetical protein                                  49.7    0.001   
ref|WP_031600085.1|  hypothetical protein                             37.7    0.001   



>ref|WP_012468051.1| hypothetical protein [Burkholderia multivorans]
 ref|YP_001949470.1| hypothetical protein BMULJ_05092 [Burkholderia multivorans ATCC 
17616]
 dbj|BAG46934.1| hypothetical protein BMULJ_05092 [Burkholderia multivorans ATCC 
17616]
Length=123

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  516  LTCFPSATHLCLALGADSPCSDER*TGNLGLSARGLFTLFIATHVSIRTSDTSSILYKTP  695
            +TCFPSATH CLALGADSP +DER  GNLGL+ARG FT FIATHVSIRTSDTSS LYK P
Sbjct  1    MTCFPSATHFCLALGADSPYADERCVGNLGLTARGPFTPFIATHVSIRTSDTSSTLYKAP  60

Query  696  SQAYGTLSYHMCKHISAASVTGLAPLHLPRRTTRSVSYYAFFK*WLLLSQHPDCFSLPTS  875
            SQAYGTLSYH CKH SAASV GLAPLHLPRRTTRSVSYYAFFK WLLLSQ PDCFSLPTS
Sbjct  61   SQAYGTLSYHACKHASAASVYGLAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCFSLPTS  120

Query  876  FST  884
            F T
Sbjct  121  FPT  123



>dbj|BAJ11784.1| dehydration responsive protein, partial [Corchorus olitorius]
Length=215

 Score =   116 bits (291),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -3

Query  619  PLAESPRFPVQRSSEQGESAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVGIV  446
            P A SPRFPVQRSSEQGESAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVGIV
Sbjct  36   PAAVSPRFPVQRSSEQGESAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVGIV  93


 Score = 92.0 bits (227),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 64/109 (59%), Gaps = 7/109 (6%)
 Frame = -1

Query  429  KALRQIRARNSRG*DVCPCGTKQSEVVPRKASKLQSYETVPQTDTGGRDEYSKALERTRE  250
            K LRQIRARNSR  D      KQSEVVPRKASKLQSYETVPQTDTGGRDEYSKAL     
Sbjct  99   KVLRQIRARNSRDRDERLYAAKQSEVVPRKASKLQSYETVPQTDTGGRDEYSKALAENSV  158

Query  249  KELGKLVP*LRDKVRPGSLIGLLHEGERVAINWWLRLFNKNTALCKHES  103
            +     VP    KV    ++GL  +G           F +  ++C H S
Sbjct  159  EGTRTSVPVTAGKVLRMRILGLASDGRS-------NTFTRYDSVCIHTS  200


 Score = 68.9 bits (167),  Expect(3) = 1e-58, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  725  MVGERSVSLRRCLVKDAGGIGSANADMSSDKEGEKPSRRKPKV  597
            MVGERSVSLRRCLVKDAGGI SANADMSSD  GEKP+   P+ 
Sbjct  1    MVGERSVSLRRCLVKDAGGIRSANADMSSDNAGEKPAAVSPRF  43



>gb|ABM53544.1| conserved hypothetical protein [uncultured beta proteobacterium 
CBNPD1 BAC clone 578]
Length=109

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  504  GAGILTCFPSATHLCLALGADSPCSDER*TGNLGLSARGLFTLFIATHVSIRTSDTSSIL  683
            G GILTCFPSATHLCLALGADSP +DER  GNL L+ARGLFT F ATHVSIRTSDTSS L
Sbjct  3    GTGILTCFPSATHLCLALGADSPYADERCVGNLALTARGLFTPFNATHVSIRTSDTSSRL  62

Query  684  YKTPSQAYGTLSYHMCKHISAASVTGLAPLHLPRRTTRSVSYYAFFK  824
            +  PSQAY TLSYH     SAASVTGLAPLHLPRRTTRSVSYYAFFK
Sbjct  63   HNPPSQAYRTLSYHAHCCASAASVTGLAPLHLPRRTTRSVSYYAFFK  109



>ref|WP_012468052.1| hypothetical protein [Burkholderia multivorans]
 ref|YP_001949471.1| hypothetical protein BMULJ_05093 [Burkholderia multivorans ATCC 
17616]
 dbj|BAG46935.1| hypothetical protein BMULJ_05093 [Burkholderia multivorans ATCC 
17616]
Length=120

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +1

Query  1372  LYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvpp  1551
             +YA GFR YFTPLPGFFSPFPHGTGSLSVD+EYLALEDGPPIFRQDFTCPALLVV LV  
Sbjct  1     MYACGFRIYFTPLPGFFSPFPHGTGSLSVDHEYLALEDGPPIFRQDFTCPALLVVHLVLS  60

Query  1552  v*frvrGYHPLWLLFPKDSTISPTITYKAHPISLATTLGISVDFFSCSYLDVSVRRVRF  1728
               FR++GYH LW  FP+ S  +    YKAHPISLATTLGISVDFFSC YLDVSV RVRF
Sbjct  61    YCFRLQGYHLLWPHFPERSANNTNKEYKAHPISLATTLGISVDFFSCGYLDVSVHRVRF  119



>ref|WP_021994825.1| hypothetical protein [Sutterella wadsworthensis CAG:135]
 emb|CCZ19492.1| putative uncharacterized protein [Sutterella wadsworthensis CAG:135]
Length=174

 Score =   140 bits (354),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +3

Query  1329  IQKVRRHPTKRLRLFVCTRFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTG  1508
             +QKVR HP   L LFVC RFQ LFHSPPGVLFAFPS+YWF IGRLRVFSLGGWSPH++ G
Sbjct  1     MQKVRSHPCGLL-LFVCMRFQDLFHSPPGVLFAFPSQYWFAIGRLRVFSLGGWSPHLRAG  59

Query  1509  FHVSRPTCRTLSTTGLISCTGLSPAMAPVSKGFHYQSDYHVQG  1637
             FHVSR T R LST   IS TGLSP++A +S+ F Y+  YH+Q 
Sbjct  60    FHVSRSTSRKLSTLNPISRTGLSPSVAGLSRPFQYRIQYHLQA  102


 Score = 55.1 bits (131),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1633  KAHPISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQITM  1755
             +A PISLA T  ISVDFFSCSYLDVSVR VR + LCI   +
Sbjct  101   QALPISLAATFRISVDFFSCSYLDVSVRCVRLLKLCIHFKI  141



>ref|WP_015552221.1| hypothetical protein [Taylorella asinigenitalis]
 ref|YP_007822394.1| hypothetical protein KUM_1452 [Taylorella asinigenitalis 14/45]
 emb|CCG20230.1| hypothetical protein KUM_1452 [Taylorella asinigenitalis 14/45]
Length=175

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +1

Query  1372  LYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvpp  1551
             +YAHGFRFYFTPLPGFFSPFPHGTGSLSVD+EYLALEDGPPIF QD+TCPALLV      
Sbjct  1     MYAHGFRFYFTPLPGFFSPFPHGTGSLSVDHEYLALEDGPPIFEQDYTCPALLVATPSTI  60

Query  1552  v*frvrGYHPLWLLFPKDSTISPTITYKAHPISLATTLGISVDFFSCSYLDVSVRRVRFV  1731
                   G  P  +L P            AHPIS ATT  ISVDFFS SYLDVSV  VR +
Sbjct  61    TIVSSTGLSPSTVLLPSKFDYYNYYLVAAHPISFATTFRISVDFFSSSYLDVSVHSVRLL  120

Query  1732  TLCIQITM  1755
             TLCIQI +
Sbjct  121   TLCIQIRI  128


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 61/118 (52%), Gaps = 1/118 (1%)
 Frame = +3

Query  1536  TLSTTGLISCTGLSPAMAPVSKGFHYQSDYHVQGSS-HFARHYfgnlg*flflqllRCFS  1712
             T ST  ++S TGLSP+   +   F Y + Y V      FA  +  ++  F    L     
Sbjct  56    TPSTITIVSSTGLSPSTVLLPSKFDYYNYYLVAAHPISFATTFRISVDFFSSSYLDVSVH  115

Query  1713  SPRSLRYPMYSDNDDLKGRVSPFGNLRIKVCLLTPRSLSQATTSFIACNRQGIHHVHL  1886
             S R L   +       K  VSPFG LRI   L TPRS SQA TSF AC+RQGIHHVHL
Sbjct  116   SVRLLTLCIQIRIPPKKRWVSPFGYLRINAHLPTPRSFSQAITSFFACDRQGIHHVHL  173



>ref|WP_001894106.1| hypothetical protein, partial [Vibrio cholerae]
 gb|EAY32189.1| conserved hypothetical protein [Vibrio cholerae 1587]
Length=171

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 105/164 (64%), Gaps = 15/164 (9%)
 Frame = +1

Query  1405  PLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPL  1584
             P  GFFSPFPHGTGSLSV  EYLALEDGPPIFRQD TCPALL   L              
Sbjct  15    PSQGFFSPFPHGTGSLSVSQEYLALEDGPPIFRQDITCPALLDFTLDEASVTG-------  67

Query  1585  WLLFPKDSTISPTITY-----KAHPISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQI  1749
               L P  + +S   TY     +A+P SLA T GISVDFFS  YLDVSV  V  V LCIQ+
Sbjct  68    --LSPCIAKLSSLFTYFTECLRANPGSLAATTGISVDFFSSGYLDVSVPPVCSVNLCIQL  125

Query  1750  TMT*KA-GFPHSEICGSKCVCSLPAAYRKLLRPSSPVIAKASTM  1878
             T+T  A GFPHSEI  S     L  AYRKL+RPSSP+ A+AST+
Sbjct  126   TVTAYAVGFPHSEIADSNGSYCLICAYRKLVRPSSPLTAQASTV  169



>ref|WP_024080208.1| hypothetical protein [Magnetospirillum gryphiswaldense]
 ref|YP_008937858.1| hypothetical protein MGMSR_1983 [Magnetospirillum gryphiswaldense 
MSR-1]
 emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense 
MSR-1]
 emb|CDK99198.1| protein of unknown function [Magnetospirillum gryphiswaldense 
MSR-1 v2]
Length=259

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 118/225 (52%), Gaps = 12/225 (5%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPATVALFGLDFSTAPLSG  1293
             +AFHPYPQ+IP FFN  GFGPP  VT PS+ PW+DH VSGL  AT       F  A    
Sbjct  1     MAFHPYPQIIPDFFNRRGFGPPVGVTPPSTCPWIDHSVSGLMHATRRPIQTRFRCAYTYR  60

Query  1294  *PRH*M*VADPLYKRYAVTPRRGSDCLYAHGFRFYFT-PLPGFFSPFPHGTGSLSVDYEY  1470
                     +   Y +   +P + +     H      + PL G FSPFPHGT SLSV  EY
Sbjct  61    LKLAAYTNSLTHYTKGTPSPFKRAPTACRHSVSGTVSLPLSGCFSPFPHGTSSLSVTEEY  120

Query  1471  LALEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPLWLLFPKDSTISPTITYKAH---  1641
             L LEDGPP+FRQDFTCPALL                 L   F         +    H   
Sbjct  121   LGLEDGPPMFRQDFTCPALLKADTRFTPTGLSPAMARLSRRF--------RLCKYQHWPG  172

Query  1642  PISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQITMT*KAGFP  1776
             P SLATT G+SVD  S  YLDVSVR VR + LCIQ  +T + GFP
Sbjct  173   PRSLATTNGVSVDVLSSGYLDVSVRPVRLLNLCIQFRITLRWGFP  217


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  1286  YPVNLATECKSLTHYTKGTPSPHEEAPTVCMHTVSGSISLPSRGSF  1423
             Y + LA    SLTHYTKGTPSP + APT C H+VSG++SLP  G F
Sbjct  59    YRLKLAAYTNSLTHYTKGTPSPFKRAPTACRHSVSGTVSLPLSGCF  104



>gb|KFM94800.1| hypothetical protein DJ90_6657 [Paenibacillus macerans]
Length=189

 Score = 96.7 bits (239),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 66/112 (59%), Gaps = 0/112 (0%)
 Frame = +1

Query  913   VWVVSLLTPDVSTRRLSPKLALTGIRSLQWFGKSQ*PPSHNSALPPMVILEALPK*FSER  1092
             VW VSLLT D+ST  L+P  ++ GIRSL   G    P + +         EA PK  S R
Sbjct  2     VWAVSLLTMDLSTHCLTPGESVYGIRSLTELGNPCGPRTQSVLYLHDCHTEASPKAISGR  61

Query  1093  TSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPAT  1248
             TSY +V L F  YP LIP  FN+ GFGPP RVTAPS W  VDH VSGL   T
Sbjct  62    TSYLRVRLEFLRYPHLIPALFNVRGFGPPVRVTAPSPWTGVDHTVSGLRLQT  113


 Score = 73.2 bits (178),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  1292  VNLATECKSLTHYTKGTPSPHEEAPTVCMHTVSGSISLPSRGSFRLSLTVLVHYRSITSI  1471
             +NLA +  S  H TKGTPSP + A T C HTVSGS+SLP RG+F LSLTVL+HYRS+ SI
Sbjct  130   LNLARKRNSPVHSTKGTPSPLKWALTSCKHTVSGSLSLPFRGAFHLSLTVLLHYRSLGSI  189



>gb|ACF23508.1| hypothetical protein [uncultured bacterium]
Length=77

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  1383  RFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLIS  1562
             RFQ LFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPH+QTGFHVSRPTCR LS     S
Sbjct  2     RFQDLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHLQTGFHVSRPTCRKLSLARWFS  61

Query  1563  CTGLSPAMAPVSKGFH  1610
             CTGLSP MA +S+ FH
Sbjct  62    CTGLSPTMARLSRLFH  77



>gb|AAU50096.1| hypothetical protein BMA1789 [Burkholderia mallei ATCC 23344]
Length=77

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  1383  RFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLIS  1562
             RFQ LFHSPPGVLFAFPSRYWFTIGR RVFSLGGWSPH+QTGFHVSRPTCRT S+  L S
Sbjct  2     RFQDLFHSPPGVLFAFPSRYWFTIGRSRVFSLGGWSPHLQTGFHVSRPTCRTPSSFILFS  61

Query  1563  CTGLSPAMAPVSKGF  1607
              TGLSPAMA +S+ F
Sbjct  62    PTGLSPAMAALSRAF  76



>ref|XP_003637074.1| Cell wall-associated hydrolase, partial [Medicago truncatula]
Length=733

 Score =   133 bits (335),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 151/430 (35%), Positives = 176/430 (41%), Gaps = 90/430 (21%)
 Frame = +3

Query  444   PTIPTVGQPSAIRPPIASYDGAGILTCFPSATHLCLALGADSPCSDER*TGNLGLSARGL  623
             P+ P       +  PI  +   GI TC PS T   L LG DSP  DE   G L  S   +
Sbjct  297   PSYPEKAGAPCVLEPITIFR-TGIFTCCPSTTPFGLILGPDSPSVDEPCGGTLRFSGHWI  355

Query  624   FTLFIATHVSIRTSDTSSILYKTPSQAYGTLSYHMCKHISAASVTGLAPLHLPRRTTRSV  803
              T                          GTL Y  C   S +    L+P+HL R+  RSV
Sbjct  356   LT-----------------------NVCGTLPYR-CILTSHSFGRSLSPVHLQRKGARSV  391

Query  804   SYYAFFK*WLLLSQHPDCFSLPTSFST*PIFGTLAGGLGCFPLDAGR*HPTSVSQARTHR  983
             SYYA FK WLLL + P C   PTSF T             +P  +   H  +++      
Sbjct  392   SYYALFKGWLLLGKPPGCLCTPTSFIT-------ERSFRAYPPSS---HWPTLTPVILRS  441

Query  984   YSEFAMVW*VA--MTP*P*QCSTPdgdt*gtt*IVFGENQlfpglfslsplpTAHPLIFQ  1157
             Y  F +   +     P P QC TP           FGENQL  G   +SPL T HPL F 
Sbjct  442   YLVFRVCLDLVPLAQPAPKQCFTPRCPVNCCASTHFGENQLALGSSGISPLTTTHPLAFA  501

Query  1158  H*WVRTSRACYRTFILAMGRSPGFGSTPSDCRPVRTRFLYGSPIRLTSPLNVSR*PIIQK  1337
                                 +   GS P                 LT PL +SR  I+Q+
Sbjct  502   --------------------TAPVGSIP-----------------LTKPLPMSRRLILQQ  524

Query  1338  VRRHPTKRLRLFVCTRFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHV  1517
              R      L L    RF VLFHSP GVLF  PSRY+F IG   VFSL  WS  I TGFHV
Sbjct  525   ARGQSPGLLPLLGSLRFHVLFHSPMGVLFTLPSRYYFAIGHPGVFSLARWSLLIHTGFHV  584

Query  1518  SRPTCRTLSTTGLISCTGLSPAMAPVSKGFHYQSDYHVQGSSHFARHYfgnlg*flflql  1697
                T          +C  L             Q  +H  G SHFAR Y+GN   FLFL L
Sbjct  585   PHAT----RVRQHDACIALP------------QPRFHGLGCSHFARRYYGNRFCFLFLWL  628

Query  1698  lRCFSSPRSL  1727
             LRCFSSP  L
Sbjct  629   LRCFSSPGCL  638



>emb|CBA31922.1| hypothetical protein Csp_D29540 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=156

 Score =   114 bits (285),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTL  177
            TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVF KQSQPP++CN   L
Sbjct  66   TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFNKQSQPPIFCNLIGL  124


 Score = 43.1 bits (100),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 25/38 (66%), Gaps = 2/38 (5%)
 Frame = +3

Query  159  LQPFHPHGVNQSSYRGVPYPEVTVPICRVPSPEFSQAP  272
            L   HP G   S  +G P  EVTV ICRVPSPEFSQAP
Sbjct  121  LIGLHPRGT--SPTKGTPSSEVTVSICRVPSPEFSQAP  156



>emb|CEH44534.1| hypothetical protein XAC3610_10050001 [Xanthomonas citri pv. 
citri]
 emb|CEH63558.1| hypothetical protein XACLG97_9100001 [Xanthomonas citri pv. citri]
 emb|CEI15539.1| hypothetical protein XACB302_8740001 [Xanthomonas citri pv. citri]
 emb|CEI35905.1| hypothetical protein XACJJ10_1720001 [Xanthomonas citri pv. citri]
 emb|CEH45422.1| hypothetical protein XACLD7_12360002 [Xanthomonas citri pv. citri]
 emb|CEH54604.1| hypothetical protein XACJK48_7680001 [Xanthomonas citri pv. citri]
 emb|CEH43546.1| hypothetical protein XAC3615_11480001 [Xanthomonas citri pv. 
citri]
 emb|CEH65841.1| hypothetical protein XACG102_9020002 [Xanthomonas citri pv. citri]
 emb|CEH54703.1| hypothetical protein XACLE3_7360001 [Xanthomonas citri pv. citri]
 emb|CEH78138.1| hypothetical protein XAC3612_2290002 [Xanthomonas citri pv. citri]
 emb|CEI07008.1| hypothetical protein XACG115_2260002 [Xanthomonas citri pv. citri]
 emb|CEI16169.1| hypothetical protein XACLG98_2430001 [Xanthomonas citri pv. citri]
 emb|CEH96247.1| hypothetical protein XACG117_2160001 [Xanthomonas citri pv. citri]
 emb|CEH96682.1| hypothetical protein XACB100_2230001 [Xanthomonas citri pv. citri]
 emb|CEH78239.1| hypothetical protein XACLH37_2340001 [Xanthomonas citri pv. citri]
 emb|CEH86566.1| hypothetical protein XAC3607_3090001 [Xanthomonas citri pv. citri]
 emb|CEJ25532.1| hypothetical protein XACE116_10060001 [Xanthomonas citri pv. 
citri]
 emb|CEJ20942.1| hypothetical protein XACE116_10060001 [Xanthomonas citri pv. 
citri]
 emb|CEL46621.1| hypothetical protein XAC439_9960001 [Xanthomonas citri pv. citri]
 emb|CEL39943.1| hypothetical protein XACJK4_2420001 [Xanthomonas citri pv. citri]
 emb|CEL48745.1| hypothetical protein XACJM35_2180001 [Xanthomonas citri pv. citri]
 emb|CEL34943.1| hypothetical protein XAC4311_2140001 [Xanthomonas citri pv. citri]
Length=150

 Score = 76.3 bits (186),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +2

Query  1250  SPCSDSISLRLPYPVNLATECKSLTHYTKGTPSPHEEAPTVCMHTVSGSISLPSRGSF  1423
             +P SDS+SLRLPY V LAT  KSLTHYTKGT S    APT C HTVSGSISLPS G F
Sbjct  34    APLSDSVSLRLPYTVKLATNSKSLTHYTKGTQS-LLRAPTACTHTVSGSISLPSPGFF  90


 Score = 74.3 bits (181),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  1405  PLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTC  1518
             P PGFFSPFPHGTGSLSV  EYLALEDGPPIFRQ FTC
Sbjct  85    PSPGFFSPFPHGTGSLSVGQEYLALEDGPPIFRQGFTC  122



>emb|CBA31926.1| hypothetical protein Csp_D29560 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=168

 Score = 95.9 bits (237),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +1

Query  1393  FYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvppv*frvrG  1572
              YFTPLPGFFSPFPHGT SLSV+ EYLALEDGPPIFRQDF+CPALL    VP   F VRG
Sbjct  1     MYFTPLPGFFSPFPHGTSSLSVNDEYLALEDGPPIFRQDFSCPALLFASSVPHRSFHVRG  60

Query  1573  YHPLWLLFPKDSTISPTITYK  1635
             YHPLW  FP  S +S  IT +
Sbjct  61    YHPLWPAFPGCSVMSCAITCR  81


 Score = 54.7 bits (130),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +2

Query  1634  RLIPFRSPLLWESRLISfpaat*mfqfaafaSLPYVfr*r*pkrpgfpirkSADQSVFAH  1813
             RL+ FRSPLL ESRL+SFP AT MFQF  FAS  YVF  R         + S DQS+FA 
Sbjct  81    RLLRFRSPLLSESRLMSFPRATEMFQFTRFASHDYVFIMRYLSVGFPIRK-SPDQSLFAS  139

Query  1814  SPQLIASYYVLHRL*SPRHPPCALI  1888
             SP+LIA Y+VL RL  PRHPP ALI
Sbjct  140   SPKLIAGYHVLRRLSLPRHPPHALI  164



>emb|CEH53215.1| hypothetical protein XACS582_11310001 [Xanthomonas citri pv. 
citri]
 emb|CEH94261.1| hypothetical protein XACS581_1990001 [Xanthomonas citri pv. citri]
Length=150

 Score = 76.3 bits (186),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +2

Query  1250  SPCSDSISLRLPYPVNLATECKSLTHYTKGTPSPHEEAPTVCMHTVSGSISLPSRGSF  1423
             +P SDS+SLRLPY V LAT  KSLTHYTKGT S    APT C HTVSGSISLPS G F
Sbjct  34    APLSDSVSLRLPYTVKLATNSKSLTHYTKGTQS-LLRAPTACTHTVSGSISLPSPGFF  90


 Score = 74.3 bits (181),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  1405  PLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTC  1518
             P PGFFSPFPHGTGSLSV  EYLALEDGPPIFRQ FTC
Sbjct  85    PSPGFFSPFPHGTGSLSVGQEYLALEDGPPIFRQGFTC  122



>emb|CBA31924.1| hypothetical protein Csp_D29550 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=77

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +3

Query  504  GAGILTCFPSATHLCLALGADSPCSDER*TGNLGLSARGLFTLFIATHVSIRTSDTSSIL  683
            G GILTCFPSATHLCLALGADS  +DER   NL L+ARGLFT F ATHVSIRTSDTSS L
Sbjct  2    GTGILTCFPSATHLCLALGADSLYADERCVENLALTARGLFTPFNATHVSIRTSDTSSTL  61

Query  684  YKTPSQAYGTLSYHM  728
            Y  PSQAY TLSYH+
Sbjct  62   YNAPSQAYRTLSYHL  76



>gb|EGG54196.1| hypothetical protein HMPREF9439_01523 [Parasutterella excrementihominis 
YIT 11859]
Length=107

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  1383  RFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLIS  1562
             RFQVLFHSPPGVLFAFPSRYWFTIGR RVFSLGGWSP ++TGFHVSR T R LST   +S
Sbjct  2     RFQVLFHSPPGVLFAFPSRYWFTIGRSRVFSLGGWSPRLRTGFHVSRSTSRFLSTVPTLS  61

Query  1563  CTGLSPAMAPVSKGFHYQ  1616
              TGLSP +A +S+ F  +
Sbjct  62    PTGLSPTIAGLSRTFRLK  79



>gb|KDE01841.1| hypothetical protein M837_01826 [Streptococcus equi subsp. zooepidemicus 
SzS31A1]
Length=149

 Score = 81.6 bits (200),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  1060  LEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLH  1239
             ++A PK  SERTSY QV L F  YPQ+I   FN+  FGPP R+TAPS+  WV H+VSGL 
Sbjct  16    IDASPKAISERTSYLQVRLEFLRYPQVIQALFNVPWFGPPVRLTAPSTCSWVGHMVSGLR  75

Query  1240  PATVALFGLDFSTAP  1284
             P T AL  L F +AP
Sbjct  76    PRTYALLRLGFPSAP  90


 Score = 62.8 bits (151),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  1350  PTKRLRLFVCTRFQVLFHSPPGVLFAFPSRYWFTIG  1457
             P   L L V TRFQVLFHSPPGVLF FPSRYWFTIG
Sbjct  113   PINGLELLVGTRFQVLFHSPPGVLFTFPSRYWFTIG  148


 Score = 23.1 bits (48),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 18/32 (56%), Gaps = 6/32 (19%)
 Frame = +2

Query  1274  LRLPYP------VNLATECKSLTHYTKGTPSP  1351
             LRL +P      +NLA +  S  H TKGT SP
Sbjct  82    LRLGFPSAPSLQLNLARKRNSPVHSTKGTLSP  113



>gb|ADI16715.1| hypothetical protein [uncultured gamma proteobacterium HF0010_05D02]
Length=77

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  1873  WMPWRLQAMKDVVACDKLRGVSKHTLIRRFPNGETRPFRSSLSEYIG*RSERGELKHLSS  1694
             WMPW+ +AMKDVVACDKLRGV K TLIRRFPNGET P R S +EYIG R E GELKHLS+
Sbjct  7     WMPWQSEAMKDVVACDKLRGVGKQTLIRRFPNGETHPLRVSCTEYIGVRGEPGELKHLST  66

Query  1693  CRKRNQPRFPK  1661
              RKRNQ RFP+
Sbjct  67    RRKRNQLRFPQ  77



>gb|AJA38639.1| hypothetical protein [Thermotoga sp. TBYP3.1.4.1]
Length=310

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 110/230 (48%), Gaps = 31/230 (13%)
 Frame = +3

Query  1221  PGFGSTPSDCRPVRTRFLYGSP-IRLTSPLNVSR*PIIQKVRRHPTKRLRLFVCTRFQVL  1397
             P  G  P   RPVRTRF  G   I LTSP   +R  I QK RRHP   LRL V TRFQVL
Sbjct  63    PASGLPPVTERPVRTRFRCGYAFIGLTSPPTATRGLINQKARRHPKWGLRLLVGTRFQVL  122

Query  1398  FHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSR------PTCRTLSTTGLI  1559
             FHSP GVLF FPSRYW TIGR  VFSLGGWSP + TGFHVSR      P   +    G +
Sbjct  123   FHSPSGVLFTFPSRYWCTIGRRVVFSLGGWSPQLPTGFHVSRGTREHGPGSPSPFAYGAV  182

Query  1560  SCTGLSPAMAPVSKGFHYQSDYHVQGSSH--------------FARHYfgnlg*flflql  1697
             + +G    +  + +GF   +   V+G +                 R +         L  
Sbjct  183   TLSGPPSQVVRLEEGF--VTPRRVRGLARPCPATPAWQRPRALTPRWFGLLPVRSPLLGE  240

Query  1698  lRCFSSPRSLR---YPMYSDN-----DDLKGRVSPFGNLRIKVCLLTPRS  1823
              R  S PR      +P Y             +VSPFGN  I  CL  PR+
Sbjct  241   SRLISFPRGTEMFHFPRYRTAFRRRVASTATQVSPFGNPGINACLRLPRA  290


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +1

Query  1063  EALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHP  1242
             EA P+  S RTSY +V LAFH YPQ+I   F +  FGPP     PS  P V H  SGL P
Sbjct  10    EAAPQCISGRTSYHRVRLAFHSYPQVIRGLFTVHRFGPPVGFNPPSPCPGVAHPASGLPP  69

Query  1243  AT  1248
              T
Sbjct  70    VT  71



>gb|EQA95122.1| hypothetical protein HPS_1373 [Haemophilus parasuis 29755]
Length=219

 Score = 77.4 bits (189),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  1405  PLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPL  1584
             P  GFFSPF H TGSLSV+ EYLALEDGPPIF+QDF+CPALLV  LVP    ++RGYHP+
Sbjct  122   PSLGFFSPFLHSTGSLSVNQEYLALEDGPPIFKQDFSCPALLVASLVPQHKLKIRGYHPV  181

Query  1585  WLLFPKDSTISPTIT  1629
              L FP +S++   IT
Sbjct  182   SLGFPANSSVFAAIT  196


 Score = 67.4 bits (163),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  1247  LSPCSDSI--SLRLPYPVNLATECKSLTHYTKGTPSPHEEAPTVCMHTVSGSISLPSRGS  1420
             LSPC   +      PY VNLAT+ KSLTHYTKGT SP   APT C +TVSGSISLPS G 
Sbjct  68    LSPCVAWLPFFFFFPYSVNLATKYKSLTHYTKGTQSPF-RAPTACTYTVSGSISLPSLGF  126

Query  1421  F  1423
             F
Sbjct  127   F  127


 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 48/72 (67%), Gaps = 8/72 (11%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT----CRTLSTTG  1553
             F+  F    GVLFAFPS+YWFTIG+  VFSLGGWSPH    F VSRPT    C  LSTT 
Sbjct  6     FRFYFTPLTGVLFAFPSQYWFTIGQSGVFSLGGWSPH----FLVSRPTCCKPCCKLSTTT  61

Query  1554  LISCTGLSPAMA  1589
               S TGLSP +A
Sbjct  62    KTSNTGLSPCVA  73



>ref|WP_003529620.1| hypothetical protein [[Clostridium] leptum]
 gb|EDO61937.1| hypothetical protein CLOLEP_01448 [ [[Clostridium] leptum DSM 
753]
Length=139

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 68/105 (65%), Gaps = 9/105 (9%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTAAVYW FN  LA   L FQHRAGV+PYTS+F  AE CVF KQS  P++C      
Sbjct  26   TVIVTAAVYWGFNSMLAHLLLTFQHRAGVSPYTSSFDLAETCVFAKQSPGPIHC------  79

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYG  315
                  +GA L PKLR QFAEFL   S   LRIL   TCVGLRYG
Sbjct  80   ---GSISGASLFPKLRDQFAEFLNYPSPVGLRILFLSTCVGLRYG  121



>ref|WP_005423973.1| hypothetical protein [[Ruminococcus] obeum]
 gb|EDM87028.1| hypothetical protein RUMOBE_02439 [Ruminococcus obeum ATCC 29174]
Length=199

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 109/201 (54%), Gaps = 14/201 (7%)
 Frame = +1

Query  1021  PPSHNSALPPMVILEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPS  1200
             PP   SALPP +  +A PK  S RTSY +V L F PYP LIP  FN  GFGPP  +TA S
Sbjct  3     PPRKFSALPPQISTKASPKAISRRTSYLRVRLEFLPYPHLIPTLFNGCGFGPPLPLTAAS  62

Query  1201  SWPWVDHLVSGLHPATVALFGLDFSTAPLSG*PRH*M*VADPL--YKRYAVTPRRGSD--  1368
             +W W+DH VSGL P T+AL  L F TAP      H   +  P+   +R  +   RG    
Sbjct  63    TWTWIDHPVSGLPPLTLALLRLGFPTAP------HLRCLTLPVSATRRTVLQKVRGRAYK  116

Query  1369  ---CLYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvr  1539
                 L   GF+  F   PG    FP    +LSV   YLAL  GPP F Q F+C   ++  
Sbjct  117   ALPQLVDTGFQVLFHSPPGVLFTFPSQYYALSVTKWYLALGGGPPYFPQGFSC-PAVLWI  175

Query  1540  lvppv*frvrGYHPLWLLFPK  1602
             L+  + FR+RG+HPL   FPK
Sbjct  176   LLSLLCFRLRGFHPLRPAFPK  196



>ref|WP_005427226.1| hypothetical protein [[Ruminococcus] obeum]
 gb|EDM87878.1| hypothetical protein RUMOBE_01293 [Ruminococcus obeum ATCC 29174]
Length=199

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 109/201 (54%), Gaps = 14/201 (7%)
 Frame = +1

Query  1021  PPSHNSALPPMVILEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPS  1200
             PP   SALPP +  +A PK  S RTSY +V L F PYP LIP  FN  GFGPP  +TA S
Sbjct  3     PPRKFSALPPQISTKASPKAISRRTSYLRVRLEFLPYPHLIPTLFNGCGFGPPLPLTAAS  62

Query  1201  SWPWVDHLVSGLHPATVALFGLDFSTAPLSG*PRH*M*VADPL--YKRYAVTPRRGSD--  1368
             +W W+DH VSGL P T+AL  L F TAP      H   +  P+   +R  +   RG    
Sbjct  63    TWTWIDHPVSGLPPLTLALLRLGFPTAP------HLRCLTLPVSATRRTVLQKVRGRAYK  116

Query  1369  ---CLYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvr  1539
                 L   GF+  F   PG    FP    +LSV   YLAL  GPP F Q F+C   ++  
Sbjct  117   ALPQLVDTGFQVLFHSPPGVLFTFPSQYYALSVTKWYLALGGGPPHFPQGFSC-PAVLWI  175

Query  1540  lvppv*frvrGYHPLWLLFPK  1602
             L+  + FR+RG+HPL   FPK
Sbjct  176   LLSLLCFRLRGFHPLRPAFPK  196



>gb|KGC54484.1| putative serine acetyltransferase [Burkholderia mallei]
 gb|KGD54992.1| putative serine acetyltransferase [Burkholderia pseudomallei]
Length=109

 Score =   107 bits (267),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  1372  LYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvpp  1551
             +YA GFR YFTPLPGFFSPFPHGTGSLSVD+EYLALEDGPPIFRQDFTCPALLVV LV  
Sbjct  1     MYACGFRIYFTPLPGFFSPFPHGTGSLSVDHEYLALEDGPPIFRQDFTCPALLVVHLVLS  60

Query  1552  v*frvrGYHPLWLLFPKDSTISPTITYKAHP  1644
               FR++GYH LW  FP+ S  +    Y+  P
Sbjct  61    YCFRLQGYHLLWPHFPERSANNTNKEYRLFP  91


 Score = 35.0 bits (79),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +2

Query  1634  RLIPFRSPLLWESRLIS  1684
             RL PFRSPLLWESRLIS
Sbjct  88    RLFPFRSPLLWESRLIS  104



>emb|CDW93821.1| conserved hypothetical protein [Thiomonas sp. CB2]
Length=80

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +3

Query  516  LTCFPSATHLCLALGADSPCSDER*TGNLGLSARGLFTLFIATHVSIRTSDTSSILYKTP  695
            +TCFPS THLCLALGADSP +DER  GNL LSA+ LFT F ATHVSIRTSDTSS+   TP
Sbjct  1    MTCFPSTTHLCLALGADSPYADERCVGNLALSAKRLFTSFNATHVSIRTSDTSSMPLSTP  60

Query  696  SQAYGTLSYHMCKHI  740
            SQAY TL YH+  HI
Sbjct  61   SQAYRTLLYHVLTHI  75



>gb|AEQ20465.1| hypothetical protein [uncultured bacterium CSL142]
Length=93

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  516  LTCFPSATHLCLALGADSPCSDER*TGNLGLSARGLFTLFIATHVSIRTSDTSSILYKTP  695
            +T FPS T   LALG DSPC+DER  GNLGLSA G FT FIATHVSIRTSDTSS  Y++P
Sbjct  1    MTDFPSTTPFGLALGTDSPCTDERGAGNLGLSASGPFTRFIATHVSIRTSDTSSNPYESP  60

Query  696  SQAYGTLSYHMC  731
            SQAY TLSYH C
Sbjct  61   SQAYRTLSYHSC  72



>ref|WP_021399582.1| hypothetical protein [Peptoclostridium difficile]
 gb|EQG74591.1| hypothetical protein QKA_3524 [Clostridium difficile DA00165]
 gb|EQJ20122.1| hypothetical protein QS3_0132 [Clostridium difficile P13]
 gb|EQJ85959.1| hypothetical protein QU7_0117 [Clostridium difficile P46]
 gb|ERM50695.1| hypothetical protein QUG_0137 [Clostridium difficile P53]
 gb|ERM52323.1| hypothetical protein QUQ_0118 [Clostridium difficile P68]
Length=152

 Score = 71.2 bits (173),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +3

Query  1251  RPVRTRFLYGSPIR-LTSPLNVSR*PIIQKVRRHPTKRLRLFVCTRFQVLFHSPPGVLFA  1427
             R V+TRF YGS ++ LT  LNV+R P++QKVR H    L   V   FQVLFHSPPGVLF 
Sbjct  81    RSVKTRFRYGSHLKCLTLLLNVTRWPVLQKVRGHTRNVLPQLVSAGFQVLFHSPPGVLFT  140

Query  1428  FPSRYW  1445
             FPSRY+
Sbjct  141   FPSRYY  146


 Score = 63.9 bits (154),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  1015  Q*PPSHNSALPPMVILEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTA  1194
             Q P  H+     +  LEA PK  S RTSY +  L FH YPQ+IP  FN  GFGPP   T 
Sbjct  2     QYPLGHSVLYLRISHLEASPKAISGRTSYLRARLEFHRYPQVIPELFNARGFGPPRNFTF  61

Query  1195  PSSWPWVDHLVSGLHPAT  1248
              SS  WV   VSGL   T
Sbjct  62    ASSCSWVGRPVSGLRQVT  79



>gb|EQJ26087.1| hypothetical protein QS5_0359 [Clostridium difficile P15]
 gb|EQJ96212.1| hypothetical protein QUA_0359 [Clostridium difficile P49]
 gb|EQJ96666.1| hypothetical protein QUA_0130 [Clostridium difficile P49]
 gb|EQJ96934.1| hypothetical protein QUA_0121 [Clostridium difficile P49]
 gb|ERM33690.1| hypothetical protein QUO_3590 [Clostridium difficile P64]
 gb|ERM40316.1| hypothetical protein QUO_0144 [Clostridium difficile P64]
 gb|ERM40423.1| hypothetical protein QUO_0136 [Clostridium difficile P64]
Length=144

 Score = 70.9 bits (172),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +3

Query  1251  RPVRTRFLYGSPIR-LTSPLNVSR*PIIQKVRRHPTKRLRLFVCTRFQVLFHSPPGVLFA  1427
             R V+TRF YGS ++ LT  LNV+R P++QKVR H    L   V   FQVLFHSPPGVLF 
Sbjct  73    RSVKTRFRYGSHLKCLTLLLNVTRWPVLQKVRGHTRNVLPQLVSAGFQVLFHSPPGVLFT  132

Query  1428  FPSRYW  1445
             FPSRY+
Sbjct  133   FPSRYY  138


 Score = 63.9 bits (154),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  1060  LEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLH  1239
             LEA PK  S RTSY +  L FH YPQ+IP  FN  GFGPP   T  SS  WV   VSGL 
Sbjct  9     LEASPKAISGRTSYLRARLEFHRYPQVIPELFNARGFGPPRNFTFASSCSWVGRPVSGLR  68

Query  1240  PAT  1248
               T
Sbjct  69    QVT  71



>gb|KHF26993.1| hypothetical protein CM49_06689 [Paenibacillus sp. P1XP2]
Length=156

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 68/112 (61%), Gaps = 0/112 (0%)
 Frame = +1

Query  913   VWVVSLLTPDVSTRRLSPKLALTGIRSLQWFGKSQ*PPSHNSALPPMVILEALPK*FSER  1092
             VW VSLLT D+ST  L+P  ++ GIRSL   G    P + +         EA PK  S R
Sbjct  2     VWAVSLLTMDLSTHCLTPGQSVYGIRSLTELGNPCGPRTQSVLYLHDCTTEASPKAISGR  61

Query  1093  TSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPAT  1248
             TSY +V L F  YP LIP FFNI GFGPP RVTAPS W  VDH VSGL P T
Sbjct  62    TSYLRVRLEFLRYPHLIPEFFNIRGFGPPVRVTAPSPWTGVDHTVSGLRPRT  113



>gb|EKK92457.1| hypothetical protein VCHC1A2_3330 [Vibrio cholerae HC-1A2]
Length=133

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 85/140 (61%), Gaps = 15/140 (11%)
 Frame = +1

Query  1477  LEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPLWLLFPKDSTISPTITY-----KAH  1641
             +EDGPPIFRQD TCPALL   L                L P  + +S   TY     +A+
Sbjct  1     MEDGPPIFRQDITCPALLDFTLDEASVTG---------LSPCIAKLSSLFTYFTECLRAN  51

Query  1642  PISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQITMT*KA-GFPHSEICGSKCVCSLP  1818
             P SLA T GISVDFFS  YLDVSV  V  V LCIQ+T+T  A GFPHSEI  S     L 
Sbjct  52    PDSLAATTGISVDFFSSGYLDVSVPPVCSVNLCIQLTVTAYAVGFPHSEIADSNGSYCLI  111

Query  1819  AAYRKLLRPSSPVIAKASTM  1878
              AYRKL+RPSSP+ A+AST+
Sbjct  112   CAYRKLVRPSSPLTAQASTV  131



>ref|WP_001890945.1| hypothetical protein [Vibrio cholerae]
 gb|EAX56623.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gb|EAX60309.1| serine acetyltransferase [Vibrio cholerae V52]
 gb|EAX60318.1| conserved hypothetical protein [Vibrio cholerae V52]
 gb|EAY32127.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gb|EAY32277.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gb|EAY39463.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gb|EAY39538.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gb|EAZ75437.1| conserved hypothetical protein [Vibrio cholerae B33]
 gb|EDL73566.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gb|EDM52716.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gb|EDM52717.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gb|EKK92178.1| hypothetical protein VCHC1A2_3588 [Vibrio cholerae HC-1A2]
 gb|EKK94953.1| hypothetical protein VCHC1A2_1704 [Vibrio cholerae HC-1A2]
 gb|EKK95542.1| hypothetical protein VCHC1A2_1314 [Vibrio cholerae HC-1A2]
 gb|EKK97551.1| hypothetical protein VCHC1A2_0179 [Vibrio cholerae HC-1A2]
 gb|KFD82659.1| putative serine acetyltransferase [Vibrio cholerae]
 gb|KFD86186.1| putative serine acetyltransferase [Vibrio cholerae]
Length=133

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 85/140 (61%), Gaps = 15/140 (11%)
 Frame = +1

Query  1477  LEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPLWLLFPKDSTISPTITY-----KAH  1641
             +EDGPPIFRQD TCPALL   L                L P  + +S   TY     +A+
Sbjct  1     MEDGPPIFRQDITCPALLDFTLDEASVTG---------LSPCIAKLSSLFTYFTECLRAN  51

Query  1642  PISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQITMT*KA-GFPHSEICGSKCVCSLP  1818
             P SLA T GISVDFFS  YLDVSV  V  V LCIQ+T+T  A GFPHSEI  S     L 
Sbjct  52    PGSLAATTGISVDFFSSGYLDVSVPPVCSVNLCIQLTVTAYAVGFPHSEIADSNGSYCLI  111

Query  1819  AAYRKLLRPSSPVIAKASTM  1878
              AYRKL+RPSSP+ A+AST+
Sbjct  112   CAYRKLVRPSSPLTAQASTV  131



>gb|EDM53059.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
Length=133

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 85/140 (61%), Gaps = 15/140 (11%)
 Frame = +1

Query  1477  LEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPLWLLFPKDSTISPTITY-----KAH  1641
             +EDGPPIFRQD TCPALL   L                L P  + +S   TY     +A+
Sbjct  1     MEDGPPIFRQDITCPALLDFTLDEASVTG---------LSPCIAKLSSLFTYFIECLRAN  51

Query  1642  PISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQITMT*KA-GFPHSEICGSKCVCSLP  1818
             P SLA T GISVDFFS  YLDVSV  V  V LCIQ+T+T  A GFPHSEI  S     L 
Sbjct  52    PGSLAATTGISVDFFSSGYLDVSVPPVCSVNLCIQLTVTAYAVGFPHSEIADSNGSYCLI  111

Query  1819  AAYRKLLRPSSPVIAKASTM  1878
              AYRKL+RPSSP+ A+AST+
Sbjct  112   CAYRKLVRPSSPLTAQASTV  131



>gb|ABM53545.1| conserved hypothetical protein [uncultured beta proteobacterium 
CBNPD1 BAC clone 578]
Length=126

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  1372  LYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvpp  1551
             +YA GFR YFTPLPGFFSPFPHGT SLSV+YEYLALEDGPPIFRQD+TCPALLVVR VP 
Sbjct  1     MYACGFRIYFTPLPGFFSPFPHGTCSLSVNYEYLALEDGPPIFRQDYTCPALLVVRSVPQ  60

Query  1552  v*frvrGYHPLWLLFP  1599
             + F ++GYH LW  FP
Sbjct  61    IAFLIQGYHLLWPDFP  76



>ref|WP_009610708.1| hypothetical protein [Caldanaerobacter subterraneus]
 gb|EEB75630.1| hypothetical protein CDSM653_949 [Caldanaerobacter subterraneus 
subsp. pacificus DSM 12653]
Length=155

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 64/105 (61%), Gaps = 11/105 (10%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTAAV+W F  E  P  L FQHRAGV+PYTS F  AE CVF KQS  P+        
Sbjct  57   TVIVTAAVHWGFGSEPTPFPLTFQHRAGVSPYTSPFGLAETCVFGKQSLGPL--------  108

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYG  315
                    A L+PKLR  FAEFL   S  RL IL SPTCVGLRYG
Sbjct  109  ---LCGLSALLLPKLRSHFAEFLKEGSPARLWILSSPTCVGLRYG  150



>gb|ADI16883.1| hypothetical protein [uncultured gamma proteobacterium HF0010_16J05]
Length=71

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -3

Query  1870  MPWRLQAMKDVVACDKLRGVSKHTLIRRFPNGETRPFRS-SLSEYIG*RSERGELKHLSS  1694
             MPW+L+AMKDVVACD  RGV K TLIR FPNGET P    S  EYIG R E GELK+LS+
Sbjct  1     MPWQLKAMKDVVACDMPRGVGKQTLIRGFPNGETHPTCGISAPEYIGCRGELGELKYLST  60

Query  1693  CRKRNQPRFPK  1661
              RKRNQPRFP+
Sbjct  61    QRKRNQPRFPQ  71



>ref|WP_001899247.1| hypothetical protein [Vibrio cholerae]
 gb|EAY39411.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
Length=133

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 84/140 (60%), Gaps = 15/140 (11%)
 Frame = +1

Query  1477  LEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPLWLLFPKDSTISPTITY-----KAH  1641
             +EDGPPIFRQD TCPALL   L                L P  + +S   TY     +A+
Sbjct  1     MEDGPPIFRQDITCPALLDFTLDEASVTG---------LSPCIAKLSSLFTYFTECLRAN  51

Query  1642  PISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQITMT*KA-GFPHSEICGSKCVCSLP  1818
             P SLA T GISVDFFS  YLDVSV  V  V LCIQ+T+T  A  FPHSEI  S     L 
Sbjct  52    PGSLAATTGISVDFFSSGYLDVSVPPVCSVNLCIQLTVTAYAVEFPHSEIADSNGSYCLI  111

Query  1819  AAYRKLLRPSSPVIAKASTM  1878
              AYRKL+RPSSP+ A+AST+
Sbjct  112   CAYRKLVRPSSPLTAQASTV  131



>gb|EJH48895.1| hypothetical protein VCCP104821_0250 [Vibrio cholerae CP1048(21)]
Length=168

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 95/183 (52%), Gaps = 31/183 (17%)
 Frame = +1

Query  1372  LYAHGFRFYFTPLPGFFSPFPH-------GTGSLSVDYEYLALEDGPPIFRQ-DFTCpal  1527
             +Y HGFRFYFTPL G    FP         +G  S+      ++ G  + R  DFT    
Sbjct  1     MYVHGFRFYFTPLTGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRLLDFTLDEA  60

Query  1528  lvvrlvppv*frvrGYHPLWLLFPKDSTISPTITY-----KAHPISLATTLGISVDFFSC  1692
              V                   L P  + +S   TY     +A+P SLA T GISVDFFS 
Sbjct  61    SVTG-----------------LSPCIAKLSSLFTYFTECLRANPGSLAATTGISVDFFSS  103

Query  1693  SYLDVSVRRVRFVTLCIQITMT*KA-GFPHSEICGSKCVCSLPAAYRKLLRPSSPVIAKA  1869
              YLDVSV  V  V LCIQ+T+T  A GFPHSEI  S     L  AYRKL+RPSSP+ A+A
Sbjct  104   GYLDVSVPPVCSVNLCIQLTVTAYAVGFPHSEIADSNGSYCLICAYRKLVRPSSPLTAQA  163

Query  1870  STM  1878
             ST+
Sbjct  164   STV  166


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISC  1565
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSR    TL      S 
Sbjct  6     FRFYFTPLTGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRLLDFTLDEA---SV  62

Query  1566  TGLSPAMAPVSKGFHYQSD  1622
             TGLSP +A +S  F Y ++
Sbjct  63    TGLSPCIAKLSSLFTYFTE  81



>emb|CDW61111.1| hypothetical protein TTRE_0000953901 [Trichuris trichiura]
Length=253

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTAAV+W F+  LA   L FQHRAGV+ YTS+F  A+ CVF KQ   P+ C      
Sbjct  118  TVIVTAAVHWGFDSMLAHLLLTFQHRAGVSSYTSSFDLAQTCVFGKQLLGPILCGSI---  174

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYG  315
                  +GA L+PKLR QFAEFL   S   LRI   PTCVGLRYG
Sbjct  175  ------SGAPLLPKLRGQFAEFLNNPSPVGLRIFFLPTCVGLRYG  213



>gb|ADI18832.1| hypothetical protein [uncultured beta proteobacterium HF0010_04H24]
Length=55

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = -1

Query  369  TKQSEVVPRKASKLQSYETVPQTDTGGRDEYSKALERTREKELGKLVP  226
            TKQSEVVPRKASKLQSYETVPQTDTGGRDEYSKALERTREKELGKLVP
Sbjct  8    TKQSEVVPRKASKLQSYETVPQTDTGGRDEYSKALERTREKELGKLVP  55



>gb|EGG54220.1| hypothetical protein HMPREF9439_01518 [Parasutterella excrementihominis 
YIT 11859]
Length=82

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPV  156
            TVIVTAAVYWDF+Q L+PH LIFQHRAG+TPYTS+F FAECCVF KQSQPP+
Sbjct  30   TVIVTAAVYWDFDQGLSPHQLIFQHRAGITPYTSSFDFAECCVFNKQSQPPI  81



>gb|ETI82480.1| hypothetical protein Q618_VCMC00001G0061 [Varibaculum cambriense 
DORA_20]
 gb|ETI82948.1| hypothetical protein Q618_VCMC00001G0529 [Varibaculum cambriense 
DORA_20]
Length=392

 Score =   103 bits (256),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 74/131 (56%), Gaps = 14/131 (11%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPATVALFGLDFSTAPLSG  1293
             +AFHPYPQLIP  FN+ G GPP R TA S+WPWVDH  SGL  AT+   GL F T     
Sbjct  1     MAFHPYPQLIPPVFNLGGCGPPRRSTAASTWPWVDHPASGLCHATITPPGLGFPTTT---  57

Query  1294  *PRH*M*VADPLYKRYAV--TP--------RRGSDCLYAHGFRFYFTPLPGFFSPFPHGT  1443
              P+          + ++   TP         RGSD L   GFR YFTPLPG+FSPFPHGT
Sbjct  58    -PQQVNLATQHNSQAHSSIGTPPPHQPPKGSRGSDGLKTLGFRNYFTPLPGYFSPFPHGT  116

Query  1444  GSLSVDYEYLA  1476
               LSV     A
Sbjct  117   NPLSVTMPVQA  127



>ref|WP_007506545.1| hypothetical protein, partial [Caldalkalibacillus thermarum]
 gb|EGL81434.1| hypothetical protein CathTA2_0037 [Caldalkalibacillus thermarum 
TA2.A1]
Length=169

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 67/99 (68%), Gaps = 8/99 (8%)
 Frame = +3

Query  1242  SDCRPVRTRFLYGSPIRLTSPLNVSR*PIIQKVRRHPTKR---LRLFVCTRFQVLFHSPP  1412
             SD   +R R L+G    LTS   V+R  I+QK RRH       LRL V TRFQVLFHSPP
Sbjct  6     SDSLSLRLR-LFG----LTSHETVTRRFILQKARRHTALTGIVLRLVVGTRFQVLFHSPP  60

Query  1413  GVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT  1529
             GVLF FPSRYWFTIGR  VFSLG WS  I TGFHVSR T
Sbjct  61    GVLFTFPSRYWFTIGRWGVFSLGRWSSRIPTGFHVSRRT  99



>ref|WP_005921497.1| hypothetical protein [Faecalibacterium prausnitzii]
 gb|EDP19791.1| hypothetical protein FAEPRAM212_02572 [Faecalibacterium prausnitzii 
M21/2]
 gb|EDP22128.1| hypothetical protein FAEPRAM212_01164 [Faecalibacterium prausnitzii 
M21/2]
 gb|EDP22975.1| hypothetical protein FAEPRAM212_00173 [Faecalibacterium prausnitzii 
M21/2]
Length=267

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTAAV+W F+  LA   L FQHRAGV+ YTS+F  A+ CVF KQ   P+ C      
Sbjct  132  TVIVTAAVHWGFDSMLAHLLLTFQHRAGVSSYTSSFDLAQTCVFGKQLLGPILCGSI---  188

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYG  315
                  +GA L+PKLR QFAEFL   S   LRI   PTCVGLRYG
Sbjct  189  ------SGAPLLPKLRGQFAEFLNNPSPVGLRIFFLPTCVGLRYG  227



>ref|WP_005924044.1| hypothetical protein [Faecalibacterium prausnitzii]
 gb|EDP21864.1| hypothetical protein FAEPRAM212_01694 [Faecalibacterium prausnitzii 
M21/2]
Length=267

 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTAAV+W F+  LA   L FQHRAGV+ YTS+F  A+ CVF KQ   P+ C      
Sbjct  132  TVIVTAAVHWGFDSMLAHLLLTFQHRAGVSSYTSSFDLAQTCVFGKQLLGPILCGSI---  188

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYG  315
                  +GA L+PKLR QFAEFL   S   LRI   PTCVGLRYG
Sbjct  189  ------SGAPLLPKLRGQFAEFLNNPSPVGLRIFFLPTCVGLRYG  227



>ref|WP_005920085.1| hypothetical protein [Faecalibacterium prausnitzii]
 gb|EDP22261.1| hypothetical protein FAEPRAM212_00886 [Faecalibacterium prausnitzii 
M21/2]
 gb|EDP22759.1| hypothetical protein FAEPRAM212_00540 [Faecalibacterium prausnitzii 
M21/2]
Length=267

 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTAAV+W F+  LA   L FQHRAGV+ YTS+F  A+ CVF KQ   P+ C      
Sbjct  132  TVIVTAAVHWGFDSMLAHLLLTFQHRAGVSSYTSSFDLAQTCVFGKQLLGPILC------  185

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYG  315
                  +GA L+PKLR QFAEFL   S   LRI   PTCVGLRYG
Sbjct  186  ---GSISGAPLLPKLRGQFAEFLNNPSPVGLRIFFLPTCVGLRYG  227



>gb|EEU95451.1| hypothetical protein FAEPRAA2165_02967, partial [Faecalibacterium 
prausnitzii A2-165]
Length=288

 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTAAV+W F+  LA   L FQHRAGV+ YTS+F  A+ CVF KQ   P+ C      
Sbjct  153  TVIVTAAVHWGFDSMLAHLLLTFQHRAGVSSYTSSFDLAQTCVFGKQLLGPILC------  206

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYG  315
                  +GA L+PKLR QFAEFL   S   LRI   PTCVGLRYG
Sbjct  207  ---GSISGAPLLPKLRGQFAEFLNNPSPVGLRIFFLPTCVGLRYG  248



>gb|ADI16721.1| hypothetical protein [uncultured Verrucomicrobiales bacterium 
HF0010_05E02]
Length=126

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 66/105 (63%), Gaps = 8/105 (8%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTA ++   + +L+P  L F H + VTPYTST+V AE CVF KQS    +C      
Sbjct  26   TVIVTADIHGGLDPKLSPQALTFPHWSQVTPYTSTYVLAESCVFAKQSVGLFHCG-----  80

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYG  315
                  + A L+PKLR  FAEFL   SL RLRILIS TCVGLRYG
Sbjct  81   ---LARSQAPLLPKLRGNFAEFLKEVSLTRLRILISDTCVGLRYG  122



>gb|ENV71128.1| hypothetical protein F947_00014, partial [Acinetobacter towneri 
DSM 14962 = CIP 107472]
Length=164

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 88/172 (51%), Gaps = 30/172 (17%)
 Frame = +3

Query  1413  GVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT---CRTLSTTGLISCTGLSPA  1583
             GVLFAFPSRYWFTIG+  VFSLGGWSPHIQT FHV RPT   C      G I+    +  
Sbjct  7     GVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTRFHVPRPTRHHCVCPFVYGNITLYVRTSQ  66

Query  1584  MAPVSKGFHYQSDYHVQGSSHFARHYfgnlg*flflqllRCFSSPRS---LRYPMYSDND  1754
               P+          H Q +  F             L+  +  S P+      +P ++ +D
Sbjct  67    SVPLE---------HTQLNGLFP-------FRSPLLRESQLISFPKGTEMFHFPSFALHD  110

Query  1755  --------DLKGRVSPFGNLRIKVCLLTPRSLSQATTSFIACNRQGIHHVHL  1886
                          VSPF +LRIK  L  PRS SQA TSFIA + QGIHH+HL
Sbjct  111   YVFIMQYLSYDKWVSPFRHLRIKGYLPPPRSFSQAITSFIASDCQGIHHMHL  162



>dbj|BAO82212.1| hypothetical protein SRAA_2358 [Comamonadaceae bacterium A1]
 dbj|BAO82213.1| hypothetical protein SRAA_2359 [Comamonadaceae bacterium A1]
 dbj|BAO84599.1| hypothetical protein SMCB_2371 [Comamonadaceae bacterium B1]
 dbj|BAO84600.1| hypothetical protein SMCB_2372 [Comamonadaceae bacterium B1]
Length=59

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -1

Query  999  LQTPNTGECELGRQTSGANVRRQEGNNPDRQLRSQRLAKWKTKWEG*NSQDVGLEAAII  823
            +QTPNT E  LG +  GANVR QEGNNPDRQLRS +LAKW+TKWEG NSQDVGLEAAII
Sbjct  1    MQTPNTDEYSLGDRAPGANVRTQEGNNPDRQLRSLKLAKWETKWEGYNSQDVGLEAAII  59



>ref|WP_004846641.1| hypothetical protein [[Ruminococcus] torques]
 gb|EDK25107.1| hypothetical protein RUMTOR_00910 [Ruminococcus torques ATCC 
27756]
Length=245

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 95/187 (51%), Gaps = 14/187 (7%)
 Frame = +1

Query  1063  EALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHP  1242
             EA PK  S RTSY +V L F PYP LIP  FN  GFGPP   TA S+W W+DH VSGL  
Sbjct  3     EASPKAISRRTSYLRVRLEFLPYPHLIPTLFNGCGFGPPLPFTATSTWTWIDHPVSGLLR  62

Query  1243  ATVALFGLDFSTAPLSG*PRH*M*VADP-------LYKRYAVTPRRGSDCLYAHGFRFYF  1401
              T ALF L F +AP      H   +  P       + ++YA +  +    L    F+  F
Sbjct  63    LTFALFRLGFPSAP------HLQCLTSPASVTRRTVLQKYAGSSYKDVPQLENIWFQVLF  116

Query  1402  TPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvppv*frvrGYHP  1581
                PG   PFP    +LS   EYLAL  G P   Q  TC   L+      + FR+R +HP
Sbjct  117   QSPPGGLFPFPSQYYALSGTKEYLALRGGSPHISQGSTC-LDLLWIPPCQLAFRLRDFHP  175

Query  1582  LWLLFPK  1602
             LW  FPK
Sbjct  176   LWSAFPK  182



>gb|EKE04739.1| hypothetical protein ACD_20C00008G0002 [uncultured bacterium]
Length=209

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 104/226 (46%), Gaps = 48/226 (21%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPATVALFGLDFSTAPLSG  1293
             + FHPYPQ+I   F+ + F PP   T  S   W+DH VSGL P T A +    S      
Sbjct  1     MVFHPYPQVIQKVFSPNWFEPPLGFTRASLCSWIDHSVSGLLPRTKAPYSDSLSLR----  56

Query  1294  *PRH*M*VADPLYKRYAVTPRRGSDCL--YAHGFRFYFTPLP----------------GF  1419
                          + + +   R S+ L  YA G R +   LP                G 
Sbjct  57    ------------LRHFRLNLARKSNSLTHYAKGTRSHPKVLPPLVGNRFQVLLHSPNRGS  104

Query  1420  FSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPLWLLFP  1599
             FSPFPHGTGSLSV  EYLALEDGPP F +DF+   +++   +     RVRG+H LW  FP
Sbjct  105   FSPFPHGTGSLSVAKEYLALEDGPPRFPRDFSG-LVVLGYRLRHFQVRVRGFHTLWRAFP  163

Query  1600  KDSTISPTITYK-------------AHPISLATTLGISVDFFSCSY  1698
               S     I Y              A P SLA T GIS DF SC Y
Sbjct  164   DASPAYSWIAYVGPTTPDRRIYPVWALPSSLAATRGISFDFSSCRY  209



>gb|EBA38672.1| hypothetical protein COLAER_02246 [Collinsella aerofaciens ATCC 
25986]
Length=223

 Score = 79.3 bits (194),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = +2

Query  1283  PYPVNLAT--ECKSLTHYTKGTPSPHEEAPTVCMHTVSGSISLPSRGSFRLSLTVLVHYR  1456
             P P  L +     SL H TKGTPS  + APT    TVSG++SLPSRG+F LSLTVLV YR
Sbjct  56    PAPFRLTSPRASDSLAHSTKGTPSQLKVAPTARGRTVSGTVSLPSRGAFHLSLTVLVRYR  115

Query  1457  SITSI*PWRMVPPYSDRISRVPPYLSYA  1540
             S  S   W +V P SDR+SR  PY   A
Sbjct  116   SQGSTQAWMVVHPGSDRVSRARPYSGTA  143


 Score = 45.4 bits (106),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 1/58 (2%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPAT-VALFGLDFSTAP  1284
             +AFHPYPQ+I   FN   FGPP  +T  S+ P + H  S     T VAL  L F+ AP
Sbjct  1     MAFHPYPQVIAAVFNRRAFGPPRGLTPASACPRIAHPASRPRRGTQVALLRLAFAPAP  58



>gb|EEA89302.1| hypothetical protein COLSTE_02537 [Collinsella stercoris DSM 
13279]
Length=346

 Score = 89.0 bits (219),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  1313  KSLTHYTKGTPSPHEEAPTVCMHTVSGSISLPSRGSFRLSLTVLVHYRSITSI*PWRMVP  1492
              SL H TKGTPS    APT C  TVSG++SLPSRG+F LSLTVLV YRS  SI  WR+VP
Sbjct  70    NSLAHSTKGTPSHRMGAPTPCGRTVSGTVSLPSRGAFHLSLTVLVRYRSHGSIQAWRVVP  129

Query  1493  PYSDRISRVPPY  1528
             P SDR+SR  PY
Sbjct  130   PGSDRVSRARPY  141


 Score = 35.0 bits (79),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 27/57 (47%), Gaps = 1/57 (2%)
 Frame = +3

Query  1137  AHPLIFQH*WVRTSRACYRTFILAMGRSPGFGSTPSDC-RPVRTRFLYGSPIRLTSP  1304
              H   FQ   VR S   Y  F L    SPGF S   D  RP RTRF  GS   LTSP
Sbjct  10    GHRRTFQRTSVRPSTGSYPRFSLPRDSSPGFASAARDWERPFRTRFRSGSLPSLTSP  66



>ref|WP_005937134.1| conserved domain protein, partial [Faecalibacterium prausnitzii]
 gb|EFQ08391.1| hypothetical protein HMPREF9436_00081, partial [Faecalibacterium 
cf. prausnitzii KLE1255]
Length=242

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 64/105 (61%), Gaps = 9/105 (9%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTAAV+W F+  LA   L FQHRAGV+ YTS+F  A+ CVF KQ   P+ C      
Sbjct  132  TVIVTAAVHWGFDSMLAHLLLTFQHRAGVSSYTSSFDLAQTCVFGKQLLGPILCGCI---  188

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYG  315
                    A L+PKLR QFAEFL   S   LRI   PTCVGLRYG
Sbjct  189  ------AAAPLLPKLRGQFAEFLNNPSPVGLRIFFLPTCVGLRYG  227



>emb|CDF98816.1| Putative Uncharacterized protein [Avibacterium paragallinarum 
JF4211]
 emb|CDF97944.1| Putative Uncharacterized protein [Avibacterium paragallinarum 
JF4211]
Length=200

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISC  1565
             F+  F    GVLFAFPS+YWFTIG+  VFSLGGWSPH+QTGF VSRPT R LSTT  I  
Sbjct  6     FRFYFTPLTGVLFAFPSQYWFTIGQSGVFSLGGWSPHLQTGFLVSRPTSRKLSTTAWILS  65

Query  1566  TGLSPAMAPVSKGFHYQSDYHV  1631
             TGLSP +A + + F Y   Y++
Sbjct  66    TGLSPCVACLPRQFLYLCCYYL  87


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 75/178 (42%), Gaps = 8/178 (4%)
 Frame = +1

Query  1372  LYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvpp  1551
             +Y  GFRFYFTPL G    FP             +L    P  +  F        +L   
Sbjct  1     MYVQGFRFYFTPLTGVLFAFPSQYWFTIGQSGVFSLGGWSPHLQTGFLVSRPTSRKLSTT  60

Query  1552  v*frvrGYHPLWLLFPKDSTISPTITYKAHPISLATTLGISVDFFSCSYLDVSVRRVRFV  1731
                   G  P     P+           A P+SLA T  ISVDFFS  YLDVSV  VR  
Sbjct  61    AWILSTGLSPCVACLPRQFLYLCCYYLLAPPLSLAATHRISVDFFSSGYLDVSVLPVRLT  120

Query  1732  TLCI-----QITMT*KAGFPHSEICGSKCVCSLPAAYRKLLRPSSPVIAKASTMCTYS  1890
              L       ++     + F H  +  S     L  A+R+L RPSSP+IAKAS +  +S
Sbjct  121   RLFYSPRNDRLFAYRVSPFGHRGLNASY---QLTHAFRRLARPSSPLIAKASALYAFS  175



>ref|WP_001894078.1| hypothetical protein, partial [Vibrio cholerae]
 gb|EAY32215.1| conserved hypothetical protein [Vibrio cholerae 1587]
Length=152

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 89/157 (57%), Gaps = 22/157 (14%)
 Frame = +1

Query  1447  SLSVDYEYLALEDG-------PPIFRQDFTCpallvvrlvppv*frvrGYHPLWLLFPKD  1605
             SLS+ Y +   + G       PPIFRQD TCPALL   L                L P  
Sbjct  3     SLSLTYWFTIGQSGVFSLGGCPPIFRQDITCPALLDFTLDEASVTG---------LSPCI  53

Query  1606  STISPTITY-----KAHPISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQITMT*KA-  1767
             + +S   TY     +A+P SLA T GISVDFFS  YLDVSV  V  V LCIQ+T+T  A 
Sbjct  54    AKLSSLFTYFTECLRANPGSLAATTGISVDFFSSGYLDVSVPPVCSVNLCIQLTVTAYAV  113

Query  1768  GFPHSEICGSKCVCSLPAAYRKLLRPSSPVIAKASTM  1878
             GFPHSEI  S     L  AYRKL+RPSSP+ A+AST+
Sbjct  114   GFPHSEIADSNGSYCLICAYRKLVRPSSPLTAQASTV  150



>emb|CDF98165.1| Putative Uncharacterized protein [Avibacterium paragallinarum 
JF4211]
 emb|CDF98117.1| Putative Uncharacterized protein [Avibacterium paragallinarum 
JF4211]
 emb|CDF97691.1| Putative Uncharacterized protein [Avibacterium paragallinarum 
JF4211]
Length=200

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISC  1565
             F+  F    GVLFAFPS+YWFTIG+  VFSLGGWSPH+QTGF VSRPT R LSTT  I  
Sbjct  6     FRFYFTPLTGVLFAFPSQYWFTIGQSGVFSLGGWSPHLQTGFLVSRPTSRKLSTTAWILS  65

Query  1566  TGLSPAMAPVSKGFHYQSDYHV  1631
             TGLSP +A + + F Y   Y++
Sbjct  66    TGLSPCVACLPRQFLYLCCYYL  87


 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 75/178 (42%), Gaps = 8/178 (4%)
 Frame = +1

Query  1372  LYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvpp  1551
             +Y  GFRFYFTPL G    FP             +L    P  +  F        +L   
Sbjct  1     MYVQGFRFYFTPLTGVLFAFPSQYWFTIGQSGVFSLGGWSPHLQTGFLVSRPTSRKLSTT  60

Query  1552  v*frvrGYHPLWLLFPKDSTISPTITYKAHPISLATTLGISVDFFSCSYLDVSVRRVRFV  1731
                   G  P     P+           A P+SLA T  ISVDFFS  YLDVSV  VR  
Sbjct  61    AWILSTGLSPCVACLPRQFLYLCCYYLLAPPLSLAATHRISVDFFSSGYLDVSVLPVRLT  120

Query  1732  TLCI-----QITMT*KAGFPHSEICGSKCVCSLPAAYRKLLRPSSPVIAKASTMCTYS  1890
              L       ++     + F H  +  S     L  A+R+L RPSSP+IAKAS +  +S
Sbjct  121   RLFYSPRNDRLFAYRVSPFGHRGLNASY---QLTHAFRRLARPSSPLIAKASALYAFS  175



>gb|EEZ93815.1| conserved hypothetical protein [Legionella longbeachae D-4968]
Length=157

 Score = 83.2 bits (204),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 64/104 (62%), Gaps = 4/104 (4%)
 Frame = +2

Query  125  VFLLNSRSHQFIATLSPSWSKPIKLPGRTLSRSYGTNLPSSFSRVLSSALEYSSRPPVSV  304
            +FL+NSRSH   A L  S SK +   GRT SRSYGT LPSSF+RVLSSAL +S+ PPVSV
Sbjct  1    MFLINSRSHLVSAALFSSESKFLHRKGRTFSRSYGTILPSSFTRVLSSALVFSTCPPVSV  60

Query  305  CGTVSYD*SLEAFLGTTSDCFVPQGHTSQPLE----LRARICLS  424
            CGTV Y   L AF G+ +         S P      +  RICL+
Sbjct  61   CGTVLYKLWLAAFPGSRASMTSLYTEVSAPCRTSELITVRICLN  104


 Score = 39.3 bits (90),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  510  GILTCFPSATHLCLALGADSPCSD  581
            GILT FPS T   LALGADSPCSD
Sbjct  134  GILTWFPSTTLFSLALGADSPCSD  157



>gb|ELY20072.1| hypothetical protein HALTITAN_3297 [Halomonas titanicae BH1]
Length=98

 Score = 76.6 bits (187),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  732  KHISAASVTGLAPLHLPRRTTRSVSYYAFFK*WLLLSQHPDCFSLPTSFST  884
            ++   ASV GLAPLHLPRR TR VSYYAFFK WLLLSQ P C SLPTSF T
Sbjct  48   RNSPVASVPGLAPLHLPRRPTRLVSYYAFFKGWLLLSQPPSCLSLPTSFPT  98


 Score = 46.2 bits (108),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +1

Query  607  FRREGFSPSLSLLMSAFALPIPPASFTRHLLRLTERSPTICASTY  741
            FRR  FS  LSLLMSAFAL IPPA+F+ HL  LT RS T  A++Y
Sbjct  3    FRRGSFSLPLSLLMSAFALVIPPANFSIHLHWLTRRSST--ANSY  45



>dbj|GAL87805.1| dehydration responsive protein [Sporocytophaga myxococcoides]
Length=52

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  725  MVGERSVSLRRCLVKDAGGIGSANADMSSDKEGEKPSRRKPKVSCSTFI  579
            MVGERSVSLRRCLVKDAGGI SANADMSSD  GEKP+RRKPKVSCSTFI
Sbjct  1    MVGERSVSLRRCLVKDAGGIRSANADMSSDNAGEKPARRKPKVSCSTFI  49



>gb|EJH48961.1| hypothetical protein VCCP104821_0001 [Vibrio cholerae CP1048(21)]
Length=182

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 91/179 (51%), Gaps = 31/179 (17%)
 Frame = +1

Query  1372  LYAHGFRFYFTPLPGFFSPFPH-------GTGSLSVDYEYLALEDGPPIFRQ-DFTCpal  1527
             +Y HGFRFYFTPL G    FP         +G  S+      ++ G  + R  DFT    
Sbjct  1     MYVHGFRFYFTPLTGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRLLDFTLDEA  60

Query  1528  lvvrlvppv*frvrGYHPLWLLFPKDSTISPTITY-----KAHPISLATTLGISVDFFSC  1692
              V                   L P  + +S   TY     +A+P SLA T GISVDFFS 
Sbjct  61    SVTG-----------------LSPCIAKLSSLFTYFTECLRANPGSLAATTGISVDFFSS  103

Query  1693  SYLDVSVRRVRFVTLCIQITMT*KA-GFPHSEICGSKCVCSLPAAYRKLLRPSSPVIAK  1866
              YLDVSV  V  V LCIQ+T+T  A GFPHSEI  S     L  AYRKL+RPSSP+ A+
Sbjct  104   GYLDVSVPPVCSVNLCIQLTVTAYAVGFPHSEIADSNGSYCLICAYRKLVRPSSPLTAR  162


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISC  1565
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSR    TL      S 
Sbjct  6     FRFYFTPLTGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRLLDFTLDEA---SV  62

Query  1566  TGLSPAMAPVSKGFHYQSD  1622
             TGLSP +A +S  F Y ++
Sbjct  63    TGLSPCIAKLSSLFTYFTE  81



>gb|EEI82387.1| hypothetical protein HMPREF0077_1527 [Anaerococcus tetradius 
ATCC 35098]
Length=134

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 67/109 (61%), Gaps = 3/109 (3%)
 Frame = +3

Query  1209  MGRSPGFGSTPSDCRPVRTRFLYGSP--IRLTSPLNVSR*PIIQKVRRHPTKRLRLFVCT  1382
             M RSPGFGS  ++   +       +P    LT  + ++R PI+QKVR H T  L L V  
Sbjct  1     MDRSPGFGSIATNFFALLRLAFALAPSLKDLTLLITITRWPILQKVR-HQTLVLCLLVGA  59

Query  1383  RFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT  1529
             RFQVLFHSP GVLF FPSRY F IG + VFSL GWSP +  GF VS  T
Sbjct  60    RFQVLFHSPFGVLFTFPSRYLFAIGHMLVFSLRGWSPCLHNGFLVSGAT  108



>emb|CDW93820.1| hypothetical protein THICB2_410075 [Thiomonas sp. CB2]
Length=59

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  999  LQTPNTGECELGRQTSGANVRRQEGNNPDRQLRSQRLAKWKTKWEG*NSQDVGLEAAII  823
            +QTPNTGEC  G    GANVR QEGNNPDRQLRS  +AKW+TKWEG +SQ+VGLEAA +
Sbjct  1    MQTPNTGECSAGDSAPGANVRTQEGNNPDRQLRSLNIAKWETKWEGIDSQEVGLEAATL  59



>ref|WP_012468050.1| hypothetical protein [Burkholderia multivorans]
 ref|YP_001949469.1| hypothetical protein BMULJ_05091 [Burkholderia multivorans ATCC 
17616]
 dbj|BAG46933.1| conserved hypothetical protein [Burkholderia multivorans ATCC 
17616]
Length=90

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -1

Query  495  MRWGDGSRKVVQLLE*LVLDS*KALRQIRARNSRG*DVCPCGTKQSEVVPRKASKLQSYE  316
            MRWGDGSRKVV++L+  V    KALRQIRA++SR            +    K        
Sbjct  1    MRWGDGSRKVVRVLDVPVAALEKALRQIRAQDSRVWRERLRSRSNWKWFQEKPLSFSLTM  60

Query  315  TVPQTDTGGRDEYSKALERTREKELGKLVP  226
            TVPQTDTGGRDEYSKALERTREKELGKLVP
Sbjct  61   TVPQTDTGGRDEYSKALERTREKELGKLVP  90



>gb|EEZ33514.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella 
sp. 83/13]
Length=135

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 79/144 (55%), Gaps = 15/144 (10%)
 Frame = +1

Query  1315  VADPLYKRYAVT---PRRGSDCLYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALED  1485
             VADPLYKRYAVT   P   + C +         P  G+FSPFPHGTGSLSV +EYL L+ 
Sbjct  1     VADPLYKRYAVTQDKPWAPTVCRHPVSGTVSL-PSSGYFSPFPHGTGSLSVMHEYLGLDR  59

Query  1486  GPPIFRQDFTCpallvvrlvppv*frvrGYHPLWLLFPKDSTISPTITYKAH---PISLA  1656
             G P+FRQDFTC       L         G  P  + F      S    +K+H   P SLA
Sbjct  60    GRPMFRQDFTC----PALLKDFCYSTCTGLSPTSVEFSN----SFHFIHKSHWPGPRSLA  111

Query  1657  TTLGISVDFFSCSYLDVSVRRVRF  1728
             TT G+S D  S  YLDVSV +VRF
Sbjct  112   TTSGVSFDVLSSGYLDVSVPQVRF  135



>gb|ADI19371.1| hypothetical protein [uncultured Spirochaetales bacterium HF0500_06B09]
Length=160

 Score = 79.0 bits (193),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCN  165
            TVIVTAAVYW F+ EL+P  L FQHRAGV+PYTS +  AE CVF KQS  P  CN
Sbjct  26   TVIVTAAVYWGFDSELSPFLLTFQHRAGVSPYTSRYRLAETCVFGKQSPGPFLCN  80


 Score = 40.4 bits (93),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  212  LSRSYGTNLPSSFSRVLSSALEYSSRPPVSVCGTV  316
             SRSY   LPSS +RV SSALE SSR PVSV GTV
Sbjct  99   FSRSYVCILPSSLTRVHSSALESSSRLPVSVYGTV  133



>gb|EEW79285.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella 
abortus NCTC 8038]
 gb|EEW86124.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella 
melitensis bv. 1 str. 16M]
 gb|EEW89199.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella 
suis bv. 4 str. 40]
 gb|EEX91414.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella 
ceti M13/05/1]
 gb|EEX98832.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella 
ceti M644/93/1]
 gb|EEX98866.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella 
pinnipedialis B2/94]
 gb|EEY06498.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella 
pinnipedialis M163/99/10]
Length=135

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 78/144 (54%), Gaps = 15/144 (10%)
 Frame = +1

Query  1315  VADPLYKRYAVT---PRRGSDCLYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALED  1485
             VADPLYKRYAVT   P   + C +         P  G FSPFPHGTGSLSV +EYL L+ 
Sbjct  1     VADPLYKRYAVTQDKPWAPTVCRHPVSGTVSL-PSSGCFSPFPHGTGSLSVMHEYLGLDR  59

Query  1486  GPPIFRQDFTCpallvvrlvppv*frvrGYHPLWLLFPKDSTISPTITYKAH---PISLA  1656
             G P+FRQDFTC       L         G  P  + F      S    +K+H   P SLA
Sbjct  60    GRPMFRQDFTC----PALLKDFCYSTCTGLSPTSVEFSN----SFHFIHKSHWPGPRSLA  111

Query  1657  TTLGISVDFFSCSYLDVSVRRVRF  1728
             TT G+S D  S  YLDVSV +VRF
Sbjct  112   TTSGVSFDVLSSGYLDVSVPQVRF  135



>gb|EFG00472.1| conserved hypothetical protein [Listeria monocytogenes J2818]
Length=110

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  1060  LEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLH  1239
             LEA PK  SERTSY QV L F  YP LIP  FN+ GFGPP  +T PSSW WVDHLVSGL 
Sbjct  5     LEASPKAISERTSYLQVRLEFLRYPHLIPALFNVRGFGPPVSITLPSSWTWVDHLVSGLR  64

Query  1240  PATVA  1254
             P T A
Sbjct  65    PVTYA  69



>gb|AFJ95810.1| hypothetical protein, partial [uncultured bacterium]
Length=113

 Score = 82.4 bits (202),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  1250  SPCSDSISLRLPYPVNLATECKSLTHYTKGTPSP-HEEAPTVCMHTVSGSISLPSRGSFR  1426
             +PCSDS+SLRL   + LAT   SL H TKGTPS     APT C   VSG++SLPSRG+F 
Sbjct  39    TPCSDSLSLRLASWLGLATRRNSLAHSTKGTPSHLRAGAPTACGQAVSGAVSLPSRGAFH  98

Query  1427  LSLTVLVHYRSITSI  1471
             LSL VLV YRS  SI
Sbjct  99    LSLAVLVRYRSQESI  113


 Score = 35.4 bits (80),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 19/39 (49%), Gaps = 0/39 (0%)
 Frame = +3

Query  1140  HPLIFQH*WVRTSRACYRTFILAMGRSPGFGSTPSDCRP  1256
             HP  FQ  WVR S   Y  F L M  SPGF S   D  P
Sbjct  2     HPPSFQPRWVRPSTGSYPRFSLPMDSSPGFASAARDSTP  40



>ref|WP_016356304.1| hypothetical protein [Carnobacterium maltaromaticum]
 ref|YP_006991027.2| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 ref|YP_006991273.2| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 ref|YP_006991392.2| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 ref|YP_006991810.2| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 ref|YP_006993288.2| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 ref|YP_006994279.1| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 emb|CCO12964.1| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 emb|CCO09712.2| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 emb|CCO09958.2| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 emb|CCO10077.2| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 emb|CCO10495.2| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
 emb|CCO11973.2| putative uncharacterized protein [Carnobacterium maltaromaticum 
LMA28]
Length=110

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  1063  EALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHP  1242
             EA PK  SERTSY QV L F  YP LIP FFNI GFGPP R+TAPS+W WV HLVSGL P
Sbjct  6     EASPKAISERTSYLQVRLEFLRYPHLIPAFFNIRGFGPPVRITAPSTWTWVGHLVSGLRP  65

Query  1243  AT  1248
              T
Sbjct  66    HT  67



>ref|WP_022299945.1| uncharacterized protein [Erysipelotrichaceae bacterium CAG:64]
 emb|CDC86113.1| uncharacterized protein BN746_00004 [Erysipelotrichaceae bacterium 
CAG:64]
Length=219

 Score = 86.3 bits (212),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 74/146 (51%), Gaps = 0/146 (0%)
 Frame = +3

Query  447  TIPTVGQPSAIRPPIASYDGAGILTCFPSATHLCLALGADSPCSDER*TGNLGLSARGLF  626
            TI +V   S +R    S  G GI  CFPS T   LALG D P +DE   G LGLS   + 
Sbjct  74   TIHSVAHTSLLRHSFISIAGTGISACFPSTTPFGLALGPDLPRADEPSPGILGLSVCRIL  133

Query  627  TLFIATHVSIRTSDTSSILYKTPSQAYGTLSYHMCKHISAASVTGLAPLHLPRRTTRSVS  806
            T       +     +  +L     +A         K  SAASV  LAP+H  RR TR VS
Sbjct  134  TYISLLTPAFSLPCSPPLLTVRLLRACNAPLPLNSKVESAASVVCLAPVHFRRRVTRLVS  193

Query  807  YYAFFK*WLLLSQHPDCFSLPTSFST  884
             YA F+ WLLLSQ P C  +PTSFST
Sbjct  194  CYALFEGWLLLSQPPSCLCIPTSFST  219


 Score = 30.8 bits (68),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +2

Query  236  LPSSFSRVLSSALEYSSRPPVSVCGTVSYD*SLEAFLGT  352
            +PSS + VLS    +S  PPVSV    + + SLE FLG+
Sbjct  1    MPSSLATVLSLTSGFSPCPPVSVLVRAAMESSLETFLGS  39



>emb|CDN41084.1| Uncharacterized protein BN871_AB_00820 [Paenibacillus sp. P22]
Length=106

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  1051  MVILEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVS  1230
             M+  EA PK  S RTSYF+V L F  YP LIP FFNI GFGPP RVTAPS W  VDH VS
Sbjct  1     MLNTEASPKAISGRTSYFRVRLEFLRYPHLIPEFFNIRGFGPPVRVTAPSPWTGVDHTVS  60

Query  1231  GLHPATVALFGLDFS  1275
             GLHP T+A +    S
Sbjct  61    GLHPRTMAPYSDSLS  75



>gb|AAF09840.1|AE001886_6 hypothetical protein DR_0254 [Deinococcus radiodurans R1]
Length=139

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 69/129 (53%), Gaps = 2/129 (2%)
 Frame = +3

Query  504  GAGILTCFPSATHLCLALGADSPCSDER*TGNLGLSARGLFTLFIATHVSIRTS--DTSS  677
            GAGILTC PSA    L LG D P +D+   G L L+A+ + T FI TH  IRTS   T+ 
Sbjct  3    GAGILTCCPSAAPFGLTLGPDFPWADDPSPGTLVLTAKKILTSFIVTHAGIRTSVGSTTP  62

Query  678  ILYKTPSQAYGTLSYHMCKHISAASVTGLAPLHLPRRTTRSVSYYAFFK*WLLLSQHPDC  857
                +P            +  S ASV  L+P H  R  TR VSYYA F+ WLLLSQ P C
Sbjct  63   SGMASPRTERSPTRQLASRVESIASVDHLSPDHFRRIVTRPVSYYALFEGWLLLSQPPGC  122

Query  858  FSLPTSFST  884
                TS +T
Sbjct  123  LCDDTSLTT  131



>ref|WP_015552220.1| hypothetical protein, partial [Taylorella asinigenitalis]
 ref|YP_007822393.1| hypothetical protein KUM_1451, partial [Taylorella asinigenitalis 
14/45]
 emb|CCG20229.1| hypothetical protein KUM_1451, partial [Taylorella asinigenitalis 
14/45]
Length=53

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  741  SAASVTGLAPLHLPRRTTRSVSYYAFFK*WLLLSQHPDCFSLPTSFST  884
            SAASVTGLAPLHLPRRTTRSVSYYAFFK WLLLSQ PDC  LPTSF T
Sbjct  6    SAASVTGLAPLHLPRRTTRSVSYYAFFKGWLLLSQPPDCLCLPTSFPT  53



>gb|EJH40973.1| serine acetyltransferase [Vibrio cholerae CP1048(21)]
Length=94

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +1

Query  1633  KAHPISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQITMT*KA-GFPHSEICGSKCVC  1809
             +A+P SLA T GISVDFFS  YLDVSV  V  V LCIQ+T+T  A GFPHSEI  S    
Sbjct  10    RANPGSLAATTGISVDFFSSGYLDVSVPPVCSVNLCIQLTVTAYAVGFPHSEIADSNGSY  69

Query  1810  SLPAAYRKLLRPSSPVIAKASTM  1878
              L  AYRKL+RPSSP+ A+AST+
Sbjct  70    CLICAYRKLVRPSSPLTAQASTV  92



>dbj|BAJ11783.1| dehydration responsive protein, partial [Corchorus capsularis]
Length=53

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/41 (100%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -3

Query  565  SAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVGIVG  443
            SAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVGIVG
Sbjct  1    SAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVGIVG  41



>emb|CBX28565.1| hypothetical protein N47_G38890 [uncultured Desulfobacterium 
sp.]
Length=75

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  1045  PPMVILEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHL  1224
             P  +I +A+PK  S RTSYFQVCLAFHPYPQLI   FN+  F P    T  S WPW+DHL
Sbjct  4     PHYLIYKAIPKYISGRTSYFQVCLAFHPYPQLIRVVFNLQRFEPSRNFTCASLWPWIDHL  63

Query  1225  VSGLHPATVALF  1260
             VSGL  AT  L+
Sbjct  64    VSGLLHATNTLY  75



>gb|ABH09321.1| leucine rich protein [Arachis hypogaea]
Length=182

 Score = 82.0 bits (201),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +2

Query  620  AFHPLYRYSCQHSHFRYLQHPLQDTFSGLRNALLPY-VQAHIRSFGDWLSPVTSSAQDDS  796
             F P  RYSC HSHFR LQ  LQ TF+ +RNA LP   +  IRS G  LSPVT SA D S
Sbjct  94   GFSPTIRYSCHHSHFRTLQPSLQSTFTAVRNAPLPLQAEPVIRSLGVLLSPVTLSAPDHS  153

Query  797  ISELLRFL*MMAASKPTS  850
             SELLR L  +AASKPTS
Sbjct  154  TSELLRTLSRVAASKPTS  171


 Score = 33.9 bits (76),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  559  GPTHPAPMNVEQETLGFRREGFSPSL  636
            GPT+P  +++ QETL FR  GFSP++
Sbjct  74   GPTNPERIDLAQETLDFRCVGFSPTI  99



>ref|WP_013085636.1| hypothetical protein [Lactobacillus crispatus]
 ref|YP_003600535.1| hypothetical protein LCRIS_00063 [Lactobacillus crispatus ST1]
 ref|YP_003600914.1| hypothetical protein LCRIS_00442 [Lactobacillus crispatus ST1]
 ref|YP_003600927.1| hypothetical protein LCRIS_00455 [Lactobacillus crispatus ST1]
 ref|YP_003602122.1| hypothetical protein LCRIS_01650 [Lactobacillus crispatus ST1]
 emb|CBL49510.1| conserved protein [Lactobacillus crispatus ST1]
 emb|CBL49889.1| conserved protein [Lactobacillus crispatus ST1]
 emb|CBL49902.1| conserved protein [Lactobacillus crispatus ST1]
 emb|CBL51097.1| conserved protein [Lactobacillus crispatus ST1]
Length=156

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 63/115 (55%), Gaps = 6/115 (5%)
 Frame = +1

Query  913   VWVVSLLTPDVSTRRLSPKLALTGIRSLQWFGKSQ*PPS---HNSALPPMVILEALPK*F  1083
             +W VSL T D+ TR L+P   + G      +  S  P              + EA PK  
Sbjct  2     IWAVSLSTTDLITRSLTP---VYGYLEFVVYLDSVTPDGPLVQTELYLHYPLHEASPKAI  58

Query  1084  SERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPAT  1248
             SERTSY QV L FH YPQLIP  FN+ GFGPP R T PS+W WV HLVSGL   T
Sbjct  59    SERTSYLQVRLEFHRYPQLIPAIFNLRGFGPPVRFTTPSAWSWVGHLVSGLRHLT  113



>gb|KHF27783.1| hypothetical protein CM49_06648 [Paenibacillus sp. P1XP2]
Length=191

 Score = 60.5 bits (145),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +2

Query  197  LPGRTLSRSYGTNLPSSFSRVLSSALEYSSRPPVSVCGTVSYD*SLEAFLGTT  355
            LPG   SRSYG  LPSS +RVL  ALE+SSR PVSVCGT ++   LEAFLG+ 
Sbjct  138  LPGHPFSRSYGVILPSSLTRVLPRALEFSSRLPVSVCGTGTFT-WLEAFLGSV  189


 Score = 54.3 bits (129),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 37/65 (57%), Gaps = 8/65 (12%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQEL------APHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYC  162
            TVIVTAAVYW F  +L      AP +L    R    PYTS + FA+ CVF KQS  P +C
Sbjct  73   TVIVTAAVYWGFGSQLRSYSLTAPLNLPAPGRR--QPYTSPYGFAQTCVFAKQSLGPFHC  130

Query  163  NPFTL  177
             P  L
Sbjct  131  GPLVL  135



>emb|CDG37541.1| hypothetical protein CTHBC1_2972 [Ruminiclostridium thermocellum 
BC1]
Length=157

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 65/113 (58%), Gaps = 0/113 (0%)
 Frame = +1

Query  913   VWVVSLLTPDVSTRRLSPKLALTGIRSLQWFGKSQ*PPSHNSALPPMVILEALPK*FSER  1092
             VW VSL T  + +  L+PK  L GI+SL+ FG    P + +       +LEA PK  S R
Sbjct  2     VWAVSLSTMKLISHSLTPKQHLDGIQSLRGFGNPVRPLAQSVLYLRQTLLEASPKAISGR  61

Query  1093  TSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPATV  1251
             TSY +V L F  YPQLIP  FN  GFGPP   T  S+ PW+ H VSGL  AT 
Sbjct  62    TSYIRVRLEFLRYPQLIPNLFNGYGFGPPRDFTLASTCPWIGHPVSGLLHATC  114



>gb|EHI04052.1| hypothetical protein VCHC61A1_3636 [Vibrio cholerae HC-61A1]
Length=169

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 94/185 (51%), Gaps = 34/185 (18%)
 Frame = +1

Query  1372  LYAHGFRFYFTPLPGFFSPFPH-------GTGSLSVDYEYLALEDGPPIFRQ-DFTCpal  1527
             +Y HGFRFYFTPL G    FP         +G  S+      ++ G  + R  DFT    
Sbjct  1     MYVHGFRFYFTPLTGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRLLDFTLDEA  60

Query  1528  lvvrlvppv*frvrGYHPLWLLFPKDSTISPTITY-----KAHPISLATTLGISVDFFSC  1692
              V                   L P  + +S   TY     +A+P SLA T GISVDFFS 
Sbjct  61    SVTG-----------------LSPCIAKLSSLFTYFTECLRANPGSLAATTGISVDFFSS  103

Query  1693  SYLDVSVRRVRFVTLCIQITMT*KA-GFPH--SEICGSKCVCSLPAAYRKLLRPSSPVIA  1863
              YLDVSV  V  V LCIQ+T+T  A GFPH  +    +   C L  AYRKL+RPSSP+ A
Sbjct  104   GYLDVSVPPVCSVNLCIQLTVTAYAVGFPHFGNTQTQTDSYC-LICAYRKLVRPSSPLTA  162

Query  1864  KASTM  1878
             +AST+
Sbjct  163   QASTV  167


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISC  1565
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSR    TL      S 
Sbjct  6     FRFYFTPLTGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRLLDFTLDEA---SV  62

Query  1566  TGLSPAMAPVSKGFHYQSD  1622
             TGLSP +A +S  F Y ++
Sbjct  63    TGLSPCIAKLSSLFTYFTE  81



>ref|WP_004846158.1| hypothetical protein [[Ruminococcus] torques]
 gb|EDK22938.1| hypothetical protein RUMTOR_02903 [Ruminococcus torques ATCC 
27756]
 gb|EDK22964.1| hypothetical protein RUMTOR_02872 [Ruminococcus torques ATCC 
27756]
 gb|EDK22983.1| hypothetical protein RUMTOR_02853 [Ruminococcus torques ATCC 
27756]
 gb|EDK23021.1| hypothetical protein RUMTOR_02826 [Ruminococcus torques ATCC 
27756]
 gb|EDK23026.1| hypothetical protein RUMTOR_02811 [Ruminococcus torques ATCC 
27756]
 gb|EDK23068.1| hypothetical protein RUMTOR_02783 [Ruminococcus torques ATCC 
27756]
Length=166

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 86/170 (51%), Gaps = 14/170 (8%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPATVALFGLDFSTAPLSG  1293
             + F PYP LIP  FN  GFGPP   TA S+W W+DH VSGL   T ALF L F +AP   
Sbjct  1     MEFLPYPHLIPTLFNGCGFGPPLPFTATSTWTWIDHPVSGLLRLTFALFRLGFPSAP---  57

Query  1294  *PRH*M*VADP--LYKRYAVTPRRGSD-----CLYAHGFRFYFTPLPGFFSPFPHGTGSL  1452
                H   +  P  + +R  +   RGS       L    F+  F   PG    FP    +L
Sbjct  58    ---HLQCLTSPASVTRRTVLQKVRGSSYKDVPQLVNIWFQVLFHSPPGVLFTFPSQYYAL  114

Query  1453  SVDYEYLALEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPLWLLFPK  1602
             SV  EYLAL  GP IF Q  TC   L+      + FR+R +HPLW  FPK
Sbjct  115   SVTKEYLALRGGPRIFSQGSTC-LDLLWIPPCQLAFRLRDFHPLWSAFPK  163



>emb|CAR86202.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR86713.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR86732.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR87783.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR88397.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR89132.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89651.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89670.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR90709.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR91346.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
Length=131

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  1063  EALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHP  1242
             EA PK  SERTSY QV L FH YPQLIP FFNI GFGPP   T PS+W WV HLVSGLH 
Sbjct  29    EANPKAISERTSYLQVRLEFHRYPQLIPAFFNIHGFGPPVCFTTPSTWSWVGHLVSGLHL  88

Query  1243  ATVA  1254
              T A
Sbjct  89    PTEA  92



>ref|WP_014566373.1| hypothetical protein [Lactobacillus casei]
 ref|YP_005855168.1| hypothetical protein LC2W_0248 [Lactobacillus casei LC2W]
 ref|YP_005855828.1| hypothetical protein LC2W_0910 [Lactobacillus casei LC2W]
 ref|YP_005855844.1| hypothetical protein LC2W_0926 [Lactobacillus casei LC2W]
 ref|YP_005856922.1| hypothetical protein LC2W_2006 [Lactobacillus casei LC2W]
 ref|YP_005857591.1| hypothetical protein LC2W_2677 [Lactobacillus casei LC2W]
 ref|YP_005858298.1| hypothetical protein LCBD_0257 [Lactobacillus casei BD-II]
 ref|YP_005858946.1| hypothetical protein LCBD_0907 [Lactobacillus casei BD-II]
 ref|YP_005858961.1| hypothetical protein LCBD_0922 [Lactobacillus casei BD-II]
 ref|YP_005860063.1| hypothetical protein LCBD_2026 [Lactobacillus casei BD-II]
 ref|YP_005860739.1| hypothetical protein LCBD_2704 [Lactobacillus casei BD-II]
 gb|AEA52584.1| Conserved protein [Lactobacillus casei LC2W]
 gb|AEA53244.1| Conserved protein [Lactobacillus casei LC2W]
 gb|AEA53260.1| Conserved protein [Lactobacillus casei LC2W]
 gb|AEA54338.1| Conserved protein [Lactobacillus casei LC2W]
 gb|AEA55007.1| Conserved protein [Lactobacillus casei LC2W]
 gb|AEA55757.1| Conserved protein [Lactobacillus casei BD-II]
 gb|AEA56405.1| Conserved protein [Lactobacillus casei BD-II]
 gb|AEA56420.1| Conserved protein [Lactobacillus casei BD-II]
 gb|AEA57522.1| Conserved protein [Lactobacillus casei BD-II]
 gb|AEA58198.1| Conserved protein [Lactobacillus casei BD-II]
Length=131

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  1063  EALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHP  1242
             EA PK  SERTSY QV L FH YPQLIP FFNI GFGPP   T PS+W WV HLVSGLH 
Sbjct  29    EANPKAISERTSYLQVRLEFHRYPQLIPAFFNIHGFGPPVCFTTPSTWSWVGHLVSGLHL  88

Query  1243  AT  1248
              T
Sbjct  89    LT  90



>dbj|BAJ11781.1| dehydration responsive protein, partial [Corchorus pseudo-olitorius]
Length=54

 Score = 82.8 bits (203),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -3

Query  565  SAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVGI  449
            SAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVGI
Sbjct  1    SAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVGI  39


 Score = 30.8 bits (68),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -2

Query  449  SWFLTHRRRLGKSGR  405
            S FLTHRRRLGKSGR
Sbjct  40   SRFLTHRRRLGKSGR  54



>dbj|GAD81567.1| hypothetical protein NCAST_03_00002, partial [Nocardia asteroides 
NBRC 15531]
Length=127

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +2

Query  1313  KSLTHYTKGTPSPH--EEAPTVCMHTVSGSISLPSRGSFRLSLTVLVHYRSITSI*PWRM  1486
              S  H +KGTPSPH  ++A T C  TVSG+ISLPSRG+F LSLTVLV YRS  SI  +R+
Sbjct  27    DSQAHSSKGTPSPHCKQKALTDCKRTVSGTISLPSRGTFHLSLTVLVRYRSPGSIQAYRV  86

Query  1487  VPPYSDRISRVPPYLSYA*YHRSDFVYGAITRYGSCFQ  1600
             VP  S +ISR   Y       +  FVY  IT YG  FQ
Sbjct  87    VPADSQQISRARCYSGITHESQHVFVYRTITVYGRPFQ  124



>dbj|BAJ11779.1| dehydration responsive protein, partial [Corchorus tridens]
Length=53

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -3

Query  565  SAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVGIVG  443
            SAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCP VGI G
Sbjct  1    SAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPAVGIAG  41



>gb|EGU94741.1| hypothetical protein HMPREF9349_05394 [Escherichia coli MS 79-10]
 gb|EGU94777.1| hypothetical protein HMPREF9349_05349 [Escherichia coli MS 79-10]
Length=76

 Score = 60.8 bits (146),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  607  FRREGFSPSLSLLMSAFALPIPPASFTRHLLRLTERSPT  723
            FRR GFSP+LSLLMSAFAL IPPA  T HL RLTERSPT
Sbjct  3    FRRAGFSPALSLLMSAFALLIPPACLTAHLRRLTERSPT  41


 Score = 50.4 bits (119),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  741  SAASVTGLAPLHLPRRTTRSVSYYAFFK  824
            +AASV GLAPLHLPRR TR VSYYAFFK
Sbjct  49   AAASVHGLAPLHLPRRPTRPVSYYAFFK  76



>gb|AHQ36865.1| hypothetical protein AV48_26720 [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20120916]
Length=91

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLI  1559
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R  ST   +
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTHRAHSTCAFV  63



>gb|AHQ99647.1| hypothetical protein AV68_01885, partial [Salmonella enterica 
subsp. enterica serovar Enteritidis str. EC20130347]
 gb|AHS43203.1| hypothetical protein AV79_01480, partial [Salmonella enterica 
subsp. enterica serovar Enteritidis str. EC20120051]
Length=70

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLI  1559
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R  ST   +
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTHRAHSTCAFV  63



>gb|AHS46837.1| hypothetical protein AV15_01510, partial [Salmonella enterica 
subsp. enterica serovar Enteritidis str. EC20120528]
Length=71

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLI  1559
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R  ST   +
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTHRAHSTCAFV  63



>gb|AHQ45912.1| hypothetical protein AU86_26085 [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20092320]
Length=71

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLI  1559
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R  ST   +
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTHRAHSTCAFV  63



>gb|AHS49618.1| hypothetical protein AV47_01815, partial [Salmonella enterica 
subsp. enterica serovar Enteritidis str. EC20120994]
Length=75

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLI  1559
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R  ST   +
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTHRAHSTCAFV  63



>ref|WP_026400319.1| hypothetical protein [Acholeplasma equifetale]
Length=78

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  1535  TTSRAGHVKSCLNMGGPSSKAKYS*STDSEPVP*GKGEKNPGRGVK*NLKPCAYK  1371
             +TSRAGHV+S L +GGPS KAKYS  TDSEPV   KGEKNPGRGVK NLK CAYK
Sbjct  24    STSRAGHVESRLKIGGPSPKAKYSLVTDSEPVQWWKGEKNPGRGVKENLKLCAYK  78



>gb|ADI17229.1| hypothetical protein [uncultured alpha proteobacterium HF0070_14E07]
Length=139

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  596  KPWAFGERAFHPLYRYSCQHSHFRYLQHPLQDTFSGLRNALLPYVQAHIRSFGDWLSPVT  775
             PWA+GE   H L RYSCQHSHFRYLQHP QDTF+GLRNA LP V+    +    LSP T
Sbjct  42   NPWAYGESVSHTLCRYSCQHSHFRYLQHPSQDTFTGLRNAPLPCVKDTSSASVYGLSPDT  101

Query  776  SSAQ  787
            SSAQ
Sbjct  102  SSAQ  105


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = +3

Query  732  KHISAASVTGLAPLHLPRRT--TRSVSYYAFFK*WLLLSQHPDCFSLPTSFST  884
            K  S+ASV GL+P     +   +R VSYYAFFK WLLLSQ P C  LPTSF T
Sbjct  87   KDTSSASVYGLSPDTSSAQAGLSRPVSYYAFFKGWLLLSQPPGCLGLPTSFPT  139



>gb|AAX66567.1| hypothetical protein SCH_2661 [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
 gb|AAX67238.1| hypothetical protein SCH_3332 [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
 gb|AAX67709.1| hypothetical protein SCH_3803 [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
 gb|AAX67791.1| hypothetical protein SCH_3885 [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
 gb|AAX67929.1| hypothetical protein SCH_4023 [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
 gb|AAX67964.1| hypothetical protein SCH_4058 [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
Length=101

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLI  1559
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R  ST   +
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTHRAHSTCAFV  63



>gb|EFE51872.1| hypothetical protein PROVRETT_09454 [Providencia rettgeri DSM 
1131]
 gb|EFE53623.1| hypothetical protein PROVRETT_07659 [Providencia rettgeri DSM 
1131]
Length=86

 Score = 73.9 bits (180),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  1405  PLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTC  1518
             P PGFFSPFPHGTGSLSV+ EYLALEDGPPIFRQD TC
Sbjct  20    PSPGFFSPFPHGTGSLSVNQEYLALEDGPPIFRQDNTC  57


 Score = 33.9 bits (76),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +2

Query  1355  EEAPTVCMHTVSGSISLPSRGSF  1423
             + APT C +TVSGSISLPS G F
Sbjct  3     DGAPTACTYTVSGSISLPSPGFF  25



>ref|WP_014413244.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415573.1| hypothetical protein RSPPHO_03264, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06603.1| unnamed protein product, partial [Rhodospirillum photometricum 
DSM 122]
Length=114

 Score = 58.2 bits (139),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  1286  YPVNLATECKSLTHYTKGTPSPHEEAPTVCMHTVSGSISLPSRGSFRLSLTVLVHYRS  1459
             Y + LA + KSLTHYTKGTPSP +E   +           P RG+F LSLTVLVHYRS
Sbjct  53    YRLKLARQIKSLTHYTKGTPSPPKELRLLVGIRFQELFHSPHRGAFHLSLTVLVHYRS  110


 Score = 49.7 bits (117),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +1

Query  1132  PQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPATVALFGLDFSTA  1281
             PQ+IP FFN  GFGPP  VT PS+ PW+DH VSGL   T       F  A
Sbjct  1     PQVIPVFFNRRGFGPPVGVTPPSTCPWLDHPVSGLIRRTRRPLKTRFRCA  50



>ref|WP_004986315.1| hypothetical protein, partial [Streptomyces ghanaensis]
 gb|EFE68556.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces 
ghanaensis ATCC 14672]
Length=172

 Score = 54.7 bits (130),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +1

Query  1132  PQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPAT-VALFGLDFST  1278
             PQ+IP  FN  GFGPP  +T+ S+ PW+DH  SGL  AT  ALFGL F+T
Sbjct  1     PQVIPQVFNPGGFGPPRSLTSASTCPWLDHSASGLERATETALFGLAFAT  50


 Score = 52.8 bits (125),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 7/64 (11%)
 Frame = +2

Query  1310  CKSLTHYTKGTPS-----PHEEAPTVCMHTVSGSISLPSRGSFRLSLTVL--VHYRSITS  1468
               S  H +KGT S     P  +APT C HTVSG+ISLPSRG+F  SLTVL  + ++ I  
Sbjct  62    ANSQAHSSKGTQSRERGKPRSDAPTACRHTVSGTISLPSRGTFHHSLTVLSAIGHQGIFR  121

Query  1469  I*PW  1480
             +  W
Sbjct  122   LGGW  125



>gb|EEW08769.1| hypothetical protein VMD_37440 [Vibrio mimicus VM573]
Length=104

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +2

Query  113  LQSAVFLLNSRSHQFIATLSPSWSKPIKLPGRTLSRSYGTNLPSSFSRVLSSALEYSSRP  292
            + SAVFLLNS SH   ATL  S  + +    RT SRSYGT LPSSF+RVLSSAL +S+RP
Sbjct  1    MHSAVFLLNSCSHLVSATLVSSIREGLHHQERTFSRSYGTILPSSFTRVLSSALVFSTRP  60

Query  293  PVSVCGTVSYD*SLEAF  343
            PVSV GT+ Y+  L  F
Sbjct  61   PVSVWGTIPYNLKLRGF  77



>gb|EDM97728.1| hypothetical protein BACCAP_04469 [Pseudoflavonifractor capillosus 
ATCC 29799]
 gb|EDM98348.1| hypothetical protein BACCAP_03836 [Pseudoflavonifractor capillosus 
ATCC 29799]
Length=58

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  1368  LFVCTRFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRT  1538
             + V TRFQVLFHSPPGVLF FPSRY  +IG   VF +GGWSP + TGFHVSR T  T
Sbjct  1     MLVSTRFQVLFHSPPGVLFTFPSRYCSSIGHQVVFRVGGWSPQLPTGFHVSRGTLDT  57



>emb|CDZ23242.1| hypothetical protein CCDG5_0096 [ [[Clostridium] cellulosi]
 emb|CDZ23658.1| hypothetical protein CCDG5_0524 [ [[Clostridium] cellulosi]
 emb|CDZ24021.1| hypothetical protein CCDG5_0901 [ [[Clostridium] cellulosi]
 emb|CDZ25145.1| hypothetical protein CCDG5_2062 [ [[Clostridium] cellulosi]
Length=158

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 69/126 (55%), Gaps = 31/126 (25%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYC------  162
            TVIVTAAVY  F  +L+   L F+HRAGV+PYTS+F  AE CVF KQS  P+ C      
Sbjct  26   TVIVTAAVYRGFGSKLSLLPLTFRHRAGVSPYTSSFDLAETCVFAKQSPGPILCGSGFPE  85

Query  163  NPFTLME*TNQATGAYLIPKLRYQFAEFLLPSSLKR-----LRILISPTCVGLRYGLV*L  327
            +PF+L    N                   LPSSL       LR+L+  TCVGLRYG + +
Sbjct  86   HPFSLGYGVN-------------------LPSSLTNPYPVGLRVLLLSTCVGLRYGRL-V  125

Query  328  KLRGFS  345
              +GFS
Sbjct  126  NTQGFS  131



>gb|AAX64155.1| hypothetical protein SCH_0249 [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
Length=133

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLI  1559
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R  ST   +
Sbjct  38    FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTHRAHSTCAFV  95



>ref|WP_014413241.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415566.1| hypothetical protein RSPPHO_03257, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06596.1| unnamed protein product, partial [Rhodospirillum photometricum 
DSM 122]
Length=103

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +1

Query  1315  VADPLYKRYAVTPRRGSDCLYAHGFRFYFT-PLPGFFSPFPHGTGSLSVDYEYLALEDGP  1491
             VADPLYKRYAVTP  G+     H      + P  G FSPFPHGTGSLSV  EYLALE GP
Sbjct  1     VADPLYKRYAVTPE-GAPTACRHPVSGTVSLPSSGCFSPFPHGTGSLSVVKEYLALEGGP  59

Query  1492  PIFRQDFTC  1518
             P+FRQ FTC
Sbjct  60    PMFRQGFTC  68



>gb|AAF11800.1|AE002057_8 hypothetical protein DR_2252 [Deinococcus radiodurans R1]
Length=133

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 65/125 (52%), Gaps = 2/125 (2%)
 Frame = +3

Query  516  LTCFPSATHLCLALGADSPCSDER*TGNLGLSARGLFTLFIATHVSIRTS--DTSSILYK  689
            +TC PSA    L LG D P +D+   G L L+A+ + T FI TH  IRTS   T+     
Sbjct  1    MTCCPSAAPFGLTLGPDFPWADDPSPGTLVLTAKKILTSFIVTHAGIRTSVGSTTPSGMA  60

Query  690  TPSQAYGTLSYHMCKHISAASVTGLAPLHLPRRTTRSVSYYAFFK*WLLLSQHPDCFSLP  869
            +P            +  S ASV  L+P H  R  TR VSYYA F+ WLLLSQ P C    
Sbjct  61   SPRTERSPTRQLASRVESIASVDHLSPDHFRRIVTRPVSYYALFEGWLLLSQPPGCLCDD  120

Query  870  TSFST  884
            TS +T
Sbjct  121  TSLTT  125



>ref|WP_004923040.1| hypothetical protein [Providencia stuartii]
 gb|EDU60912.1| hypothetical protein PROSTU_01097 [Providencia stuartii ATCC 
25827]
Length=92

 Score = 73.6 bits (179),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  1405  PLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTC  1518
             P PGFFSPFPHGTGSLSV+ EYLALEDGPPIFRQD TC
Sbjct  26    PSPGFFSPFPHGTGSLSVNQEYLALEDGPPIFRQDNTC  63


 Score = 33.1 bits (74),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +2

Query  1361  APTVCMHTVSGSISLPSRGSF  1423
             APT C +TVSGSISLPS G F
Sbjct  11    APTACTYTVSGSISLPSPGFF  31



>ref|WP_005390411.1| hypothetical protein [Vibrio alginolyticus]
 gb|EEZ80825.1| hypothetical protein VMC_43280 [Vibrio alginolyticus 40B]
Length=71

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -3

Query  1870  MPWRLQAMKDVVACDKLRGVSKHTLIRRFPNGETRPFRS-SLSEYIG*RSERGELKHLSS  1694
             MPW+ +AMKDV+ CDK R  SK+ L   FPNGET+  +   LSEYI  + E GELKHLS+
Sbjct  1     MPWQSEAMKDVLTCDKPRLGSKNHLSLGFPNGETQYHKVLLLSEYIAQQGEPGELKHLST  60

Query  1693  CRKRNQPRF  1667
              RKRNQPRF
Sbjct  61    PRKRNQPRF  69



>ref|YP_007989109.1| unnamed protein product [Klebsiella pneumoniae]
 gb|EFD82300.1| hypothetical protein HMPREF0485_05014 [Klebsiella sp. 1_1_55]
 emb|CCI74357.1| unnamed protein product [Klebsiella pneumoniae]
Length=101

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRT  1538
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R 
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTLRV  56



>gb|ADI18616.1| hypothetical protein [uncultured Rhodospirillales bacterium HF4000_24M03]
Length=90

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = +3

Query  1416  VLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISCTGLSPAMAPV  1595
             +LF FPSRYW+TIGR  V  LGGWSPH+QTGFHVSRPT R   TT   + TGLSP+MA +
Sbjct  1     MLFTFPSRYWYTIGRQGVLRLGGWSPHVQTGFHVSRPT-RVQQTTD--THTGLSPSMAGL  57

Query  1596  SKGF  1607
             S+ F
Sbjct  58    SRPF  61



>gb|EFE07775.1| hypothetical protein CIT292_08808 [Citrobacter youngae ATCC 29220]
Length=109

 Score = 78.6 bits (192),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRT  1538
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R 
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTLRA  56


 Score = 27.3 bits (59),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  1625  SRTRLIPFRSPLLWESRLIS  1684
             S + L+P RSPLL ESRLIS
Sbjct  85    SGSGLLPVRSPLLGESRLIS  104



>dbj|GAL60545.1| hypothetical protein EV102420_45_00015 [Escherichia vulneris 
NBRC 102420]
Length=101

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRT  1538
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R 
Sbjct  6     FRFCFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTLRV  56



>gb|ABE05728.1| hypothetical protein UTI89_C0222 [Escherichia coli UTI89]
 gb|ABE08378.1| hypothetical protein UTI89_C2920 [Escherichia coli UTI89]
 gb|ABE09159.1| hypothetical protein UTI89_C3719 [Escherichia coli UTI89]
 gb|ABE09240.1| hypothetical protein UTI89_C3809 [Escherichia coli UTI89]
 gb|ABE09739.1| hypothetical protein UTI89_C4315 [Escherichia coli UTI89]
 gb|ABE09854.1| hypothetical protein UTI89_C4441 [Escherichia coli UTI89]
 gb|ABE09976.1| hypothetical protein UTI89_C4567 [Escherichia coli UTI89]
 gb|EEH89634.1| hypothetical protein ESAG_07159 [Escherichia sp. 3_2_53FAA]
Length=101

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRT  1538
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R 
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTHRA  56



>emb|CAJ30046.1| hypothetical protein mgI388 [Magnetospirillum gryphiswaldense 
MSR-1]
Length=150

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 94/186 (51%), Gaps = 38/186 (20%)
 Frame = +2

Query  125  VFLLNSRSHQFIATLSPSWSKPIKLPGRTLSRSYGTNLPSSFSRVLSSALEYSSRPPVSV  304
            +FL+NSR     AT    + +  + P   LSRSYG NLPSSF+ +LSSAL YS+ PPVSV
Sbjct  1    MFLVNSRHPLVCATYH--YLRNGRYP---LSRSYGVNLPSSFNTILSSALVYSTSPPVSV  55

Query  305  CGTVSYD*SLEAFLGTTSDCFVPQGHTSQPLELRARICLSAFYESRTNYSNSWTTFRDPS  484
             GTV    +LE F G +S    PQ      L             SR    N         
Sbjct  56   SGTVY---TLELFPGPSS--LHPQSDKQVQLT-------KVVTSSRPTNIN---------  94

Query  485  PHriirrcrninllpiSYASLPrlrgrltllr*tlnrKPWAFGERAFHPLYRYSCQHSHF  664
                        ++PI YA  PRLRGRLTL    L R PW FGE   H L RYSCQHSHF
Sbjct  95   ------------VVPIDYAFRPRLRGRLTLRGLALRRNPWTFGESVSHTLCRYSCQHSHF  142

Query  665  RYLQHP  682
            RYLQ P
Sbjct  143  RYLQRP  148



>emb|CCJ46478.1| putative uncharacterized protein [Escherichia coli]
Length=101

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLS  1544
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT R  S
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRPTHRAHS  58



>gb|ELS47047.1| hypothetical protein C789_3192 [Microcystis aeruginosa DIANCHI905]
 gb|ELS47348.1| hypothetical protein C789_2872 [Microcystis aeruginosa DIANCHI905]
Length=102

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = -1

Query  1191  GNTPWRSEPTNVEKLGDELWVGVKG*TNLEIAGSLRKLFR*CLKYHHRG*STVMARGSLR  1012
             G T WRSEPTNVEKL DELW+GVK  +N E+AGS R + R        G     A G   
Sbjct  2     GKTKWRSEPTNVEKLADELWLGVKCQSNSELAGSPRNVLRRSGSGSLVGVKHCFAAGWET  61

Query  1011  LTKPLQTPNTGECELGRQTSGANVRRQEGNNPDRQLRS  898
              TK  QT NT + +   +T G  + RQEGN+PD QLRS
Sbjct  62    GTKARQTLNTAK-KTTSETVGDKLHRQEGNSPDHQLRS  98



>gb|ADI19336.1| hypothetical protein [uncultured delta proteobacterium HF0500_03A04]
Length=166

 Score = 65.9 bits (159),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  1326  IIQKVRRHPTKRLRLFVCTRFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQT  1505
             I+QK R   + R R      F++ F    GVLF FPSRYWFTIG   V SLGGWSP ++T
Sbjct  73    IMQKARGRGSSRFRRLWTQGFRICFTPLDGVLFTFPSRYWFTIGLRVVLSLGGWSPLLRT  132

Query  1506  GFHVSRPT  1529
             GFHV RPT
Sbjct  133   GFHVPRPT  140


 Score = 38.5 bits (88),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPAT  1248
             +AFHPYP LI   F     GPP  +T  S+W  +D  VSG  PAT
Sbjct  1     MAFHPYPHLIRGLFKAHRSGPPPGLTLASAWTGIDRPVSGPWPAT  45



>gb|EZU73576.1| hypothetical protein U991_01373, partial [Staphylococcus aureus 
1111100370]
Length=134

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +3

Query  1368  LFVCTRFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLST  1547
             L V TRFQVLFHSP GVLF FPSRYWFTIG  RVFSL  WS  I T FHV R T   L  
Sbjct  1     LLVSTRFQVLFHSPSGVLFTFPSRYWFTIGHQRVFSLRRWSSQIPTEFHVLRRTQDPLKR  60

Query  1548  TGLIS  1562
               +  
Sbjct  61    DNIFD  65



>dbj|GAB83214.1| hypothetical protein EB105725_51_00005 [Shimwellia blattae DSM 
4481 = NBRC 105725]
Length=101

 Score = 76.6 bits (187),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRT  1538
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPH+QTG+HVSRPT R 
Sbjct  6     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHLQTGYHVSRPTHRV  56


 Score = 27.3 bits (59),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +2

Query  1559  FVYGAITRYGSCFQRIPLSVRLSRT  1633
             FVYGA T Y + FQ +PL+  L +T
Sbjct  62    FVYGAFTLYRATFQTLPLTHTLIQT  86



>gb|EQL85868.1| putative serine acetyltransferase [Vibrio parahaemolyticus 10290]
Length=56

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT  1529
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSRPT
Sbjct  6     FRFYFTPLTGVLFAFPSRYWFTIGQSVVFSLGGWSPHIQTGYHVSRPT  53



>gb|ADI19636.1| hypothetical protein [uncultured delta proteobacterium HF0770_45N15]
Length=166

 Score = 65.1 bits (157),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  1326  IIQKVRRHPTKRLRLFVCTRFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQT  1505
             I+QK R   + R R      F++ F    GVLF FPSRYWFTIG   V SLGGWSP ++T
Sbjct  73    IMQKARGRGSSRFRRLWTQGFRICFTPLGGVLFTFPSRYWFTIGLRVVLSLGGWSPLLRT  132

Query  1506  GFHVSRPT  1529
             GFHV RPT
Sbjct  133   GFHVPRPT  140


 Score = 38.5 bits (88),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPAT  1248
             +AFHPYP LI   F     GPP  +T  S+W  +D  VSG  PAT
Sbjct  1     MAFHPYPHLIRGLFKAHRSGPPPGLTLASAWTGIDRPVSGPWPAT  45



>ref|WP_004990863.1| hypothetical protein, partial [Streptomyces ghanaensis]
 gb|EFE70733.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces 
ghanaensis ATCC 14672]
Length=172

 Score = 52.8 bits (125),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 7/64 (11%)
 Frame = +2

Query  1310  CKSLTHYTKGTPS-----PHEEAPTVCMHTVSGSISLPSRGSFRLSLTVL--VHYRSITS  1468
               S  H +KGT S     P  +APT C HTVSG+ISLPSRG+F  SLTVL  + ++ I  
Sbjct  62    ANSQAHSSKGTQSRERGKPRSDAPTACRHTVSGTISLPSRGTFHHSLTVLSAIGHQGIFR  121

Query  1469  I*PW  1480
             +  W
Sbjct  122   LGGW  125


 Score = 50.4 bits (119),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +1

Query  1132  PQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPAT-VALFGLDFSTA  1281
             PQ+IP    +  FGPP  +T+ S+ PW+DH  SGL  AT  ALFGL F+TA
Sbjct  1     PQVIPQVSTLVRFGPPRSLTSASTCPWLDHSASGLERATETALFGLAFATA  51



>gb|EEX74124.1| hypothetical protein GCWU000323_01827 [Leptotrichia hofstadii 
F0254]
Length=112

 Score = 58.9 bits (141),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  693  PSQAYGTLSYHMCKHISAASVTGLAPLHLPRRTTRSVSYYAFFK  824
            PS AY TLSY  C+H SAASV  LAPLHL RR +R VSYYA F+
Sbjct  11   PSTAYRTLSYQACRHASAASVYVLAPLHLRRRYSRPVSYYALFQ  54


 Score = 43.5 bits (101),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  827  MAASKPTS*LF*PSHFVFHLANLWDLSWRSGLFPS*RRTLA  949
            MAASKPTS L    H + HL  + DLSWRSGLFPS  RTL+
Sbjct  56   MAASKPTSWLSVNIHLLSHLDIIRDLSWRSGLFPSRPRTLS  96



>gb|EEH89633.1| hypothetical protein ESAG_07158 [Escherichia sp. 3_2_53FAA]
Length=66

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  1058  YLRHYLNSFRREPAISRFV*PFTPTHSSSPNFSTLVGSDLQGVLPHLHPGHG  1213
             + R YLNSFR EPAISRF  PFTP+H SS NFSTLVGS LQ VLP+L P HG
Sbjct  15    FTRRYLNSFRGEPAISRFDWPFTPSHKSSANFSTLVGSVLQLVLPNLQPAHG  66



>ref|WP_011075501.1| hypothetical protein [Corynebacterium efficiens]
 ref|NP_738153.1| hypothetical protein CE1543 [Corynebacterium efficiens YS-314]
 dbj|BAC18353.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
Length=261

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 63/121 (52%), Gaps = 8/121 (7%)
 Frame = +1

Query  4    VIVTAAVYWDFNQEL-------APHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYC  162
            VIVT AVYW  N +L        P +L    R     Y +  VFA  CVF KQS P + C
Sbjct  27   VIVTTAVYWGLNSQLRRLTQLTGPLNLPAPGRRQSV-YINFNVFARTCVFSKQSLPSILC  85

Query  163  NPFTLME*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYGLV*LKLRGF  342
            +P  L +       A L+PKLR  FAEFL  SS +RL IL   TCVGL YG      RGF
Sbjct  86   DPHQLQKQIPSPVQAPLLPKLRGHFAEFLNHSSPERLSILYLTTCVGLGYGPNMHIARGF  145

Query  343  S  345
            S
Sbjct  146  S  146



>ref|WP_012676413.1| hypothetical protein [Persephonella marina]
 ref|YP_002730925.1| hypothetical protein PERMA_1142 [Persephonella marina EX-H1]
 ref|YP_002731696.1| hypothetical protein PERMA_1936 [Persephonella marina EX-H1]
 gb|ACO04175.1| conserved hypothetical protein [Persephonella marina EX-H1]
 gb|ACO04521.1| conserved hypothetical protein [Persephonella marina EX-H1]
Length=189

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 59/101 (58%), Gaps = 11/101 (11%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTAAVY  F   LAP  L + H AG TP+TS+F FA+CCVF KQS PP +C+P   +
Sbjct  99   TVIVTAAVYPGFGSRLAPLPLTYGHWAGFTPHTSSFEFAQCCVFGKQSPPPGFCDPLPHL  158

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVG  303
                 A G  L      +     LPSSL+R    ++PT +G
Sbjct  159  N--GTACGHPL-----SRSYGVNLPSSLRR----VTPTALG  188



>gb|ADI17460.1| hypothetical protein [uncultured beta proteobacterium HF0130_04F21]
Length=93

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  1770  VSPFGNLRIKVCLLTPRSLSQATTSFIACNRQGIHHVHLF  1889
             VSPFGNLRIK CL  PRSLSQATTSFIACNRQGIH +HLF
Sbjct  53    VSPFGNLRIKACLPAPRSLSQATTSFIACNRQGIHDMHLF  92



>gb|ACN99803.1| conserved hypothetical protein [Sulfurihydrogenibium azorense 
Az-Fu1]
Length=327

 Score = 52.4 bits (124),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 89/211 (42%), Gaps = 50/211 (24%)
 Frame = +2

Query  1364  PTVCMHTVSGSISLPSRGSFRLSLTVL--VHYRSITSI*PWRMVPPYS--------DRIS  1513
             P  C   VSGS+SLP RGSF LSL VL  +    I S+  W  + P +        D I 
Sbjct  86    PLACRSMVSGSLSLPFRGSFHLSLAVLCAIGQPGIFSLTQWSGLIPTTFHGGSGTRDHIL  145

Query  1514  RVPPYLSYA*YHRSDFVYGAITRYGSCFQRIPL---------------------------  1612
               PP           F YGA T YG  FQ + L                           
Sbjct  146   GRPP----------GFAYGAFTLYGVAFQLLLLPVGFVTSPEAGRLLTDMSHYPDVAKAA  195

Query  1613  SVRLSRTRLIPFRSPLLWESRLISfpaat*mfqfaafaSLPYVfr*r*pkrpgfpirkSA  1792
             ++ L R RL P RSPLL ES  +SFP AT  F FA F S    F        GFP     
Sbjct  196   AMALRRFRLFPVRSPLLRESLSVSFPRATKRFYFARFGS---SFEDTSLWAGGFPHSGIL  252

Query  1793  DQSVFAHSPQLIASYYVLHRL*SPRHPPCAL  1885
               ++   SP+LIA+ + LH    PRHPP  L
Sbjct  253   GSTLACSSPRLIAACHALHPFWLPRHPPWTL  283


 Score = 49.3 bits (116),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 32/56 (57%), Gaps = 1/56 (2%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPATV-ALFGLDFST  1278
             +AFHPYP LI    +   F PP  VT PS W W+D   S L  AT  ALFGL F T
Sbjct  1     MAFHPYPHLIQLCCSTDWFRPPDGVTRPSPWAWIDRSASRLQHATYSALFGLGFPT  56



>ref|WP_003038302.1| hypothetical protein [Streptococcus anginosus]
 gb|EID19494.1| hypothetical protein HMPREF1043_0706 [Streptococcus anginosus 
subsp. whileyi CCUG 39159]
Length=223

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 72/135 (53%), Gaps = 21/135 (16%)
 Frame = +2

Query  1187  LPHLHPGHG*ITWFRVYTQRL--------------SPCSDSISL-RLPY----PVNLATE  1309
             LP  HP H  + W R  T+                S   DSI+L RL +    P  L + 
Sbjct  18    LPTAHPLHFQLKWVRSSTRSYTRFNLAMGRSLRFGSRTRDSIALFRLAFATASPHGLTSP  77

Query  1310  --CKSLTHYTKGTPSPHEEAPTVCMHTVSGSISLPSRGSFRLSLTVLVHYRSITSI*PWR  1483
                 S  H +KGT SPH+EAPTVC H VSG+ISLPSRG+F  SLTVL+ YRS  SI  ++
Sbjct  78    RITNSQAHSSKGTLSPHKEAPTVCRHMVSGTISLPSRGTFHHSLTVLIRYRSTGSIQAYQ  137

Query  1484  MVPPYSDRISRVPPY  1528
             +V   S  I R P Y
Sbjct  138   VVLADSHGIPRAPCY  152


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +3

Query  1083  FGENQlfpglfslsplpTAHPLIFQH*WVRTSRACYRTFILAMGRSPGFGSTPSDCRPV-  1259
             FGENQL   L  LSPLPTAHPL FQ  WVR+S   Y  F LAMGRS  FGS   D   + 
Sbjct  3     FGENQLSRSLIGLSPLPTAHPLHFQLKWVRSSTRSYTRFNLAMGRSLRFGSRTRDSIALF  62

Query  1260  RTRFLYGSPIRLTSP  1304
             R  F   SP  LTSP
Sbjct  63    RLAFATASPHGLTSP  77



>gb|EJH40972.1| serine acetyltransferase [Vibrio cholerae CP1048(21)]
Length=82

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISC  1565
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG+HVSR    TL    L   
Sbjct  6     FRFYFTPLTGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTGYHVSRLLDFTLDEASLRGY  65

Query  1566  TGLSPAM  1586
               +SP+ 
Sbjct  66    HPVSPSF  72



>emb|CDW93822.1| conserved hypothetical protein [Thiomonas sp. CB2]
Length=56

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  354  VVPRKASKLQSYETVPQTDTGGRDEYSKALERTREKELGKLVP  226
            ++PRKA+KLQ   TVPQTDTG RDEYSKALERTREKELGK VP
Sbjct  14   LLPRKATKLQLDTTVPQTDTGARDEYSKALERTREKELGKFVP  56



>gb|EES70919.1| hypothetical protein POTG_04460, partial [Paenibacillus sp. oral 
taxon 786 str. D14]
Length=84

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  1063  EALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHP  1242
             EA PK  S RTSY +V L F  YP LIP  FN+ GFGPP RVTAPS W  VDH VSGL  
Sbjct  23    EASPKAISGRTSYLRVRLEFLRYPHLIPALFNVRGFGPPVRVTAPSPWTGVDHTVSGLRL  82

Query  1243  AT  1248
              T
Sbjct  83    QT  84



>dbj|BAN86004.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237]
 dbj|BAN86414.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237]
 dbj|BAN86446.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237]
 dbj|BAN88767.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237]
 dbj|BAN89178.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237]
 dbj|BAN89327.1| 23S ribosomal RNA [Acinetobacter baumannii NCGM 237]
Length=81

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT  1529
             F++ F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQT FHV RPT
Sbjct  6     FRIYFTPLTGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTRFHVPRPT  53



>ref|WP_014413255.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415584.1| hypothetical protein RSPPHO_03275, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06614.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=114

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 59/94 (63%), Gaps = 5/94 (5%)
 Frame = +2

Query  68   SSTGQASHPIRPLSCLQSAVFLLNSRSHQFIATLSPSWSKPIKLPGRTLSRSYGTNLPSS  247
            S TGQAS PIR L+  QS VFL+NSR H  +   SP W    + P    SRSYG  LPSS
Sbjct  2    SGTGQASDPIRRLATSQSPVFLVNSR-HPLVCAPSP-WLPKTRAP---FSRSYGGILPSS  56

Query  248  FSRVLSSALEYSSRPPVSVCGTVSYD*SLEAFLG  349
            F+ +LSSAL YS+ PPVSV GTV       AFLG
Sbjct  57   FNTILSSALVYSTSPPVSVWGTVHTWGYFLAFLG  90



>gb|EGG54195.1| hypothetical protein HMPREF9439_01522 [Parasutterella excrementihominis 
YIT 11859]
Length=75

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  723  HMCKHISAASVTGLAPLHLPRRTTRSVSYYAFFK*WLLLSQHPDCFSLPTSFST  884
            H     SAASV  LAPLHLPRR TR VSYYAFF+ WLLLSQ P C  L TSFST
Sbjct  22   HWITSASAASVNSLAPLHLPRRRTRPVSYYAFFEGWLLLSQLPGCHGLSTSFST  75



>emb|CDY45505.1| BnaCnng12640D [Brassica napus]
Length=378

 Score = 55.5 bits (132),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLI-FQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCN  165
            TV VTAAVY  F+ +L    L+ FQHRAGV  YTS +  AE CVF KQS PP  C 
Sbjct  258  TVRVTAAVYRGFHSKLITLLLLTFQHRAGVRLYTSCYHLAESCVFNKQSLPPGMCR  313


 Score = 44.7 bits (104),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  194  KLPGRTLSRSYGTNLPSSFSRVLSSALEYSSRPPVSVCGTVS  319
            K+     SRSYG  LPSSF  VLSSAL YS+  PVSV GTVS
Sbjct  318  KIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGTVS  359



>gb|EHH01337.1| hypothetical protein HMPREF9441_00776 [Paraprevotella clara YIT 
11840]
Length=187

 Score = 68.6 bits (166),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 75/161 (47%), Gaps = 16/161 (10%)
 Frame = +1

Query  1405  PLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPL  1584
             P  G+FSPFPHGTGSLSV YEYLAL DGP  F QD++C   L+   +     RVRG HPL
Sbjct  27    PCKGYFSPFPHGTGSLSVSYEYLALPDGPGGFTQDYSC-PALLRSPLRFGLLRVRGSHPL  85

Query  1585  WLLFPKDSTISPTITYKA-HPISLATTLGISVDFFSCSYLD--------VSVRRVRFVTL  1737
             W  FP  ST   +       P      +G+     +  Y             +  +F   
Sbjct  86    WRGFPVASTHGLSCDGAVLQPRRCRDNVGLGSSPVARHYWGNHSLFSFPAGTKMFQFPAF  145

Query  1738  CIQ---ITMT*KAGFPHSEICGSKCVCSLP---AAYRKLLR  1842
               +   I      G  HSEI GS+ +C+ P   AAY  L R
Sbjct  146   ASRIGGIISLQDIGLSHSEIRGSRAICASPRLFAAYHVLHR  186


 Score = 31.2 bits (69),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  1358  EAPTVCMHTVSGSISLPSRGSF  1423
             +APT C  TVSG++SLP +G F
Sbjct  11    DAPTACRRTVSGTLSLPCKGYF  32



>gb|ACN98721.1| conserved hypothetical protein [Sulfurihydrogenibium azorense 
Az-Fu1]
Length=327

 Score = 50.4 bits (119),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 88/211 (42%), Gaps = 50/211 (24%)
 Frame = +2

Query  1364  PTVCMHTVSGSISLPSRGSFRLSLTVL--VHYRSITSI*PWRMVPPYS--------DRIS  1513
             P  C   VSGS+SLP RGSF LSL VL  +    I S+  W  + P +        D I 
Sbjct  86    PLACRSMVSGSLSLPFRGSFHLSLAVLCAIGQPGIFSLTQWSGLIPTTFHGGSGTRDHIL  145

Query  1514  RVPPYLSYA*YHRSDFVYGAITRYGSCFQRIPL---------------------------  1612
               PP           F YGA T YG  FQ + L                           
Sbjct  146   GRPP----------GFAYGAFTLYGVAFQLLLLPVGFVTSPEAGRLLTDMSHYPDVAKAA  195

Query  1613  SVRLSRTRLIPFRSPLLWESRLISfpaat*mfqfaafaSLPYVfr*r*pkrpgfpirkSA  1792
             ++ L R RL P RSPLL ES  + FP AT  F FA F S    F        GFP     
Sbjct  196   AMALRRFRLFPVRSPLLRESLSVFFPRATKRFYFARFGS---SFEDTSLWAGGFPHSGIL  252

Query  1793  DQSVFAHSPQLIASYYVLHRL*SPRHPPCAL  1885
               ++   SP+LIA+ + LH    PRHPP  L
Sbjct  253   GSTLACSSPRLIAACHALHPFWLPRHPPWTL  283


 Score = 49.3 bits (116),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 32/56 (57%), Gaps = 1/56 (2%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPATV-ALFGLDFST  1278
             +AFHPYP LI    +   F PP  VT PS W W+D   S L  AT  ALFGL F T
Sbjct  1     MAFHPYPHLIQLCCSTDWFRPPDGVTRPSPWAWIDRSASRLQHATYSALFGLGFPT  56



>gb|EPS74531.1| hypothetical protein M569_00248, partial [Genlisea aurea]
Length=102

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = +1

Query  49   APHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLME*TNQATGAYLIPKLR  228
            +P  L F+H AGV+P+T ++ FAE CVF KQS  P +C+P            A L+PKLR
Sbjct  18   SPTSLTFRHWAGVSPHTWSYDFAETCVFGKQSPGPGHCDPL--------CEEAPLLPKLR  69

Query  229  YQFAEFLLPSSLKRLRILISPTCVGLRY  312
              FAEFL  S L  L IL  PTCVG  Y
Sbjct  70   GYFAEFLRESCLAPLGILYLPTCVGFGY  97



>gb|KGC54522.1| hypothetical protein DM75_499 [Burkholderia mallei]
 gb|KGD54998.1| hypothetical protein DP49_5735 [Burkholderia pseudomallei]
Length=64

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  1761  KGRVSPFGNLRIKVCLLTPRSLSQATTSFIACNRQGIHHVHLF  1889
             KGRVSPFG+LRIK  L  PRS SQAT SFIAC+RQGIHH+HLF
Sbjct  21    KGRVSPFGHLRIKARLPAPRSFSQATASFIACDRQGIHHMHLF  63



>gb|EEX73106.1| hypothetical protein GCWU000323_02875 [Leptotrichia hofstadii 
F0254]
 gb|EEX74125.1| hypothetical protein GCWU000323_01826 [Leptotrichia hofstadii 
F0254]
Length=112

 Score = 55.5 bits (132),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  693  PSQAYGTLSYHMCKHISAASVTGLAPLHLPRRTTRSVSYYAFFK  824
            PS AY TLSY  C+H SAASV  LAPLHL RR +R VS YA F+
Sbjct  11   PSTAYRTLSYQACRHASAASVYVLAPLHLRRRYSRPVSCYALFQ  54


 Score = 43.5 bits (101),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  827  MAASKPTS*LF*PSHFVFHLANLWDLSWRSGLFPS*RRTLA  949
            MAASKPTS L    H + HL  + DLSWRSGLFPS  RTL+
Sbjct  56   MAASKPTSWLSVNIHLLSHLDIIRDLSWRSGLFPSRPRTLS  96



>ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula]
Length=1106

 Score = 53.9 bits (128),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHL-IFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCN  165
            TV VTAAVY  F+ +L    L  FQHRAGV  YTS +  AE CVF KQS PP  C 
Sbjct  559  TVRVTAAVYRGFHSKLITLLLPTFQHRAGVRLYTSCYHLAESCVFNKQSLPPGMCR  614


 Score = 45.1 bits (105),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  194  KLPGRTLSRSYGTNLPSSFSRVLSSALEYSSRPPVSVCGTVS  319
            K+     SRSYG  LPSSF  VLSSAL YS+  PVSV GTVS
Sbjct  619  KIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGTVS  660



>gb|AGC71893.1| hypothetical protein [uncultured bacterium A1Q1_fos_4]
Length=52

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  354  VVPRKASKLQSYETVPQTDTGGRDEYSKALERTREKELGKLVP  226
            ++P KA+KLQ Y TVPQTDTG RDEYSKALERT+EKELGKL P
Sbjct  10   LLPGKATKLQLYTTVPQTDTGARDEYSKALERTQEKELGKLTP  52



>gb|AGC78890.1| hypothetical protein (mitochondrion) [Vicia faba]
 gb|AGC79003.1| hypothetical protein (mitochondrion) [Vicia faba]
Length=162

 Score = 53.9 bits (128),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHL-IFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCN  165
            TV VTAAVY  F+ +L    L  FQHRAGV  YTS +  AE CVF KQS PP  C 
Sbjct  42   TVRVTAAVYRGFHSKLITLLLPTFQHRAGVRLYTSCYHLAESCVFNKQSLPPGMCR  97


 Score = 44.7 bits (104),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  194  KLPGRTLSRSYGTNLPSSFSRVLSSALEYSSRPPVSVCGTVS  319
            K+     SRSYG  LPSSF  VLSSAL YS+  PVSV GTVS
Sbjct  102  KIGEHPFSRSYGVILPSSFDMVLSSALVYSTCSPVSVWGTVS  143



>gb|EDM70192.1| hypothetical protein RAZWK3B_11306 [Roseobacter sp. AzwK-3b]
 gb|EDM72673.1| hypothetical protein RAZWK3B_00595 [Roseobacter sp. AzwK-3b]
Length=101

 Score = 65.9 bits (159),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  1405  PLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTC  1518
             P  G FSPFPHGTGSLSV  EYLA E GPPIFRQDFTC
Sbjct  23    PSSGCFSPFPHGTGSLSVSKEYLAFEGGPPIFRQDFTC  60


 Score = 28.9 bits (63),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  1358  EAPTVCMHTVSGSISLPSRGSF  1423
             +APT C   VSG++SLPS G F
Sbjct  7     QAPTDCRRPVSGTVSLPSSGCF  28


 Score = 23.1 bits (48),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 22/41 (54%), Gaps = 3/41 (7%)
 Frame = +3

Query  1539  LSTTGLISCTGLSPAMAPVSKGFHYQSDYHVQGSSHFARHY  1661
             L+T+   S TGLSPAMA +   F   S     G S FAR Y
Sbjct  64    LNTSHRASHTGLSPAMAMLPNMFWSLSRL---GWSPFARRY  101



>gb|EPR32483.1| hypothetical protein dsmv_3640 [Desulfococcus multivorans DSM 
2059]
Length=152

 Score = 67.0 bits (162),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 58/109 (53%), Gaps = 12/109 (11%)
 Frame = +1

Query  187  TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYGLV*LKLRGF-------S  345
            T     A+L+PKLR  FAEFL   SLKRL IL  PTCVGLRY  + + +  F       S
Sbjct  22   TLHIAAAHLLPKLRCHFAEFLNQGSLKRLGILSPPTCVGLRYDHLHISIEAFLGSLGSIS  81

Query  346  WNHFRLLRAARAHVSTP*ITRPDLPKRLL*VKNQLFQQLDNLPRSVPPS  492
                 LL  +R H +   I    LP  L    N+LFQQ D+LP  VPPS
Sbjct  82   LRGKPLLITSR-HCTKERICLLFLPTGL----NRLFQQADDLPSCVPPS  125


 Score = 31.6 bits (70),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 19/34 (56%), Gaps = 1/34 (3%)
 Frame = +3

Query  468  PSAIRPPIASYDGA-GILTCFPSATHLCLALGAD  566
            PS + P +  YDG  GI TC PS T   L LG D
Sbjct  119  PSCVPPSLKRYDGGTGIFTCLPSPTPFGLGLGID  152



>emb|CDW90691.1| UNKNOWN [Stylonychia lemnae]
Length=83

 Score = 63.9 bits (154),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = -3

Query  1888  NKCTWWMPWRLQAMKDVVACDKLRGVSKHTLIRRFPNGETRPFRSSLSEY  1739
              KCTWWMPWR QAMKDVVAC+KLRG  K  LIRR      + +R+  S+Y
Sbjct  13    TKCTWWMPWRYQAMKDVVACEKLRGAGKQALIRR-----QQTWRTETSKY  57


 Score = 34.7 bits (78),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  1703  SK*LQEKKSTEIPKVVASEMG*ALYV  1626
             SK  +EKKSTEIPKVVASEMG A  +
Sbjct  55    SKYPEEKKSTEIPKVVASEMGRACKI  80



>ref|WP_014413243.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415572.1| hypothetical protein RSPPHO_03263, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06602.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=114

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 55/83 (66%), Gaps = 5/83 (6%)
 Frame = +2

Query  68   SSTGQASHPIRPLSCLQSAVFLLNSRSHQFIATLSPSWSKPIKLPGRTLSRSYGTNLPSS  247
            S TGQAS PIR L+  QS VFL+NSR H  +   SP W    + P    SRSYG  LPSS
Sbjct  2    SGTGQASDPIRRLATSQSPVFLVNSR-HPLVCAPSP-WLPKTRAP---FSRSYGGILPSS  56

Query  248  FSRVLSSALEYSSRPPVSVCGTV  316
            F+ +LSSAL YS+ PPVSV GTV
Sbjct  57   FNTILSSALVYSTSPPVSVWGTV  79



>gb|EFJ93358.1| hypothetical protein HMPREF9531_01540 [Escherichia coli MS 45-1]
 gb|EFU54798.1| hypothetical protein HMPREF9544_00071 [Escherichia coli MS 153-1]
 gb|EFU60024.1| hypothetical protein HMPREF9545_00138 [Escherichia coli MS 16-3]
 gb|EGB84937.1| hypothetical protein HMPREF9533_00192 [Escherichia coli MS 60-1]
Length=49

 Score = 69.3 bits (168),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  1433  GKGEKNPGRGVK*NLKPCAYKQSEPLRGVTAYLLYNGSATYI  1308
             GK ++ P RGVK NLKPC YKQ EPL GVTAYLLYNGSATYI
Sbjct  7     GKAKRTPARGVKKNLKPCTYKQWEPLNGVTAYLLYNGSATYI  48


 Score = 28.9 bits (63),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -3

Query  1450  VNQYREGKAKRTPG  1409
             +NQYREGKAKRTP 
Sbjct  1     MNQYREGKAKRTPA  14



>ref|WP_034222476.1| hypothetical protein [Lachnospiraceae bacterium A4]
Length=96

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 55/98 (56%), Gaps = 12/98 (12%)
 Frame = -2

Query  350  FQEKPLSFSHTRPYRKPTQVGEMSILRRLRELGRRNSANWYRNFGIRYAPVA*LVYSMRV  171
            ++EKPLSF    PYRKPTQV    I R   E   RNSA W RN G R A          +
Sbjct  2    YREKPLSFIPY-PYRKPTQVDGERIPRPAGEALSRNSAKWPRNLGKRGA----------I  50

Query  170  KGL-Q*TGGCDCLIKTQHSANTKVDV*GVTPARCWKIK  60
            +G  Q  G  +CL KTQ  A  K +V G+TPARCWK+K
Sbjct  51   EGWPQRIGSSNCLAKTQVYAKPKGEVYGLTPARCWKVK  88



>dbj|BAJ11780.1| dehydration responsive protein, partial [Corchorus aestuans]
Length=71

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -3

Query  565  SAPKARQRCVADGKQVNIPAPSYDAMGGRIAEGCPTVG  452
            SAPKARQRCVADGKQVNIPAPSY+AMGGRIAE  P VG
Sbjct  1    SAPKARQRCVADGKQVNIPAPSYNAMGGRIAEDHPAVG  38



>ref|WP_014413260.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415589.1| hypothetical protein RSPPHO_03280, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06619.1| unnamed protein product, partial [Rhodospirillum photometricum 
DSM 122]
Length=109

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  559  GPTHPAPMNVEQETLGFRREGFSPSLSLLMSAFALPIPPASFTRHLLRLTERSPT  723
            GP HPA +N+ QE LGFRR+ FS   SLLMSAF+LPIPPA  T HL R TERS T
Sbjct  1    GPAHPARINLAQEPLGFRRKCFSHFFSLLMSAFSLPIPPAVLTDHLHRRTERSAT  55



>gb|ABV11276.1| hypothetical protein CKO_00099 [Citrobacter koseri ATCC BAA-895]
 gb|ABV14081.1| hypothetical protein CKO_02979 [Citrobacter koseri ATCC BAA-895]
 gb|ABV14249.1| hypothetical protein CKO_03161 [Citrobacter koseri ATCC BAA-895]
 gb|ABV14986.1| hypothetical protein CKO_03911 [Citrobacter koseri ATCC BAA-895]
 gb|ABV15735.1| hypothetical protein CKO_04688 [Citrobacter koseri ATCC BAA-895]
Length=49

 Score = 68.9 bits (167),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  1433  GKGEKNPGRGVK*NLKPCAYKQSEPLRGVTAYLLYNGSATYI  1308
             GK ++ P RGVK NLKPC YKQ EPL GVTAYLLYNGSATYI
Sbjct  7     GKAKRTPARGVKKNLKPCTYKQWEPLYGVTAYLLYNGSATYI  48


 Score = 28.9 bits (63),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -3

Query  1450  VNQYREGKAKRTPG  1409
             +NQYREGKAKRTP 
Sbjct  1     MNQYREGKAKRTPA  14



>gb|KGW37799.1| hypothetical protein Y045_6146 [Burkholderia pseudomallei MSHR2451]
Length=78

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = -1

Query  429  KALRQIRARNSRG*DVCPCGTKQSEVVPRKASKLQSYETVPQTDTGGRDEYSKALERTRE  250
            KALRQIRA++SR            +    K        TVPQTDTGGRDEYSKALERTRE
Sbjct  11   KALRQIRAQDSRVWRELLRERSNWKWFQEKPLSFSLTMTVPQTDTGGRDEYSKALERTRE  70

Query  249  KELGKLVP  226
            KELGKLVP
Sbjct  71   KELGKLVP  78



>gb|EOQ35791.1| hypothetical protein HMPREF1526_02587, partial [Butyricicoccus 
pullicaecorum 1.2]
Length=163

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 52/76 (68%), Gaps = 5/76 (7%)
 Frame = +1

Query  1642  PISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQITMT--*KAGFPHSEICGSKCVCSL  1815
             P SLATT GISVDFFS  YLDVSV+ V +V L IQ+T+T    AGFPHSEI GSK +C  
Sbjct  16    PRSLATTSGISVDFFSSPYLDVSVQAVPYVNLWIQLTLTEYCSAGFPHSEIFGSKPICGS  75

Query  1816  P---AAYRKLLRPSSP  1854
             P   AA R L R S P
Sbjct  76    PKLIAACRVLHRLSVP  91



>emb|CAJ55200.1| Unknown [Lawsonia intracellularis PHE/MN1-00]
Length=125

 Score = 67.0 bits (162),  Expect(3) = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  1405  PLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPL  1584
             PL GFFSPFPHGT SLSV  EYLALEDGPP F Q +TC   ++   +     ++RGYH L
Sbjct  23    PLQGFFSPFPHGTCSLSVAEEYLALEDGPPRFPQGYTC-LAVLRYRLCLFQVQIRGYHSL  81

Query  1585  WLLFP  1599
             W  FP
Sbjct  82    WRNFP  86


 Score = 29.6 bits (65),  Expect(3) = 4e-11, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  1355  EEAPTVCMHTVSGSISLPSRGSF  1423
             ++APT C   VS SISLP +G F
Sbjct  6     KDAPTACRQLVSDSISLPLQGFF  28


 Score = 20.4 bits (41),  Expect(3) = 4e-11, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +3

Query  1614  QSDYHVQGSSHFARHY  1661
             QS     GSS FARHY
Sbjct  105   QSKLFGLGSSRFARHY  120



>ref|WP_014413258.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415587.1| hypothetical protein RSPPHO_03278, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06617.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=114

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = +2

Query  68   SSTGQASHPIRPLSCLQSAVFLLNSRSHQFIATLSPSWSKPIKLPGRTLSRSYGTNLPSS  247
            S TGQAS PIR L+  Q  VFL+NSR H  +   SP W    + P    SRSYG  LPSS
Sbjct  2    SGTGQASDPIRRLATSQGPVFLVNSR-HPLVCAPSP-WLPKTRAP---FSRSYGGILPSS  56

Query  248  FSRVLSSALEYSSRPPVSVCGTV  316
            F+ +LSSAL YS+ PPVSV GTV
Sbjct  57   FNTILSSALVYSTSPPVSVWGTV  79



>gb|EKI24911.1| dehydration responsive domain protein, partial [Escherichia coli 
TW15901]
Length=67

 Score = 52.4 bits (124),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  618  GLFTLFIATHVSIRTSDTSSILYKTPSQAYGTLSY  722
            GLFT FI T+VSIRTSDTSS+ + TPSQAY TL Y
Sbjct  1    GLFTRFIVTYVSIRTSDTSSMPHSTPSQAYRTLPY  35


 Score = 44.3 bits (103),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 24/35 (69%), Gaps = 3/35 (9%)
 Frame = +2

Query  719  LPYVQAH---IRSFGDWLSPVTSSAQDDSISELLR  814
            LPY   H    RSFG W SPVTSSAQ DS SELLR
Sbjct  33   LPYPTTHQRRCRSFGAWFSPVTSSAQADSTSELLR  67



>gb|EEO40746.1| hypothetical protein FSCG_01459 [Fusobacterium nucleatum subsp. 
vincentii 4_1_13]
Length=95

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = +3

Query  1083  FGENQlfpglfslsplpTAHPLIFQH*WVRTSRACYRTFILAMGRSPGFGSTPSDCRPVR  1262
             FGEN+L PG    SPL   HP  FQ  WVRTS   Y +FIL   RSPGF STP+D   + 
Sbjct  3     FGENELSPGSIGFSPLNLPHPPTFQRRWVRTSTVSYHSFILDRFRSPGFASTPNDYIALL  62

Query  1263  TRFLYGSPIRLTSPLNVSR*PIIQKVRRHPT  1355
                   +P+ LTSP NV+R  I+QK R HP 
Sbjct  63    RLGFPSAPLYLTSPFNVTRRIILQKARHHPN  93



>gb|EDN75700.1| hypothetical protein RUMGNA_03973 [Ruminococcus gnavus ATCC 29149]
Length=81

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  1063  EALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHP  1242
             EA PK  S RTSY +V L F PYP LIP  FN  GFGPP   TA S+W W+DH VSGL  
Sbjct  3     EASPKAISRRTSYLRVRLEFLPYPHLIPTLFNGCGFGPPLPFTATSTWTWIDHPVSGLLR  62

Query  1243  ATVA  1254
              T++
Sbjct  63    LTIS  66



>gb|EDQ97287.1| hypothetical protein CLOBAR_00774 [Intestinibacter bartlettii 
DSM 16795]
 gb|EDQ97485.1| hypothetical protein CLOBAR_00537 [Intestinibacter bartlettii 
DSM 16795]
Length=85

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +1

Query  1060  LEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLH  1239
             LEA PK  S RTSY Q  L FH YPQ+IP  FN+ GFGPP   T  S+  W+  LVSGL 
Sbjct  9     LEASPKAISGRTSYLQARLEFHRYPQVIPALFNVRGFGPPRNFTFASTCSWIGRLVSGLR  68

Query  1240  PATVALFGLDF  1272
               T   F   F
Sbjct  69    RVTGRPFKTRF  79



>gb|EGB79477.1| hypothetical protein HMPREF9532_00001 [Escherichia coli MS 57-2]
Length=49

 Score = 67.0 bits (162),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  1433  GKGEKNPGRGVK*NLKPCAYKQSEPLRGVTAYLLYNGSATYI  1308
             GK ++ P RGVK NLKPC YKQ EPL  VTAYLLYNGSATYI
Sbjct  7     GKAKRTPARGVKKNLKPCTYKQWEPLNEVTAYLLYNGSATYI  48


 Score = 29.3 bits (64),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -3

Query  1450  VNQYREGKAKRTPG  1409
             +NQYREGKAKRTP 
Sbjct  1     MNQYREGKAKRTPA  14



>gb|ELY20071.1| hypothetical protein HALTITAN_3296 [Halomonas titanicae BH1]
Length=77

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISC  1565
             F++ F    GVLFAFPSRYWFTIG+  VFSLGGWSP +Q+ F V RPT   +      S 
Sbjct  6     FRIYFTPLSGVLFAFPSRYWFTIGQPGVFSLGGWSPRLQSRFLVPRPTRFHMIR---FST  62

Query  1566  TGLSPAMAPVSKGF  1607
             TGLSPA A +   F
Sbjct  63    TGLSPATATLPSVF  76



>gb|ADI17560.1| hypothetical protein [uncultured alpha proteobacterium HF0130_06E21]
Length=62

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  596  KPWAFGERAFHPLYRYSCQHSHFRYLQHPLQDTFSGLRNALLP  724
             PW +GE   H LYRYSCQHSHFRYLQH  +DTF+GLRNA LP
Sbjct  4    NPWTYGESVSHTLYRYSCQHSHFRYLQHLSRDTFAGLRNAPLP  46



>ref|XP_010104771.1| hypothetical protein L484_018823 [Morus notabilis]
 gb|EXC01912.1| hypothetical protein L484_018823 [Morus notabilis]
Length=77

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +3

Query  1311  VSR*PIIQKVRRHPTKRLRLFVCTRFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWS  1490
             +SR  I+Q+ R      L L    RF VLFHSP GVLF  PSRY+FTIG   VFSL  WS
Sbjct  1     MSRRLILQQARGQSPGLLPLLGSLRFHVLFHSPMGVLFTLPSRYYFTIGHPGVFSLARWS  60

Query  1491  PHIQTGFHVSRPT  1529
               I TGFHVS  T
Sbjct  61    LLIHTGFHVSHAT  73



>gb|EEW77470.1| serine acetyltransferase [Haemophilus influenzae NT127]
Length=66

 Score = 65.1 bits (157),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  1405  PLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTC  1518
             P PGFFSPF H TGSLSV+ EYLALEDGPP F+QD TC
Sbjct  15    PSPGFFSPFLHSTGSLSVNQEYLALEDGPPFFKQDITC  52


 Score = 30.0 bits (66),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +2

Query  1364  PTVCMHTVSGSISLPSRGSF  1423
             PT C + VSGSISLPS G F
Sbjct  1     PTACTYKVSGSISLPSPGFF  20



>gb|EFX63797.1| hypothetical protein DAPPUDRAFT_118838 [Daphnia pulex]
Length=109

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  354  VVPRKASKLQSYETVPQTDTGGRDEYSKALERTREKELGKLVP  226
            ++P KA+KLQ   TVPQTDTG RDEYSKALERT+EKELGKL+P
Sbjct  67   LLPGKATKLQLLTTVPQTDTGARDEYSKALERTQEKELGKLIP  109


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  999  LQTPNTGECELGRQTSGANVRRQEGNNPDRQLR  901
            +QTPNT E  LG +  GANVR QEGNNPDRQLR
Sbjct  1    MQTPNTAEYSLGDRAPGANVRTQEGNNPDRQLR  33



>gb|ADI19242.1| hypothetical protein [uncultured delta proteobacterium HF0200_14D13]
Length=151

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = +3

Query  1326  IIQKVRRHPTKRLRLFVCTRFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQT  1505
             I+QK R     R R      F+V F    GVLF FPSRYWF IG   V SLGGWSP I+ 
Sbjct  17    IMQKARGRGHSRSRCLWTQGFRVCFTPLGGVLFTFPSRYWFAIGLRVVLSLGGWSPLIRA  76

Query  1506  GFHVSRPTCRTLSTTGLISCTGLSPAMAPVSKGFHYQSD  1622
             GFHV RPT R  +     S TG+ P+   + + F + S 
Sbjct  77    GFHVPRPT-RDPAGALSPSRTGVLPSPPRLPRRFRWTSG  114



>gb|ABM53546.1| conserved hypothetical protein [uncultured beta proteobacterium 
CBNPD1 BAC clone 578]
Length=49

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  1765  AGFPHSEICGSKCVCSLPAAYRKLLRPSSPVIAKASTMCT  1884
              GFPHSEI GSK +C LP AYR+L RPSSPVIAKAST CT
Sbjct  10    GGFPHSEISGSKLICQLPEAYRRLSRPSSPVIAKASTTCT  49



>gb|EHN78839.1| hypothetical protein SMCF_1619 [Streptomyces coelicoflavus ZG0656]
Length=242

 Score = 51.2 bits (121),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 70/177 (40%), Gaps = 34/177 (19%)
 Frame = +3

Query  1452  IGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISCTGLSPAMAPVS-----------  1598
             IG   +F L GWS  I TGF   R T  +L     +S TG+ P+   +S           
Sbjct  34    IGHQGIFRLSGWSRQIHTGFLGPRATWVSLKRAADVSTTGVLPSTPDLSHVLRLHQRFLT  93

Query  1599  ---KGFHYQSDY---HVQGSSHFAR-HYfgnlg*flflqllRCFSSPRSLR---YPMY--  1742
                 G  ++ D    H Q      R  +         L   R FS P       +P +  
Sbjct  94    RPTAGRPWKRDPTTPHTQPLPGLTRIRFGLIRFRSPLLPESRLFSLPAGTEMFHFPAFPP  153

Query  1743  ---------SDNDDLKGRVSPFGNLRIKVCLLTPRSLSQATTSFIACNRQGIHHVHL  1886
                      + +DD   RVSPFG+ RIK  L TPR LS   TSFI    QGIH   L
Sbjct  154   HCLCVQQRVTAHDDC--RVSPFGHPRIKAWLTTPRGLSWPPTSFIGSWCQGIHRAPL  208


 Score = 42.7 bits (99),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  1358  EAPTVCMHTVSGSISLPSRGSFRLSLTVL  1444
             +APT C HTVSG+ISL SRG+F  SLTVL
Sbjct  3     DAPTACRHTVSGTISLRSRGTFHHSLTVL  31



>gb|EHN79822.1| hypothetical protein SMCF_600 [Streptomyces coelicoflavus ZG0656]
Length=242

 Score = 51.2 bits (121),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 70/177 (40%), Gaps = 34/177 (19%)
 Frame = +3

Query  1452  IGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISCTGLSPAMAPVS-----------  1598
             IG   +F L GWS  I TGF   R T  +L     +S TG+ P+   +S           
Sbjct  34    IGHQGIFRLSGWSRQIHTGFLGPRATWVSLKRAADVSTTGVLPSTPDLSHVLRLHQRFLT  93

Query  1599  ---KGFHYQSDY---HVQGSSHFAR-HYfgnlg*flflqllRCFSSPRSLR---YPMY--  1742
                 G  ++ D    H Q      R  +         L   R FS P       +P +  
Sbjct  94    RPTAGRPWKRDPTTPHTQPLPGLTRIRFGLIRFRSPLLPESRLFSLPAGTEMFHFPAFPP  153

Query  1743  ---------SDNDDLKGRVSPFGNLRIKVCLLTPRSLSQATTSFIACNRQGIHHVHL  1886
                      + +DD   RVSPFG+ RIK  L TPR LS   TSFI    QGIH   L
Sbjct  154   HCLCVQQRVTAHDDC--RVSPFGHPRIKAWLTTPRGLSWPPTSFIGSWCQGIHRAPL  208


 Score = 42.7 bits (99),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  1358  EAPTVCMHTVSGSISLPSRGSFRLSLTVL  1444
             +APT C HTVSG+ISL SRG+F  SLTVL
Sbjct  3     DAPTACRHTVSGTISLRSRGTFHHSLTVL  31



>gb|EFC30233.1| hypothetical protein C1336_000600005 [Campylobacter jejuni subsp. 
jejuni 1336]
Length=51

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  726  MCKHISAASVTGLAPLHLPRRTTRSVSYYAFFK*WLLLSQHPDCFSLPTSFST  884
            MCK  S ASV  LAPL+ PR+ TR VSYYAFFK WLLLSQ P C S  TSFST
Sbjct  1    MCK--STASVLTLAPLYFPRKITRPVSYYAFFKGWLLLSQPPGCLSNFTSFST  51



>ref|WP_007264782.1| hypothetical protein, partial [Streptomyces sp. C]
 gb|EFL15838.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces 
sp. C]
 gb|EFL16484.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces 
sp. C]
Length=81

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  61   LIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLME*TNQATGAYLIPKLRYQFA  240
            L FQHRAGV+PYTS + FA  CVF KQS     C    L E  +    A L+PKLR  FA
Sbjct  4    LTFQHRAGVSPYTSPYGFARTCVFSKQSLLAGLCGHPQLREQVSSPGMAPLLPKLRGHFA  63

Query  241  EFLLPSSLKRLRIL  282
            EFL  SS +RL IL
Sbjct  64   EFLNHSSPERLGIL  77



>dbj|BAA29291.1| 235aa long hypothetical protein [Pyrococcus horikoshii OT3]
Length=235

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 61/106 (58%), Gaps = 11/106 (10%)
 Frame = +1

Query  4    VIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLME  183
            VIVT AVY  F + L P    ++H AGV P T+ F  A  CVFIKQS PP +C+    + 
Sbjct  50   VIVTPAVYRCFTR-LYPG-FTYRHWAGVGPSTNPFGLAGTCVFIKQSGPPSHCD----LR  103

Query  184  *TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISP--TCVGLRYG  315
             T+    A L+PKLR QFAEF  P    R  +  SP  TCVG RYG
Sbjct  104  VTHPQ--APLLPKLRGQFAEFPRP-GFPRHALGFSPRGTCVGSRYG  146



>gb|EHN79496.1| hypothetical protein SMCF_951 [Streptomyces coelicoflavus ZG0656]
Length=242

 Score = 50.4 bits (119),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 69/177 (39%), Gaps = 34/177 (19%)
 Frame = +3

Query  1452  IGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISCTGLSPAMAPVS-----------  1598
             IG   +F L GWS  I TGF   R T  +L     +S TG+ P+   +S           
Sbjct  34    IGHQGIFRLSGWSRQIHTGFLGPRATWVSLKRAADVSTTGVLPSTPDLSHVLRLHQRFLT  93

Query  1599  ---KGFHYQSDY---HVQGSSHFAR-HYfgnlg*flflqllRCFSSPRSLR---YPMY--  1742
                 G   + D    H Q      R  +         L   R FS P       +P +  
Sbjct  94    RPVAGRQQKRDPTTPHTQPLPGLTRIRFGLIRFRSPLLPESRLFSLPAGTEMFHFPAFPP  153

Query  1743  ---------SDNDDLKGRVSPFGNLRIKVCLLTPRSLSQATTSFIACNRQGIHHVHL  1886
                      + +DD   RVSPFG+ RIK  L TPR LS   TSFI    QGIH   L
Sbjct  154   HCLCVQQRVTAHDDC--RVSPFGHPRIKAWLTTPRGLSWPPTSFIGSWCQGIHRAPL  208


 Score = 42.7 bits (99),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  1358  EAPTVCMHTVSGSISLPSRGSFRLSLTVL  1444
             +APT C HTVSG+ISL SRG+F  SLTVL
Sbjct  3     DAPTACRHTVSGTISLRSRGTFHHSLTVL  31



>ref|WP_003714185.1| unnamed protein product [Neisseria lactamica]
 emb|CBX22841.1| unnamed protein product [Neisseria lactamica Y92-1009]
Length=49

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  1032  MARGSLRLTKPLQTPNTGECELGRQTSGANVRRQEGNNPDRQLRSQRL  889
             MARG L+LT P QT NT +  LGRQT+GANVR QEGNNPDR+LRSQ +
Sbjct  1     MARGLLQLTNPWQTQNTIKWFLGRQTAGANVRCQEGNNPDRRLRSQMI  48



>gb|AHI24017.1| hypothetical protein H845_49 [Komagataeibacter xylinus E25]
 gb|AHI24648.1| hypothetical protein H845_693 [Komagataeibacter xylinus E25]
 gb|AHI24875.1| hypothetical protein H845_927 [Komagataeibacter xylinus E25]
 gb|AHI26394.1| hypothetical protein H845_2467 [Komagataeibacter xylinus E25]
 gb|AHI26695.1| hypothetical protein H845_2781 [Komagataeibacter xylinus E25]
Length=180

 Score = 62.4 bits (150),  Expect(3) = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 51/88 (58%), Gaps = 12/88 (14%)
 Frame = +1

Query  1642  PISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQITMT*KAG------FPHSEICGSKC  1803
             P SLATT  IS+D FS  YLDVSV RVR ++LCIQ  M   AG      +P  + C    
Sbjct  49    PRSLATTSRISIDVFSSGYLDVSVPRVRLMSLCIQ-DMIPIAGWVAPFRYPRIKACS---  104

Query  1804  VCSLPAAYRKLLRPSSPVIAKASTMCTY  1887
                LP A+R + R SSP  AKAST C Y
Sbjct  105   --RLPMAFRSVPRLSSPPGAKASTECPY  130


 Score = 30.4 bits (67),  Expect(3) = 7e-10, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  1484  MVPPYSDRISRVPPY  1528
             MVPP SDRISRVPPY
Sbjct  1     MVPPCSDRISRVPPY  15


 Score = 19.6 bits (39),  Expect(3) = 7e-10, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  TGLSPAMAPVSKGFHYQSDYH  1628
             TGLSPA+A +S  F +  + H
Sbjct  25    TGLSPALAGLSIPFCFFKNDH  45



>gb|EKE04738.1| hypothetical protein ACD_20C00008G0001 [uncultured bacterium]
Length=86

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = -2

Query  1874  VDALAITGDEGRSSLR*AAGSEQTHFDPQISEWGNPAF*V---IVI*IHrvtkrtrrteT  1704
             +DALA+ GDEGR  LR ++GS QT +DP +SEWGNPA  +   ++     + KRT+ +ET
Sbjct  1     MDALALRGDEGRGWLRNSSGSRQTGYDPGVSEWGNPAGVMSSHLLTEFIGLEKRTQGSET  60

Query  1703  SK*LQEKKSTEIPKVVASEMG  1641
             S+ LQE+KS EIP V ASE G
Sbjct  61    SQYLQEEKSNEIPLVAASEEG  81



>ref|WP_012673749.1| hypothetical protein [Sulfurihydrogenibium azorense]
 ref|YP_002728882.1| hypothetical protein SULAZ_0908 [Sulfurihydrogenibium azorense 
Az-Fu1]
 ref|YP_002729595.1| hypothetical protein SULAZ_1633 [Sulfurihydrogenibium azorense 
Az-Fu1]
 gb|ACN98424.1| conserved hypothetical protein [Sulfurihydrogenibium azorense 
Az-Fu1]
 gb|ACN98841.1| conserved hypothetical protein [Sulfurihydrogenibium azorense 
Az-Fu1]
Length=183

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 59/101 (58%), Gaps = 17/101 (17%)
 Frame = +1

Query  1    TVIVTAAVYWDFNQELAPHHLIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLM  180
            TVIVTAAVY  F   LAP  L + H AG TP+TS+F FA+CCVF KQS  P +C+P    
Sbjct  99   TVIVTAAVYPGFGSGLAPIPLTYGHWAGFTPHTSSFEFAQCCVFGKQSPGPGFCDP----  154

Query  181  E*TNQATGAYLIPKLRYQFAEFLLPSSLKRLRILISPTCVG  303
                   G + + + RY  +   LPSSL+R    ++P  +G
Sbjct  155  -----PCGGHPLFR-RYGVS---LPSSLRR----VTPNALG  182



>ref|WP_004595993.1| hypothetical protein [Rickettsia prowazekii]
 gb|EOB10733.1| hypothetical protein H376_690 [Rickettsia prowazekii str. GvF12]
 gb|EOB11076.1| hypothetical protein H377_530 [Rickettsia prowazekii str. Cairo 
3]
Length=156

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  596  KPWAFGERAFHPLYRYSCQHSHFRYLQHPLQDTFSGLRNALLPYV  730
             PW FGE   H LYRY CQHSHFRYLQ  LQ TF+GLRNA LP++
Sbjct  109  NPWTFGENVSHILYRYLCQHSHFRYLQQTLQFTFTGLRNAPLPFM  153



>ref|WP_032941583.1| hypothetical protein [Citrobacter sp. 30_2]
Length=115

 Score = 52.0 bits (123),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  998  CKLRIPVSASLGDRRRVLTSGVKRETTQTAS*GPK  894
            CKLRIP +   GD RRVLTS VKRETTQTAS GPK
Sbjct  57   CKLRIPKNVITGDTRRVLTSVVKRETTQTASYGPK  91


 Score = 40.0 bits (92),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -1

Query  891  LAKWKTKWEG*NSQDVGLEAAII  823
            + KW+T WEG +SQDVGLEAAII
Sbjct  93   MVKWETMWEGTDSQDVGLEAAII  115



>gb|EQL89715.1| hypothetical protein D052_4663 [Vibrio parahaemolyticus 10290]
Length=59

 Score = 53.5 bits (127),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  1363  SDCLYAHGFRFYFTPLPGFFSPFPHGTGSLSVD  1461
             S CLY HGFRFYFTPL G    FPHGTGSLSV 
Sbjct  26    SYCLYVHGFRFYFTPLTGVLFAFPHGTGSLSVS  58


 Score = 38.1 bits (87),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 1/30 (3%)
 Frame = +2

Query  1292  VNLATECKSLTHYTKGTPSPHEEAPTVCMH  1381
             VNLATE KSLTHYTKGT S  ++A + C++
Sbjct  2     VNLATEYKSLTHYTKGTQS-QDKACSYCLY  30



>gb|EDN76706.1| hypothetical protein RUMGNA_02966 [Ruminococcus gnavus ATCC 29149]
Length=135

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = +3

Query  1209  MGRSPGFGSTPSDCRPV-RTRFLYGSPIR-LTSPLNVSR*PIIQKVRRHPTKRLRLFVCT  1382
             M RSPGFGSTP+D   + R  F     ++ LTSP +V+R  ++QKVR    K +   V  
Sbjct  1     MDRSPGFGSTPTDYFALFRLGFPSAPGLQPLTSPASVTRRTVLQKVRGSSYKDVPQLVNI  60

Query  1383  RFQVLFHSPPGVLFAFPSRYW  1445
              FQVLFHSPPGVLF FPS+Y+
Sbjct  61    WFQVLFHSPPGVLFTFPSQYY  81



>gb|EDN75699.1| hypothetical protein RUMGNA_03972 [Ruminococcus gnavus ATCC 29149]
 gb|EDN76539.1| hypothetical protein RUMGNA_03219 [Ruminococcus gnavus ATCC 29149]
Length=135

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = +3

Query  1209  MGRSPGFGSTPSDCRPV-RTRFLYGSPIR-LTSPLNVSR*PIIQKVRRHPTKRLRLFVCT  1382
             M RSPGFGSTP+D   + R  F     ++ LTSP +V+R  ++QKVR    K +   V  
Sbjct  1     MDRSPGFGSTPTDYFALFRLGFPSAPGLQPLTSPASVTRRTVLQKVRGSSYKDVPQLVNI  60

Query  1383  RFQVLFHSPPGVLFAFPSRYW  1445
              FQVLFHSPPGVLF FPS+Y+
Sbjct  61    WFQVLFHSPPGVLFTFPSQYY  81



>dbj|GAL60544.1| hypothetical protein EV102420_45_00017 [Escherichia vulneris 
NBRC 102420]
Length=61

 Score = 50.8 bits (120),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  741  SAASVTGLAPLHLPRRTTRSVSYYAFFK  824
            +AASV GLAPLHLPRR TR VSYYAFFK
Sbjct  34   AAASVHGLAPLHLPRRPTRPVSYYAFFK  61


 Score = 40.8 bits (94),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +1

Query  646  MSAFALPIPPASFTRHLLRLTERSPT  723
            MSAFAL IPPA  T HL RLTERSPT
Sbjct  1    MSAFALLIPPACLTAHLQRLTERSPT  26



>gb|ETT00906.1| hypothetical protein HMPREF1497_2012, partial [Fusobacterium 
sp. CM21]
Length=175

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 79/149 (53%), Gaps = 17/149 (11%)
 Frame = +3

Query  1446  FTIGRLRVFSLGGWSPHIQTGFHVSRPTCRTLSTTGLISCTGLSPAMAPVSKG-------  1604
             ++IG   VF LGGWS  + TGF VSR T  T  +   +S T LS +MA   K        
Sbjct  17    YSIGHQVVFRLGGWSLLLPTGFLVSRSTLDTTESQS-VSYTRLSLSMAGFPKTVLLPTAS  75

Query  1605  ----FHYQSDYHVQGSSHFARHYfgnlg*flflqllRCFSSPRSLRYPMYSDNDDLKG--  1766
                  +      V  SS FARHY G    FLFL+LLRCFSSP SLR  M S   D     
Sbjct  76    SSVVLNPGDKSPVWASSPFARHYSGIRCFFLFLRLLRCFSSPGSLRMTMDSSYGDRSSFC  135

Query  1767  RVSPFGNLRIKVCLLTP---RSLSQATTS  1844
             RVSPFG LRI   LL P   RSLS+ +++
Sbjct  136   RVSPFGYLRINGYLLLPAAFRSLSRPSSA  164



>gb|EEI46427.1| hypothetical protein HMPREF0693_3633 [Proteus mirabilis ATCC 
29906]
Length=41

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  1191  GNTPWRSEPTNVEKLGDELWVGVKG*TNLEIAGSLRKLFR  1072
             GNT WR+EPTNVEKL D+LW+GVKG +N EIAGS RKLFR
Sbjct  2     GNTNWRTEPTNVEKLADDLWMGVKGQSNREIAGSPRKLFR  41



>gb|AHO23029.1| hypothetical protein AV75_33185 [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121180]
Length=61

 Score = 50.8 bits (120),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  741  SAASVTGLAPLHLPRRTTRSVSYYAFFK  824
            +AASV GLAPLHLPRR TR VSYYAFFK
Sbjct  34   AAASVHGLAPLHLPRRPTRPVSYYAFFK  61


 Score = 40.4 bits (93),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  646  MSAFALPIPPASFTRHLLRLTERSPT  723
            MSAFAL IPPA+ T HL RLTERSPT
Sbjct  1    MSAFALLIPPATLTGHLRRLTERSPT  26



>ref|WP_004923043.1| hypothetical protein [Providencia stuartii]
 gb|EDU60913.1| hypothetical protein PROSTU_01098 [Providencia stuartii ATCC 
25827]
Length=41

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  1191  GNTPWRSEPTNVEKLGDELWVGVKG*TNLEIAGSLRKLFR  1072
             GNT WR+EPTNVEKL D+LW+GVKG +N EIAGS RKLFR
Sbjct  2     GNTNWRTEPTNVEKLADDLWLGVKGQSNREIAGSPRKLFR  41



>gb|ADI18019.1| hypothetical protein [uncultured delta proteobacterium HF0200_19J16]
Length=175

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 67/151 (44%), Gaps = 15/151 (10%)
 Frame = +3

Query  1416  VLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT---CRTLSTTGLISCTGLSPAM  1586
             +LF FPSRYW+TIG   +FSLGGWSP IQTGF VSRPT    RT S   L     L  A 
Sbjct  1     MLFTFPSRYWYTIGLQVIFSLGGWSPRIQTGFLVSRPTQVPPRTSSDFRLRGSNPLCRAF  60

Query  1587  APVSKGFHYQSDYHVQGSSHFARHYfgnlg*flflqllRCFSSP---RSLRYPMYSD---  1748
                S        +     +   R +         L+  R  S P      ++P ++    
Sbjct  61    PGTSTNPPIILCWQPYNPAGRTRRFGLFPLRSPLLRESRLISFPSGTEMFQFPEFAPLTY  120

Query  1749  ------NDDLKGRVSPFGNLRIKVCLLTPRS  1823
                         RV+P GN RIK CLL P +
Sbjct  121   GFSQQCMASTAMRVTPLGNPRIKRCLLFPEA  151



>gb|KGE54303.1| hypothetical protein MGAS2111_2303 [Streptococcus pyogenes MGAS2111]
 gb|KGE54535.1| hypothetical protein MGAS2111_2281 [Streptococcus pyogenes MGAS2111]
 gb|KGE54623.1| hypothetical protein MGAS2111_2270 [Streptococcus pyogenes MGAS2111]
 gb|KGE56396.1| hypothetical protein MGAS2111_2233 [Streptococcus pyogenes MGAS2111]
 gb|KGE57455.1| hypothetical protein MGAS2111_2202 [Streptococcus pyogenes MGAS2111]
 gb|KGE57459.1| hypothetical protein MGAS2111_2199 [Streptococcus pyogenes MGAS2111]
 gb|KGE57645.1| hypothetical protein MGAS2111_2130 [Streptococcus pyogenes MGAS2111]
 gb|KGE58894.1| hypothetical protein MGAS2111_1734 [Streptococcus pyogenes MGAS2111]
 gb|KGE59270.1| hypothetical protein MGAS2111_1473 [Streptococcus pyogenes MGAS2111]
 gb|KGE59417.1| hypothetical protein MGAS2111_1457 [Streptococcus pyogenes MGAS2111]
Length=82

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  1060  LEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLH  1239
             ++A PK  SERTSY QV L F  YPQ+I   FN+  FGPP   T+PS+  WV H+VSGL 
Sbjct  16    IDASPKAISERTSYLQVRLEFLRYPQVIQALFNVPWFGPPVSFTSPSTCSWVGHMVSGLQ  75

Query  1240  PAT  1248
               T
Sbjct  76    HDT  78



>gb|EEI46272.1| hypothetical protein HMPREF0693_3788, partial [Proteus mirabilis 
ATCC 29906]
Length=49

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  1386  FQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTG  1508
             F+  F    GVLFAFPSRYWFTIG+  VFSLGGWSPHIQTG
Sbjct  9     FRFFFTPLAGVLFAFPSRYWFTIGQSGVFSLGGWSPHIQTG  49



>gb|KFA45294.1| hypothetical protein EW35_3223 [Staphylococcus aureus]
Length=154

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 58/121 (48%), Gaps = 15/121 (12%)
 Frame = +3

Query  1152  FQH*WVRTSRACYRTFILAMGRSPGFGSTPSDCRPVRTRFLYGSPIRLTSPLNVSR*PII  1331
             FQ   VR+S  CY  F L  GRSPGFGST +  RP++T  L      LT    V+R  I+
Sbjct  13    FQRKSVRSSIQCYLNFNLTKGRSPGFGSTTNTKRPIQTLSLRLHIYCLTLHQIVTRRFIL  72

Query  1332  QKVRRHPTKRLRLFVCTRFQVLFHSPPG-------VLFAFPSRYWFTIGRLRVFSLGGWS  1490
             QK R HP         T      H+  G       VLF FPSRYWFTI      +LG   
Sbjct  73    QKARHHP--------LTALTTCKHTVSGSISLPFRVLFTFPSRYWFTIVTREYLALGDGP  124

Query  1491  P  1493
             P
Sbjct  125   P  125



>gb|EFD68878.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces 
lividans TK24]
 gb|EFD70528.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces 
lividans TK24]
Length=81

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  61   LIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLME*TNQATGAYLIPKLRYQFA  240
            L FQHRAGV+PYTS + FA  CVF KQS     C    L    +    A L+PKLR  FA
Sbjct  4    LTFQHRAGVSPYTSPYGFARTCVFSKQSLLAGLCGHPQLRVQNSSPGVAPLLPKLRGHFA  63

Query  241  EFLLPSSLKRLRIL  282
            EFL  SS +RL IL
Sbjct  64   EFLNHSSPERLGIL  77



>gb|ADI18196.1| hypothetical protein [uncultured delta proteobacterium HF0200_39N20]
Length=125

 Score = 63.5 bits (153),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  1416  VLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT  1529
             +LF FPSRYW+TIG   +FSLGGWSP IQTGF VSRPT
Sbjct  1     MLFTFPSRYWYTIGLQVIFSLGGWSPRIQTGFLVSRPT  38


 Score = 26.2 bits (56),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = +2

Query  1592  CFQRIPLSVRLSRTRLIPFRSPLLWESRLIS  1684
             C++    + R  R  L P RSPLL ESRLIS
Sbjct  72    CWRPYNPAGRTRRFGLFPLRSPLLRESRLIS  102



>gb|EOS28076.1| hypothetical protein C804_03778, partial [Lachnospiraceae bacterium 
A4]
Length=85

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 47/86 (55%), Gaps = 11/86 (13%)
 Frame = -2

Query  314  PYRKPTQVGEMSILRRLRELGRRNSANWYRNFGIRYAPVA*LVYSMRVKGL-Q*TGGCDC  138
            PYRKPTQV    I R   E   RNSA W RN G R A          ++G  Q  G  +C
Sbjct  2    PYRKPTQVDGERIPRPAGEALSRNSAKWPRNLGKRGA----------IEGWPQRIGSSNC  51

Query  137  LIKTQHSANTKVDV*GVTPARCWKIK  60
            L KTQ  A  K +V G+TPARCWK+K
Sbjct  52   LAKTQVYAKPKGEVYGLTPARCWKVK  77



>dbj|BAJ11782.1| dehydration responsive protein, partial [Corchorus trilocularis]
Length=71

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  565  SAPKARQRCVADGKQVNIPAPSYDAMGGRIAE  470
            SAPKARQRCVADGK VNIPAPSY AMGGRIAE
Sbjct  1    SAPKARQRCVADGKLVNIPAPSYSAMGGRIAE  32



>ref|WP_004984917.1| hypothetical protein, partial [Streptomyces ghanaensis]
 gb|EFE67887.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces 
ghanaensis ATCC 14672]
Length=179

 Score = 52.8 bits (125),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +2

Query  1310  CKSLTHYTKGTPS-----PHEEAPTVCMHTVSGSISLPSRGSFRLSLTVL  1444
               S  H +KGT S     P  +APT C HTVSG+ISLPSRG+F  SLTVL
Sbjct  69    ANSQAHSSKGTQSRERGKPRSDAPTACRHTVSGTISLPSRGTFHHSLTVL  118


 Score = 36.6 bits (83),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 1/34 (3%)
 Frame = +1

Query  1183  RVTAPSSWPWVDHLVSGLHPAT-VALFGLDFSTA  1281
             ++T+ S+ PW+DH  SGL  AT  ALFGL F+TA
Sbjct  25    KLTSASTCPWLDHSASGLERATETALFGLAFATA  58



>gb|EPS74533.1| hypothetical protein M569_00250, partial [Genlisea aurea]
Length=50

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  1383  RFQVLFHSPPGVLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT  1529
             RF VLFHSP GVLF  PSRY+F IG   VFSL  WS  I TGFHVS  T
Sbjct  2     RFHVLFHSPMGVLFTLPSRYYFAIGHPGVFSLARWSLLIHTGFHVSHAT  50



>gb|EEP52421.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP55268.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
Length=162

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 77/180 (43%), Gaps = 36/180 (20%)
 Frame = +1

Query  61   LIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLME*TNQATGAYLIPKLRYQFA  240
            L FQHRAGV+PYTS +  AE CVF+KQ   P+ C                 +P  R+ F+
Sbjct  4    LTFQHRAGVSPYTSAYALAETCVFVKQLLVPILCG----------------LPNGRHPFS  47

Query  241  EFL---LPSSLKRLRILISPTCVGLR---------YGLV*LKLRGFSWNH-FRLLRAARA  381
                  LPSSL     +I P+ +G            G   L  R FSW H  R   +   
Sbjct  48   RSYGVNLPSSLT----VILPSALGFSPHLPVSVCGTGTTSLS-RCFSWKHEIRYFGSVEP  102

Query  382  HVSTP*ITRPDLPKRLL*VKNQLFQQLDNLPRSVPPSHHT--TVQEY*PASHQLRISASP  555
              S P I R DLP                L  SV PS  T   V EY P  H+LR+SASP
Sbjct  103  SPSRPRIVRTDLPVLTPSTLRPASNSWHILSFSVTPSIITIIVVLEYQPIVHRLRLSASP  162



>gb|EGU94778.1| hypothetical protein HMPREF9349_05350, partial [Escherichia coli 
MS 79-10]
Length=51

 Score = 56.6 bits (135),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -2

Query  1433  GKGEKNPGRGVK*NLKPCAYKQSEPLR-GVTAYLLYNGSATYI  1308
             GK ++ P RGVK NLKPC YKQ E     VTAYLLYNGSATYI
Sbjct  8     GKAKRTPARGVKKNLKPCTYKQWEHRAICVTAYLLYNGSATYI  50


 Score = 32.3 bits (72),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1453  IVNQYREGKAKRTPG  1409
             IVNQYREGKAKRTP 
Sbjct  1     IVNQYREGKAKRTPA  15



>gb|EGG54197.1| hypothetical protein HMPREF9439_01524 [Parasutterella excrementihominis 
YIT 11859]
Length=45

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  1883  VHMVDALAITGDEGRSSLR*AAGSEQTHFDPQISEWGNP  1767
             +H+ DALAITG+E R SLR AAGS QT FDPQISEWGNP
Sbjct  1     MHVADALAITGEERRGSLRKAAGSWQTSFDPQISEWGNP  39



>emb|CDN41082.1| Putative uncharacterized protein [Paenibacillus sp. P22]
Length=51

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  741  SAASVTGLAPLHLPRRTTRSVSYYAFFK*WLLLSQHPDCFSLPTSFST  884
            + ASV  LAPLH  RR TR VSYYA FK WLLLSQHP C    TSF T
Sbjct  4    AIASVVCLAPLHFRRRVTRPVSYYALFKWWLLLSQHPGCLGNSTSFPT  51



>gb|EFE81975.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces 
albus J1074]
Length=172

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 66/137 (48%), Gaps = 11/137 (8%)
 Frame = +1

Query  1132  PQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPAT-VALFGLDFSTAPLSG*PRH*  1308
             PQ+IP  FN  GFGPP  +TA S+ PW+DH  SGL  AT +ALFGL F+TA   G     
Sbjct  1     PQVIPQVFNPGGFGPPRPLTAASTCPWLDHSASGLERATRIALFGLAFATASPHGLTS--  58

Query  1309  M*VADPLYKRYAVTPRRGSD---C-----LYAHGFRFYFTPLPGFFSPFPHGTGSLSVDY  1464
             +  A+        T  R ++   C     L    F+  F   P      P     LSV  
Sbjct  59    LHTANSQAHSSKGTQSRRTEQARCATLPRLVGTRFQVLFHSAPAVLFTIPSRYYPLSVTR  118

Query  1465  EYLALEDGPPIFRQDFT  1515
             EYL L  GP  F +DF+
Sbjct  119   EYLGLAGGPARFTRDFS  135



>gb|EEH89632.1| hypothetical protein ESAG_07157 [Escherichia sp. 3_2_53FAA]
Length=55

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +1

Query  607  FRREGFSPSLSLLMSAFALPIPPASFTRHLLRLTERSPTIC-ASTYPQLR  753
            FRR GFSP+LSLLMSAFAL IPPA+ T HL RLTERSPT     + PQLR
Sbjct  3    FRRAGFSPALSLLMSAFALLIPPATLTGHLHRLTERSPTQQHIVSLPQLR  52



>gb|EEX24763.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0513_01842, partial 
[Lactobacillus fermentum 28-3-CHN]
Length=101

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +3

Query  1083  FGENQlfpglfslsplpTAHPLIFQH*WVRTSRACYRTFILAMGRSPGFGS-TPSDCRPV  1259
             FGENQL P  F +SPLPT HP +FQ   VR S A YRTF L MGRSPGFG  T    RP 
Sbjct  3     FGENQLSPSSFGISPLPTPHPSLFQQTRVRASSAFYRTFTLDMGRSPGFGYITTYFIRPF  62

Query  1260  RTRFLYGSPIR-LTSPLNVSR*PIIQKVRRHP  1352
             +TRF  GS    LT  + ++R  I+Q+ RRHP
Sbjct  63    QTRFRCGSGFSTLTLHVIMTRRFILQEARRHP  94



>emb|CCF21089.1| hypothetical protein NT26_3367 [Rhizobium sp.]
 emb|CCF21614.1| hypothetical protein NT26_3892 [Rhizobium sp.]
Length=64

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  1416  VLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT  1529
             +LF FPSRY F IG  RV  LG WSPH+QTGFHVSRPT
Sbjct  1     MLFTFPSRYLFAIGHARVLRLGEWSPHVQTGFHVSRPT  38



>emb|CCG06598.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=150

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  596  KPWAFGERAFHPLYRYSCQHSHFRYLQHPLQDTFSGLRNALLP-YVQAHIRSFGDWLSP  769
             PWAFG    H  +RYSCQHSHFRYLQ   + TF+G+RNA LP ++   I SFG  L P
Sbjct  85   NPWAFGGSVSHTSFRYSCQHSHFRYLQQSSRTTFTGVRNAPLPLHLIDEIHSFGARLEP  143



>gb|EEP52383.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP52428.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP52468.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP52597.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP55524.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
 gb|EEP55744.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
Length=162

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 77/180 (43%), Gaps = 36/180 (20%)
 Frame = +1

Query  61   LIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLME*TNQATGAYLIPKLRYQFA  240
            L FQHRAGV+PYTS +  AE CVF+KQ   P+ C                 +P  R+ F+
Sbjct  4    LTFQHRAGVSPYTSAYALAETCVFVKQLLVPILCG----------------LPIGRHPFS  47

Query  241  EFL---LPSSLKRLRILISPTCVGLR---------YGLV*LKLRGFSWNH-FRLLRAARA  381
                  LPSSL     +I P+ +G            G   L  R FSW H  R   +   
Sbjct  48   RSYGVNLPSSLT----VILPSALGFSPHLPVSVCGTGTTSLS-RCFSWKHEIRYFGSVEP  102

Query  382  HVSTP*ITRPDLPKRLL*VKNQLFQQLDNLPRSVPPSHHT--TVQEY*PASHQLRISASP  555
              S P I R DLP                L  SV PS  T   V EY P  H+LR+SASP
Sbjct  103  SPSRPRIVRTDLPVLTPSTLRPASNSWHILSFSVTPSIITIIVVLEYQPIVHRLRLSASP  162



>ref|WP_014413254.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415583.1| hypothetical protein RSPPHO_03274, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06613.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=150

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  596  KPWAFGERAFHPLYRYSCQHSHFRYLQHPLQDTFSGLRNALLP-YVQAHIRSFGDWLSP  769
             PWAFG    H  +RYSCQHSHFRYLQ   + TF+G+RNA LP ++   I SFG  L P
Sbjct  85   NPWAFGGSVSHTSFRYSCQHSHFRYLQQSSRTTFTGVRNAPLPLHLIDEIHSFGARLEP  143



>gb|AAU06491.1| putative salivary protein [Culicoides sonorensis]
Length=46

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  1873  WMPWRLQAMKDVVACDKLRGVSKHTLIRRFPNGETRP  1763
             WMPW+ +AMKDVVACDKLRGV K TLIRR  NG T+P
Sbjct  9     WMPWQSEAMKDVVACDKLRGVGKQTLIRRSLNGGTQP  45



>ref|WP_003714186.1| unnamed protein product [Neisseria lactamica]
 emb|CBX22842.1| unnamed protein product [Neisseria lactamica Y92-1009]
Length=78

 Score = 44.7 bits (104),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  1515  VSRPTCRTLSTTGLISCTGLSPAMAPVSKGFHYQSDYHVQG  1637
             +SRPT RTL TT  IS TGLSPAM  +   F Y   YHVQ 
Sbjct  1     MSRPTFRTLGTTIEISNTGLSPAMVKLPSLFFYLDSYHVQA  41


 Score = 43.1 bits (100),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1633  KAHPISLATTLGISVDFFSCSYLDVSVRRVRF  1728
             +A P SLA T GISVDFFS  YLD SV RVRF
Sbjct  40    QAPPRSLAATCGISVDFFSSGYLDGSVLRVRF  71



>gb|EEP55040.1| conserved hypothetical protein [Clostridium butyricum E4 str. 
BoNT E BL5262]
Length=162

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 77/180 (43%), Gaps = 36/180 (20%)
 Frame = +1

Query  61   LIFQHRAGVTPYTSTFVFAECCVFIKQSQPPVYCNPFTLME*TNQATGAYLIPKLRYQFA  240
            L FQHRAGV+PYTS +  AE CVF+KQ   P+ C                 +P  R+ F+
Sbjct  4    LTFQHRAGVSPYTSAYALAETCVFVKQLLVPILCG----------------LPFGRHPFS  47

Query  241  EFL---LPSSLKRLRILISPTCVGLR---------YGLV*LKLRGFSWNH-FRLLRAARA  381
                  LPSSL     +I P+ +G            G   L  R FSW H  R   +   
Sbjct  48   RSYGVNLPSSLT----VILPSALGFSPHLPVSVCGTGTTSLS-RCFSWKHEIRYFGSVEP  102

Query  382  HVSTP*ITRPDLPKRLL*VKNQLFQQLDNLPRSVPPSHHT--TVQEY*PASHQLRISASP  555
              S P I R DLP                L  SV PS  T   V EY P  H+LR+SASP
Sbjct  103  SPSRPRIVRTDLPVLTPSTLRPASNSWHILSFSVTPSIITIIVVLEYQPIVHRLRLSASP  162



>ref|WP_022614577.1| hypothetical protein [Vibrio nigripulchritudo]
 emb|CCN38115.1| conserved hypothetical protein [Vibrio nigripulchritudo AM115]
Length=85

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = -2

Query  1691  QEKKSTEIPKVVASEMG*ALYVIVGLIVESFGNRSHSG**PRTRNQTGGTKRTTSRAGHV  1512
             +E+KSTEIPKV ASE+G AL + +   V+     +  G  P T +   G K  +S+AGHV
Sbjct  14    KEEKSTEIPKVAASEIGLALKLFMRQ-VKLLERSAIQGDSPVTDS---GFKVKSSKAGHV  69

Query  1511  KSCLNMGGPSSKAKY  1467
              SCLNMGGPSSKAKY
Sbjct  70    ISCLNMGGPSSKAKY  84



>gb|EDR96157.1| hypothetical protein ANACAC_03315, partial [Anaerostipes caccae 
DSM 14662]
Length=133

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 64/128 (50%), Gaps = 12/128 (9%)
 Frame = +1

Query  1372  LYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvpp  1551
             L   G +  F   PG    FP    +LSV  EYLAL  GP  F Q F+C  +++  L+  
Sbjct  2     LENKGNQNIFQSPPGVLFTFPSQYYALSVTKEYLALRGGPRSFPQGFSC-LVVLWILLGY  60

Query  1552  v*frvrGYHPLWLLFPKDSTISPTITYKAHP-----------ISLATTLGISVDFFSCSY  1698
                R+RG+HPLW  FP  S +    T ++ P           ISLA TL I V F S  Y
Sbjct  61    FRLRIRGFHPLWPAFPGRSPVLHNPTLQSEPQDARILVWALSISLAATLEIEVSFSSSGY  120

Query  1699  LDVSVRRV  1722
             LDVSV RV
Sbjct  121   LDVSVPRV  128



>ref|WP_003904596.1| hypothetical protein [Mycobacterium tuberculosis]
 gb|EFD61409.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gb|EFD76992.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
Length=69

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPATV  1251
             +AFHPYPQLIP  FN+SGFGPP  +T  S WPWVDH  SG   AT+
Sbjct  1     MAFHPYPQLIPSVFNLSGFGPPRGLTRASPWPWVDHSASGPEHATI  46



>gb|ADI17622.1| hypothetical protein [uncultured delta proteobacterium HF0130_19C20]
Length=175

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 67/151 (44%), Gaps = 15/151 (10%)
 Frame = +3

Query  1416  VLFAFPSRYWFTIGRLRVFSLGGWSPHIQTGFHVSRPT---CRTLSTTGLISCTGLSPAM  1586
             +LF FPSRYW+TIG   +FSLGGWSP IQTGF VSR T    RT S   L     L    
Sbjct  1     MLFTFPSRYWYTIGLQVIFSLGGWSPQIQTGFLVSRSTQVPPRTSSDFRLRGSNPLRRTF  60

Query  1587  APVSKGF---HYQSDYHVQGSSHFARHYfgnlg*flflqllRCFSSPRSLRYP-----MY  1742
                S       Y   Y+  G + +   +          +L+   S     ++P      Y
Sbjct  61    PGTSTNLLIIFYWRPYNPTGRTRWFGLFPLRSPLLRESRLIYFPSGTEMFQFPEFALLTY  120

Query  1743  SDNDDLKG----RVSPFGNLRIKVCLLTPRS  1823
               N         RV+P GN RIK CLL P +
Sbjct  121   VFNQQCMASTAIRVTPLGNPRIKRCLLFPEA  151



>ref|WP_006427240.1| hypothetical protein [Dorea longicatena]
 gb|EDM61645.1| hypothetical protein DORLON_02997 [Dorea longicatena DSM 13814]
Length=201

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 79/174 (45%), Gaps = 21/174 (12%)
 Frame = +1

Query  1411  PGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTCpallvvrlvppv*frvrGYHPLWL  1590
             PG     P    +LSV  EYLAL  GP IF Q  TC  LL +     +     G  P   
Sbjct  6     PGVLFTVPSQYYALSVTKEYLALRGGPRIFSQGSTCLDLLWIPPCQLIFSLT-GLSPSLA  64

Query  1591  LFPKDSTISPTITY-KAHPISLATTLGI-----------SVDFFSCSYLDVSVRRVRFVT  1734
              FPK   ++        +P   A   G+            V F S  YLDVSV RV  +T
Sbjct  65    GFPKTDLLNLLNQLCGPNPGMHAPRFGLFRFRSPVLTESHVVFSSSGYLDVSVHRVPLLT  124

Query  1735  LCI--QITMT*KAGFPHSEICGSKCVCSLP---AAY---RKLLRPSSPVIAKAS  1872
             LCI  +I     +GFPHSEI GSK +CS P   AAY    +LL P  P  A +S
Sbjct  125   LCIGVRILEVCSSGFPHSEISGSKDICSSPKLFAAYHVFHRLLVPRHPPYALSS  178



>gb|EFQ80765.1| hypothetical protein HMPREF0305_11076 [Corynebacterium pseudogenitalium 
ATCC 33035]
 gb|EFQ80864.1| hypothetical protein HMPREF0305_11005 [Corynebacterium pseudogenitalium 
ATCC 33035]
Length=74

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  1070  YLNSFRREPAISRFV*PFTPTHSSSPNFSTLVGSDLQGVLPHLHPGHG  1213
             +LN+FR EPAI+ F  PFTPTHSSSP FST VGS L  +L  LH GHG
Sbjct  27    HLNAFRGEPAITEFDWPFTPTHSSSPQFSTYVGSRLHNLLQLLHTGHG  74



>ref|WP_001894030.1| hypothetical protein [Vibrio cholerae]
 gb|EAY32278.1| hypothetical protein A55_B0061 [Vibrio cholerae 1587]
Length=41

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  1188  NTPWRSEPTNVEKLGDELWVGVKG*TNLEIAGSLRKLFR  1072
             N  WR+EPTNVEKL D+LW+GVKG +N EIAGS RKLFR
Sbjct  3     NINWRTEPTNVEKLADDLWLGVKGQSNSEIAGSPRKLFR  41



>gb|EKU16681.1| hypothetical protein D593_1495 [Streptococcus intermedius BA1]
 gb|EKU16682.1| hypothetical protein D593_1496 [Streptococcus intermedius BA1]
Length=121

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  1060  LEALPK*FSERTSYFQVCLAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLH  1239
             ++A PK  SERTSY QV L F  YPQ+I   FN+   GPP   T+PS+  WV H+VSGL 
Sbjct  16    VDASPKAISERTSYLQVRLEFLRYPQVIQALFNVPWCGPPVSFTSPSTCSWVGHMVSGLQ  75

Query  1240  PAT  1248
               T
Sbjct  76    HDT  78



>ref|XP_008481199.1| PREDICTED: inositol monophosphatase 2-like, partial [Diaphorina 
citri]
Length=151

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  725  MVGERSVSLRRCLVKDAGGIGSANADMSSDKEGEKPSRR  609
            MVGERSV+LRR  VK+ G I SANADMS+D EGEKPSRR
Sbjct  1    MVGERSVNLRRYFVKNTGDIRSANADMSNDNEGEKPSRR  39



>ref|WP_014250246.1| hypothetical protein [Azospirillum lipoferum]
 ref|YP_005041494.1| hypothetical protein AZOLI_p50442 [Azospirillum lipoferum 4B]
 emb|CBS90410.1| conserved protein of unknown function [Azospirillum lipoferum 
4B]
 emb|CBS91425.1| conserved protein of unknown function [Azospirillum lipoferum 
4B]
Length=46

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  1433  GKGEKNPGRGVK*NLKPCAYKQSEPLRGVTAYLLYNGSAT  1314
             GK +  P RGVK  LKP AYKQSEPL GVTAYLLYNGSAT
Sbjct  7     GKVKSTPTRGVKQFLKPDAYKQSEPLHGVTAYLLYNGSAT  46



>ref|WP_009232000.1| hypothetical protein, partial [Prevotella sp. oral taxon 317]
 gb|EFC67102.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0670_02906, partial 
[Prevotella sp. oral taxon 317 str. F0108]
Length=156

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 70/135 (52%), Gaps = 16/135 (12%)
 Frame = +1

Query  1327  LYKRYAVTPRRGSDCLYAHGFRFYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQ  1506
             L KR+AVT +                 L   FSPFPHGTGSLSV +EYLAL DGP  F Q
Sbjct  5     LCKRHAVTAKAAPTACRRMVSGTISLFLSKCFSPFPHGTGSLSVSWEYLALPDGPGRFAQ  64

Query  1507  DFTCpallvvrlvppv*frvrGYHPLWLLFPKD---------STISP-----TITYKAHP  1644
             DF+C   L+   + P+  R+RG HPL  LFP +         + + P     T    A P
Sbjct  65    DFSC-PALLRIPLCPIVLRIRGSHPLRPLFPGEFSSHARYNGAVLQPRRCVATTPVWALP  123

Query  1645  ISLATTLGISVDFFS  1689
              SLATT GI ++ FS
Sbjct  124   RSLATTGGI-INLFS  137



>ref|WP_004850312.1| hypothetical protein [Coprococcus eutactus]
 gb|EDP25404.1| hypothetical protein COPEUT_02401 [Coprococcus eutactus ATCC 
27759]
 gb|EDP25627.1| hypothetical protein COPEUT_02273 [Coprococcus eutactus ATCC 
27759]
Length=107

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +1

Query  1636  AHPISLATTLGISVDFFSCSYLDVSVRRVRFVTLCIQ--ITMT*KAGFPHSEICGSKCVC  1809
             A P+SLA T  I V F S  YLDVSV+ V  + LCIQ   T    A FPHSEICGS  +C
Sbjct  15    ALPLSLAATNRIDVSFSSSPYLDVSVQEVPDLYLCIQYRTTEVYSARFPHSEICGSLNIC  74

Query  1810  SLP---AAYRKLLRPSSP  1854
              LP   AAY   LR S P
Sbjct  75    FLPQLIAAYHVFLRLSVP  92



>ref|WP_004846370.1| hypothetical protein [[Ruminococcus] torques]
 gb|EDK22975.1| hypothetical protein RUMTOR_02863 [Ruminococcus torques ATCC 
27756]
Length=82

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  1114  LAFHPYPQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPATVALFGLDFSTAP  1284
             + F PYP LIP  FN  GFGPP   TA S+W W+DH VSGL   T ALF L F +AP
Sbjct  1     MEFLPYPHLIPTLFNGCGFGPPLPFTATSTWTWIDHPVSGLLRLTFALFRLGFPSAP  57



>gb|EDZ64152.1| hypothetical protein KB13_284 [beta proteobacterium KB13]
Length=47

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  1877  MVDALAITGDEGRSSLR*AAGSEQTHFDPQISEWGNPAF  1761
             M DALAITGDEGR SLR  +GS Q +FDP +SEWGNP F
Sbjct  1     MADALAITGDEGRDSLRKFSGSWQINFDPGVSEWGNPPF  39



>gb|EDN75573.1| hypothetical protein MHA_2707 [Mannheimia haemolytica PHL213]
Length=41

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  171  ERVAINWWLRLFNKNTALCKHESGRIGCDACPVLE  67
            E V    WL+LF KNTALCKHESGRIGCDACPVLE
Sbjct  6    EPVEDTSWLQLFIKNTALCKHESGRIGCDACPVLE  40



>gb|EDN76703.1| hypothetical protein RUMGNA_02963 [Ruminococcus gnavus ATCC 29149]
Length=116

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 59/117 (50%), Gaps = 2/117 (2%)
 Frame = +1

Query  205  AYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYGLV*LKLRGFSWNHFRLLRAARAH  384
            A L+PKLR  FAEFL  +S   LRIL S TCVGLRYG + +   GFSW    +L A R  
Sbjct  2    ALLLPKLRSHFAEFLNNASPVGLRILSSSTCVGLRYGYI-INNSGFSWQPAHILPALRPT  60

Query  385  VSTP*ITRPDLPKRLL*VKNQLFQQLDNLPRSVPPSHHTTVQEY*PASHQLRISASP  555
                 + R  L    L         L +L  S P   +  VQE  P  H+LR+S SP
Sbjct  61   SRLQIVHRICLMHSYLACTGLSIPGLCSLSAS-PQFCYDIVQESLPVIHRLRLSTSP  116



>gb|EMR91350.1| IS1 transposase InsAB, partial [Escherichia coli ONT:H33 str. 
C48/93]
Length=80

 Score = 50.8 bits (120),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  204  GVPYPEVTVPICRVPSPEFSQAP*NTHLAHLCRFAVRSRMT  326
             VP PEVT P C VPSPEFSQAP  +   HLCRF VR  +T
Sbjct  40   SVPSPEVTAPFCLVPSPEFSQAPWYSLPDHLCRFGVRFDVT  80


 Score = 34.3 bits (77),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +2

Query  89   HPIRPLSCLQSAVFLLNSRSHQFIATLSPSWSKPIKL  199
            H IRPLSCL SAVFL+NS S    +T   S SK + L
Sbjct  1    HRIRPLSCLHSAVFLINSCSQLVSSTDFSSTSKSLHL  37



>gb|EDN76536.1| hypothetical protein RUMGNA_03216 [Ruminococcus gnavus ATCC 29149]
Length=116

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 59/117 (50%), Gaps = 2/117 (2%)
 Frame = +1

Query  205  AYLIPKLRYQFAEFLLPSSLKRLRILISPTCVGLRYGLV*LKLRGFSWNHFRLLRAARAH  384
            A L+PKLR  FAEFL  +S   LRIL S TCVGLRYG + +   GFSW    +L A R  
Sbjct  2    ALLLPKLRSHFAEFLNNASPVGLRILSSSTCVGLRYGYI-INNSGFSWQPAHILPALRPT  60

Query  385  VSTP*ITRPDLPKRLL*VKNQLFQQLDNLPRSVPPSHHTTVQEY*PASHQLRISASP  555
                 + R  L    L         L +L  S P   +  VQE  P  H+LR+S SP
Sbjct  61   SRLQIVHRICLMHSYLACTGFSIPGLCSLSAS-PQFCYDIVQESLPVIHRLRLSTSP  116



>ref|WP_014413259.1| hypothetical protein [Rhodospirillum photometricum]
 ref|YP_005415588.1| hypothetical protein RSPPHO_03279 [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06618.1| unnamed protein product [Rhodospirillum photometricum DSM 122]
Length=104

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  596  KPWAFGERAFHPLYRYSCQHSHFRYLQHPLQDTFSGLRNALLP  724
             PWAFG    H  +RYSCQHSHFRYLQ   + TF+G+RNA LP
Sbjct  50   NPWAFGGSVSHTSFRYSCQHSHFRYLQQSSRTTFTGVRNAPLP  92



>ref|WP_038142016.1| hypothetical protein [Vibrio nigripulchritudo]
Length=85

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = -2

Query  1703  SK*LQEKKSTEIPKVVASEMG*ALYVIVGLIVESFGNRSHSG**PRTRNQTGGTKRTTSR  1524
             SK  +E+KSTEIPKV ASE+G AL + +   V+     +  G  P T +     +  +S+
Sbjct  10    SKYPKEEKSTEIPKVAASEIGLALKLFMRQ-VKLLERSAIQGDSPVTDS---AFQVKSSK  65

Query  1523  AGHVKSCLNMGGPSSKAKY  1467
             AGHV SCLNMGGPSSKAKY
Sbjct  66    AGHVISCLNMGGPSSKAKY  84



>gb|AGC71894.1| hypothetical protein [uncultured bacterium A1Q1_fos_4]
Length=43

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  1877  MVDALAITGDEGRSSLR*AAGSEQTHFDPQISEWGNP  1767
             MVDALA+ GDEGR SLR A+GS Q  FDP++SEWGNP
Sbjct  1     MVDALAMIGDEGRDSLRKASGSWQISFDPEVSEWGNP  37



>ref|WP_004916279.1| hypothetical protein [Providencia stuartii]
 gb|EDU61870.1| hypothetical protein PROSTU_00110 [Providencia stuartii ATCC 
25827]
Length=44

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  191  LVYSMRVKGLQ*TGGCDCLIKTQHSANTKVDV*GVTPARCWKIK  60
            +VY       Q   GC+CL+KTQH ANTKVDV GVTPARCWK+ 
Sbjct  1    MVYPWSRSQSQIPAGCNCLLKTQHCANTKVDVYGVTPARCWKVN  44



>gb|ELS47048.1| hypothetical protein C789_3193 [Microcystis aeruginosa DIANCHI905]
Length=209

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  1393  FYFTPLPGFFSPFPHGTGSLSVDYEYLALEDGPPIFRQDFTC  1518
             FYFTPLPGFFSPFP GT SLSV  EYLAL  G   F +DFTC
Sbjct  2     FYFTPLPGFFSPFPRGTVSLSVTREYLALPRGRGRFTRDFTC  43



>gb|AHV65700.1| cobalamin biosynthesis protein CbiG [Salmonella enterica subsp. 
enterica serovar Enteritidis str. SA20094177]
Length=361

 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -1

Query  810  NSSLIESSCAEDVTGLSQSPKLRICACTY-GRRAFRKPEKVSCKGCWRYRKCEC  652
            +  L+ES+CAEDVTGL+ +PKLR   C   GR AF KP KV  + CWRY+KCEC
Sbjct  308  SGXLVESACAEDVTGLNHAPKLRQRHCVLLGRGAFCKPVKVCREACWRYQKCEC  361



>ref|WP_003908676.1| predicted protein, partial [Mycobacterium tuberculosis]
 gb|EFD12915.1| LOW QUALITY PROTEIN: predicted protein [Mycobacterium tuberculosis 
T46]
Length=133

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 44/68 (65%), Gaps = 5/68 (7%)
 Frame = +2

Query  1283  PYPVNLATECKSLTHYTKGTPSP-----HEEAPTVCMHTVSGSISLPSRGSFRLSLTVLV  1447
             P+ + L     S  H +KGTPSP      +EA T C HTVSG++SLPSRG+F  SLTVL+
Sbjct  66    PHGLTLRHVPDSQAHSSKGTPSPPSSGEEKEALTDCRHTVSGTLSLPSRGTFHHSLTVLI  125

Query  1448  HYRSITSI  1471
              YRS  SI
Sbjct  126   RYRSSRSI  133



>gb|EFE80054.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces 
albus J1074]
Length=172

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 64/137 (47%), Gaps = 11/137 (8%)
 Frame = +1

Query  1132  PQLIP*FFNISGFGPPGRVTAPSSWPWVDHLVSGLHPA-TVALFGLDFSTAPLSG*PRH*  1308
             PQ+IP  FN  GFGPP  +TA S+ PW+DH  SG     ++ALFGL F+TA   G     
Sbjct  1     PQVIPQVFNPGGFGPPRPLTAASTCPWLDHSASGSRACNSIALFGLAFATASPHGLTS--  58

Query  1309  M*VADPLYKRYAVTPRRGSD---C-----LYAHGFRFYFTPLPGFFSPFPHGTGSLSVDY  1464
             +  A+        T  R ++   C     L    F+  F   P      P     LSV  
Sbjct  59    LHTANSQAHSSKGTQSRRTEQARCATLPRLVGTRFQVLFHSAPAVLFTIPSRYYPLSVTR  118

Query  1465  EYLALEDGPPIFRQDFT  1515
             EYL L  GP  F +DF+
Sbjct  119   EYLGLAGGPARFTRDFS  135



>gb|EES70918.1| hypothetical protein POTG_04459 [Paenibacillus sp. oral taxon 
786 str. D14]
Length=44

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  753  VTGLAPLHLPRRTTRSVSYYAFFK*WLLLSQHPDCFSLPTSFST  884
            +  LAPLH  RR TR VSYYA FK WLLLSQHP C    TSF T
Sbjct  1    MVCLAPLHFRRRVTRPVSYYALFKWWLLLSQHPGCLCNSTSFPT  44



>gb|EFQ80764.1| hypothetical protein HMPREF0305_11075 [Corynebacterium pseudogenitalium 
ATCC 33035]
 gb|EFQ80863.1| hypothetical protein HMPREF0305_11004 [Corynebacterium pseudogenitalium 
ATCC 33035]
Length=75

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  1283  PYPVNLATECKSLTHYTKGTPSPHEEAPTVCMHTVSGSISLPSRGSFRLSLTVLVHYRS  1459
             P+ +       S  H +KGTPS    A T C H VSG+ISLPSRG+F  SLTVL+HYRS
Sbjct  16    PHGLTSRHAADSQAHSSKGTPSHTNGALTDCKHMVSGTISLPSRGTFHHSLTVLIHYRS  74



>ref|WP_038199824.1| hypothetical protein [Vibrio nigripulchritudo]
Length=85

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = -2

Query  1703  SK*LQEKKSTEIPKVVASEMG*ALYVIVGLIVESFGNRSHSG**PRTRNQTGGTKRTTSR  1524
             SK  +E+KSTEIPKV ASE+G AL + +   V+     +  G  P T +        +S+
Sbjct  10    SKYPKEEKSTEIPKVAASEIGLALKLFMRQ-VKLLERSAIQGDSPVTDS---AFTVKSSK  65

Query  1523  AGHVKSCLNMGGPSSKAKY  1467
             AGHV SCLNMGGPSSKAKY
Sbjct  66    AGHVISCLNMGGPSSKAKY  84



>ref|WP_003714551.1| unnamed protein product [Neisseria lactamica]
 emb|CBX23067.1| unnamed protein product [Neisseria lactamica Y92-1009]
Length=94

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  1032  MARGSLRLTKPLQTPNTGECELGRQTSGANVRRQEGNNPDRQLR  901
             MARG L+LT P QT NT +  LGRQT+G NVR QEGN PDR LR
Sbjct  1     MARGLLQLTNPWQTQNTIKWFLGRQTAGVNVRCQEGNYPDRWLR  44



>gb|ELK88170.1| putative serine acetyltransferase [Neisseria meningitidis M7124]
Length=78

 Score = 42.4 bits (98),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1633  KAHPISLATTLGISVDFFSCSYLDVSVRRVRF  1728
             +A P SLATT GISVDFFS  YLD SV RV F
Sbjct  40    QAPPRSLATTCGISVDFFSSGYLDGSVLRVSF  71


 Score = 40.8 bits (94),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  1515  VSRPTCRTLSTTGLISCTGLSPAMAPVSKGFHYQSDYHVQG  1637
             +SRPT RTLST   IS TGLSP M  +   F Y   Y+VQ 
Sbjct  1     MSRPTFRTLSTAVEISNTGLSPTMVKLPSLFFYLVSYYVQA  41



>gb|EAS50136.1| hypothetical protein SI859A1_01496 [Aurantimonas manganoxydans 
SI85-9A1]
Length=100

 Score = 51.2 bits (121),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = +2

Query  1286  YPVNLATECKSLTHYTKGTPSPHEEAPTVCMHTVSGSISL--PSRGSFRLSLTVLVHYRS  1459
             Y + LA + KSLTHYTKGT SP           +   +    P RG+F LSLTVLV YRS
Sbjct  37    YRLKLARQTKSLTHYTKGTMSPRTNLELHLFVGIRFQVLFHSPCRGAFHLSLTVLVRYRS  96

Query  1460  ITS  1468
              TS
Sbjct  97    CTS  99


 Score = 30.8 bits (68),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  1183  RVTAPSSWPWVDHLVSGL  1236
             RVTAPS+  W+DH VSGL
Sbjct  2     RVTAPSTCSWLDHSVSGL  19



>gb|ADI17934.1| hypothetical protein [uncultured Desulfobacterales bacterium 
HF0200_07G10]
Length=74

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  1058  YLRHYLNSFRREPAISRFV*PFTPTHSSSPNFSTLVGSDLQGVLPHLHPGHG  1213
             Y R  L  FR EPAI+ F  PFTP H+SS  FST  GS L  VLP LHPGHG
Sbjct  23    YARLVLKLFRGEPAIAGFDWPFTPIHNSSKLFSTSTGSGLHEVLPSLHPGHG  74



>gb|ADI22944.1| hypothetical protein [uncultured actinobacterium HF0500_35G12]
Length=195

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 63/118 (53%), Gaps = 2/118 (2%)
 Frame = +2

Query  536  YASLPrlrgrltllr*tlnrKPWAFGERAFHP-LYRYSCQHSHFRYLQHPLQDTFSGLRN  712
            YAS PRL  RLTL   +L R PW  G    HP L  Y+   +  R        +    R+
Sbjct  73   YASRPRLSSRLTLGGLSLPRNPWTSGGGVSHPSLATYTYILTRARSTTVSTGASLRTRRS  132

Query  713  ALLPYVQAHIRSFGDWLSPVTSSAQDDSISELLRFL*MMAASKPTS*LF*PSHFVFHL  886
            A  P  Q    S  D LSPVT SA+D   SELLR L M+AASKPTS L   SHFVFHL
Sbjct  133  ATTPAKQESATSASD-LSPVTFSARDHLTSELLRTLSMVAASKPTSWLSGQSHFVFHL  189



>ref|WP_035254331.1| hypothetical protein [Acinetobacter ursingii]
Length=73

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  1885  KCTWWMPWRLQAMKDVVACDKLRGVSKHTLIRRFPNGETR  1766
             KC WWMPW+ +A KDV+AC+KLRG  K+ LIRR  NG T 
Sbjct  32    KCMWWMPWQSEAKKDVIACEKLRGGGKYPLIRRCLNGGTH  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5683099297884