BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25208_g1_i8 len=2303 path=[4479:0-901 5381:902-1006 5486:1007-1084
5568:1085-1133 1926:1134-1210 16875:1211-1287 11046:1288-1343
17007:1344-1413 10069:1414-1525 10181:1526-1611 17161:1612-1731
30505:1732-1734 17284:1735-2302]

Length=2303
                                                                      Score     E

ref|XP_004230411.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    364   0.0      
ref|XP_006349274.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    357   0.0      
ref|XP_009613098.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    359   0.0      
ref|XP_009762784.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    350   0.0      
ref|XP_011087617.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    323   0.0      
ref|XP_010682114.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    301   0.0      
ref|XP_010657908.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    278   0.0      
gb|KDP40893.1|  hypothetical protein JCGZ_24892                         282   1e-179   
ref|XP_002527823.1|  ATP-dependent clp protease ATP-binding subun...    279   4e-178   Ricinus communis
gb|EYU35038.1|  hypothetical protein MIMGU_mgv1a019263mg                303   4e-178   
ref|XP_006836922.1|  hypothetical protein AMTR_s00099p00142540          252   3e-174   
ref|XP_007023128.1|  ATP-dependent Clp protease isoform 3               252   1e-170   
ref|XP_010665487.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    247   5e-170   
ref|XP_006431435.1|  hypothetical protein CICLE_v10003616mg             247   8e-170   
ref|XP_006470836.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    246   1e-168   
ref|XP_006356538.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    241   6e-167   
ref|XP_004241855.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    232   2e-164   
ref|XP_008388035.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    223   3e-164   
gb|KGN52598.1|  hypothetical protein Csa_5G646720                       233   8e-164   
ref|XP_009366893.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    221   4e-163   
emb|CAN64542.1|  hypothetical protein VITISV_013764                     231   4e-162   Vitis vinifera
emb|CDY20236.1|  BnaC09g30030D                                          265   1e-161   
ref|XP_010521411.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    255   7e-161   
ref|XP_010521410.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    255   1e-160   
gb|KFK45073.1|  hypothetical protein AALP_AA1G339900                    227   1e-160   
ref|XP_010529709.1|  PREDICTED: mitochondrial clpX-like chaperone...    230   2e-160   
emb|CBI16961.3|  unnamed protein product                                218   3e-160   
ref|NP_568714.4|  ATP-dependent Clp protease                            261   3e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279597.1|  hypothetical protein CARUB_v10026110mg             264   8e-160   
ref|XP_007019731.1|  ATP-dependent clp protease ATP-binding subun...    219   2e-158   
gb|EYU22682.1|  hypothetical protein MIMGU_mgv1a002117mg                217   4e-158   
ref|XP_002893761.1|  hypothetical protein ARALYDRAFT_473508             217   2e-157   
ref|NP_564423.3|  ATP-dependent Clp protease                            219   2e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303712.1|  hypothetical protein CARUB_v10011824mg             218   6e-157   
ref|XP_010461163.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    213   4e-156   
ref|XP_006415098.1|  hypothetical protein EUTSA_v10007003mg             217   6e-156   
gb|AAG51286.1|AC027035_9  CLP protease regulatory subunit CLPX, p...    214   6e-156   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93769.1|  BnaA09g23690D                                          213   8e-156   
ref|XP_010499875.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    212   1e-155   
ref|XP_009114799.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    211   4e-155   
ref|XP_004512653.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    231   7e-155   
ref|XP_007019730.1|  ATP-dependent clp protease ATP-binding subun...    219   3e-154   
ref|XP_010252309.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    239   4e-154   
ref|XP_011095003.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    214   1e-153   
gb|AAG51217.1|AC051630_14  CLP protease regulatory subunit CLPX, ...    209   3e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788320.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    233   5e-150   
ref|XP_010908120.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    228   9e-149   
ref|XP_006376103.1|  hypothetical protein POPTR_0013s09570g             216   2e-148   
ref|XP_009616314.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    223   2e-148   
ref|XP_009781367.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    222   4e-148   
ref|XP_006587384.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    221   1e-147   
ref|XP_010930370.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    216   2e-147   
ref|XP_011009777.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    212   2e-147   
gb|KHN24432.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     219   9e-147   
emb|CBI29632.3|  unnamed protein product                                216   1e-146   
ref|XP_010063745.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    215   2e-146   
ref|XP_008459496.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    211   3e-146   
ref|XP_006441855.1|  hypothetical protein CICLE_v10019167mg             220   5e-146   
ref|XP_008788322.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    220   6e-146   
gb|EEE57209.1|  hypothetical protein OsJ_07170                          214   7e-146   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006599644.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    218   8e-146   
ref|XP_008808963.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    214   1e-145   
gb|KDP37794.1|  hypothetical protein JCGZ_06696                         215   1e-145   
ref|XP_009379893.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    223   2e-145   
ref|XP_006587386.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    214   2e-145   
ref|XP_008232534.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    208   3e-145   
ref|XP_008781975.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    214   3e-145   
ref|XP_010915955.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    208   4e-145   
ref|XP_004141515.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    208   4e-145   
dbj|BAH01586.1|  unnamed protein product                                214   5e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006478287.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    220   8e-145   
emb|CDX86004.1|  BnaC06g21300D                                          209   1e-144   
gb|KDO42064.1|  hypothetical protein CISIN_1g038067mg                   221   1e-144   
ref|XP_004952735.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    216   3e-144   
ref|XP_007143921.1|  hypothetical protein PHAVU_007G113600g             216   3e-144   
gb|KDP25897.1|  hypothetical protein JCGZ_23723                         203   5e-144   
ref|XP_002452300.1|  hypothetical protein SORBIDRAFT_04g023280          216   8e-144   Sorghum bicolor [broomcorn]
dbj|BAD15818.1|  putative ATP-dependent Clp protease ATP-binding ...    214   9e-144   Oryza sativa Japonica Group [Japonica rice]
gb|KHN05027.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     213   9e-144   
ref|XP_003556404.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    213   1e-143   
ref|XP_008218637.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    213   1e-143   
ref|XP_002519956.1|  ATP-dependent clp protease ATP-binding subun...    210   3e-143   Ricinus communis
ref|XP_006441089.1|  hypothetical protein CICLE_v10019480mg             203   5e-143   
ref|XP_006441090.1|  hypothetical protein CICLE_v10019480mg             203   5e-143   
ref|XP_010267611.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    212   5e-143   
gb|KDO54244.1|  hypothetical protein CISIN_1g005637mg                   203   5e-143   
gb|KDO54245.1|  hypothetical protein CISIN_1g005637mg                   202   8e-143   
ref|XP_009420156.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    214   8e-143   
gb|KDO54243.1|  hypothetical protein CISIN_1g005637mg                   202   8e-143   
ref|XP_010461164.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    212   9e-143   
ref|XP_009404286.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    211   1e-142   
ref|XP_008681399.1|  PREDICTED: uncharacterized protein LOC100272...    208   1e-142   
ref|XP_004307989.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    202   1e-142   
ref|XP_002272792.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    205   2e-142   Vitis vinifera
ref|XP_009349952.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    207   2e-142   
ref|XP_008681398.1|  PREDICTED: uncharacterized protein LOC100272...    208   2e-142   
ref|XP_009352024.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    207   2e-142   
ref|XP_009119879.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    198   3e-142   
gb|AFW71882.1|  hypothetical protein ZEAMMB73_870207                    207   3e-142   
ref|XP_008234752.1|  PREDICTED: mitochondrial clpX-like chaperone...    204   3e-142   
ref|XP_008376716.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    205   3e-142   
ref|XP_010499878.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    210   3e-142   
gb|KDO54242.1|  hypothetical protein CISIN_1g005637mg                   202   3e-142   
ref|XP_002516670.1|  ATP-dependent clp protease ATP-binding subun...    199   4e-142   Ricinus communis
ref|XP_008380812.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    206   4e-142   
ref|XP_007023127.1|  ATP-dependent Clp protease isoform 2               216   5e-142   
gb|AFW71881.1|  hypothetical protein ZEAMMB73_870207                    207   6e-142   
ref|XP_009357301.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    207   7e-142   
emb|CBI23009.3|  unnamed protein product                                205   9e-142   
ref|XP_003575174.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    205   1e-141   
ref|XP_007218873.1|  hypothetical protein PRUPE_ppa003261mg             204   1e-141   
ref|XP_009352023.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    204   1e-141   
ref|NP_568792.1|  CLP protease regulatory subunit X                     196   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136523.1|  hypothetical protein PHAVU_009G052400g             200   2e-141   
ref|XP_004146223.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    210   2e-141   
ref|XP_008380808.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    204   2e-141   
ref|XP_009368656.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    205   2e-141   
ref|XP_002864237.1|  hypothetical protein ARALYDRAFT_918413             196   3e-141   
ref|XP_008466827.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    210   6e-141   
ref|XP_006645143.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    220   6e-141   
gb|KFK26956.1|  hypothetical protein AALP_AA8G315200                    198   8e-141   
ref|XP_010478756.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    209   1e-140   
ref|XP_006280226.1|  hypothetical protein CARUB_v10026143mg             194   1e-140   
ref|XP_006401716.1|  hypothetical protein EUTSA_v10013106mg             197   1e-140   
gb|AAB88706.1|  CLP protease regulatory subunit CLPX                    197   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132481.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    195   3e-140   
ref|XP_010442896.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    194   3e-140   
ref|XP_010445728.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    193   4e-140   
ref|XP_010035267.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    201   4e-140   
ref|XP_010482726.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    193   4e-140   
ref|XP_008466826.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    207   5e-140   
ref|XP_011075988.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    192   5e-140   
gb|EYU25233.1|  hypothetical protein MIMGU_mgv1a003646mg                194   9e-140   
ref|XP_004300022.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    204   1e-139   
ref|XP_003564797.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    216   1e-139   
emb|CDY54345.1|  BnaC03g14910D                                          193   1e-139   
ref|XP_009588204.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    192   1e-139   
ref|XP_010555729.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    197   2e-139   
ref|XP_006350541.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    190   2e-139   
ref|XP_007152420.1|  hypothetical protein PHAVU_004G128700g             213   2e-139   
ref|XP_006647186.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    196   4e-139   
gb|KCW46559.1|  hypothetical protein EUGRSUZ_K00383                     198   4e-139   
dbj|BAJ98835.1|  predicted protein                                      205   5e-139   
ref|XP_009355384.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    199   5e-139   
ref|XP_004234968.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    191   5e-139   
dbj|BAJ93977.1|  predicted protein                                      212   2e-138   
ref|NP_001045031.1|  Os01g0886600                                       213   2e-138   Oryza sativa Japonica Group [Japonica rice]
gb|AFW84351.1|  hypothetical protein ZEAMMB73_159465                    210   4e-138   
ref|XP_002458882.1|  hypothetical protein SORBIDRAFT_03g042120          209   4e-138   Sorghum bicolor [broomcorn]
ref|XP_007023126.1|  ATP-dependent Clp protease ATP-binding subun...    202   6e-138   
ref|XP_004164772.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    210   8e-138   
ref|XP_010065233.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    206   1e-137   
ref|XP_011024834.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    191   2e-137   
ref|XP_009421144.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    197   2e-137   
gb|KCW62577.1|  hypothetical protein EUGRSUZ_G00073                     206   4e-137   
ref|XP_010677227.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    210   6e-137   
ref|XP_010677229.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    210   1e-136   
gb|AES75813.2|  ATP-dependent Clp protease regulatory subunit ClpX      201   1e-136   
ref|XP_003523365.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    192   1e-136   
ref|XP_011024833.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    191   2e-136   
ref|XP_002321405.2|  hypothetical protein POPTR_0015s01520g             190   2e-136   Populus trichocarpa [western balsam poplar]
ref|XP_003526717.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    194   2e-136   
ref|XP_011028415.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    201   3e-136   
ref|XP_011028416.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    201   3e-136   
gb|KHN19496.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     190   3e-136   
ref|XP_010520973.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    187   4e-136   
gb|EEC71918.1|  hypothetical protein OsI_04712                          213   5e-136   Oryza sativa Indica Group [Indian rice]
ref|XP_011044639.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    188   7e-136   
ref|XP_006385093.1|  hypothetical protein POPTR_0004s23830g             202   1e-135   
ref|XP_011044638.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    188   1e-135   
ref|XP_010671440.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    189   2e-135   
ref|XP_004970835.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    206   2e-135   
ref|XP_010908125.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    187   2e-135   
ref|XP_007039051.1|  CLP protease regulatory subunit X isoform 1        187   4e-135   
ref|XP_004970834.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    206   4e-135   
ref|XP_009421145.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    192   7e-135   
ref|XP_003619595.1|  ATP-dependent Clp protease ATP-binding subun...    193   5e-134   
ref|XP_010234150.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    193   7e-134   
ref|XP_001774045.1|  predicted protein                                  187   2e-133   
ref|XP_004502651.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    194   6e-133   
gb|EYU19646.1|  hypothetical protein MIMGU_mgv1a003999mg                184   1e-132   
ref|XP_010442897.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    194   1e-132   
ref|XP_010445732.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    193   2e-132   
ref|XP_002864018.1|  hypothetical protein ARALYDRAFT_495043             206   5e-132   
ref|XP_008460586.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    196   5e-132   
ref|XP_001773526.1|  predicted protein                                  191   6e-132   
ref|XP_002318424.2|  hypothetical protein POPTR_0012s02260g             190   9e-132   Populus trichocarpa [western balsam poplar]
ref|XP_004142810.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    193   1e-131   
ref|XP_006412459.1|  hypothetical protein EUTSA_v10024710mg             207   2e-131   
dbj|BAA98151.1|  CLP protease regulatory subunit CLPX-like              202   3e-131   Arabidopsis thaliana [mouse-ear cress]
gb|EEE56773.1|  hypothetical protein OsJ_06335                          194   4e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009119914.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    203   5e-131   
ref|XP_009119913.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    202   9e-131   
gb|EEE55774.1|  hypothetical protein OsJ_04339                          212   4e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952279.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    185   4e-130   
emb|CDY14359.1|  BnaA10g06960D                                          203   1e-129   
ref|XP_010482282.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    197   1e-129   
ref|XP_010441212.1|  PREDICTED: mitochondrial clpX-like chaperone...    196   1e-129   
gb|AFW70872.1|  ATP-dependent Clp protease ATP-binding subunit clpX     188   2e-129   
ref|XP_001768014.1|  predicted protein                                  190   2e-129   
dbj|BAD21479.1|  putative ATP-dependent Clp protease ATP-binding ...    190   2e-129   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147507.1|  ATP-dependent Clp protease ATP-binding subun...    187   3e-129   Zea mays [maize]
ref|XP_010442456.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    196   2e-128   
ref|XP_004952278.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    181   3e-128   
gb|KFK32966.1|  hypothetical protein AALP_AA6G312500                    197   2e-127   
gb|EYU25234.1|  hypothetical protein MIMGU_mgv1a003646mg                189   2e-127   
gb|KCW46560.1|  hypothetical protein EUGRSUZ_K00383                     188   2e-127   
ref|XP_010478757.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    180   3e-127   
ref|XP_010442455.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    196   5e-127   
emb|CAN75136.1|  hypothetical protein VITISV_040753                     203   5e-127   Vitis vinifera
ref|XP_010442457.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    196   8e-127   
ref|XP_007039052.1|  CLP protease regulatory subunit X isoform 2        187   1e-125   
gb|AES72507.2|  ATP-dependent Clp protease regulatory subunit ClpX      179   8e-125   
gb|EMT28446.1|  ATP-dependent Clp protease ATP-binding subunit clpX     216   8e-120   
ref|XP_008460588.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    196   1e-118   
ref|XP_007023129.1|  ATP-dependent Clp protease ATP-binding subun...    249   4e-118   
gb|KCW71001.1|  hypothetical protein EUGRSUZ_F04107                     186   3e-117   
ref|XP_010912710.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    215   3e-117   
ref|XP_008643592.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    173   9e-117   
ref|XP_008783202.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    210   2e-116   
ref|XP_004961402.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    174   2e-116   
gb|KDO54247.1|  hypothetical protein CISIN_1g005637mg                   188   3e-116   
ref|XP_007222159.1|  hypothetical protein PRUPE_ppa007724mg             217   4e-116   
gb|KDO54246.1|  hypothetical protein CISIN_1g005637mg                   187   9e-116   
ref|XP_010267612.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    189   1e-113   
emb|CDO97670.1|  unnamed protein product                                240   1e-111   
ref|XP_004502652.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    194   2e-111   
ref|XP_006655521.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    180   9e-111   
ref|XP_008460587.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    195   9e-111   
gb|EEC79584.1|  hypothetical protein OsI_20758                          172   1e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_010231123.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    163   1e-107   
gb|KDO54248.1|  hypothetical protein CISIN_1g005637mg                   187   2e-107   
ref|XP_010677235.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    175   2e-107   
gb|KHN27868.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     222   2e-106   
ref|XP_009781368.1|  PREDICTED: uncharacterized protein LOC104230...    186   3e-106   
ref|XP_010099789.1|  ATP-dependent Clp protease ATP-binding subun...    215   2e-105   
ref|XP_008676716.1|  PREDICTED: uncharacterized protein LOC100272...    219   2e-104   
ref|XP_010112073.1|  ATP-dependent Clp protease ATP-binding subun...    223   1e-103   
ref|XP_006647394.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    216   1e-103   
dbj|BAJ91098.1|  predicted protein                                      158   2e-103   
ref|XP_010266546.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    187   1e-102   
gb|KDO42937.1|  hypothetical protein CISIN_1g0057621mg                  190   1e-102   
emb|CDP11543.1|  unnamed protein product                                212   2e-102   
ref|NP_001140773.1|  uncharacterized protein LOC100272848               210   5e-102   Zea mays [maize]
ref|XP_010231124.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    163   1e-101   
ref|XP_002440133.1|  hypothetical protein SORBIDRAFT_09g026620          167   2e-101   Sorghum bicolor [broomcorn]
gb|AFW62663.1|  hypothetical protein ZEAMMB73_067276                    191   3e-101   
gb|EEE64480.1|  hypothetical protein OsJ_19330                          172   5e-101   Oryza sativa Japonica Group [Japonica rice]
gb|EMS53220.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     217   2e-100   
emb|CDO97669.1|  unnamed protein product                                322   3e-99    
emb|CDY14385.1|  BnaA10g06700D                                          198   4e-98    
emb|CDY35643.1|  BnaC09g29650D                                          196   2e-97    
emb|CDP05061.1|  unnamed protein product                                196   4e-97    
emb|CAN80513.1|  hypothetical protein VITISV_026067                     218   2e-96    Vitis vinifera
ref|XP_008460589.1|  PREDICTED: mitochondrial clpX-like chaperone...    195   5e-96    
gb|KHG18905.1|  clpX                                                    194   1e-95    
ref|XP_010912712.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    215   2e-95    
gb|KHG18904.1|  clpX                                                    192   3e-95    
ref|XP_010482281.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    161   5e-95    
gb|KHG18903.1|  clpX                                                    192   6e-95    
ref|WP_005981784.1|  ATP-dependent protease                             153   7e-95    
ref|WP_027261442.1|  Clp protease ATP-binding protein                   152   2e-94    
ref|WP_028095020.1|  Clp protease ATP-binding protein                   152   4e-94    
ref|WP_027239926.1|  Clp protease ATP-binding protein                   151   7e-94    
ref|XP_011028418.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    201   9e-94    
ref|WP_014874379.1|  MULTISPECIES: ATP-dependent protease               152   1e-93    
ref|WP_009808661.1|  ATP-dependent protease                             152   1e-93    
ref|WP_019295832.1|  MULTISPECIES: ATP-dependent protease               153   2e-93    
ref|WP_039130307.1|  Clp protease ATP-binding protein                   152   2e-93    
ref|WP_025061798.1|  Clp protease ATP-binding protein                   152   2e-93    
ref|WP_039165979.1|  Clp protease ATP-binding protein                   152   2e-93    
ref|WP_014879760.1|  ATP-dependent protease                             152   2e-93    
gb|AHM04628.1|  ATP-dependent Clp protease ATP-binding protein su...    151   3e-93    
ref|WP_002597001.1|  ATP-dependent Clp protease ATP-binding subun...    151   3e-93    
ref|WP_039532395.1|  Clp protease ATP-binding protein                   153   3e-93    
ref|WP_023665968.1|  ATP-dependent protease                             153   3e-93    
ref|WP_036637342.1|  Clp protease ATP-binding protein                   151   3e-93    
ref|WP_008562325.1|  ATP-dependent protease                             152   4e-93    
ref|WP_022273732.1|  aTP-dependent Clp protease ATP-binding subun...    156   4e-93    
ref|WP_011538860.1|  ATP-dependent protease                             152   4e-93    
ref|WP_024097560.1|  endopeptidase Clp ATP-binding protein regula...    152   4e-93    
ref|WP_025044425.1|  Clp protease ATP-binding protein                   152   5e-93    
ref|WP_039182301.1|  Clp protease ATP-binding protein                   153   5e-93    
ref|WP_022368537.1|  aTP-dependent Clp protease ATP-binding subun...    160   5e-93    
ref|WP_008553562.1|  ATP-dependent protease                             152   6e-93    
ref|WP_037246148.1|  Clp protease ATP-binding protein                   151   6e-93    
ref|WP_025057880.1|  Clp protease ATP-binding protein                   152   7e-93    
ref|WP_015554829.1|  ATP-dependent Clp protease ATP-binding subun...    156   7e-93    
ref|WP_022571667.1|  endopeptidase Clp ATP-binding regulatory sub...    153   7e-93    
ref|WP_025048384.1|  Clp protease ATP-binding protein                   150   8e-93    
ref|WP_022962308.1|  ATP-dependent protease                             149   8e-93    
ref|WP_008758392.1|  ATP-dependent protease                             153   9e-93    
ref|WP_024089763.1|  MULTISPECIES: ATP-dependent protease               152   9e-93    
ref|WP_039683166.1|  Clp protease ATP-binding protein                   153   1e-92    
ref|XP_003619596.1|  ATP-dependent Clp protease ATP-binding subun...    195   1e-92    
ref|WP_039534074.1|  Clp protease ATP-binding protein                   153   1e-92    
ref|WP_020950318.1|  ATP-dependent protease, ATP-binding subunit ...    150   1e-92    
ref|WP_013961512.1|  ATP-dependent protease                             150   2e-92    
ref|WP_037907779.1|  Clp protease ATP-binding protein                   150   2e-92    
ref|WP_010443268.1|  ATP-dependent protease                             153   2e-92    
ref|WP_007254527.1|  ATP-dependent protease                             151   2e-92    
ref|WP_005639713.1|  ATP-dependent protease ATP-binding subunit ClpX    151   2e-92    
ref|WP_035602252.1|  Clp protease ATP-binding protein                   152   2e-92    
ref|WP_010139165.1|  ATP-dependent protease                             151   2e-92    
ref|WP_025053950.1|  Clp protease ATP-binding protein                   150   2e-92    
ref|WP_008228584.1|  ATP-dependent protease                             150   2e-92    
ref|WP_036176460.1|  Clp protease ATP-binding protein                   153   2e-92    
ref|WP_020038023.1|  ATP-dependent protease                             149   2e-92    
gb|KGM49055.1|  Clp protease ATP-binding protein                        150   2e-92    
ref|WP_027313646.1|  Clp protease ATP-binding protein                   149   3e-92    
ref|WP_009816369.1|  ATP-dependent protease                             151   3e-92    
ref|WP_025052649.1|  Clp protease ATP-binding protein                   150   3e-92    
ref|WP_036716122.1|  Clp protease ATP-binding protein                   150   4e-92    
ref|WP_027237968.1|  Clp protease ATP-binding protein                   152   4e-92    
ref|WP_008425580.1|  endopeptidase Clp ATP-binding regulatory sub...    150   5e-92    
gb|EPS62752.1|  hypothetical protein M569_12037                         196   5e-92    
ref|WP_035258253.1|  Clp protease ATP-binding protein                   152   6e-92    
ref|WP_007120001.1|  ATP-dependent protease                             150   6e-92    
ref|WP_023851836.1|  ATP-dependent protease                             152   7e-92    
ref|WP_032119262.1|  ATP-dependent protease                             149   7e-92    
ref|WP_005852783.1|  MULTISPECIES: ATP-dependent protease               150   7e-92    
ref|WP_021100045.1|  ATP-dependent Clp protease ATP-binding subun...    150   7e-92    
ref|WP_009159622.1|  ATP-dependent protease                             147   8e-92    
ref|WP_027306583.1|  Clp protease ATP-binding protein                   157   9e-92    
emb|CEA06429.1|  ATP-dependent protease ATP-binding subunit ClpX        150   1e-91    
ref|WP_034765012.1|  Clp protease ATP-binding protein                   151   1e-91    
ref|WP_011568999.1|  ATP-dependent protease                             150   1e-91    
ref|WP_022433091.1|  aTP-dependent Clp protease ATP-binding subun...    158   1e-91    
ref|WP_010164295.1|  MULTISPECIES: ATP-dependent protease               151   1e-91    
ref|WP_022168396.1|  aTP-dependent Clp protease ATP-binding subun...    150   1e-91    
ref|WP_039631581.1|  ATP-dependent protease                             151   1e-91    
ref|WP_024811856.1|  Clp protease ATP-binding protein                   150   1e-91    
sp|Q5LUP9.1|CLPX_RUEPO  RecName: Full=ATP-dependent Clp protease ...    153   1e-91    
ref|WP_006997038.1|  ATP-dependent protease                             156   1e-91    
ref|WP_023457651.1|  ATP-dependent protease                             154   1e-91    
ref|WP_021867186.1|  aTP-dependent Clp protease ATP-binding subun...    155   1e-91    
ref|WP_030003187.1|  ATP-dependent Clp protease, ATP-binding subu...    153   1e-91    
ref|WP_039017489.1|  Clp protease ATP-binding protein                   151   1e-91    
ref|WP_011282011.1|  ATP-dependent protease                             156   1e-91    
ref|WP_014953136.1|  ATP-dependent protease                             156   1e-91    
ref|WP_008330326.1|  ATP-dependent protease                             149   1e-91    
gb|EJP72133.1|  ATP-dependent Clp protease, ATP-binding subunit ClpX    148   2e-91    
ref|WP_036992337.1|  Clp protease ATP-binding protein                   150   2e-91    
ref|WP_008711747.1|  ATP-dependent protease                             162   2e-91    
ref|WP_021876320.1|  Putative ATP-dependent Clp protease ATP-bind...    149   2e-91    
ref|WP_017211515.1|  ATP-dependent protease                             150   2e-91    
ref|WP_011968662.1|  ATP-dependent protease                             150   2e-91    
ref|WP_008209911.1|  ATP-dependent protease                             152   2e-91    
ref|WP_013068317.1|  ATP-dependent protease                             150   2e-91    
ref|WP_023974252.1|  ATP-dependent protease                             150   2e-91    
ref|WP_037529672.1|  Clp protease ATP-binding protein                   152   2e-91    
ref|WP_034442860.1|  ATP-dependent protease                             162   2e-91    
gb|ETD00930.1|  ATP-dependent protease                                  150   2e-91    
ref|XP_008875916.1|  ATP-dependent Clp protease, ATP-binding subu...    166   2e-91    
ref|WP_007392223.1|  ATP-dependent protease                             153   2e-91    
ref|WP_031396414.1|  MULTISPECIES: Clp protease ATP-binding protein     152   2e-91    
ref|WP_018038558.1|  ATP-dependent protease                             154   2e-91    
ref|WP_037925869.1|  Clp protease ATP-binding protein                   149   2e-91    
ref|WP_028958094.1|  Clp protease ATP-binding protein                   149   2e-91    
ref|WP_026889351.1|  ATP-dependent protease                             150   2e-91    
ref|WP_026147344.1|  Clp protease ATP-binding protein                   150   2e-91    
ref|WP_022502627.1|  aTP-dependent Clp protease ATP-binding subun...    159   3e-91    
gb|KGJ15289.1|  Clp protease ATP-binding protein                        150   3e-91    
ref|WP_020044448.1|  ATP-dependent protease                             153   3e-91    
ref|WP_009506420.1|  ATP-dependent protease                             150   3e-91    
ref|WP_009570653.1|  ATP-dependent protease                             150   3e-91    
ref|WP_034159405.1|  Clp protease ATP-binding protein                   152   4e-91    
dbj|GAM02135.1|  ATP-dependent Clp protease ATP-binding subunit ClpX    153   4e-91    
gb|ETW11720.1|  ATP-dependent protease ATP-binding subunit ClpX         153   4e-91    
ref|WP_014456950.1|  ATP-dependent protease                             152   4e-91    
dbj|BAQ17507.1|  ATP-dependent Clp protease ATP-binding subunit ClpX    154   4e-91    
gb|ESW40373.1|  ATP-dependent protease                                  149   4e-91    
ref|WP_002690404.1|  ATP-dependent protease                             146   4e-91    
ref|WP_022747231.1|  ATP-dependent Clp protease ATP-binding subun...    150   4e-91    
ref|WP_023536000.1|  MULTISPECIES: ATP-dependent Clp protease, AT...    149   5e-91    
ref|WP_022706782.1|  ATP-dependent protease                             149   5e-91    
gb|EGI55186.1|  ATP-dependent Clp protease, ATP-binding subunit ClpX    152   5e-91    
ref|WP_023439362.1|  ATP-dependent protease ATP-binding subunit ClpX    148   5e-91    
ref|WP_037568616.1|  Clp protease ATP-binding protein                   152   5e-91    
ref|WP_003531385.1|  MULTISPECIES: ATP-dependent protease               159   5e-91    
ref|WP_010403209.1|  MULTISPECIES: ATP-dependent protease               152   5e-91    
ref|WP_036708137.1|  MULTISPECIES: Clp protease ATP-binding protein     150   5e-91    
ref|WP_008884160.1|  ATP-dependent protease                             152   5e-91    
ref|WP_022950819.1|  ATP-dependent protease                             149   5e-91    
ref|WP_024613494.1|  ATP-dependent protease                             152   5e-91    
ref|WP_036741258.1|  Clp protease ATP-binding protein                   151   6e-91    
ref|WP_028096247.1|  Clp protease ATP-binding protein                   152   6e-91    
ref|WP_017998001.1|  ATP-dependent protease                             150   6e-91    
ref|WP_009805403.1|  ATP-dependent protease                             151   6e-91    
ref|WP_037533125.1|  Clp protease ATP-binding protein                   152   6e-91    
ref|WP_022205148.1|  aTP-dependent Clp protease ATP-binding subun...    158   6e-91    
ref|XP_007039053.1|  CLP protease regulatory subunit X isoform 3        187   6e-91    
gb|KFL90354.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     150   6e-91    
ref|WP_025899029.1|  Clp protease ATP-binding protein                   151   7e-91    
ref|WP_034618056.1|  Clp protease ClpX                                  145   7e-91    
ref|WP_021615469.1|  ATP-dependent Clp protease, ATP-binding subu...    148   7e-91    
ref|WP_022207569.1|  aTP-dependent Clp protease ATP-binding subun...    157   7e-91    
ref|WP_027299899.1|  Clp protease ATP-binding protein                   152   7e-91    
ref|WP_028034631.1|  Clp protease ATP-binding protein                   153   8e-91    
ref|WP_008676861.1|  ATP-dependent protease                             147   8e-91    
ref|WP_008186723.1|  ATP-dependent protease                             150   8e-91    
ref|WP_022211188.1|  aTP-dependent Clp protease ATP-binding subun...    150   8e-91    
ref|WP_015391638.1|  ATP-dependent Clp protease ATP-binding subun...    150   8e-91    
ref|WP_038311711.1|  Clp protease ATP-binding protein                   151   8e-91    
ref|WP_020021810.1|  ATP-dependent protease                             151   9e-91    
ref|WP_006786779.1|  ATP-dependent protease                             148   9e-91    
ref|WP_035672995.1|  Clp protease ATP-binding protein                   153   9e-91    
ref|WP_038603662.1|  Clp protease ATP-binding protein                   152   9e-91    
ref|WP_011951440.1|  MULTISPECIES: ATP-dependent protease               151   9e-91    
gb|AHK70022.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     149   9e-91    
ref|WP_007391132.1|  MULTISPECIES: ATP-dependent protease               154   9e-91    
ref|WP_005947230.1|  MULTISPECIES: ATP-dependent protease               158   1e-90    
ref|WP_038267673.1|  ATP-dependent protease [                           147   1e-90    
ref|WP_028634543.1|  Clp protease ATP-binding protein                   149   1e-90    
ref|WP_011941871.1|  MULTISPECIES: ATP-dependent protease               154   1e-90    
ref|WP_011580509.1|  ATP-dependent protease                             152   1e-90    
ref|WP_027096815.1|  ATP-dependent protease                             149   1e-90    
ref|WP_004424106.1|  ATP-dependent protease                             150   1e-90    
ref|WP_002044302.1|  ATP-dependent Clp protease, ATP-binding subu...    147   1e-90    
ref|WP_025860055.1|  Clp protease ATP-binding protein                   152   1e-90    
ref|WP_035140150.1|  ATP-dependent protease                             148   1e-90    
ref|WP_015827637.1|  ATP-dependent protease                             151   1e-90    
ref|WP_025827013.1|  Clp protease ATP-binding protein                   149   1e-90    
ref|WP_013715329.1|  ATP-dependent protease                             150   1e-90    
ref|WP_012271563.1|  ATP-dependent protease                             149   1e-90    
ref|WP_018308322.1|  ATP-dependent protease                             154   1e-90    
ref|WP_011647082.1|  MULTISPECIES: ATP-dependent protease               150   1e-90    
ref|WP_003250242.1|  MULTISPECIES: ATP-dependent protease               149   1e-90    
ref|WP_035135666.1|  ATP-dependent protease                             151   1e-90    
gb|ACR33872.1|  unknown                                                 189   1e-90    
ref|WP_022749509.1|  ATP-dependent protease                             158   1e-90    
ref|WP_029563400.1|  Clp protease ATP-binding protein                   155   2e-90    
ref|WP_006871620.1|  ATP-dependent protease                             149   2e-90    
ref|WP_036700673.1|  Clp protease ATP-binding protein                   150   2e-90    
ref|WP_029311288.1|  Clp protease ATP-binding protein                   154   2e-90    
ref|WP_037310536.1|  Clp protease ATP-binding protein                   152   2e-90    
ref|WP_008230358.1|  ATP-dependent protease                             151   2e-90    
ref|WP_024308002.1|  Clp protease ATP-binding protein                   150   2e-90    
ref|WP_014240114.1|  ATP-dependent protease                             153   2e-90    
ref|WP_006116556.1|  ATP-dependent protease                             151   2e-90    
ref|WP_012596185.1|  MULTISPECIES: ATP-dependent protease               161   2e-90    
ref|WP_011975067.1|  MULTISPECIES: ATP-dependent protease               153   2e-90    
ref|WP_010501414.1|  ATP-dependent protease ATP-binding subunit ClpX    151   2e-90    
ref|WP_019088391.1|  ATP-dependent protease                             151   2e-90    
ref|WP_036603208.1|  Clp protease ClpX                                  150   2e-90    
ref|WP_025826153.1|  Clp protease ATP-binding protein                   151   2e-90    
ref|WP_009450130.1|  ATP-dependent protease                             153   2e-90    
ref|WP_029032747.1|  Clp protease ATP-binding protein                   154   2e-90    
ref|WP_008029714.1|  ATP-dependent protease                             152   2e-90    
ref|WP_037501226.1|  Clp protease ATP-binding protein                   150   2e-90    
ref|WP_008851499.1|  ATP-dependent protease                             147   2e-90    
ref|WP_016394423.1|  MULTISPECIES: ATP-dependent protease ATP-bin...    149   2e-90    
ref|WP_022689052.1|  ATP-dependent protease                             152   2e-90    
ref|WP_019833451.1|  ATP-dependent protease                             152   2e-90    
ref|WP_010294156.1|  ATP-dependent protease                             152   2e-90    
ref|WP_022695342.1|  ATP-dependent protease                             152   2e-90    
ref|WP_004991312.1|  ATP-dependent protease                             156   2e-90    
ref|WP_034791410.1|  Clp protease ATP-binding protein                   151   2e-90    
ref|WP_005001393.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    156   2e-90    
dbj|GAJ29414.1|  ATP-dependent Clp protease ATP-binding subunit ClpX    152   2e-90    
ref|WP_024717294.1|  Clp protease ATP-binding protein                   149   2e-90    
ref|WP_012566445.1|  ATP-dependent protease                             152   2e-90    
ref|WP_037000808.1|  Clp protease ATP-binding protein                   150   2e-90    
ref|WP_035289600.1|  ATP-dependent protease                             150   2e-90    
ref|WP_034826693.1|  Clp protease ATP-binding protein                   151   2e-90    
gb|KDE20122.1|  Clp protease ATP-binding protein                        151   2e-90    
ref|WP_029455341.1|  Clp protease ATP-binding protein                   155   3e-90    
ref|WP_016485885.1|  MULTISPECIES: ATP-dependent protease               148   3e-90    
ref|WP_014292180.1|  ATP-dependent protease                             145   3e-90    
ref|WP_029040034.1|  Clp protease ATP-binding protein                   155   3e-90    
ref|WP_007117252.1|  ATP-dependent protease                             151   3e-90    
ref|WP_029454530.1|  Clp protease ATP-binding protein                   155   3e-90    
ref|WP_038528404.1|  Clp protease ATP-binding protein                   153   3e-90    
ref|WP_006559065.1|  ATP-dependent protease                             149   3e-90    
ref|WP_009169562.1|  ATP-dependent protease                             150   3e-90    
ref|WP_012227337.1|  ATP-dependent protease                             152   3e-90    
ref|WP_022687233.1|  ATP-dependent protease                             152   3e-90    
ref|WP_025747711.1|  ATP-dependent protease                             156   3e-90    
gb|KHQ51401.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     152   3e-90    
ref|WP_004943716.1|  ATP-dependent Clp protease ATP-binding subun...    157   3e-90    
ref|WP_019807968.1|  ATP-dependent protease ATP-binding subunit ClpX    151   3e-90    
ref|WP_029935292.1|  Clp protease ATP-binding protein                   152   4e-90    
ref|WP_027492330.1|  Clp protease ATP-binding protein                   153   4e-90    
ref|WP_035265272.1|  Clp protease ClpX                                  156   4e-90    
ref|WP_000130332.1|  MULTISPECIES: ATP-dependent protease               147   4e-90    
ref|WP_011100508.1|  ATP-dependent protease                             147   4e-90    
ref|WP_000130333.1|  ATP-dependent protease                             147   4e-90    
ref|WP_018427421.1|  ATP-dependent protease                             152   4e-90    
ref|WP_023853930.1|  endopeptidase Clp ATP-binding regulatory sub...    155   4e-90    
ref|WP_036083654.1|  ATP-dependent protease                             161   4e-90    
ref|WP_022249144.1|  aTP-dependent Clp protease ATP-binding subun...    157   4e-90    
ref|WP_037275249.1|  Clp protease ATP-binding protein                   151   4e-90    
ref|WP_004932846.1|  ATP-dependent Clp protease ATP-binding subun...    157   4e-90    
ref|WP_003531807.1|  MULTISPECIES: ATP-dependent protease               153   4e-90    
ref|WP_007511234.1|  MULTISPECIES: ATP-dependent protease               153   4e-90    
ref|WP_029008556.1|  Clp protease ATP-binding protein                   154   5e-90    
ref|WP_035583383.1|  Clp protease ATP-binding protein                   150   5e-90    
ref|WP_011215825.1|  ATP-dependent protease                             149   5e-90    
ref|WP_017978154.1|  ATP-dependent protease                             152   5e-90    
ref|WP_028000055.1|  Clp protease ATP-binding protein                   153   5e-90    



>ref|XP_004230411.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Solanum lycopersicum]
Length=636

 Score =   364 bits (934),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 218/345 (63%), Positives = 246/345 (71%), Gaps = 33/345 (10%)
 Frame = +3

Query  75    MSAIFRYNKTKLRHHFTFKIT-FlsftsskfpsnsssltpPLKLP-FFSTP---SRQHLP  239
             MSAIFRY K+KL H FTF+ + F   +S    S SSS   P + P  F  P   SR  L 
Sbjct  1     MSAIFRY-KSKL-HSFTFRTSLFSISSSKFHSSTSSSSLKPRRKPSLFFNPLEGSRVGL-  57

Query  240   PPPTTIRVIG--LGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAG  413
                   R  G  LGLGF  R KWEGSSDNYDH+K+EVNCPRCSK MTVLFSNRPLSITAG
Sbjct  58    ----VFRFEGSRLGLGF--RHKWEGSSDNYDHIKSEVNCPRCSKMMTVLFSNRPLSITAG  111

Query  414   ETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKA  593
             ETGIYQAVNLCPHCRTAFYFRP KLEPLQG FIEIG+VKG  GE+E++   A  S  GK 
Sbjct  112   ETGIYQAVNLCPHCRTAFYFRPFKLEPLQGTFIEIGRVKG--GEKESDDEMAGSS--GKN  167

Query  594   AGKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVKKL  773
              GKIWEKLR+YSG N S D G+ +  ++   S +  E             W G N+  +L
Sbjct  168   DGKIWEKLRSYSGTNGSDDGGQGTCETEMKDSEARKEEG-----------WGGTNLGIEL  216

Query  774   PTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFES  953
              TPKEICKGLD+FVVGQERAKKVLSVAVYNHYKRIY +S  + +  +S K  DE  N ++
Sbjct  217   LTPKEICKGLDQFVVGQERAKKVLSVAVYNHYKRIYHSSLNKKS--DSRKVRDELENIDN  274

Query  954   DFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             D VEL+KSNVLLMGPTGSGKTLLAKTLARL+NVPFVIADATTLTQ
Sbjct  275   DSVELEKSNVLLMGPTGSGKTLLAKTLARLINVPFVIADATTLTQ  319


 Score =   236 bits (603),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 172/206 (83%), Gaps = 2/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVRTNM    LT+AVV SSLLESVES+DLT+YGLIPEFVGRFP+ VSLS
Sbjct  430   RRQDSSIGFGAPVRTNMRAGGLTDAVVTSSLLESVESDDLTSYGLIPEFVGRFPVLVSLS  489

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +LD +QLVQVL +PKNALCKQYK+MF LNNVKL FT NAL+++A+KAIAK+TGARGLRSI
Sbjct  490   SLDVDQLVQVLTEPKNALCKQYKQMFNLNNVKLQFTGNALRLVAEKAIAKNTGARGLRSI  549

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFEVP ++PG + V++VLVDEEAVG+ DT GCGAKIL G++ G E +S    
Sbjct  550   LESILTEAMFEVPGSKPGEESVEVVLVDEEAVGTADTIGCGAKILCGSS-GLENISPTTG  608

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S+   EK +EA K D+D + E  +RA
Sbjct  609   SSMTMEK-KEATKEDLDSESEAPARA  633


 Score =   203 bits (517),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVES+L+KLL AADF++EAA+ GIVYIDEVDKITKKAESLNIGRDVSGEGVQQ L
Sbjct  321   GYVGEDVESVLYKLLEAADFNIEAAQQGIVYIDEVDKITKKAESLNIGRDVSGEGVQQAL  380

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+V+VPDNRARKH RGD+IQIDTK+ILFICGGAF+GLEKTISER
Sbjct  381   LKMLEGTIVSVPDNRARKHPRGDTIQIDTKDILFICGGAFVGLEKTISER  430



>ref|XP_006349274.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X1 [Solanum tuberosum]
 ref|XP_006349275.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X2 [Solanum tuberosum]
Length=636

 Score =   357 bits (915),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 217/343 (63%), Positives = 244/343 (71%), Gaps = 29/343 (8%)
 Frame = +3

Query  75    MSAIFRYNKTKLRHHFTFKIT-FlsftsskfpsnsssltpPL-KLPFFSTP---SRQHLP  239
             MSAIFRY K+KL H FTF+ + F   +S    S SSS   P  KL     P   SR  L 
Sbjct  1     MSAIFRY-KSKL-HTFTFRTSLFSISSSKFHSSTSSSSLKPRRKLSLLFNPFEGSRVGLV  58

Query  240   PPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGET  419
                   R   LGLGF  R KWEGSSDNYDH+K+EVNCPRCSK MTVLFSNRPLSITAGET
Sbjct  59    FRFEDSR---LGLGF--RHKWEGSSDNYDHIKSEVNCPRCSKMMTVLFSNRPLSITAGET  113

Query  420   GIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAG  599
             GIYQAVNLCPHCRTAFYFRP KLEPLQG FIEIG+VKGG  E E+     AGS +GK  G
Sbjct  114   GIYQAVNLCPHCRTAFYFRPFKLEPLQGTFIEIGRVKGGEKESEDE---MAGS-SGKNDG  169

Query  600   KIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVKKLPT  779
             KIWEKLR+YSG N S D G+ S  ++   S +  E             W G ++  +L T
Sbjct  170   KIWEKLRSYSGTNGSDDGGQGSCETEMKDSEARKEEG-----------WGGTDLGIELLT  218

Query  780   PKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDF  959
             PKEICKGLD+FVVGQERAKKVLSVAVYNHYKRIY +S  + +  +S K  DE  + ++D 
Sbjct  219   PKEICKGLDQFVVGQERAKKVLSVAVYNHYKRIYHSSLNKKS--DSRKVRDELESIDNDS  276

Query  960   VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             VEL+KSNVLLMGPTGSGKTLLAKTLARL+NVPFVIADATTLTQ
Sbjct  277   VELEKSNVLLMGPTGSGKTLLAKTLARLINVPFVIADATTLTQ  319


 Score =   241 bits (616),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 174/206 (84%), Gaps = 2/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVRTNM +  LT+AVV SSLLESVES+DLT+YGLIPEFVGRFP+ VSLS
Sbjct  430   RRQDSSIGFGAPVRTNMRVGGLTDAVVTSSLLESVESDDLTSYGLIPEFVGRFPVLVSLS  489

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +LD +QLVQVL +PKNALCKQYK+MF LNNVKL FT+NAL++IA+KAIAK+TGARGLRSI
Sbjct  490   SLDVDQLVQVLTEPKNALCKQYKQMFNLNNVKLQFTENALRLIAEKAIAKNTGARGLRSI  549

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFEVP ++PG + V++VLVDEEAVG+ DT GCGAKIL G++ G E +S    
Sbjct  550   LESILTEAMFEVPGSKPGEESVEVVLVDEEAVGTADTIGCGAKILHGSS-GLENISPTTG  608

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S+   EKN EA K D+D + E  +RA
Sbjct  609   SSMTMEKN-EATKEDLDSESEDPARA  633


 Score =   203 bits (517),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVES+L+KLL AADF+VEAA+ GIVYIDEVDKITKKAESLNIGRDVSGEGVQQ L
Sbjct  321   GYVGEDVESVLYKLLEAADFNVEAAQQGIVYIDEVDKITKKAESLNIGRDVSGEGVQQAL  380

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+V+VPDNRARKH RGD+IQIDTK+ILFICGGAF+GLEKTISER
Sbjct  381   LKMLEGTIVSVPDNRARKHPRGDTIQIDTKDILFICGGAFVGLEKTISER  430



>ref|XP_009613098.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nicotiana tomentosiformis]
Length=644

 Score =   359 bits (921),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/342 (62%), Positives = 247/342 (72%), Gaps = 19/342 (6%)
 Frame = +3

Query  75    MSAIFRYNKTKLRHHFTFKITFlsftsskfpsnsssltpPLKLP--FFST--PSRQHLPP  242
             MSAI+RY K+KL H+FTF+ +    +SSKF S++SS   P   P  FF++   SR  L  
Sbjct  1     MSAIYRY-KSKL-HNFTFRTSLFYLSSSKFHSSTSSSLKPKPKPALFFNSFQGSRISLGF  58

Query  243   PPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETG  422
                  R   LGLGF  R KWEGSSDNYDH+KAEVNCPRCSK MTVLFSNRPLSITAGETG
Sbjct  59    KFQGSR---LGLGF--RHKWEGSSDNYDHIKAEVNCPRCSKLMTVLFSNRPLSITAGETG  113

Query  423   IYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGK  602
             IYQAVNLCPHCRTAFYFRP KLEPL G+FIEIG+VK    EREN+G+       GK  GK
Sbjct  114   IYQAVNLCPHCRTAFYFRPFKLEPLHGSFIEIGRVK----ERENDGDMVGSC--GKNDGK  167

Query  603   IWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVKKLPTP  782
             IWEKLR+YSG +   D      + D+   + +   + E   EG       L +  +LPTP
Sbjct  168   IWEKLRSYSGTSGGVDDAGGQRSCDTEMENDTMVKKEEGCGEGGGWGGANLGI--ELPTP  225

Query  783   KEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFV  962
             KEICKGLD+FVVGQERAKKVLSVAVYNHYKRIY +S  + +  +S K  D+   F++D V
Sbjct  226   KEICKGLDQFVVGQERAKKVLSVAVYNHYKRIYHSSLYKKSDSDSSKVRDDLEMFDNDSV  285

Query  963   ELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             EL+KSNVLLMGPTGSGKTLLAKTLARL+NVPFVIADATTLTQ
Sbjct  286   ELEKSNVLLMGPTGSGKTLLAKTLARLINVPFVIADATTLTQ  327


 Score =   236 bits (602),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 171/206 (83%), Gaps = 2/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVRTNM +  LT+AVV SSLLESVES+DLTAYGLIPEFVGRFP+ VSLS
Sbjct  438   RRQDSSIGFGAPVRTNMRVGGLTDAVVTSSLLESVESDDLTAYGLIPEFVGRFPVLVSLS  497

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +LDE+QLVQVL +PKNALCKQYK+MF LNNVKL FT+NAL++IAKKAIAK+TGARGLRSI
Sbjct  498   SLDEDQLVQVLTEPKNALCKQYKQMFNLNNVKLQFTENALRLIAKKAIAKNTGARGLRSI  557

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFEVP ++PG D V++VLVDEEAVG+ D  GCGAK+L+  + G E  S  + 
Sbjct  558   LESILTEAMFEVPGSKPGEDSVEVVLVDEEAVGTADISGCGAKVLR-RSSGLEHASRPVG  616

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             ST   EK + A K D+  + E  SRA
Sbjct  617   STVTMEK-KIATKEDLGSEFEAPSRA  641


 Score =   199 bits (507),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVES+L+KLL AADF+VEAA+ G+VYIDEVDKITKKAESLN+GRDVSGEGVQQ L
Sbjct  329   GYVGEDVESVLYKLLEAADFNVEAAQQGVVYIDEVDKITKKAESLNVGRDVSGEGVQQAL  388

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+V+VPDNRARK  RGD+IQIDTK+ILFICGGAF+GLEKTISER
Sbjct  389   LKMLEGTIVSVPDNRARKQPRGDTIQIDTKDILFICGGAFVGLEKTISER  438



>ref|XP_009762784.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nicotiana sylvestris]
Length=644

 Score =   350 bits (898),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/342 (61%), Positives = 243/342 (71%), Gaps = 19/342 (6%)
 Frame = +3

Query  75    MSAIFRYNKTKLRHHFTFKIT--FlsftsskfpsnsssltpPLKLPFFST--PSRQHLPP  242
             MS IFRY K+KL H+FTF+ +  FLS +      +SS  + P    FF++   SR  L  
Sbjct  1     MSVIFRY-KSKL-HNFTFRTSLFFLSSSKFHSSPSSSLKSKPKPALFFNSFQGSRISLEF  58

Query  243   PPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETG  422
                  R   LGLGF  R KWEGSSDNYDH+KAEVNCPRCSK MTVLFSNRPLSITAGETG
Sbjct  59    KFQGSR---LGLGF--RHKWEGSSDNYDHMKAEVNCPRCSKLMTVLFSNRPLSITAGETG  113

Query  423   IYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGK  602
             IYQAVNLCPHCRTAFYFRP KLEPL G+FIEIG+VK    E+EN+G        GK  GK
Sbjct  114   IYQAVNLCPHCRTAFYFRPFKLEPLHGSFIEIGRVK----EKENDGEMVGSC--GKNDGK  167

Query  603   IWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVKKLPTP  782
             IWEKLR+YSG +   D     S+ D+   ++ +  + E   EG       L +  +LPTP
Sbjct  168   IWEKLRSYSGTSGRGDDAGGKSSCDTEMENNMTVKKEEGCGEGGGWGGANLGM--ELPTP  225

Query  783   KEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFV  962
             KEICKGLD+FVVGQE+AKKVLSVAVYNHYKRIY +S  + +  +S K  D    F++D V
Sbjct  226   KEICKGLDQFVVGQEKAKKVLSVAVYNHYKRIYHSSLYKKSDSDSSKVRDCLEMFDNDSV  285

Query  963   ELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             EL+KSNVLLMGPTGSGKTLLAKTLARL+NVPFVIADATTLTQ
Sbjct  286   ELEKSNVLLMGPTGSGKTLLAKTLARLINVPFVIADATTLTQ  327


 Score =   236 bits (603),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 169/206 (82%), Gaps = 2/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVRTNM +  LT+A+V SSLLESVES+DLTAYGLIPEFVGRFP+ VSLS
Sbjct  438   RRQDSSIGFGAPVRTNMRVGGLTDAIVTSSLLESVESDDLTAYGLIPEFVGRFPVLVSLS  497

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +LDE+QLVQVL +PKNALCKQYK+MF LNNVKL FT NAL++IAKKAIAK+TGARGLRSI
Sbjct  498   SLDEDQLVQVLTEPKNALCKQYKQMFNLNNVKLQFTKNALRLIAKKAIAKNTGARGLRSI  557

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFEVP ++PG D V++VLVDEEAVG+ D  GCGAK+L   +   E  S    
Sbjct  558   LESILTEAMFEVPGSKPGEDFVEVVLVDEEAVGTADISGCGAKVLH-RSSVLEHASRPPG  616

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             ST   EK +EA K D+D + E  SRA
Sbjct  617   STVTMEK-KEATKEDLDSESEAPSRA  641


 Score =   200 bits (509),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVES+L+KLL AADF+VEAA+ G+VYIDEVDKITKKAESLNIGRDVSGEGVQQ L
Sbjct  329   GYVGEDVESVLYKLLEAADFNVEAAQQGVVYIDEVDKITKKAESLNIGRDVSGEGVQQAL  388

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+V+VPDNRARK  RGD+IQIDTK+ILFICGGAF+GLEKTISER
Sbjct  389   LKMLEGTIVSVPDNRARKQPRGDTIQIDTKDILFICGGAFVGLEKTISER  438



>ref|XP_011087617.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Sesamum indicum]
Length=633

 Score =   323 bits (828),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 206/293 (70%), Gaps = 25/293 (9%)
 Frame = +3

Query  222   SRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLS  401
             S+Q LP  P         LGFQ+R KW+GSSDNYD +KAEVNCPRCSKPMTVLFSNRPLS
Sbjct  46    SQQTLPFKPAK-------LGFQQRHKWDGSSDNYDQIKAEVNCPRCSKPMTVLFSNRPLS  98

Query  402   ITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGG---VGERENNGNTAA  572
             ITAGE+GIYQAVN+C +CRTAFYFRP KLEPL G+F+EIG+VKGG    G+ E NG    
Sbjct  99    ITAGESGIYQAVNMCHNCRTAFYFRPFKLEPLLGSFVEIGRVKGGREHFGDMEGNG----  154

Query  573   GSENGKAAGKIWEKLRTYSGN-NsssdvgessstsdscsssssseteveesmegsAGEWT  749
                +GK   KIWEKLR+YSG+ N+  +       S +   +S   +          G   
Sbjct  155   AGRSGKTGVKIWEKLRSYSGSENNDRNGDAQGDCSSNVEENSEGRSTGSVEEMSRFG---  211

Query  750   GLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTV  929
                  K+LPTPKEICK L+E+V+GQ++AKKVLSVAVYNHYKRI  A   ++ G E     
Sbjct  212   -----KELPTPKEICKVLNEYVIGQDKAKKVLSVAVYNHYKRINHALVQKVTGSEVAHA-  265

Query  930   DEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              E  +  +D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF+IADATTLTQ
Sbjct  266   -ELDSCNNDIVELDKSNVLLIGPTGSGKTLLAKTLARVVNVPFIIADATTLTQ  317


 Score =   220 bits (560),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQD+SIGFGAPVR NM LS L+ +  AS L       DLTAYGLIPEFVGRFP+ V+LS
Sbjct  428   RRQDASIGFGAPVRANMRLSGLSISAAASLLEHVESG-DLTAYGLIPEFVGRFPVVVNLS  486

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             ALDE QLVQVL +PKNALCKQYKRMF++NNVKL+FTD+AL++IAKKAIAK+TGARGLR+I
Sbjct  487   ALDEEQLVQVLTEPKNALCKQYKRMFSMNNVKLNFTDSALRLIAKKAIAKNTGARGLRAI  546

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSE  2045
             LE ILTEAMFEVPDA+ G D  D VLVDEEAVG+ D  GCGAK+L  + G  E
Sbjct  547   LEDILTEAMFEVPDAKSGTDRADTVLVDEEAVGAPDAHGCGAKVLFSDCGLEE  599


 Score =   194 bits (492),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLM ADFDVEAA+ GIVYIDEVDKITKK ESLNIGRDVSGEGVQQ L
Sbjct  319   GYVGEDVESILYKLLMVADFDVEAAQRGIVYIDEVDKITKKTESLNIGRDVSGEGVQQAL  378

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+V+VPDNR  +H+R D+IQ+DTK+ILFICGGAF+ LEKTISER
Sbjct  379   LKMLEGTIVSVPDNRTPRHARRDNIQVDTKDILFICGGAFVDLEKTISER  428



>ref|XP_010682114.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=677

 Score =   301 bits (772),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/300 (55%), Positives = 194/300 (65%), Gaps = 27/300 (9%)
 Frame = +3

Query  261   VIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVN  440
             ++ LGLGFQ R KWEGSSDNYD +KA VNCPRCSK MTVLFSNRPLSIT  E GIYQA+N
Sbjct  63    ILKLGLGFQGRLKWEGSSDNYDQIKAVVNCPRCSKHMTVLFSNRPLSITPNEVGIYQALN  122

Query  441   LCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGER--------ENNGNTAAGSENGKAA  596
             +CPHC+TAFYFRP KL PLQG+F EIG+V G   +         +++ N   G    +  
Sbjct  123   ICPHCKTAFYFRPFKLSPLQGSFFEIGKVGGKDKDELMMEGKFIKDDSNGGGGGSEEEEN  182

Query  597   GKI--WEKLRTYS--------------GNNsssdvgessstsdscsssssseteveesme  728
              K+  W+KLR+Y               G N  +       +     S           + 
Sbjct  183   DKVSMWQKLRSYVRDLPPPSSEDDTRLGENHWAATRVDCESLPGEVSKGRHGESGGSVVG  242

Query  729   gsAGEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAG  908
               +G W G N+ K  PTPKEIC+GLDEFV+GQERAKKVLSVAVYNHYKR+  AS  +  G
Sbjct  243   ERSG-WGGANLGKDFPTPKEICRGLDEFVIGQERAKKVLSVAVYNHYKRVNYASEEKQLG  301

Query  909   GESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              +      +Q +F  D VEL+KSNVLLMGPTG GKTLLAKT+ARLVNVPFVIADATTLTQ
Sbjct  302   ADLDGNEVKQDDF--DIVELEKSNVLLMGPTGCGKTLLAKTMARLVNVPFVIADATTLTQ  359


 Score =   209 bits (532),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNAVVASSLLE+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  470   RRHDSSIGFGAPVRANMRSGGMTNAVVASSLLETVESSDLIAYGLIPEFVGRFPVLVSLS  529

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQYK+MF++N+ K H T+ AL++IA+KAI K+TGARGLRSI
Sbjct  530   ALNEDQLVQVLMEPKNALGKQYKKMFSMNDAKFHITEEALRLIARKAIVKNTGARGLRSI  589

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAM+EVPD + G D VD VLVD EAVGS +  G GAKIL+G+      L     
Sbjct  590   LEAILTEAMYEVPDVKTGTDRVDAVLVDGEAVGSAERLGSGAKILRGDHAFDHFLQET-K  648

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S+D+ E+ E      ++ D ++A RA
Sbjct  649   SSDQMEEYEVGKIESLESDLQIACRA  674


 Score =   187 bits (476),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AA+F+VEAA+ GIVYIDEVDKITKKAES N+GRDVSGEGVQQ 
Sbjct  360   AGYVGEDVESILYKLLTAAEFNVEAAQQGIVYIDEVDKITKKAESSNVGRDVSGEGVQQA  419

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVPD  +RK+ RGDSIQI+TK+ILFICGGAF+ LEKTISER
Sbjct  420   LLKMLEGTIVNVPDKGSRKNPRGDSIQINTKDILFICGGAFVDLEKTISER  470



>ref|XP_010657908.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Vitis vinifera]
 ref|XP_010657909.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Vitis vinifera]
Length=607

 Score =   278 bits (712),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 155/273 (57%), Positives = 181/273 (66%), Gaps = 21/273 (8%)
 Frame = +3

Query  279   GF-QRRCKWEG-SSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGET-GIYQAVNLCP  449
             GF QRR K +  S D YDH++A+VNCPRCS  M++LFSNRPLSITA E  G+YQA+NLCP
Sbjct  36    GFHQRRLKSDKYSGDTYDHIRADVNCPRCSSQMSILFSNRPLSITAAEPPGVYQALNLCP  95

Query  450   HCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKIWEKLRTYS  629
             +CRTAFYFRP KL PLQG+FIEIG+ K       +      G   G     IWEKLR Y 
Sbjct  96    NCRTAFYFRPFKLAPLQGSFIEIGRFK-------DKDGGGGGGGGGGRGVPIWEKLRLYG  148

Query  630   GNNsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVKKLPTPKEICKGLDE  809
             G                     +                   N+ ++LPTPKEICKGLDE
Sbjct  149   GGEGGEGEAGVRDEGVVVVGGGAPGGGSGWGGA---------NLGRELPTPKEICKGLDE  199

Query  810   FVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSNVLL  989
             FV+GQE+AKKVLSVAVYNHYKRI+ AS  + +G ES K   E  N ++D VEL+KSNVLL
Sbjct  200   FVIGQEQAKKVLSVAVYNHYKRIHHASLQKESGAESTKA--EIDNDDNDSVELEKSNVLL  257

Query  990   MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +GPTGSGKTLLAKTLAR+VNVPFVIADATTLTQ
Sbjct  258   LGPTGSGKTLLAKTLARVVNVPFVIADATTLTQ  290


 Score =   216 bits (550),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 162/208 (78%), Gaps = 6/208 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LT+AVV SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  401   RRQDSSIGFGAPVRANMRTGGLTDAVVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLS  460

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQYK+M ++NNVKLHFT+NAL++IAKKAIAK+TGAR LR+I
Sbjct  461   ALNEDQLVQVLTEPKNALGKQYKKMLSMNNVKLHFTENALRLIAKKAIAKNTGARSLRAI  520

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE ILTEAMFE+PD + G D VD VLVDEEAV S++  GCGAK+L+G     + L    +
Sbjct  521   LEKILTEAMFEIPDVKTGTDMVDAVLVDEEAVESIEEQGCGAKVLRGEGALEQFLHETKS  580

Query  2067  STD--KAEKNEEALKGDMDGDCEVASRA  2144
             S    + E  +E L  +M    EV+SRA
Sbjct  581   SNPLGRDEMAQELLPREM----EVSSRA  604


 Score =   192 bits (487),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL KLLM A+F+VEAA+ GIVYIDEVDKITKKAESLN GRDVSGEGVQQ L
Sbjct  292   GYVGEDVESILHKLLMVAEFNVEAAQQGIVYIDEVDKITKKAESLNTGRDVSGEGVQQAL  351

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVPD   RKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  352   LKMLEGTIVNVPDKGGRKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  401



>gb|KDP40893.1| hypothetical protein JCGZ_24892 [Jatropha curcas]
Length=599

 Score =   282 bits (722),  Expect(3) = 1e-179, Method: Compositional matrix adjust.
 Identities = 159/290 (55%), Positives = 189/290 (65%), Gaps = 47/290 (16%)
 Frame = +3

Query  234   LPPPPTTIRV-----IGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPL  398
             +P PP +        +GLGLGF R+   + +SD YDH++A VNCPRCS  M VLFSNRPL
Sbjct  32    IPKPPISAHQRRTVGVGLGLGFSRQVSDKTTSD-YDHIRANVNCPRCSSQMPVLFSNRPL  90

Query  399   SITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGS  578
             SITA ETGIYQAVN C +C+TAFYFRP KLEPLQG+FIE+G+VKG   +  +NGN    S
Sbjct  91    SITARETGIYQAVNFCANCKTAFYFRPLKLEPLQGSFIELGRVKGL--DDGSNGNVGCKS  148

Query  579   ENGKAAGKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsAGEWTGLN  758
               G     I EK     GN                                       + 
Sbjct  149   VEG-----IIEKDGDRIGNLEEVSDD--------------------------------MR  171

Query  759   VVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQ  938
             + KKLPTPKEI KGLDEFV+GQ++AKKVLSVAVYNHYKRIY AS  + +  +   + ++ 
Sbjct  172   LEKKLPTPKEISKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASRQKESRIDF--SYNDL  229

Query  939   GNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              N +++FVELDKSNVLLMGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQ
Sbjct  230   QNDDNEFVELDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATTLTQ  279


 Score =   218 bits (555),  Expect(3) = 1e-179, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQD+SIGFGAPVR NM    +T+A V SSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  392   RRQDASIGFGAPVRANMRTGGMTDAAVTSSLLESVESGDLIAYGLIPEFVGRFPILVSLS  451

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQYK+MF +NNVKLHFT+N+L++IAKKA+AK+TGARGLR+I
Sbjct  452   ALNEDQLVQVLMEPKNALGKQYKKMFNMNNVKLHFTENSLRLIAKKAMAKNTGARGLRAI  511

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LE+ILTEAM+EVP+ + G + +  VLVDEEAVGS+D PGCGAKIL G+
Sbjct  512   LENILTEAMYEVPENKTGTNYITAVLVDEEAVGSVDAPGCGAKILYGD  559


 Score =   182 bits (461),  Expect(3) = 1e-179, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL++LL A++F+VEAA+ GIVYIDEVDK+TKKAES NIGRDVSGEGVQQ L
Sbjct  281   GYVGEDVESILYRLLEASEFNVEAAQRGIVYIDEVDKMTKKAESSNIGRDVSGEGVQQAL  340

Query  1268  LKMLEGTVVN--VPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVN  VPD   RK SRGD+IQ+DTK+ILFICGGAF+ LEKTISER
Sbjct  341   LKMLEGTVVNVPVPDKGPRKQSRGDTIQMDTKDILFICGGAFVNLEKTISER  392



>ref|XP_002527823.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
 gb|EEF34526.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
Length=603

 Score =   279 bits (713),  Expect(3) = 4e-178, Method: Compositional matrix adjust.
 Identities = 157/297 (53%), Positives = 193/297 (65%), Gaps = 38/297 (13%)
 Frame = +3

Query  198   KLPFFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTV  377
             K+P    P+  H     T    + LGLG  R+   + ++D YDH++A VNCPRCS  M V
Sbjct  26    KIPPAKPPAHAH----QTKTSSLRLGLGSIRKVSDKSTTD-YDHIRANVNCPRCSSQMPV  80

Query  378   LFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENN  557
             LFSNRPLSIT  ETGI+QAVN CP+C+TAFYFRP KLEPLQG+FIE+G+VKG      +N
Sbjct  81    LFSNRPLSITGRETGIFQAVNFCPNCKTAFYFRPFKLEPLQGSFIELGRVKG-----FDN  135

Query  558   GNTAAGSENGKAAGKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsA  737
             G+ ++ + N K  G +  K     G+                           E      
Sbjct  136   GSCSSNNVNCKDTGGVIVKDCGKIGS--------------------------FEVACDDV  169

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
              +   + +  +LPTPKEICKGLDEFV+GQ+RAKKVL+VAVYNHYKRIY  S  + +G + 
Sbjct  170   DDDDDVKLENELPTPKEICKGLDEFVIGQDRAKKVLAVAVYNHYKRIYHGSKRKESGADM  229

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G T D Q N +++ VELDKSNVLLMGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQ
Sbjct  230   GYT-DSQ-NDDNEIVELDKSNVLLMGPTGSGKTLLAKTLARVVNVPFVIADATTLTQ  284


 Score =   214 bits (545),  Expect(3) = 4e-178, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQD+SIGFGAPVRTNM    + +AVVASSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  397   RRQDASIGFGAPVRTNMRTGRMIDAVVASSLLESVESGDLVAYGLIPEFVGRFPILVSLS  456

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL++PKNAL KQYK+MF++N+VKLHFTD AL++IAKKA+AK+TGARGLR+I
Sbjct  457   ALNEDQLVQVLVEPKNALGKQYKKMFSMNDVKLHFTDEALRLIAKKAMAKNTGARGLRAI  516

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAM+E+P+ + G++ +  VLVDEEAVGS D PGCGAKIL G+
Sbjct  517   LESILTEAMYEIPENKTGSNCISAVLVDEEAVGSADEPGCGAKILHGD  564


 Score =   184 bits (467),  Expect(3) = 4e-178, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL A++F+VEAA+ GI+YIDEVDKITKKAES NIGRDVSGEGVQQ L
Sbjct  286   GYVGEDVESILYKLLAASEFNVEAAQRGIIYIDEVDKITKKAESSNIGRDVSGEGVQQAL  345

Query  1268  LKMLEGTVVN--VPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VN  VPD   RKH RGD IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  346   LKMLEGTIVNVPVPDKGPRKHPRGDPIQIDTKDILFICGGAFVDLEKTISER  397



>gb|EYU35038.1| hypothetical protein MIMGU_mgv1a019263mg, partial [Erythranthe 
guttata]
Length=551

 Score =   303 bits (776),  Expect(3) = 4e-178, Method: Compositional matrix adjust.
 Identities = 168/279 (60%), Positives = 195/279 (70%), Gaps = 28/279 (10%)
 Frame = +3

Query  291   RCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFY  470
             R KW+G SDNYD +KAEV+CPRCSKPMTVLFSNRPLSITA E+GIYQAVN+C +CRTAFY
Sbjct  2     RHKWDGISDNYDQIKAEVDCPRCSKPMTVLFSNRPLSITAAESGIYQAVNMCHNCRTAFY  61

Query  471   FRPSKLEPLQGNFIEIGQVKGGVGEREN----NGNTAAGSENGKAAGKIWEKLRTYSGNN  638
             FRP KLEPLQG+FIEIG++KGG   REN     GN A   E GK   KIWEKLR+YSG  
Sbjct  62    FRPFKLEPLQGSFIEIGRIKGG---RENFRDLEGNHAG--EIGKKGVKIWEKLRSYSGGG  116

Query  639   sssdvgessstsdscsssssseteveesmegsAGEWTGLN-----VVKKLPTPKEICKGL  803
               +     ++  D   +                G  TG++     + K LPTPKEICK L
Sbjct  117   EDNRKNSDAADRDCNCNEEEISE----------GGATGVSEEVEKLGKDLPTPKEICKVL  166

Query  804   DEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSNV  983
             +EFV+GQE+AKKVLSVAVYNHYKRI  +   +    E+G T  E     SD VEL+KSNV
Sbjct  167   NEFVIGQEKAKKVLSVAVYNHYKRINHSMFQKETVAEAGCTEPELDCHNSDVVELEKSNV  226

Query  984   LLMGPTGSG----KTLLAKTLARLVNVPFVIADATTLTQ  1088
             LL+GPTGSG    KTLLAKTLAR+VNVPFVIADAT+LTQ
Sbjct  227   LLIGPTGSGMISRKTLLAKTLARVVNVPFVIADATSLTQ  265


 Score =   221 bits (564),  Expect(3) = 4e-178, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVRTNM +  L  A  +S L       DLTAYGLIPEFVGRFP+ VSLS
Sbjct  357   RRQDSSIGFGAPVRTNMRVGGLNIASASSLLEHVEGG-DLTAYGLIPEFVGRFPVVVSLS  415

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             ALDE+QLVQVL +PKNALCKQYKRMF++NNVKL FTD A+++IAKKA A++TGARGLR+I
Sbjct  416   ALDEDQLVQVLTEPKNALCKQYKRMFSMNNVKLQFTDGAMRLIAKKATARNTGARGLRAI  475

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAG  2036
             LE+ILTEAMFEVPDA  G +  D VLVD+EAVGS DTPGCGAK+L  + G
Sbjct  476   LENILTEAMFEVPDATSGVNYADTVLVDDEAVGSPDTPGCGAKLLWSSRG  525


 Score =   152 bits (384),  Expect(3) = 4e-178, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 85/111 (77%), Gaps = 19/111 (17%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLLM ADFDVEAA+ GIVYIDEVDKITKK ESLN+GRDVSGEGVQQ 
Sbjct  266   AGYVGEDVESILYKLLMVADFDVEAAQRGIVYIDEVDKITKKTESLNVGRDVSGEGVQQA  325

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT                   IDTK+ILFICGGAF+ LEK ISER
Sbjct  326   LLKMLEGT-------------------IDTKDILFICGGAFVDLEKRISER  357



>ref|XP_006836922.1| hypothetical protein AMTR_s00099p00142540 [Amborella trichopoda]
 gb|ERM99775.1| hypothetical protein AMTR_s00099p00142540 [Amborella trichopoda]
Length=709

 Score =   252 bits (643),  Expect(3) = 3e-174, Method: Compositional matrix adjust.
 Identities = 153/329 (47%), Positives = 182/329 (55%), Gaps = 64/329 (19%)
 Frame = +3

Query  276   LGFQRRCKWEGSSDNYDH---LKAEVNCPRCSKPMTVL----------FSNRPLSITAGE  416
             LGFQ R KWEG  D+  H   ++AEVNCPRCSK M VL           SNRPL    G+
Sbjct  70    LGFQERNKWEGGRDDGIHPKRIRAEVNCPRCSKQMDVLIAPNSLSVRSLSNRPL---IGD  126

Query  417   TGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG---------------------  533
                +QAVNLCP+C+TA+YFRP +L PLQG+F+EIG++                       
Sbjct  127   QS-FQAVNLCPNCKTAYYFRPFRLVPLQGSFVEIGRINSHDSNSNDSKDPPVQDSRVSLK  185

Query  534   -------GVGERENNGNTAAGSENGKAAGKIWEKLRTYS----------GNNsssdvges  662
                    G    E  G  +  S   +     WE LR+Y           GN  +      
Sbjct  186   TRVSDGKGDSNWEQEGENSNNSYENRLRASFWETLRSYGDPPEHWQPPPGNGIAVQSPPG  245

Query  663   sstsdscsssssseteveesmegsAGE-------WTGLNVVKKLPTPKEICKGLDEFVVG  821
                  + +   +S          + G        W G N+ K LPTPKEICKGLD+FV+G
Sbjct  246   PPFPPNLNVVRASGPGGGGGGSSNGGGSFGSKDAWGGANLGKDLPTPKEICKGLDKFVIG  305

Query  822   QERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSNVLLMGPT  1001
             QERAKKVLSVAVYNHYKRIY AS  +  GG+S  +  E    + D VEL+KSNVLLMGPT
Sbjct  306   QERAKKVLSVAVYNHYKRIYHASLQKGIGGDS--SCSEAETDDGDHVELEKSNVLLMGPT  363

Query  1002  GSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             GSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  364   GSGKTLLAKTLARFVNVPFVIADATTLTQ  392


 Score =   224 bits (572),  Expect(3) = 3e-174, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 166/211 (79%), Gaps = 12/211 (6%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LTNAVV SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  503   RRQDSSIGFGAPVRANMRTGGLTNAVVTSSLLESVESGDLMAYGLIPEFIGRFPILVSLS  562

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQYK+MF++NNVKLHFT+NAL++IAKKA++K+TGARGLR+I
Sbjct  563   ALNEDQLVQVLTEPKNALGKQYKKMFSMNNVKLHFTENALRLIAKKAMSKNTGARGLRAI  622

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAG-----GSERL  2051
             LESILTEAM+E+PD + GND VD V+VDEEAVG  D PG GAKIL+G+          +L
Sbjct  623   LESILTEAMYEIPDVKTGNDRVDAVVVDEEAVGYGDMPGTGAKILRGDGALDCYLADHKL  682

Query  2052  SSAMTSTDKAEKNEEALKGDMDGDCEVASRA  2144
                + S D +E       G+ + + E+ASRA
Sbjct  683   KDPVLSVDGSE-------GESEVEAELASRA  706


 Score =   187 bits (476),  Expect(3) = 3e-174, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  A+F+V AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  393   AGYVGEDVESILYKLLTVAEFNVAAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  452

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVVNVP+  ARKH RGD+IQIDTK ILFICGGAF+ LEKTISER
Sbjct  453   LLKMLEGTVVNVPEKGARKHPRGDNIQIDTKEILFICGGAFVDLEKTISER  503



>ref|XP_007023128.1| ATP-dependent Clp protease isoform 3, partial [Theobroma cacao]
 gb|EOY25750.1| ATP-dependent Clp protease isoform 3, partial [Theobroma cacao]
Length=535

 Score =   252 bits (643),  Expect(3) = 1e-170, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 174/266 (65%), Gaps = 49/266 (18%)
 Frame = +3

Query  291   RCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFY  470
             R KW+G    YDH++A+VNCPRC   M VLFSNRPLSITA E G+YQA+NLCP+C+TAFY
Sbjct  33    RQKWDGV--EYDHIRADVNCPRCFNQMPVLFSNRPLSITAREPGLYQALNLCPNCKTAFY  90

Query  471   FRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKIWEKLRTYSGNNsssd  650
             FRP KL PLQG+F+E+G++   +G+ E      +G E G+  GK+ +      GN+ + +
Sbjct  91    FRPFKLVPLQGSFVELGRI---MGDAEG----ISGKEPGQI-GKLSD------GNDDADE  136

Query  651   vgessstsdscsssssseteveesmegsAGEWTGLNVVKKLPTPKEICKGLDEFVVGQER  830
               +                                 + ++LPTPKEIC  LDEFV+GQ++
Sbjct  137   DKDD----------------------------VARRLERELPTPKEICGRLDEFVIGQQK  168

Query  831   AKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSG  1010
             AKKVLSVAVYNHYKRIY AS    A       + +  N  +DFVELDKSNVLL+GPTGSG
Sbjct  169   AKKVLSVAVYNHYKRIYHASQQNEAC-----ILGDDENDANDFVELDKSNVLLIGPTGSG  223

Query  1011  KTLLAKTLARLVNVPFVIADATTLTQ  1088
             KTLLAKTLAR+VNVPFVI DATTLTQ
Sbjct  224   KTLLAKTLARIVNVPFVIVDATTLTQ  249


 Score =   216 bits (550),  Expect(3) = 1e-170, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  S LT A V SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  362   RRQDSSIGFGAPVRANMRSSGLTTAAVTSSLLESVESDDLIAYGLIPEFIGRFPILVSLS  421

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
              L+E+QLV+VLMKPKNAL KQYK+MF++N VKLHFT NAL++I+KKA+AK+TGARGLR+I
Sbjct  422   GLNEDQLVEVLMKPKNALGKQYKKMFSMNGVKLHFTANALRLISKKAMAKNTGARGLRAI  481

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LE+ILTEAMFE+PD +  + GV+ VLVDEEAVGS D  GCGAKIL G+
Sbjct  482   LENILTEAMFEIPDTKMESQGVNAVLVDEEAVGSFDETGCGAKILYGD  529


 Score =   184 bits (467),  Expect(3) = 1e-170, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 2/111 (2%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KLL+ A+FDVEAA+HGIVYIDEVDKITKKAES NIGRDVSGEGVQQ LL
Sbjct  252   YVGEDVESILYKLLVEAEFDVEAAQHGIVYIDEVDKITKKAESSNIGRDVSGEGVQQALL  311

Query  1271  KMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             K+LEGT+VNV  PD  AR++ RGDS QIDTK+ILF+CGGAFI LEKTISER
Sbjct  312   KLLEGTIVNVPLPDKGARRYPRGDSFQIDTKDILFVCGGAFIDLEKTISER  362



>ref|XP_010665487.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Vitis vinifera]
Length=686

 Score =   247 bits (630),  Expect(3) = 5e-170, Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 185/325 (57%), Gaps = 63/325 (19%)
 Frame = +3

Query  276   LGFQRRCKWE-GSSDNYD--HLKAEVNCPRCSKPMTVLFSNRPL------------SITA  410
             +G Q R KW+ G SD +    ++AE NCPRCSK M +LFSNR              S + 
Sbjct  52    IGVQERYKWDHGGSDGFQTRKIRAEANCPRCSKVMDLLFSNRHFPSNFSPAVPTDSSNSK  111

Query  411   GETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGK  590
             G  G YQAVNLCP+C+TA+YFRP K+ PLQG+F+EIG+          N N   G +N K
Sbjct  112   GSGGSYQAVNLCPNCKTAYYFRPYKIAPLQGSFVEIGRSD----YNNTNTNHPKGKDNEK  167

Query  591   AAGK----------------IWEKLRTY---------------SGNNsssdvgessstsd  677
              + K                 WE LR+Y               SGN  +         + 
Sbjct  168   KSSKNGGGHEEDYGSRLRMSFWETLRSYGGDPPENWPPPPPPPSGNGLAVHAPPGPPFAP  227

Query  678   scsssssseteveesmegsA-----GE---WTGLNVVKKLPTPKEICKGLDEFVVGQERA  833
               +   ++   V  +  G       GE   W G N+ K LPTPKEICKGLD+FV+GQERA
Sbjct  228   GVNVIRAAGPGVGGNGGGGGGNGSFGERNGWGGSNLGKDLPTPKEICKGLDKFVIGQERA  287

Query  834   KKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGK  1013
             KKVLSVAVYNHYKRIY  S  + +G ESG +       + D VEL+KSNVLLMGPTGSGK
Sbjct  288   KKVLSVAVYNHYKRIYHGSLQKGSGAESGTS-----EVDDDSVELEKSNVLLMGPTGSGK  342

Query  1014  TLLAKTLARLVNVPFVIADATTLTQ  1088
             TLLAKTLAR VNVPFVIADATTLTQ
Sbjct  343   TLLAKTLARFVNVPFVIADATTLTQ  367


 Score =   218 bits (555),  Expect(3) = 5e-170, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 165/207 (80%), Gaps = 2/207 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LTNAVV SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  478   RRQDSSIGFGAPVRANMRTGGLTNAVVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLS  537

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL +PKNAL KQYK++F++NNVKLHFT+ AL+ IAKKA+ K+TGARGLR++
Sbjct  538   ALTEDQLVKVLTEPKNALGKQYKKLFSMNNVKLHFTEKALRQIAKKAMVKNTGARGLRAL  597

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G D VD V+VDEE+VGS++ PGCG KIL+G+ G  +   +   
Sbjct  598   LESILTEAMYEIPDVKTGKDRVDAVVVDEESVGSVNAPGCGGKILRGD-GALDCYLAETK  656

Query  2067  STDKAEKNEEALKGDM-DGDCEVASRA  2144
               D  E   EA  G++ + + EV+SRA
Sbjct  657   LKDPVESGGEAGDGELQEAESEVSSRA  683


 Score =   185 bits (469),  Expect(3) = 5e-170, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ G+VYIDEVDKITKKAESLN+ RDVSGEGVQ
Sbjct  366   TQAGYVGEDVESILYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNLSRDVSGEGVQ  425

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTIS+R
Sbjct  426   QALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISDR  478



>ref|XP_006431435.1| hypothetical protein CICLE_v10003616mg [Citrus clementina]
 gb|ESR44675.1| hypothetical protein CICLE_v10003616mg [Citrus clementina]
Length=592

 Score =   247 bits (630),  Expect(3) = 8e-170, Method: Compositional matrix adjust.
 Identities = 145/304 (48%), Positives = 175/304 (58%), Gaps = 77/304 (25%)
 Frame = +3

Query  204   PFFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLF  383
             P  ++P+  H  P               R     G   +YD+++A+VNCPRCS    VLF
Sbjct  43    PLLNSPNCPHFRP-------------LFRYNHNGGYGTDYDYIRADVNCPRCSAEFPVLF  89

Query  384   SNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK-----GGVGER  548
             SNRPLS+T  E G+YQAVN CP C+TAFYFRP KL PL+G+FIE+G+VK     GG   +
Sbjct  90    SNRPLSLTNREPGVYQAVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRK  149

Query  549   --ENNG-NTAAGSENGKAAGKIWEKLRTYSGNNsssdvgessstsdscssssssetevee  719
               E+NG  + + +ENG        + R   GN                            
Sbjct  150   DGESNGIESESETENGN-------RNRNSEGN----------------------------  174

Query  720   smegsAGEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQ  899
                              LPTPKEICKGLDEFV+GQERAKKVL+VAVYNHYKRIY +S  +
Sbjct  175   ---------------IDLPTPKEICKGLDEFVIGQERAKKVLAVAVYNHYKRIYHSSLQK  219

Query  900   MAGGESGKTVDEQGNFESD-FVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADAT  1076
              +G +SG       N E+D  VEL+KSNVLLMGPTGSGKTLLAKTLAR+VNVPF I DAT
Sbjct  220   ESGVKSGNC-----NVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDAT  274

Query  1077  TLTQ  1088
              LTQ
Sbjct  275   ALTQ  278


 Score =   222 bits (565),  Expect(3) = 8e-170, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 165/206 (80%), Gaps = 6/206 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LT+A+V SSLLESV+S DL AYGLIPEF+GRFPI VSLS
Sbjct  390   RRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLS  449

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL +QYK+MF++NNVKLHFTD+AL++IAKKA+AK+TGARGLR++
Sbjct  450   ALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRAL  509

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAMFE+P+ + G   V+ VLVD+EAVGS+D PGCGAKIL G+ G  ER+     
Sbjct  510   LENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGD-GELERVLHETK  568

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S D   K + A      G  EV SR+
Sbjct  569   SKDFMGKGKFA-----QGGLEVQSRS  589


 Score =   180 bits (456),  Expect(3) = 8e-170, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGED ES+L+KLL AADFDVEAA+ GIVYIDEVDKI K AES N GRDVSGEGVQQ L
Sbjct  280   GYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVK-AESRNNGRDVSGEGVQQAL  338

Query  1268  LKMLEGTVVNVP--DNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP  DN  RKH RGD+I IDTK+ILFICGGAF+GLEKTISER
Sbjct  339   LKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISER  390



>ref|XP_006470836.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Citrus sinensis]
Length=592

 Score =   246 bits (629),  Expect(3) = 1e-168, Method: Compositional matrix adjust.
 Identities = 141/267 (53%), Positives = 168/267 (63%), Gaps = 58/267 (22%)
 Frame = +3

Query  306   GSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSK  485
             G   +YD+++A+VNCPRCS    VLFSNRPLS+T  E G+YQAVN CP C+TAFYFRP K
Sbjct  64    GYGTDYDYIRADVNCPRCSAEFPVLFSNRPLSLTNREPGVYQAVNFCPKCKTAFYFRPFK  123

Query  486   LEPLQGNFIEIGQVK-----GGVGERENNGNTAAGSENGKAAGKIWEKLRTYSGNNsssd  650
             L PL+G+FIE+G+VK     GG   ++       G  NG     I  +  T +GN +   
Sbjct  124   LTPLEGSFIELGKVKVEEIMGGFIRKD-------GESNG-----IESESETENGNRN---  168

Query  651   vgessstsdscsssssseteveesmegsAGEWTGLNVVKKLPTPKEICKGLDEFVVGQER  830
                                          G   G N+   LPTPKEICKGLDEFV+GQER
Sbjct  169   -----------------------------GNSEG-NI--DLPTPKEICKGLDEFVIGQER  196

Query  831   AKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESD-FVELDKSNVLLMGPTGS  1007
             AKKVL+VAVYNHYKRIY +S  + +G +SG       N E+D  VEL+KSNVLLMGPTGS
Sbjct  197   AKKVLAVAVYNHYKRIYHSSLQKESGVKSGNC-----NVENDEIVELEKSNVLLMGPTGS  251

Query  1008  GKTLLAKTLARLVNVPFVIADATTLTQ  1088
             GKTLLAKTLAR+VNVPF I DAT LTQ
Sbjct  252   GKTLLAKTLARIVNVPFTITDATALTQ  278


 Score =   219 bits (558),  Expect(3) = 1e-168, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 164/206 (80%), Gaps = 6/206 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LT+A+V SSLLESV+S DL AYGLIPEF+GRFPI VSLS
Sbjct  390   RRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLS  449

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL +QYK+MF++NNVKLHFTD+AL++IAKKA+AK+TGARGLR++
Sbjct  450   ALNEDQLVQVLTEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRAL  509

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAMFE+P+ + G   V+ VLVD+EAVGS+D PGCGAKIL G+ G  ER+     
Sbjct  510   LENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGD-GELERVLHETK  568

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S D   K + A      G  EV SR+
Sbjct  569   SKDFMGKGKFA-----QGGLEVQSRS  589


 Score =   179 bits (455),  Expect(3) = 1e-168, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 98/112 (88%), Gaps = 3/112 (3%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGED ES+L+KLL AADFDVEAA+ GIVYIDEVDKI K AES N GRDVSGEGVQQ L
Sbjct  280   GYVGEDAESLLYKLLAAADFDVEAAQRGIVYIDEVDKIVK-AESRNNGRDVSGEGVQQAL  338

Query  1268  LKMLEGTVVNVP--DNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP  DN  RKH RGD+I IDTK+ILFICGGAF+GLEKTISER
Sbjct  339   LKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISER  390



>ref|XP_006356538.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Solanum tuberosum]
Length=684

 Score =   241 bits (616),  Expect(3) = 6e-167, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 187/323 (58%), Gaps = 63/323 (20%)
 Frame = +3

Query  276   LGFQRRCKWE-----GSSDNYD----HLKAEVNCPRCSKPMTVLFSNRPLSITA------  410
             +G Q R KW+     GSSD Y      ++AE  CPRCSK M +LFSNR   +        
Sbjct  55    IGVQERYKWDRGGGGGSSDEYRTAPRRIRAEAYCPRCSKHMDLLFSNRNHQLIPPPPSND  114

Query  411   ------------------GE--TGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
                               GE  +G YQAVNLCP+C+TA+YFRP K+ PLQG+F EIG++K
Sbjct  115   DDDNSNSSNSNNNSTDSKGEAGSGPYQAVNLCPNCKTAYYFRPYKMAPLQGSFFEIGRMK  174

Query  531   G-GVGERENNGNTAAGSENGK-AAGKIWEKLRTYS----------GNNsssdvgesssts  674
             G G G+R NN       +NGK      WE L++Y           GN  +         +
Sbjct  175   GNGNGKRVNND-----EDNGKRQKPSFWESLKSYGGEPPENWTPPGNGLAVHTPPGPPFA  229

Query  675   dscsssssseteveesmegsAGE-----WTGLNVVKKLPTPKEICKGLDEFVVGQERAKK  839
                +   ++ TE +       G      W G N+ K LPTPKEICKGLD FV+GQERAKK
Sbjct  230   PGLNLIRANGTEGKNGGGKDEGSDEKSGWGGSNLGKNLPTPKEICKGLDTFVIGQERAKK  289

Query  840   VLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTL  1019
             VLSV VYNHYKRIY AS  + +G ES K  +E+       VEL+KSNVLLMGPTGSGKTL
Sbjct  290   VLSVGVYNHYKRIYHASLQKGSGAESPKDDNEEN------VELEKSNVLLMGPTGSGKTL  343

Query  1020  LAKTLARLVNVPFVIADATTLTQ  1088
             LAKTLAR VNVPFVIADATTLTQ
Sbjct  344   LAKTLARFVNVPFVIADATTLTQ  366


 Score =   214 bits (546),  Expect(3) = 6e-167, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA + SSLLES ES+D   YGLIPEF+GRFPI VSLS
Sbjct  477   RRQDSSIGFGAPVRANMRTGGITNATITSSLLESAESSDFITYGLIPEFIGRFPILVSLS  536

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNALCKQYK++F++NN KLHFT+ AL++IAKKA+ K+TGARGLR++
Sbjct  537   ALTEDQLVQVLTEPKNALCKQYKKLFSMNNTKLHFTEGALRLIAKKAMVKNTGARGLRAL  596

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILT+AM+E+PD + G+D VD ++VDEE+VG+++  GCG K+L+G+ G  +R  +   
Sbjct  597   LESILTDAMYEIPDVKYGDDRVDAIVVDEESVGAVNARGCGGKVLRGD-GALQRYLAQAD  655

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
               D+ E +  A     +G+ EV+SRA
Sbjct  656   LVDQRENDGAAETEVQEGESEVSSRA  681


 Score =   183 bits (465),  Expect(3) = 6e-167, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ G++YIDEVDKITKKAESLN+ RDVSGEGVQ
Sbjct  365   TQAGYVGEDVESILYKLLSVAEFNVQAAQQGMIYIDEVDKITKKAESLNVSRDVSGEGVQ  424

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+V+VP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  425   QALLKMLEGTIVSVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  477



>ref|XP_004241855.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Solanum lycopersicum]
Length=682

 Score =   232 bits (592),  Expect(3) = 2e-164, Method: Compositional matrix adjust.
 Identities = 152/320 (48%), Positives = 184/320 (58%), Gaps = 56/320 (18%)
 Frame = +3

Query  276   LGFQRRCKWE-----GSSDNYD----HLKAEVNCPRCSKPMTVLFSNRPLSIT-------  407
             +G Q R KW+     GSSD Y      ++AE  CPRCSK M +LFSNR   +        
Sbjct  52    IGVQERYKWDRGGGGGSSDEYRTAPRRIRAEAYCPRCSKHMDLLFSNRNHQLIPPPPASN  111

Query  408   ---------------------AGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQ  524
                                  AG +G YQAVNLCP+C+TA+YFRP K+ PLQG+F EIG+
Sbjct  112   DDDDNSSTSNSSINTTDSKPEAG-SGPYQAVNLCPNCKTAYYFRPYKMAPLQGSFFEIGR  170

Query  525   VKG-GVGER----ENNGNTAAGS--ENGKAAGKIWEKLRTYSGNNsssdvg-----esss  668
             +KG G G+R    E+NG     S  E+ K+ G    +  T  GN  +             
Sbjct  171   MKGNGNGKRVNNDEDNGKRQKPSFWESLKSYGGEPPENWTPPGNGLAVHTPPGPPFAPGL  230

Query  669   tsdscsssssseteveesmegsAGEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLS  848
                  + +       ++        W G N+ K LPTPKEICKGLD+FV+GQERAKKVLS
Sbjct  231   NLIRVTGTDGKNGGGKDEDSDEKSGWGGSNLGKNLPTPKEICKGLDKFVIGQERAKKVLS  290

Query  849   VAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAK  1028
             V VYNHYKRIY AS  + +G ES K  +E+       VEL+KSNVLLMGPTGSGKTLLAK
Sbjct  291   VGVYNHYKRIYHASLQKGSGAESTKEDNEEN------VELEKSNVLLMGPTGSGKTLLAK  344

Query  1029  TLARLVNVPFVIADATTLTQ  1088
             TLAR VNVPFVIADATTLTQ
Sbjct  345   TLARFVNVPFVIADATTLTQ  364


 Score =   215 bits (547),  Expect(3) = 2e-164, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA V S+LLES ES+D   YGLIPEF+GRFPI VSLS
Sbjct  475   RRQDSSIGFGAPVRANMRTGGITNATVTSTLLESAESSDFITYGLIPEFIGRFPILVSLS  534

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNALCKQYK++F++NN KLHFT+ AL++IAKKA+ K+TGARGLR++
Sbjct  535   ALTEDQLVQVLTEPKNALCKQYKKLFSMNNTKLHFTEGALRLIAKKAMVKNTGARGLRAL  594

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILT+AM+E+PD + G+D +D ++VDEE+VG+++  GCG K+L+G+ G  +R      
Sbjct  595   LESILTDAMYEIPDVKSGDDRIDAIVVDEESVGAVNARGCGGKVLRGD-GALQRYLDQAD  653

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
               D+ E +  A     +G+ EV+SRA
Sbjct  654   LVDQRENDGAAETELQEGESEVSSRA  679


 Score =   184 bits (466),  Expect(3) = 2e-164, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ G++YIDEVDKITKKAESLN+ RDVSGEGVQ
Sbjct  363   TQAGYVGEDVESILYKLLTVAEFNVQAAQQGMIYIDEVDKITKKAESLNVSRDVSGEGVQ  422

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+V+VP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  423   QALLKMLEGTIVSVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  475



>ref|XP_008388035.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Malus domestica]
Length=728

 Score =   223 bits (567),  Expect(3) = 3e-164, Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 175/347 (50%), Gaps = 81/347 (23%)
 Frame = +3

Query  276   LGFQRRCKWE--GSSD-NYDHLKAEVNCPRCS-KPMTVLFSNRPL---------------  398
             +G Q R KW+  GS+D     ++AE NCPRCS   M +LFS+R L               
Sbjct  70    IGLQERYKWDHGGSADVRIRKIRAEANCPRCSFNRMDLLFSDRRLPNLSPSPPPPDDSTT  129

Query  399   -------------SITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQV----  527
                            +  E   YQA+NLCP+C+TA+YFRP ++ PLQG F+EIG++    
Sbjct  130   KAKAASTSATSASGNSDSEIRQYQALNLCPNCKTAYYFRPHQIAPLQGTFVEIGRLTNTT  189

Query  528   --------------------KGGVGERENNGNTAAGSE----NGKAAGKIWEKLRTYSGN  635
                                 K     R  N N  A SE    N       W+ LR+Y+  
Sbjct  190   SSTSSSSNRSATKTNNSDNNKKSHSSRNGNNNEGADSEPNTNNNGLRVSFWDSLRSYANG  249

Query  636   --------------NsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVKKL  773
                           N  +             +   +              W G N+   L
Sbjct  250   ADPPENWPPPPPPGNGLAVHTPPGPPFAPGVNVVRASAPPGTGDARDKNAWGGSNLGNNL  309

Query  774   PTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG--KTVDEQGNF  947
             PTPK+ICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY AS  + +G ESG    VD     
Sbjct  310   PTPKDICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLKKGSGAESGIPNKVD-----  364

Query  948   ESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVI DATTLTQ
Sbjct  365   DDDKVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVITDATTLTQ  411


 Score =   213 bits (543),  Expect(3) = 3e-164, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TN+VV SSLLESVES+DL +YGLIPEF+GRFPI VSLS
Sbjct  522   RRQDSSIGFGAPVRANMRAGGVTNSVVTSSLLESVESSDLISYGLIPEFIGRFPILVSLS  581

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVLM+PKNAL KQYK++F +NNVKLHF +NAL++IA KA+AK+TGARGLR++
Sbjct  582   ALTEDQLVQVLMEPKNALGKQYKKLFGMNNVKLHFMENALRLIANKAMAKNTGARGLRAL  641

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G D +D V+VDEE+VG+++ PGCG KI++G+ G  ER    ++
Sbjct  642   LESILTEAMYEIPDVKTGKDRIDAVVVDEESVGTVNAPGCGGKIVRGD-GALERYLHEIS  700

Query  2067  STDKAE  2084
               D  E
Sbjct  701   LKDSME  706


 Score =   195 bits (495),  Expect(3) = 3e-164, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLLMAA+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  412   AGYVGEDVESILYKLLMAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  471

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  472   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  522



>gb|KGN52598.1| hypothetical protein Csa_5G646720 [Cucumis sativus]
Length=634

 Score =   233 bits (595),  Expect(3) = 8e-164, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 172/302 (57%), Gaps = 69/302 (23%)
 Frame = +3

Query  276   LGFQRRCKWE----GSSDNYDH----------LKAEVNCPRCSKPMTVLFSNR---PLSI  404
             +G Q R KW+    GS D +            ++AE NCPRCSK M +LFSNR    L++
Sbjct  55    IGVQERYKWDNGGSGSDDFHSQSNITGTPIRKIRAEANCPRCSKHMDILFSNRHFPTLNL  114

Query  405   TAGETG-----------IYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERE  551
              +  +G            Y+AVNLCP+C+TA+YFRP K+ PLQG+FIEI           
Sbjct  115   PSSSSGDAPPKAGGGREAYEAVNLCPNCKTAYYFRPYKIAPLQGSFIEI-----------  163

Query  552   NNGNTAAGSENGKAAGKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmeg  731
                    G+ N K       ++ T  G   +     S                       
Sbjct  164   -------GNLNSKPKNSSERRITTKDGKGPNGSTSGSGGNGAGDGKK-------------  203

Query  732   sAGEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQ-MAG  908
                EW G N+ K LPTPKEICKGLD+FV+GQE+AKKVLSVAV+NHYKRIY AS  +  +G
Sbjct  204   --NEWGGSNLGKDLPTPKEICKGLDKFVIGQEKAKKVLSVAVHNHYKRIYHASLQKGRSG  261

Query  909   GESGK--TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTL  1082
              ESG   TVD+      D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFV+ADATTL
Sbjct  262   NESGTQDTVDDD-----DSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVLADATTL  316

Query  1083  TQ  1088
             TQ
Sbjct  317   TQ  318


 Score =   209 bits (531),  Expect(3) = 8e-164, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 166/206 (81%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM +   T+A V SSLLESVES+DL AYGLIPEF+GRFPI VSL 
Sbjct  429   RRQDSSIGFGAPVRANMRIGGATSAAVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLL  488

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK++F +N VKLH+T+ AL+MIAKKAIAK+TGARGLR+I
Sbjct  489   ALTEDQLVQVLTEPKNALGKQYKKLFGMNKVKLHYTEKALRMIAKKAIAKNTGARGLRAI  548

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G + VD V+VDEE+VG L++ GCG KIL+G+ G  ER   A T
Sbjct  549   LESILTEAMYEIPDVKTGIERVDAVVVDEESVGPLNSRGCGGKILRGD-GALERY-LAET  606

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
                ++++N E ++   +G+ E++SRA
Sbjct  607   KLKESQENLEVVE-LQEGETELSSRA  631


 Score =   187 bits (474),  Expect(3) = 8e-164, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL AA+F+V+AA+ G++YIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  317   TQAGYVGEDVESILYKLLAAAEFNVQAAQQGMIYIDEVDKITKKAESLNISRDVSGEGVQ  376

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  +RKH RGD+IQIDTK+ILFICGGAF+ LEKTIS+R
Sbjct  377   QALLKMLEGTIVNVPEKGSRKHPRGDNIQIDTKDILFICGGAFVDLEKTISDR  429



>ref|XP_009366893.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Pyrus x bretschneideri]
Length=707

 Score =   221 bits (564),  Expect(3) = 4e-163, Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 179/348 (51%), Gaps = 82/348 (24%)
 Frame = +3

Query  276   LGFQRRCKWE--GSSD-NYDHLKAEVNCPRCS-KPMTVLFSNRPL---------------  398
             +G Q R KW+  GS+D     ++AE NCPRCS   M +LFS+R L               
Sbjct  48    IGLQERYKWDHGGSADVRIRKIRAEANCPRCSFNRMDLLFSDRRLPNLSPSPPPPDDSTT  107

Query  399   -------------SITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGG-  536
                            +  E   YQA+NLCP+C+TA+YFRP ++ PLQG F+EIG++    
Sbjct  108   KAKAASTSATSTSGNSDSEIRQYQALNLCPNCKTAYYFRPHQIAPLQGTFVEIGRLTNTT  167

Query  537   --------------VGERENNGNTAA---GSENGKAAGK-----------IWEKLRTYSG  632
                               +NN  + +   GS NG A  +            W+ LR+Y+ 
Sbjct  168   TSSSSSSSNRSATKTNNSDNNKKSHSSRNGSNNGVADSEPNTNNNGLRVSFWDSLRSYAN  227

Query  633   N--------------NsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVKK  770
                            N  +             +   +         G    W G N+   
Sbjct  228   GADPPENWPPPPPPGNGLAVHTPPGPPFAPGVNVIRASVPPGTGDAGDKNAWGGSNLGNN  287

Query  771   LPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG--KTVDEQGN  944
             LPTPKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY AS  + +G ESG    VD    
Sbjct  288   LPTPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLKKGSGAESGIPNKVD----  343

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVI DATTLTQ
Sbjct  344   -DDDKVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVITDATTLTQ  390


 Score =   210 bits (535),  Expect(3) = 4e-163, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    + N+VV SSLLE VES+DL AYGLIPEF+GRFPI VSLS
Sbjct  501   RRQDSSIGFGAPVRANMRAGGVINSVVTSSLLELVESSDLIAYGLIPEFIGRFPILVSLS  560

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVLM+PKNAL KQYK++F +NNVKLHF +NAL++IA KA+AK+TGARGLR++
Sbjct  561   ALTEDQLVQVLMEPKNALGKQYKKLFGMNNVKLHFMENALRLIANKAMAKNTGARGLRAL  620

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G D +D V+VDEE+VG+++  GCG KI++G+ G  ER    ++
Sbjct  621   LESILTEAMYEIPDVKTGKDRIDAVVVDEESVGTVNAHGCGGKIVRGD-GALERYLHEIS  679

Query  2067  STDKAE  2084
               D  E
Sbjct  680   LKDSME  685


 Score =   195 bits (495),  Expect(3) = 4e-163, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLLMAA+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  391   AGYVGEDVESILYKLLMAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  450

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  451   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  501



>emb|CAN64542.1| hypothetical protein VITISV_013764 [Vitis vinifera]
Length=730

 Score =   231 bits (588),  Expect(3) = 4e-162, Method: Compositional matrix adjust.
 Identities = 154/353 (44%), Positives = 185/353 (52%), Gaps = 91/353 (26%)
 Frame = +3

Query  276   LGFQRRCKWE-GSSDNYD--HLKAEVNCPRCSKPMTVLFSNRPL------------SITA  410
             +G Q R KW+ G SD +    ++AE NCPRCSK M +LFSNR              S + 
Sbjct  52    IGVQERYKWDHGGSDGFQTRKIRAEANCPRCSKVMDLLFSNRHFPSNFSPAVPTDSSNSK  111

Query  411   GETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGK  590
             G  G YQAVNLCP+C+TA+YFRP K+ PLQG+F+EIG+          N N   G +N K
Sbjct  112   GSGGSYQAVNLCPNCKTAYYFRPYKIAPLQGSFVEIGRSD----YNNTNTNHPKGKDNEK  167

Query  591   AAGK----------------IWEKLRTY---------------SGNNsssdvgessstsd  677
              + K                 WE LR+Y               SGN  +         + 
Sbjct  168   KSSKNGGGHEEDYGSRLRMSFWETLRSYGGDPPENWPPPPPPPSGNGLAVHAPPGPPFAP  227

Query  678   scsssssseteveesmegsA-----GE---WTGLNVVKKLPTPKEICKGLDEFVVGQERA  833
               +   ++   V  +  G       GE   W G N+ K LPTPKEICKGLD+FV+GQERA
Sbjct  228   GVNVIRAAGPGVGGNGGGGGGNGSFGERNGWGGSNLGKDLPTPKEICKGLDKFVIGQERA  287

Query  834   KK----------------------------VLSVAVYNHYKRIYDASSTQMAGGESGKTV  929
             KK                            VLSVAVYNHYKRIY  S  + +G ESG + 
Sbjct  288   KKFSGIEVYIVEIGKWGHSFKRSNWCQTWEVLSVAVYNHYKRIYHGSLQKGSGAESGTS-  346

Query  930   DEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                   + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  347   ----EVDDDSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  395


 Score =   218 bits (556),  Expect(3) = 4e-162, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 165/207 (80%), Gaps = 2/207 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LTNAVV SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  522   RRQDSSIGFGAPVRANMRTGGLTNAVVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLS  581

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL +PKNAL KQYK++F++NNVKLHFT+ AL+ IAKKA+ K+TGARGLR++
Sbjct  582   ALTEDQLVKVLTEPKNALGKQYKKLFSMNNVKLHFTEKALRQIAKKAMVKNTGARGLRAL  641

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G D VD V+VDEE+VGS++ PGCG KIL+G+ G  +   +   
Sbjct  642   LESILTEAMYEIPDVKTGKDRVDAVVVDEESVGSVNAPGCGGKILRGD-GALDCYLAETK  700

Query  2067  STDKAEKNEEALKGDM-DGDCEVASRA  2144
               D  E   EA  G++ + + EV+SRA
Sbjct  701   LKDPVESGGEAGDGELQEAESEVSSRA  727


 Score =   174 bits (442),  Expect(3) = 4e-162, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 101/129 (78%), Gaps = 16/129 (12%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ G+VYIDEVDKITKKAESLN+ RDVSGEGVQ
Sbjct  394   TQAGYVGEDVESILYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNLSRDVSGEGVQ  453

Query  1259  QGLLKMLEGT----------------VVNVPDNRARKHSRGDSIQIDTKNILFICGGAFI  1390
             Q LLKMLEGT                +VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+
Sbjct  454   QALLKMLEGTDLKWSGYKILRGIKQXIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFV  513

Query  1391  GLEKTISER  1417
              LEKTIS+R
Sbjct  514   DLEKTISDR  522



>emb|CDY20236.1| BnaC09g30030D [Brassica napus]
Length=588

 Score =   265 bits (678),  Expect(3) = 1e-161, Method: Compositional matrix adjust.
 Identities = 143/284 (50%), Positives = 179/284 (63%), Gaps = 44/284 (15%)
 Frame = +3

Query  243   PPTTIRVIGLGLGF--QRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGE  416
             PPT+   +     F   RR  ++ S  +YD+++++VNCPRCS  M V+FSNRPLS+TA E
Sbjct  39    PPTSNTTLTTPFPFFSSRRSIYDSSGGDYDYIRSDVNCPRCSAHMLVVFSNRPLSLTARE  98

Query  417   TGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAA  596
              GIYQAVN CP C++AFYFRP KL PLQG+FIE+G+VK G    +++ +      + K  
Sbjct  99    PGIYQAVNFCPQCKSAFYFRPFKLSPLQGSFIELGKVKKGADGDDDDDDDDGDDRSWKIQ  158

Query  597   GKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVKKLP  776
             G     L+     NSS                                     N + KLP
Sbjct  159   G-----LKNEDDANSS-------------------------------------NGLVKLP  176

Query  777   TPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESD  956
             TPKEIC+GLD+FV+GQ++AKKVLSVAVYNHYKRIY AS  + +G ES   V E  +   D
Sbjct  177   TPKEICQGLDQFVIGQDKAKKVLSVAVYNHYKRIYHASKLKGSGSESVNLVMEDDDDSID  236

Query  957   FVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              VELDKSNVLL+GPTGSGKTLLAKTLAR+V+VPF IADAT+LTQ
Sbjct  237   LVELDKSNVLLLGPTGSGKTLLAKTLARIVSVPFAIADATSLTQ  280


 Score =   204 bits (520),  Expect(3) = 1e-161, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  +++ V SSLLES++S DL AYGLIPEFVGR PIFVSLS
Sbjct  393   RQHDASIGFGASVRTNMNTSGFSSSAVTSSLLESLQSEDLVAYGLIPEFVGRLPIFVSLS  452

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +P++AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  453   ALNEDQLVQVLTEPRSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  512

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAMFEVPD +  G+  +  VLVDEEAVGS+ +PGCGAKIL+G+
Sbjct  513   LESILTEAMFEVPDGKSEGSQSIKAVLVDEEAVGSVGSPGCGAKILRGD  561


 Score =   152 bits (383),  Expect(3) = 1e-161, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK++ K+ S N GRDVSGEGVQQ LL
Sbjct  283   YVGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMSMKSHSSNGGRDVSGEGVQQSLL  342

Query  1271  KMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             K+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAF+ LEKT+SER
Sbjct  343   KLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFVDLEKTVSER  393



>ref|XP_010521411.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Tarenaya hassleriana]
Length=613

 Score =   255 bits (652),  Expect(3) = 7e-161, Method: Compositional matrix adjust.
 Identities = 148/297 (50%), Positives = 185/297 (62%), Gaps = 48/297 (16%)
 Frame = +3

Query  240   PPPTTIRV-----IGLGLGFQRRCKWEGSSDN---------YDHLKAEVNCPRCSKPMTV  377
             PPP  +R        +   F R  KW GS  +         YDH++A+VNCPRCS  M V
Sbjct  41    PPPLCLRSNLIPNTQIPTSFSRH-KWHGSGGDCGGGGGGSGYDHIRADVNCPRCSAQMPV  99

Query  378   LFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENN  557
             +FSNRPLS+TA E GIYQAVN CP C+TAFYFRP KL PL+G+FIE+G VKG        
Sbjct  100   VFSNRPLSLTAREPGIYQAVNFCPKCKTAFYFRPFKLVPLEGSFIELGMVKG-------T  152

Query  558   GNTAAGSENGKAAGKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsA  737
             G+    SE+    G+ W K++ +     + +  ++                         
Sbjct  153   GDDDGVSED--VFGRRW-KMQGFRSEEGNDEEEDNEY----------------------G  187

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G+    +V+KKLPTPKEIC+ LDEFV+GQ++AKKVLSVAVYNHYKR+Y AS  + +  ES
Sbjct  188   GDREKDSVMKKLPTPKEICQKLDEFVIGQQKAKKVLSVAVYNHYKRVYHASWRKGSASES  247

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G    +  +   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  248   GNIDMDDDD-NIDLVELDKSNVLLIGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  303


 Score =   199 bits (507),  Expect(3) = 7e-161, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGAPVR+NM+ S  + A+V+S L     + DL  YGLIPEFVGR PI VSLS
Sbjct  416   RQHDASIGFGAPVRSNMTTSRFSTAIVSSLLELVESA-DLVTYGLIPEFVGRVPILVSLS  474

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQYK++F++N+V+L FT+ A +MIAKKA++K+TGARGLRS+
Sbjct  475   ALNEDQLVQVLMEPKNALGKQYKKLFSMNSVQLLFTEGATRMIAKKAMSKNTGARGLRSL  534

Query  1887  LESILTEAMFEVPDA-RPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAMFEVPD+   G+ G+  VLVDEEAVGS++TPGCGAKI++GN
Sbjct  535   LESILTEAMFEVPDSITEGSHGIRAVLVDEEAVGSVETPGCGAKIIKGN  583


 Score =   164 bits (415),  Expect(3) = 7e-161, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ A F+V+AA+ GIVYIDEVDKITKK+ S N GRDVSGEGVQQ L
Sbjct  305   GYVGEDVESILYKLLVEAGFNVDAAQRGIVYIDEVDKITKKSHSSNGGRDVSGEGVQQAL  364

Query  1268  LKMLEGTVVN--VPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+  VPD   R+  RGD IQ+DTK+ILFICGGAF+ LEKT+SER
Sbjct  365   LKLLEGTVVSVPVPDKGFRRDPRGDCIQMDTKDILFICGGAFVDLEKTVSER  416



>ref|XP_010521410.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Tarenaya hassleriana]
Length=619

 Score =   255 bits (651),  Expect(3) = 1e-160, Method: Compositional matrix adjust.
 Identities = 148/297 (50%), Positives = 185/297 (62%), Gaps = 48/297 (16%)
 Frame = +3

Query  240   PPPTTIRV-----IGLGLGFQRRCKWEGSSDN---------YDHLKAEVNCPRCSKPMTV  377
             PPP  +R        +   F R  KW GS  +         YDH++A+VNCPRCS  M V
Sbjct  41    PPPLCLRSNLIPNTQIPTSFSRH-KWHGSGGDCGGGGGGSGYDHIRADVNCPRCSAQMPV  99

Query  378   LFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENN  557
             +FSNRPLS+TA E GIYQAVN CP C+TAFYFRP KL PL+G+FIE+G VKG        
Sbjct  100   VFSNRPLSLTAREPGIYQAVNFCPKCKTAFYFRPFKLVPLEGSFIELGMVKG-------T  152

Query  558   GNTAAGSENGKAAGKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsA  737
             G+    SE+    G+ W K++ +     + +  ++                         
Sbjct  153   GDDDGVSED--VFGRRW-KMQGFRSEEGNDEEEDNEY----------------------G  187

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G+    +V+KKLPTPKEIC+ LDEFV+GQ++AKKVLSVAVYNHYKR+Y AS  + +  ES
Sbjct  188   GDREKDSVMKKLPTPKEICQKLDEFVIGQQKAKKVLSVAVYNHYKRVYHASWRKGSASES  247

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G    +  +   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  248   GNIDMDDDD-NIDLVELDKSNVLLIGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  303


 Score =   199 bits (507),  Expect(3) = 1e-160, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGAPVR+NM+ S  + A+V+S L     + DL  YGLIPEFVGR PI VSLS
Sbjct  416   RQHDASIGFGAPVRSNMTTSRFSTAIVSSLLELVESA-DLVTYGLIPEFVGRVPILVSLS  474

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQYK++F++N+V+L FT+ A +MIAKKA++K+TGARGLRS+
Sbjct  475   ALNEDQLVQVLMEPKNALGKQYKKLFSMNSVQLLFTEGATRMIAKKAMSKNTGARGLRSL  534

Query  1887  LESILTEAMFEVPDA-RPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNA  2033
             LESILTEAMFEVPD+   G+ G+  VLVDEEAVGS++TPGCGAKI++GN 
Sbjct  535   LESILTEAMFEVPDSITEGSHGIRAVLVDEEAVGSVETPGCGAKIIKGNV  584


 Score =   164 bits (415),  Expect(3) = 1e-160, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ A F+V+AA+ GIVYIDEVDKITKK+ S N GRDVSGEGVQQ L
Sbjct  305   GYVGEDVESILYKLLVEAGFNVDAAQRGIVYIDEVDKITKKSHSSNGGRDVSGEGVQQAL  364

Query  1268  LKMLEGTVVN--VPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+  VPD   R+  RGD IQ+DTK+ILFICGGAF+ LEKT+SER
Sbjct  365   LKLLEGTVVSVPVPDKGFRRDPRGDCIQMDTKDILFICGGAFVDLEKTVSER  416



>gb|KFK45073.1| hypothetical protein AALP_AA1G339900 [Arabis alpina]
Length=653

 Score =   227 bits (579),  Expect(3) = 1e-160, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 163/278 (59%), Gaps = 33/278 (12%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPL--------------SITAGETGIYQAVNLCPHCRTAF  467
             L+AE NCPRCSK M +LFSNR                S+ AG+   +Q+VN CP C+TA+
Sbjct  74    LRAEPNCPRCSKQMDLLFSNRQFPSSNLIHRDRPDDDSVVAGDKTDFQSVNFCPTCKTAY  133

Query  468   YFRPSKLEPLQGNFIEIGQVKG-------GVGERENNGNTAAGSEN--GKAAGKIWEKLR  620
              F P  + PLQG FIEIG+V+           +   + N    S N   K     W+ LR
Sbjct  134   GFNPRGVSPLQGTFIEIGRVQSPSNTISKSTRKHSKDPNRLDQSSNYRNKLRSSFWDTLR  193

Query  621   TYSGNNsssdvgessstsdscssssssetevees--megsAGEWTGLNVVKKLPTPKEIC  794
             +Y             +++ + +S+ ++  +             W G ++ +  PTPKEIC
Sbjct  194   SYGAEPPEDWSPPPPNSNIAPASNGAANVDASPLPDAVKDVSRWGGASLGRDFPTPKEIC  253

Query  795   KGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDK  974
             K LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + + +D+  N     VELDK
Sbjct  254   KWLDKFVIGQSRAKKVLSVAVYNHYKRIY---HTSMKKGSAAQPIDDDDN-----VELDK  305

Query  975   SNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             SNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  306   SNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  343


 Score =   208 bits (529),  Expect(3) = 1e-160, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+ VV SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  454   RRQDSSIGFGAPVRANMATSGVTSGVVTSSLLESVESADLTAYGLIPEFVGRFPILVSLS  513

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL +I+K+A+ K+TGARGLR++
Sbjct  514   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALGLISKQAMVKNTGARGLRAL  573

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAMFE+PDA+ G++ +D V+VDEE+ GS  + GC A+IL+G+ G  ER  S   
Sbjct  574   LETILTEAMFEIPDAKNGDERIDAVIVDEESTGSEASRGCTAEILRGD-GAFERYLSENK  632

Query  2067  STDKAE  2084
               D  E
Sbjct  633   LKDATE  638


 Score =   183 bits (465),  Expect(3) = 1e-160, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL KLL AA+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  345   GYVGEDVESILHKLLTAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  404

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  405   LKLLEGTIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  454



>ref|XP_010529709.1| PREDICTED: mitochondrial clpX-like chaperone MCX1 [Tarenaya hassleriana]
 ref|XP_010529710.1| PREDICTED: mitochondrial clpX-like chaperone MCX1 [Tarenaya hassleriana]
Length=661

 Score =   230 bits (586),  Expect(3) = 2e-160, Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 175/324 (54%), Gaps = 57/324 (18%)
 Frame = +3

Query  264   IGLGLGFQRRCKWEG---------------SSDNYDHLKAEVNCPRCSKPMTVLFSNRPL  398
             IG     Q+R KWE                SS     ++AE NCPRCSK M +LFSNR  
Sbjct  32    IGSPRRMQKRFKWEQGGGGGGGGGGGDDFPSSVTRRKIRAEANCPRCSKQMDLLFSNRQF  91

Query  399   -----------SITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGE  545
                        S  AG++  YQAVN CP C+TA+ F P  + PLQG FIEIG+V      
Sbjct  92    PYSNLHRPVDSSAGAGDSSNYQAVNFCPTCKTAYCFNPRGVSPLQGTFIEIGRVHQPTNN  151

Query  546   -------RENNGNTAAGSENGKAAGKIWEKLRTY----------------SGNNsssdvg  656
                    RE+   +   S   +     W+ LR+Y                S  N  S+  
Sbjct  152   SKSSKKSRESQLGSDNSSGRNRLRSAFWDTLRSYGTDPPEDLPSAPANGVSVRNPPSNNV  211

Query  657   essstsdscsssssseteveesmegsAGEWTGLNVVKKLPTPKEICKGLDEFVVGQERAK  836
               ++        ++ +   +     S+G W G N+ K  PTPK+IC+ LD+FV+GQ RAK
Sbjct  212   VRAAGGGGGGDGANVDAPPQPDAAESSGRWGGTNLGKDFPTPKKICEFLDKFVIGQSRAK  271

Query  837   KVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKT  1016
             KVLSVAVYNHYKRIY AS  + +G E     DE      D VEL+KSNVLLMGPTGSGKT
Sbjct  272   KVLSVAVYNHYKRIYHASVRKGSGAEP--VADE------DNVELEKSNVLLMGPTGSGKT  323

Query  1017  LLAKTLARLVNVPFVIADATTLTQ  1088
             LLAKTLARLVNVPFVIADATTLTQ
Sbjct  324   LLAKTLARLVNVPFVIADATTLTQ  347


 Score =   201 bits (511),  Expect(3) = 2e-160, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 155/192 (81%), Gaps = 1/192 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM      +A+V SSLLES+ES+DL AYGLIPEFVGRFPI VSLS
Sbjct  458   RRHDSSIGFGAPVRANMRTGGPISALVTSSLLESIESSDLIAYGLIPEFVGRFPILVSLS  517

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQY+++F++NNVKLHFT+ AL++IAK+A+ K+TGARGLR++
Sbjct  518   ALTEDQLIRVLVEPKNALGKQYRKLFSMNNVKLHFTEKALELIAKQAMVKNTGARGLRAL  577

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAM+E+PDA+ GN+  D V+VDEE+VG     GCGAKIL+G+ G  ER  +   
Sbjct  578   LENILTEAMYEIPDAKTGNERADAVVVDEESVGLEAARGCGAKILRGD-GALERHLARSK  636

Query  2067  STDKAEKNEEAL  2102
               + AE  E+A+
Sbjct  637   LKEAAESQEKAV  648


 Score =   187 bits (474),  Expect(3) = 2e-160, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL AA+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  346   TQAGYVGEDVESILYKLLTAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQ  405

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLK+LEGT+VNVP+   RKH RGD IQIDTK+ILFICGGAFI LEKTI ER
Sbjct  406   QALLKLLEGTIVNVPEKGTRKHPRGDHIQIDTKDILFICGGAFIDLEKTIVER  458



>emb|CBI16961.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   218 bits (555),  Expect(3) = 3e-160, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 165/207 (80%), Gaps = 2/207 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LTNAVV SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  354   RRQDSSIGFGAPVRANMRTGGLTNAVVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLS  413

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL +PKNAL KQYK++F++NNVKLHFT+ AL+ IAKKA+ K+TGARGLR++
Sbjct  414   ALTEDQLVKVLTEPKNALGKQYKKLFSMNNVKLHFTEKALRQIAKKAMVKNTGARGLRAL  473

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G D VD V+VDEE+VGS++ PGCG KIL+G+ G  +   +   
Sbjct  474   LESILTEAMYEIPDVKTGKDRVDAVVVDEESVGSVNAPGCGGKILRGD-GALDCYLAETK  532

Query  2067  STDKAEKNEEALKGDM-DGDCEVASRA  2144
               D  E   EA  G++ + + EV+SRA
Sbjct  533   LKDPVESGGEAGDGELQEAESEVSSRA  559


 Score =   214 bits (544),  Expect(3) = 3e-160, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 145/241 (60%), Gaps = 49/241 (20%)
 Frame = +3

Query  426   YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKI  605
             YQAVNLCP+C+TA+YFRP K+ PLQG+F+EIG   GG G  E+ G+    S         
Sbjct  32    YQAVNLCPNCKTAYYFRPYKIAPLQGSFVEIGSKNGG-GHEEDYGSRLRMS--------F  82

Query  606   WEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVKKLPTPK  785
             WE LR+Y G+   +        S +  + +                W G N+ K LPTPK
Sbjct  83    WETLRSYGGDPPENWPPPPPPPSGNGLARNG---------------WGGSNLGKDLPTPK  127

Query  786   EICKGLDEFVVGQERAKK--------------------VLSVAVYNHYKRIYDASSTQMA  905
             EICKGLD+FV+GQERAKK                    VLSVAVYNHYKRIY  S  + +
Sbjct  128   EICKGLDKFVIGQERAKKLDFIPFSDFLVRSNWCQTWEVLSVAVYNHYKRIYHGSLQKGS  187

Query  906   GGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLT  1085
             G ESG +       + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLT
Sbjct  188   GAESGTS-----EVDDDSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLT  242

Query  1086  Q  1088
             Q
Sbjct  243   Q  243


 Score =   185 bits (470),  Expect(3) = 3e-160, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  A+F+V+AA+ G+VYIDEVDKITKKAESLN+ RDVSGEGVQQ L
Sbjct  245   GYVGEDVESILYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNLSRDVSGEGVQQAL  304

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTIS+R
Sbjct  305   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISDR  354



>ref|NP_568714.4| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AED95863.1| ATP-dependent Clp protease [Arabidopsis thaliana]
Length=608

 Score =   261 bits (666),  Expect(3) = 3e-160, Method: Compositional matrix adjust.
 Identities = 147/279 (53%), Positives = 179/279 (64%), Gaps = 42/279 (15%)
 Frame = +3

Query  282   FQRRCKWEGSS--------DNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAV  437
             F RR  W+  S        D+YDH++++VNCPRCS  M V+FSNRPLS+TA E GIYQAV
Sbjct  54    FSRRI-WDSCSGGGGGGGGDDYDHIRSDVNCPRCSAQMHVIFSNRPLSLTAREPGIYQAV  112

Query  438   NLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKIW--E  611
             N C  C+TAFYFRP KL PLQG+FIE+G+VKG       + +     ++ K+  + W  +
Sbjct  113   NFCSQCKTAFYFRPFKLSPLQGSFIELGKVKG------TDDDHDDDDDDQKSFPRNWKIQ  166

Query  612   KLRTYSGNNsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVKKLPTPKEI  791
              LR+                              EE  E + G+    +V+K LPTPKEI
Sbjct  167   GLRSDEDGE----------------------DADEEEDESNGGDKEKQSVIK-LPTPKEI  203

Query  792   CKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELD  971
             C+GLDEFV+GQE+AKKVLSVAVYNHYKRIY AS  + +  ES     E  N   D VELD
Sbjct  204   CQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKKGSASESYNIDMEDDNI--DHVELD  261

Query  972   KSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             KSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  262   KSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  300


 Score =   202 bits (515),  Expect(3) = 3e-160, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNMS S L++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  413   RQHDASIGFGASVRTNMSTSGLSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  472

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +NNV+L FT+ A ++IA+KA++K+TGARGLRSI
Sbjct  473   ALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLQFTEGATRLIARKAMSKNTGARGLRSI  532

Query  1887  LESILTEAMFEVPDA-RPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAMFEVPD+   G+  +  VLVDEEAVGS+ +PGCGAKIL+G+
Sbjct  533   LESILTEAMFEVPDSITEGSQSIKAVLVDEEAVGSVGSPGCGAKILKGD  581


 Score =   154 bits (389),  Expect(3) = 3e-160, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK+T K+ S N GRDVSGEGVQQ LL
Sbjct  303   YVGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSLL  362

Query  1271  KMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             K+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  363   KLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  413



>ref|XP_006279597.1| hypothetical protein CARUB_v10026110mg [Capsella rubella]
 gb|EOA12495.1| hypothetical protein CARUB_v10026110mg [Capsella rubella]
Length=604

 Score =   264 bits (675),  Expect(3) = 8e-160, Method: Compositional matrix adjust.
 Identities = 152/297 (51%), Positives = 185/297 (62%), Gaps = 34/297 (11%)
 Frame = +3

Query  210   FSTPSRQHLPPPPTTIRVIGLGLGFQRR----CKWEGSSDNYDHLKAEVNCPRCSKPMTV  377
              S  S  H+P    +   +     F RR    C   G  D+YDH++++VNCPRCS  M +
Sbjct  30    LSVDSLPHIPLLRPSSNTLIPSSSFSRRIWDSCGGGGGGDDYDHIRSDVNCPRCSAQMHI  89

Query  378   LFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENN  557
             +FSNRPLS+TA E GIYQAVN C  CRTAFYFRP KL PLQG+FIE+G+VKG   + +++
Sbjct  90    IFSNRPLSLTAREPGIYQAVNFCSQCRTAFYFRPFKLSPLQGSFIELGKVKGTDDDHDDD  149

Query  558   GNTAAGSENGKAAGKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsA  737
              +  +   N K  G                             S    E E E+  E + 
Sbjct  150   DDQKSFPRNWKIQG---------------------------LKSDEDGEDEDEDEDETNG  182

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G     +V+K LPTPKEIC+GLDEFV+GQE+AKKVLSVAVYNHYKRIY AS  + +  ES
Sbjct  183   GGKEKQSVIK-LPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKKGSSSES  241

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G    +  N   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  242   GNLDMDDDNI--DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  296


 Score =   198 bits (504),  Expect(3) = 8e-160, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 153/192 (80%), Gaps = 5/192 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  ++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  409   RQHDASIGFGASVRTNMNTSGFSSATVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  468

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +N+V+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  469   ALNEDQLVQVLTEPKSALGKQYKKLFRMNDVQLHFTEGATRLIARKAMSKNTGARGLRSI  528

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAM  2063
             LESILTEAM+EVPD+   G+  +  VLVDEEAVGS+ T GCGAKIL+G+    + L   +
Sbjct  529   LESILTEAMYEVPDSMTEGSQSIKAVLVDEEAVGSVGTQGCGAKILKGD----DVLQQFV  584

Query  2064  TSTDKAEKNEEA  2099
               T+  EK +E 
Sbjct  585   EETESKEKRKEV  596


 Score =   153 bits (387),  Expect(3) = 8e-160, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KL + A   VE A+ GIVYIDEVDK+T K+ S N GRDVSGEGVQQ LL
Sbjct  299   YVGEDVESILYKLYVEAGCSVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSLL  358

Query  1271  KMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             K+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  359   KLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  409



>ref|XP_007019731.1| ATP-dependent clp protease ATP-binding subunit clpx isoform 2 
[Theobroma cacao]
 gb|EOY16956.1| ATP-dependent clp protease ATP-binding subunit clpx isoform 2 
[Theobroma cacao]
Length=677

 Score =   219 bits (558),  Expect(3) = 2e-158, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = +3

Query  1509  DYYFCPRRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFP  1688
             D     RRQDSSIGFGAPVR NM  + LTNA V SSLLE+VES+DL AYGLIPEF+GRFP
Sbjct  464   DKTISERRQDSSIGFGAPVRANMRATGLTNAAVTSSLLETVESSDLIAYGLIPEFIGRFP  523

Query  1689  IFVSLSALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGA  1868
             I VSLSAL E+QL+QVL +PKNAL KQYK++F++NNVKLHFT  AL++IAKKA+AK+TGA
Sbjct  524   ILVSLSALTEDQLMQVLTEPKNALGKQYKKLFSMNNVKLHFTSKALRLIAKKAMAKNTGA  583

Query  1869  RGLRSILESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSER  2048
             RGLR+ILE ILTEAM+E+PDA+ GN+ +D V+VDEE+VGS + PGCG KIL G+ G  E 
Sbjct  584   RGLRAILEGILTEAMYEIPDAKTGNNRLDAVVVDEESVGSTNIPGCGGKILCGD-GALEN  642

Query  2049  LSSAMTSTDKAEKNEEALKGDMDGDCEVASRA  2144
               +     D AE      +   +G+ EV+SRA
Sbjct  643   YFAEAKLKDSAENLASVERELQEGESEVSSRA  674


 Score =   204 bits (520),  Expect(3) = 2e-158, Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 165/292 (57%), Gaps = 51/292 (17%)
 Frame = +3

Query  330   LKAEVNCPRCS--KPMTVLFSNRPLSIT-----AGETGIYQA------------------  434
             +KAE NCPRCS   PM ++FSNR  S       AG  G  Q+                  
Sbjct  80    MKAETNCPRCSSLNPMDLVFSNRHNSFNLNFPHAGAHGDDQSDDTSSNSSGSKSTPTSTS  139

Query  435   --VNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKIW  608
               +N CP C+T ++FR   + PLQG F+EIG+ +      ++N  T++ S   +     W
Sbjct  140   TPLNFCPTCKTPYHFR---ISPLQGTFMEIGRHQ----NHKSNPKTSSASPRNRLRLSFW  192

Query  609   EKLRTYSGNNsssdvgessstsdscsss---------ssseteveesmegsAGEWTG-LN  758
             + LR+ +   +          +     +          +         +  +G W G  N
Sbjct  193   DNLRSENWPPTPPPPTPPPPGNGIAVHTPPGPPFAPGVNVIRATGPKEDHGSGAWLGGAN  252

Query  759   VVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG--KTVD  932
             + K LPTPKEICKGLD+FV+GQ RAKKVLSVAVYNHYKRIY AS  + +G E+G  +++D
Sbjct  253   LGKDLPTPKEICKGLDQFVIGQRRAKKVLSVAVYNHYKRIYHASLQKGSGAEAGSSESID  312

Query  933   EQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +      D VEL+KSNVLL+GPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  313   DD-----DKVELEKSNVLLVGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  359


 Score =   187 bits (475),  Expect(3) = 2e-158, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+VEAA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  358   TQAGYVGEDVESILYKLLSVAEFNVEAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQ  417

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ L+KTISER
Sbjct  418   QALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLDKTISER  470



>gb|EYU22682.1| hypothetical protein MIMGU_mgv1a002117mg [Erythranthe guttata]
Length=711

 Score =   217 bits (553),  Expect(3) = 4e-158, Method: Compositional matrix adjust.
 Identities = 142/356 (40%), Positives = 171/356 (48%), Gaps = 104/356 (29%)
 Frame = +3

Query  276   LGFQRRCKWEGSSDNYD-----------HLKAEVNCPRCSKPMTVLFSNRPLSIT-----  407
             +G Q R +W+  S                ++AE NCPRCSK M +LF+NR   +      
Sbjct  56    IGVQERYRWDNGSSGGSGGNDEPRQITRRIRAEANCPRCSKQMDLLFTNRSHHLIPPSPP  115

Query  408   --------------------------------------------AGETGIYQAVNLCPHC  455
                                                         AG    +QAVNLCP+C
Sbjct  116   NSDLGDAPAPPTFPNNNNIVNHNSNNNSYTNNTHDSNNPSPKDGAGGGNAFQAVNLCPNC  175

Query  456   RTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGK-----IWEKLR  620
             +TA+YFRP K+ PLQG+F+EIG+VK        N N+     + +  GK      WE LR
Sbjct  176   KTAYYFRPFKMSPLQGSFVEIGRVK------NKNSNSDKKLTDPQDNGKRLRPSFWETLR  229

Query  621   TYSG-------------NNsssdvgessstsdscsssssseteveesmegsAG-------  740
             +Y                N  +             +   +           AG       
Sbjct  230   SYGSEPPENWPSPPPSTGNGIAVHTPPGPPFAPGINVVRASGPGGGGHGTRAGVNNGDKS  289

Query  741   EWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG  920
              W G N+ KKLPTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY AS          
Sbjct  290   TWGGSNLGKKLPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHASLP--------  341

Query  921   KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +G    D V+L+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  342   -----KGLDNDDNVDLEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  392


 Score =   205 bits (522),  Expect(3) = 4e-158, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 161/206 (78%), Gaps = 0/206 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    + +A + SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  503   RRQDSSIGFGAPVRANMRAGGVIDASITSSLLESVESSDLIAYGLIPEFIGRFPILVSLS  562

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK++  +NNVKLHFT+ AL++I+ KAI+K+TGARGLR+I
Sbjct  563   ALTEDQLVQVLTEPKNALGKQYKKLLEMNNVKLHFTEKALRLISNKAISKNTGARGLRTI  622

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LES+LT+AM+E+PDAR G + VD V+VDEE+VG+ D  GCG K+L+G       L++A  
Sbjct  623   LESLLTDAMYEIPDARSGKERVDAVVVDEESVGTSDVAGCGGKLLEGEGALERYLAAAAA  682

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
               D+AE+   A     +G+ EV+SRA
Sbjct  683   LKDEAERKGAAEAELQEGESEVSSRA  708


 Score =   187 bits (476),  Expect(3) = 4e-158, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  A+F+V+AA+ G+VYIDEVDKITKKAESLN  RDVSGEGVQQ L
Sbjct  394   GYVGEDVESILYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNTSRDVSGEGVQQAL  453

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  454   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  503



>ref|XP_002893761.1| hypothetical protein ARALYDRAFT_473508 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70020.1| hypothetical protein ARALYDRAFT_473508 [Arabidopsis lyrata subsp. 
lyrata]
Length=660

 Score =   217 bits (553),  Expect(3) = 2e-157, Method: Compositional matrix adjust.
 Identities = 129/293 (44%), Positives = 162/293 (55%), Gaps = 48/293 (16%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPL-------------SITAGETGIYQAVNLCPHCRTAFY  470
             L+AE NCPRCSK M +LFSNR               S  AG+   +Q++N CP C+TA+ 
Sbjct  66    LRAEPNCPRCSKQMDLLFSNRQFPSSNLLQRPDDSDSSGAGDKTNFQSMNFCPTCKTAYG  125

Query  471   FRPSKLEPLQGNFIEIGQVKGGVG--------ERENNGNTAAG-SENGKAAGKIWEKLRT  623
             F P  + PLQG FIEIG+V+            +++++ +   G +   K     W+ LR+
Sbjct  126   FNPRGVSPLQGTFIEIGRVQSPTNAATSKSTRKQQHSKDLNQGFNYRNKLRSSFWDTLRS  185

Query  624   YSGNNsssdvgessstsdscsssssseteveesmegsAG------------------EWT  749
             Y                    S  S  +    ++  +A                    W 
Sbjct  186   YGAEPPEDWSPPPPPPPPPPPSHPSLNSSPPTTIPVNASPSTVETTSPLPDAANDVSRWG  245

Query  750   GLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTV  929
             G ++ +  PTPKEICK LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + + +
Sbjct  246   GASLGRDFPTPKEICKWLDKFVIGQTRAKKVLSVAVYNHYKRIY---HTSMKKGSAAQPI  302

Query  930   DEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             D+  N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  303   DDDDN-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  350


 Score =   210 bits (535),  Expect(3) = 2e-157, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  461   RRQDSSIGFGAPVRANMATSGVTSGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLS  520

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL++I+K+A+ K+TGARGLR++
Sbjct  521   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRAL  580

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G++ +D V+VDEE+  S  + GC AKIL+G+ G  ER  S   
Sbjct  581   LESILTEAMFEIPDDKKGDERIDAVIVDEESTSSEASRGCSAKILRGD-GAFERYLSENK  639

Query  2067  STDKAE  2084
             S D  E
Sbjct  640   SKDATE  645


 Score =   181 bits (458),  Expect(3) = 2e-157, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  352   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  411

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  412   LKLLEGTIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  461



>ref|NP_564423.3| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AAU05486.1| At1g33360 [Arabidopsis thaliana]
 gb|AAU95429.1| At1g33360 [Arabidopsis thaliana]
 gb|AEE31587.1| ATP-dependent Clp protease [Arabidopsis thaliana]
Length=656

 Score =   219 bits (557),  Expect(3) = 2e-157, Method: Compositional matrix adjust.
 Identities = 129/289 (45%), Positives = 162/289 (56%), Gaps = 44/289 (15%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPL-------------SITAGETGIYQAVNLCPHCRTAFY  470
             L+AE NCPRCSK M +LFSNR               S  AG+   +Q+VN CP C+TA+ 
Sbjct  66    LRAEPNCPRCSKQMDLLFSNRQFPSSNLLQRPDDSDSSGAGDKTNFQSVNFCPTCKTAYG  125

Query  471   FRPSKLEPLQGNFIEIGQVKGGVG-------------ERENNGNTAAG-SENGKAAGKIW  608
             F P  + PLQG FIEIG+V+                 +++++ +   G +   K     W
Sbjct  126   FNPRGVSPLQGTFIEIGRVQSPTTTTTNATTSKSTRKQQQHSKDPNQGFNYRNKLRSSFW  185

Query  609   EKLRTYSGNNsssdvgessstsdscsssssseteveesmegsA---------GEWTGLNV  761
             + LR+Y              +  + S  ++       S   ++           W G  +
Sbjct  186   DTLRSYGAEPPEDWSPPPPHSPLNSSPPNTIPVNASPSAVDTSPLPDAVNDVSRWGGAGL  245

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQG  941
              +  PTPKEICK LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + + +D+  
Sbjct  246   GRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIY---HTSMKKGSAAQPIDDDD  302

Query  942   NFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  303   N-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  346


 Score =   209 bits (532),  Expect(3) = 2e-157, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  457   RRQDSSIGFGAPVRANMATSGVTSGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLS  516

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL++I+K+A+ K+TGARGLR++
Sbjct  517   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRAL  576

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G++ +D V+VDEE+  S  + GC AKIL+G+ G  ER  S   
Sbjct  577   LESILTEAMFEIPDDKKGDERIDAVIVDEESTSSEASRGCTAKILRGD-GAFERYLSENK  635

Query  2067  STDKAE  2084
             S D  E
Sbjct  636   SKDATE  641


 Score =   180 bits (457),  Expect(3) = 2e-157, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  348   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  407

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  408   LKLLEGTIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  457



>ref|XP_006303712.1| hypothetical protein CARUB_v10011824mg [Capsella rubella]
 gb|EOA36610.1| hypothetical protein CARUB_v10011824mg [Capsella rubella]
Length=652

 Score =   218 bits (556),  Expect(3) = 6e-157, Method: Compositional matrix adjust.
 Identities = 140/336 (42%), Positives = 173/336 (51%), Gaps = 67/336 (20%)
 Frame = +3

Query  246   PTTIRVIGLGLG-------FQRRCKWE--GSSDNYD------HLKAEVNCPRCSKPMTVL  380
             P   R+  L LG        Q R K E  G  D++        L+AE NCPRCSK M +L
Sbjct  22    PLHTRLHSLELGSSSPRRRIQERFKSEQGGGGDDFPVPVTRRKLRAEPNCPRCSKQMDLL  81

Query  381   FSNRPLSITA----------------GETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFI  512
             FSNR    +                 G+   +Q+VN CP C+TA+ F P  + PLQG FI
Sbjct  82    FSNRQFPSSNLLQRPDESDSSAVDGDGDKTNFQSVNFCPTCKTAYGFNPRGVSPLQGTFI  141

Query  513   EIGQVKGGVGERENNGNTAAGSENGKAAGK---------------IWEKLRTYSGNNsss  647
             EIG+V+        N NT + S   +   K                W+ LR+Y       
Sbjct  142   EIGRVQSPT----TNNNTTSKSTRKQQHSKDTNQGFNYRNKLRSSFWDTLRSYGAEPPED  197

Query  648   dvgessstsdscsssssseteveesmegsA---------GEWTGLNVVKKLPTPKEICKG  800
                   S  ++   ++ +          ++           W G  + +  PTPKEICK 
Sbjct  198   WSPPPPSPLNASPPNNIAPATNGAVKTDTSPLPDPANDVSRWGGAGLGRDFPTPKEICKW  257

Query  801   LDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSN  980
             LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + + +D+  N     VELDKSN
Sbjct  258   LDKFVIGQSRAKKVLSVAVYNHYKRIY---HTSMKKGSAAQPIDDDDN-----VELDKSN  309

Query  981   VLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             VLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  310   VLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  345


 Score =   207 bits (528),  Expect(3) = 6e-157, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  456   RRQDSSIGFGAPVRANMATSGVTSGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLS  515

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL++PKNAL KQYK++F++NNVKLHFT+ AL +I+K+A+ K+TGARGLR++
Sbjct  516   ALTEDQLVRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALGIISKQAMVKNTGARGLRAL  575

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLS  2054
             LESILTEAMFE+PD + G++ +D V+VDEE+ GS  + GC AK+L+G+      LS
Sbjct  576   LESILTEAMFEIPDDKKGDERIDAVIVDEESTGSEASRGCIAKVLRGDGAFERYLS  631


 Score =   180 bits (456),  Expect(3) = 6e-157, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  347   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  406

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  407   LKLLEGTIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  456



>ref|XP_010461163.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
Length=665

 Score =   213 bits (541),  Expect(3) = 4e-156, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  466   RRQDSSIGFGAPVRANMATSGVTSGALTSSLLESVESADLTAYGLIPEFVGRFPILVSLS  525

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL++I+K+A+ K+TGARGLR++
Sbjct  526   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRAL  585

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G++ +D V+VDEE+ GS  + GC AK+L+G+ G  ER  S   
Sbjct  586   LESILTEAMFEIPDDKKGDERIDAVIVDEESTGSEASRGCTAKVLRGD-GAFERYLSENK  644

Query  2067  STDKAEKNEE  2096
             S D  E+  E
Sbjct  645   SKDTTEETVE  654


 Score =   211 bits (538),  Expect(3) = 4e-156, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 160/296 (54%), Gaps = 51/296 (17%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPLSITA---------GETG--------IYQAVNLCPHCR  458
             L+AE NCPRCSK M +LFSNR    ++           +G         +Q+VN CP C+
Sbjct  68    LRAEPNCPRCSKQMDLLFSNRQFPSSSLLQRPDESDSSSGDGDEDSKTSFQSVNFCPTCK  127

Query  459   TAFYFRPSKLEPLQGNFIEIGQV-------------KGGVGERENNGNTAAG-SENGKAA  596
             TA+ F P  + PLQG FIEIG+V             K    +++++ +   G +   K  
Sbjct  128   TAYGFNPRGVSPLQGTFIEIGRVQSPTTNNTTTTTSKSTRKQQQHSKDPNQGFNYRNKLR  187

Query  597   GKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegs------------AG  740
                W+ LR+Y                   ++S  +      +                  
Sbjct  188   SSFWDTLRSYGAEPPEDWSPPPPHPPHPLNASPPNNIAPATNGAVKMDPSPLPDPANDVS  247

Query  741   EWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG  920
              W G ++ +  PTPKEICK LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + 
Sbjct  248   RWGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIY---HTSMKKGSAA  304

Query  921   KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             + +D+  N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  305   QPIDDDDN-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  355


 Score =   179 bits (455),  Expect(3) = 4e-156, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  357   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  416

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  417   LKLLEGTTVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  466



>ref|XP_006415098.1| hypothetical protein EUTSA_v10007003mg [Eutrema salsugineum]
 gb|ESQ33451.1| hypothetical protein EUTSA_v10007003mg [Eutrema salsugineum]
Length=667

 Score =   217 bits (553),  Expect(3) = 6e-156, Method: Compositional matrix adjust.
 Identities = 129/294 (44%), Positives = 160/294 (54%), Gaps = 49/294 (17%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPL-------------SITAGETGIYQAVNLCPHCRTAFY  470
             L+AE NCPRCSK M +LFSNR               S  AG+   +Q+VN CP C+TA+ 
Sbjct  72    LRAEPNCPRCSKQMDLLFSNRQFPSSNLLHRPNDSDSDPAGDKTNFQSVNFCPTCKTAYG  131

Query  471   FRPSKLEPLQGNFIEIGQVKG-----------GVGERENNGNTAAGSENGKAAG------  599
             F P  + PLQG FIEIG+V+                   + N   G  N   +G      
Sbjct  132   FNPHGVSPLQGTFIEIGRVQSPTTTTTNTSRSSTRRHSKDTNQGFGCSNNLGSGYRNKLR  191

Query  600   -KIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsAG----------EW  746
                W+ LR+Y                 + S  ++       +++              +W
Sbjct  192   SSFWDTLRSYGAEPPEDWSPPPPPPPLNDSPPNNIAPASNGAVKMETSPLPDAANDVKQW  251

Query  747   TGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKT  926
              G ++ +  PTPKEIC+ LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + + 
Sbjct  252   GGASLGRDFPTPKEICQWLDKFVIGQCRAKKVLSVAVYNHYKRIY---HTSMKKGSAAQP  308

Query  927   VDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +D+  N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  309   IDDDDN-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  357


 Score =   208 bits (530),  Expect(3) = 6e-156, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVE  DLTAYGLIPEFVGRFPI VSLS
Sbjct  468   RRQDSSIGFGAPVRANMATSGVTSGAITSSLLESVEGADLTAYGLIPEFVGRFPILVSLS  527

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL MI+K A+ K+TGARGLR++
Sbjct  528   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALGMISKLAMVKNTGARGLRAL  587

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PDA+ G + +D V+VDEE+ G   + GC AKIL+G+ G  ER  +   
Sbjct  588   LESILTEAMFEIPDAKKGEERIDAVIVDEESTGPEASRGCTAKILRGD-GAFERYLNENK  646

Query  2067  STDKAE  2084
             S D  E
Sbjct  647   SKDGTE  652


 Score =   177 bits (449),  Expect(3) = 6e-156, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  359   GYVGDDVESILHKLLTVAKFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  418

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEG++VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  419   LKLLEGSIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  468



>gb|AAG51286.1|AC027035_9 CLP protease regulatory subunit CLPX, putative [Arabidopsis thaliana]
Length=650

 Score =   214 bits (544),  Expect(3) = 6e-156, Method: Compositional matrix adjust.
 Identities = 128/292 (44%), Positives = 163/292 (56%), Gaps = 44/292 (15%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPL-------------SITAGETGIYQAVNLCPHCRTAFY  470
             L+AE NCPRCSK M +LFSNR               S  AG+   +Q+VN CP C+TA+ 
Sbjct  66    LRAEPNCPRCSKQMDLLFSNRQFPSSNLLQRPDDSDSSGAGDKTNFQSVNFCPTCKTAYG  125

Query  471   FRPSKLEPLQGNFIEIGQVKGGVG-------------ERENNGNTAAG-SENGKAAGKIW  608
             F P  + PLQG FIEIG+V+                 +++++ +   G +   K     W
Sbjct  126   FNPRGVSPLQGTFIEIGRVQSPTTTTTNATTSKSTRKQQQHSKDPNQGFNYRNKLRSSFW  185

Query  609   EKLRTYSGNNsssdvgessstsdscsssssseteveesmegsA---------GEWTGLNV  761
             + LR+Y              +  + S  ++       S   ++           W G  +
Sbjct  186   DTLRSYGAEPPEDWSPPPPHSPLNSSPPNTIPVNASPSAVDTSPLPDAVNDVSRWGGAGL  245

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQ---MAGGESGKTVD  932
              +  PTPKEICK LD+FV+GQ RAKKVLSVAVYNHYKRIY  S  +   ++   S + +D
Sbjct  246   GRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKKGLVLSLIHSAQPID  305

Query  933   EQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  306   DDDN-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  352


 Score =   209 bits (531),  Expect(3) = 6e-156, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  463   RRQDSSIGFGAPVRANMATSGVTSGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLS  522

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL++I+K+A+ K+TGARGLR++
Sbjct  523   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRAL  582

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G++ +D V+VDEE+  S  + GC AKIL+G+ G  ER  S   
Sbjct  583   LESILTEAMFEIPDDKKGDERIDAVIVDEESTSSEASRGCTAKILRGD-GAFERYLSENK  641

Query  2067  STDKAE  2084
             S D  E
Sbjct  642   SKDATE  647


 Score =   180 bits (457),  Expect(3) = 6e-156, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  354   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  413

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  414   LKLLEGTIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  463



>emb|CDX93769.1| BnaA09g23690D [Brassica napus]
Length=641

 Score =   213 bits (543),  Expect(3) = 8e-156, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 154/278 (55%), Gaps = 39/278 (14%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPL-------------SITAGETGIYQAVNLCPHCRTAFY  470
             L+AE NCPRCSK M +LFSNR               S  A +T  +Q+VN CP C+TA+ 
Sbjct  68    LRAEPNCPRCSKQMDLLFSNRQFPSPNLLHRPEDSDSNVADKTS-FQSVNFCPTCKTAY-  125

Query  471   FRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSEN--GKAAGKIWEKLRTYSGNNss  644
                  + PLQG F+EIG+V+     R+ +      S N   K     W+ LR+Y      
Sbjct  126   ----GVSPLQGTFVEIGRVQSPTTTRKQHSKDLNLSSNHRNKLRSSFWDTLRSYGAEPPE  181

Query  645   sdvgessstsdscssssssetevees----------megsAGEWTGLNVVKKLPTPKEIC  794
                        + S  ++       +                 W G  +    PTPKEIC
Sbjct  182   DWSSTPPPPPLNASPPNNIAPASNGAVKMDTSPLPDAAKDVSRWGGATLGTDFPTPKEIC  241

Query  795   KGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDK  974
             K LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + +++D+  N     VELDK
Sbjct  242   KWLDKFVIGQSRAKKVLSVAVYNHYKRIY---HTSMKKGSAAQSLDDDDN-----VELDK  293

Query  975   SNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             SNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  294   SNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  331


 Score =   210 bits (535),  Expect(3) = 8e-156, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  V SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  442   RRQDSSIGFGAPVRANMATSGVTSGAVTSSLLESVESADLTAYGLIPEFVGRFPILVSLS  501

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL +I+K A+ K+TGARGLR++
Sbjct  502   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALGIISKLAMVKNTGARGLRAL  561

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PDA+ G++ +D V+VDE++ GS  + GC AK+L+G+ G  ER  +   
Sbjct  562   LESILTEAMFEIPDAKKGDERIDAVIVDEDSTGSEASRGCTAKLLRGD-GAFERYLNENK  620

Query  2067  STDKAE  2084
             S D  E
Sbjct  621   SKDATE  626


 Score =   179 bits (453),  Expect(3) = 8e-156, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  333   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  392

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH R D IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  393   LKLLEGTIVNVPGKGARKHPRADHIQIDTKDILFICGGAFVDLEKTIVDR  442



>ref|XP_010499875.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
 ref|XP_010499877.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=666

 Score =   212 bits (539),  Expect(3) = 1e-155, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  467   RRQDSSIGFGAPVRANMATSGVTSGALTSSLLESVESADLTAYGLIPEFVGRFPILVSLS  526

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL++I+K+A+ K+TGARGLR++
Sbjct  527   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRAL  586

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G++ +D V+VDEE+ GS  + GC AK+L+G+ G  ER  S   
Sbjct  587   LESILTEAMFEIPDDKKGDERIDAVIVDEESTGSEASRGCTAKVLKGD-GAFERYLSENK  645

Query  2067  STDKAEKNEE  2096
             S D  E   E
Sbjct  646   SKDATEATVE  655


 Score =   210 bits (535),  Expect(3) = 1e-155, Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 156/297 (53%), Gaps = 52/297 (18%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPLSITA-----------------GETGIYQAVNLCPHCR  458
             L+AE NCPRCSK M +LFSNR    ++                      +Q+VN CP C+
Sbjct  68    LRAEPNCPRCSKQMDLLFSNRQFPSSSLLQRPDEYDSSSGDGDGDSKTSFQSVNFCPTCK  127

Query  459   TAFYFRPSKLEPLQGNFIEIGQV-------------KGGVGERENNGNTAAG-SENGKAA  596
             TA+ F P  + PLQG FIEIG+V             K    ++ ++ +   G +   K  
Sbjct  128   TAYGFNPRGVSPLQGTFIEIGRVQSPTTNNTTTTTSKSTRKQQHHSKDPNQGFNYRNKLR  187

Query  597   GKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesm-------------egsA  737
                W+ LR+Y                    ++S        +                  
Sbjct  188   SSFWDTLRSYGAEPPEDWSPPPPPHPPHPLNASPPNNIAPATNGAVKMDPSPLPDPANDV  247

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
               W G ++ +  PTPKEICK LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G +
Sbjct  248   SRWGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYH---TSMKKGSA  304

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + +D+  N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  305   AQPIDDDDN-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  356


 Score =   179 bits (455),  Expect(3) = 1e-155, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  358   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  417

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH RGD +QIDTK+ILFICGGAF+ LEKTI +R
Sbjct  418   LKLLEGTIVNVPGKGARKHPRGDHLQIDTKDILFICGGAFVDLEKTIVDR  467



>ref|XP_009114799.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpX-like, mitochondrial [Brassica rapa]
Length=647

 Score =   211 bits (537),  Expect(3) = 4e-155, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 152/278 (55%), Gaps = 39/278 (14%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPL-------------SITAGETGIYQAVNLCPHCRTAFY  470
             L+AE NCPRCSK M +LFSNR               S  A +T  +Q+VN CP C+TA+ 
Sbjct  74    LRAEPNCPRCSKQMDLLFSNRQFPSPNLLHRPEDSDSNVADKTS-FQSVNFCPTCKTAY-  131

Query  471   FRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSEN--GKAAGKIWEKLRTYSGNNss  644
                  + PLQG FI IG+V+     R+ +      S N   K     W+ LR+Y      
Sbjct  132   ----GVSPLQGTFIXIGRVQSPTTARKQHSKDLNLSSNHRNKLRSSFWDTLRSYGAEPPE  187

Query  645   sdvgessstsdscssssssetevees----------megsAGEWTGLNVVKKLPTPKEIC  794
                        + S  ++       +                 W G  +    PTPKEIC
Sbjct  188   DWSSTPPPPPLNASPPNNIAPASNGAVKMDTSPLPDAAKDVSRWGGATLGTDFPTPKEIC  247

Query  795   KGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDK  974
             K LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + + +D+  N     VELDK
Sbjct  248   KWLDKFVIGQSRAKKVLSVAVYNHYKRIY---HTSMKKGSAAQPLDDDDN-----VELDK  299

Query  975   SNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             SNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  300   SNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  337


 Score =   210 bits (535),  Expect(3) = 4e-155, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  V SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  448   RRQDSSIGFGAPVRANMATSGVTSGAVTSSLLESVESADLTAYGLIPEFVGRFPILVSLS  507

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL +I+K A+ K+TGARGLR++
Sbjct  508   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALGIISKLAMVKNTGARGLRAL  567

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PDA+ G++ +D V+VDE++ GS  + GC AK+L+G+ G  ER  +   
Sbjct  568   LESILTEAMFEIPDAKKGDERIDAVIVDEDSTGSEASRGCTAKLLRGD-GAFERYLNENK  626

Query  2067  STDKAE  2084
             S D  E
Sbjct  627   SKDATE  632


 Score =   179 bits (453),  Expect(3) = 4e-155, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  339   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  398

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH R D IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  399   LKLLEGTIVNVPGKGARKHPRADHIQIDTKDILFICGGAFVDLEKTIVDR  448



>ref|XP_004512653.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Cicer arietinum]
Length=714

 Score =   231 bits (589),  Expect(3) = 7e-155, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 182/356 (51%), Gaps = 92/356 (26%)
 Frame = +3

Query  276   LGFQRRCKWE--GSSDNYDH-----LKAEVNCPRCSKPMTVLFSNRPLSIT---------  407
             +G Q R KW+  GS D+  H     ++AE NCPRC+K M + FSNR    T         
Sbjct  62    IGVQERYKWDRGGSDDSNTHNPTRKIRAEANCPRCTKDMNLFFSNRQFPSTTDSDCGGGG  121

Query  408   -----------------AGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGG  536
                               GE+G YQAVNLCP+C+TA+YFRP    PLQG F+EIG+V G 
Sbjct  122   GGGGGGGGGSNLDPNGGGGESG-YQAVNLCPNCKTAYYFRPYNTSPLQGTFVEIGRVSGS  180

Query  537   --------VGERENNGNTAAGSE--------------------NGKAAG----KIWEKLR  620
                     +  R ++G    G+                      G A+      +W+ LR
Sbjct  181   NNNGVNSKLSRRVSHGKDGGGNSNSNSISNSIKNGNGGEDFGLKGSASNWLEVSLWDTLR  240

Query  621   TYSGNNsssdvgessstsdscsssssseteveesmegsAG--------------------  740
             +Y+G N+               + +            + G                    
Sbjct  241   SYNGGNNGEPPETWPPPVGGGGNGNGLAVHTPPGPPFAPGINVIRAPREGGSGGVNGEKN  300

Query  741   EWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG  920
              W G N+ K LPTPKEICKGLD+FV+GQ RAKKVLSVAVYNHYKRIY A+  + +G +S 
Sbjct  301   TWGGSNLGKDLPTPKEICKGLDKFVIGQGRAKKVLSVAVYNHYKRIYHATLPKGSGLDSE  360

Query  921   KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                D++       VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  361   VLDDDEA------VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  410


 Score =   208 bits (529),  Expect(3) = 7e-155, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 162/206 (79%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+R NM    + ++ V SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  509   RRQDSSIGFGAPIRANMRSGRIIDSAVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLS  568

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E QL+QV  +PKNAL KQYK++F++NNVKLH+T+ AL+++AKKA+AK+TGARGLR++
Sbjct  569   ALTEEQLMQVFTEPKNALGKQYKKLFSMNNVKLHYTEQALRLVAKKAMAKNTGARGLRAL  628

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILT+AMFE+PD + G+D VD V+VDEE+VGSL+ PGCG KIL+G+    + L+    
Sbjct  629   LENILTDAMFEIPDNKSGSDRVDAVVVDEESVGSLNAPGCGGKILRGDGALEQYLAKTKD  688

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S    E  +  L+   + D +++SRA
Sbjct  689   SMVNVEVAQSELQ---ERDSDISSRA  711


 Score =   160 bits (404),  Expect(3) = 7e-155, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 89/110 (81%), Gaps = 12/110 (11%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL KLL AADF+V AA+ GI+YIDEVDKITKKAESLNI RDVSGEG     
Sbjct  412   GYVGEDVESILHKLLSAADFNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEG-----  466

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
                    +VNVP+  ARKH RGD+IQ+DTKNILFICGGAFI LEKTISER
Sbjct  467   -------IVNVPEKGARKHPRGDNIQMDTKNILFICGGAFIDLEKTISER  509



>ref|XP_007019730.1| ATP-dependent clp protease ATP-binding subunit clpx isoform 1 
[Theobroma cacao]
 gb|EOY16955.1| ATP-dependent clp protease ATP-binding subunit clpx isoform 1 
[Theobroma cacao]
Length=703

 Score =   219 bits (557),  Expect(3) = 3e-154, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = +3

Query  1509  DYYFCPRRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFP  1688
             D     RRQDSSIGFGAPVR NM  + LTNA V SSLLE+VES+DL AYGLIPEF+GRFP
Sbjct  490   DKTISERRQDSSIGFGAPVRANMRATGLTNAAVTSSLLETVESSDLIAYGLIPEFIGRFP  549

Query  1689  IFVSLSALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGA  1868
             I VSLSAL E+QL+QVL +PKNAL KQYK++F++NNVKLHFT  AL++IAKKA+AK+TGA
Sbjct  550   ILVSLSALTEDQLMQVLTEPKNALGKQYKKLFSMNNVKLHFTSKALRLIAKKAMAKNTGA  609

Query  1869  RGLRSILESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSER  2048
             RGLR+ILE ILTEAM+E+PDA+ GN+ +D V+VDEE+VGS + PGCG KIL G+ G  E 
Sbjct  610   RGLRAILEGILTEAMYEIPDAKTGNNRLDAVVVDEESVGSTNIPGCGGKILCGD-GALEN  668

Query  2049  LSSAMTSTDKAEKNEEALKGDMDGDCEVASRA  2144
               +     D AE      +   +G+ EV+SRA
Sbjct  669   YFAEAKLKDSAENLASVERELQEGESEVSSRA  700


 Score =   204 bits (519),  Expect(3) = 3e-154, Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 165/292 (57%), Gaps = 51/292 (17%)
 Frame = +3

Query  330   LKAEVNCPRCS--KPMTVLFSNRPLSIT-----AGETGIYQA------------------  434
             +KAE NCPRCS   PM ++FSNR  S       AG  G  Q+                  
Sbjct  80    MKAETNCPRCSSLNPMDLVFSNRHNSFNLNFPHAGAHGDDQSDDTSSNSSGSKSTPTSTS  139

Query  435   --VNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKIW  608
               +N CP C+T ++FR   + PLQG F+EIG+ +      ++N  T++ S   +     W
Sbjct  140   TPLNFCPTCKTPYHFR---ISPLQGTFMEIGRHQ----NHKSNPKTSSASPRNRLRLSFW  192

Query  609   EKLRTYSGNNsssdvgessstsdscsss---------ssseteveesmegsAGEWTG-LN  758
             + LR+ +   +          +     +          +         +  +G W G  N
Sbjct  193   DNLRSENWPPTPPPPTPPPPGNGIAVHTPPGPPFAPGVNVIRATGPKEDHGSGAWLGGAN  252

Query  759   VVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG--KTVD  932
             + K LPTPKEICKGLD+FV+GQ RAKKVLSVAVYNHYKRIY AS  + +G E+G  +++D
Sbjct  253   LGKDLPTPKEICKGLDQFVIGQRRAKKVLSVAVYNHYKRIYHASLQKGSGAEAGSSESID  312

Query  933   EQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +      D VEL+KSNVLL+GPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  313   DD-----DKVELEKSNVLLVGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  359


 Score =   174 bits (441),  Expect(3) = 3e-154, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 101/139 (73%), Gaps = 26/139 (19%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLL--------------------------MAADFDVEAAEHGIVY  1180
                GYVGEDVESIL+KLL                            A+F+VEAA+ G+VY
Sbjct  358   TQAGYVGEDVESILYKLLSYDEGEGRQTSGSRHLLPTNETSIPQFVAEFNVEAAQQGMVY  417

Query  1181  IDEVDKITKKAESLNIGRDVSGEGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKN  1360
             IDEVDKITKKAESLNI RDVSGEGVQQ LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+
Sbjct  418   IDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKD  477

Query  1361  ILFICGGAFIGLEKTISER  1417
             ILFICGGAF+ L+KTISER
Sbjct  478   ILFICGGAFVDLDKTISER  496



>ref|XP_010252309.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nelumbo nucifera]
Length=678

 Score =   239 bits (611),  Expect(3) = 4e-154, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 169/204 (83%), Gaps = 5/204 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LTNA V SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  474   RRQDSSIGFGAPVRANMRTGGLTNAAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLS  533

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E QLVQVL +PKNAL KQYK+MF++NNVKLHFTDNAL++IAKKA+AKSTGARGLR+I
Sbjct  534   ALNEGQLVQVLKEPKNALGKQYKKMFSMNNVKLHFTDNALRLIAKKAMAKSTGARGLRAI  593

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + GND VD V++DEEAVGS+D PG GAKIL+G+ G  ER      
Sbjct  594   LESILTEAMYEIPDVKTGNDRVDAVVIDEEAVGSVDAPGLGAKILRGD-GALER----YL  648

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S  K+E N E  +G+++G+ EV+S
Sbjct  649   SETKSEGNGEVAEGEIEGESEVSS  672


 Score =   189 bits (481),  Expect(3) = 4e-154, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  362   TQAGYVGEDVESILYKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQ  421

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  422   QALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  474


 Score =   168 bits (425),  Expect(3) = 4e-154, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 93/115 (81%), Gaps = 3/115 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K  PTPKEICK LD+FV+GQ+RAKKVLSVAVYNHYKRIY AS  + +G E G 
Sbjct  252   WGGSNLGKDFPTPKEICKNLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLQKGSGAEPGN  311

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  E    + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  312   SEAEN---DDDSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  363


 Score =   135 bits (341),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 89/132 (67%), Gaps = 12/132 (9%)
 Frame = +3

Query  276  LGFQRRCKWEGSSDNYD--HLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCP  449
            +G+Q R KWEG SD++    ++AE NCPRCSK M +LFSNR   I   + G YQAVNLCP
Sbjct  59   IGYQERHKWEGGSDDFQTRKIRAEANCPRCSKQMDLLFSNRHPPIYGADRGSYQAVNLCP  118

Query  450  HCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGK---------  602
            +C+TA+YFRPSK+ PLQG+FIEIG+V+GG    + + +   GS NG A G+         
Sbjct  119  NCKTAYYFRPSKIAPLQGSFIEIGRVRGGKDSEKKSVSGDGGSGNGDATGEDDYGNRLRI  178

Query  603  -IWEKLRTYSGN  635
              WE LR++SG+
Sbjct  179  SFWETLRSFSGD  190



>ref|XP_011095003.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpX-like, mitochondrial [Sesamum indicum]
Length=715

 Score =   214 bits (546),  Expect(3) = 1e-153, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    + +A V SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  508   RRQDSSIGFGAPVRANMRAGGVIDAAVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLS  567

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVLM+PKNAL KQYK++F +NNVKLHFT+ AL++I+ KA+ K+TGARGLR+I
Sbjct  568   ALTEDQLVQVLMEPKNALGKQYKKLFKMNNVKLHFTEKALRLISNKAMTKNTGARGLRAI  627

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++LT+AM+E+PDA+ G D VD V++D+E+VG ++ PGCG KIL+G+ G  ER  +   
Sbjct  628   LENLLTDAMYEIPDAKTGKDRVDAVVIDDESVGKINEPGCGGKILRGD-GALERYLAEAN  686

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
               D+AE+N  A     +G+ EV SRA
Sbjct  687   FKDQAEENGAAEAELQEGELEVTSRA  712


 Score =   210 bits (535),  Expect(3) = 1e-153, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 146/242 (60%), Gaps = 33/242 (14%)
 Frame = +3

Query  426   YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGK-  602
             +QAVNLCP+C+TA+YFRP K+ PLQG+FIEIG+VK        N  +   S + +  GK 
Sbjct  173   FQAVNLCPNCKTAYYFRPFKMSPLQGSFIEIGRVK------SRNSGSEKKSTDPQDYGKR  226

Query  603   ----IWEKLRTYSG-------------NNsssdvgessstsdscsssssseteveesmeg  731
                  WE LR+Y G              N  +             +   +          
Sbjct  227   LRPSFWETLRSYGGEPPENWPPHPPPSGNGIAVHTPPGPPFAPGVNVIRASGGNGTRSGV  286

Query  732   sAGE---WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQM  902
             + GE   W G N+ K LPTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY AS  + 
Sbjct  287   NNGEKSTWGGSNLGKNLPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHASLHK-  345

Query  903   AGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTL  1082
                  G  V+     + D V+L+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTL
Sbjct  346   -----GSEVEPSTLDDDDNVDLEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTL  400

Query  1083  TQ  1088
             TQ
Sbjct  401   TQ  402


 Score =   170 bits (430),  Expect(3) = 1e-153, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 5/110 (5%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  A+F+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEG     
Sbjct  404   GYVGEDVESILYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGXS---  460

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
               MLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  461   --MLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  508



>gb|AAG51217.1|AC051630_14 CLP protease regulatory subunit CLPX, putative; 15869-19379 [Arabidopsis 
thaliana]
Length=670

 Score =   209 bits (531),  Expect(3) = 3e-153, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  483   RRQDSSIGFGAPVRANMATSGVTSGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLS  542

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL++I+K+A+ K+TGARGLR++
Sbjct  543   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRAL  602

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G++ +D V+VDEE+  S  + GC AKIL+G+ G  ER  S   
Sbjct  603   LESILTEAMFEIPDDKKGDERIDAVIVDEESTSSEASRGCTAKILRGD-GAFERYLSENK  661

Query  2067  STDKAE  2084
             S D  E
Sbjct  662   SKDATE  667


 Score =   204 bits (520),  Expect(3) = 3e-153, Method: Compositional matrix adjust.
 Identities = 127/312 (41%), Positives = 162/312 (52%), Gaps = 64/312 (21%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPL-------------SITAGETGIYQAVNLCPHCRTAFY  470
             L+AE NCPRCSK M +LFSNR               S  AG+   +Q+VN CP C+TA+ 
Sbjct  66    LRAEPNCPRCSKQMDLLFSNRQFPSSNLLQRPDDSDSSGAGDKTNFQSVNFCPTCKTAYG  125

Query  471   FRPSKLEPLQGNFIEIGQVKGGVG-------------ERENNGNTAAG-SENGKAAGKIW  608
             F P  + PLQG FIEIG+V+                 +++++ +   G +   K     W
Sbjct  126   FNPRGVSPLQGTFIEIGRVQSPTTTTTNATTSKSTRKQQQHSKDPNQGFNYRNKLRSSFW  185

Query  609   EKLRTYSGNNsssdvgessstsdscsssssseteveesmegsA---------GEWTGLNV  761
             + LR+Y              +  + S  ++       S   ++           W G  +
Sbjct  186   DTLRSYGAEPPEDWSPPPPHSPLNSSPPNTIPVNASPSAVDTSPLPDAVNDVSRWGGAGL  245

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQ--------------  899
              +  PTPKEICK LD+FV+GQ RAKKVLSVAVYNHYKRIY  S  +              
Sbjct  246   GRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKKGLLHDSDALSPFNP  305

Query  900   ---------MAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNV  1052
                      +    + + +D+  N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNV
Sbjct  306   LWFTLILWTLNPRSAAQPIDDDDN-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNV  360

Query  1053  PFVIADATTLTQ  1088
             PFVIADATTLTQ
Sbjct  361   PFVIADATTLTQ  372


 Score =   180 bits (457),  Expect(3) = 3e-153, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  374   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  433

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  434   LKLLEGTIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  483



>ref|XP_008788320.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Phoenix dactylifera]
 ref|XP_008788321.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Phoenix dactylifera]
Length=671

 Score =   233 bits (595),  Expect(3) = 5e-150, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 169/206 (82%), Gaps = 7/206 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NMS   LTN VV SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  470   RRHDSSIGFGAPVRANMSTGGLTNLVVTSSLLESVESSDLVAYGLIPEFIGRFPILVSLS  529

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QL QVL +PKNAL KQYK++F++NNVKLHFT  AL++IAKKA+ K+TGARGLR+I
Sbjct  530   ALNEDQLFQVLTEPKNALGKQYKKLFSMNNVKLHFTKAALRLIAKKAMEKNTGARGLRAI  589

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + GN+ VD V+VDEEA+GSLD PGCGAKILQG+      L     
Sbjct  590   LESILTEAMYEIPDMKTGNERVDGVVVDEEAIGSLDRPGCGAKILQGDGALEHYLLQ---  646

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
               +KA+ N+  L+GD++G+ E+ASRA
Sbjct  647   --NKADTNQ--LEGDLEGETELASRA  668


 Score =   186 bits (473),  Expect(3) = 5e-150, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  ADF+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  358   TQAGYVGEDVESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQ  417

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH R D IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  418   QALLKMLEGTIVNVPEKGARKHPRNDHIQIDTKDILFICGGAFVDLEKTISER  470


 Score =   163 bits (412),  Expect(3) = 5e-150, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 95/120 (79%), Gaps = 11/120 (9%)
 Frame = +3

Query  741   EWTG-LNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             EW G  N+ K LPTPKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY AS  + +  + 
Sbjct  247   EWGGGSNLGKDLPTPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLQKGSAADP  306

Query  918   GK---TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             GK    +D       D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  307   GKLEVKID-------DHVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  359


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 9/101 (9%)
 Frame = +3

Query  285  QRRCKWEGSSDNYD-----HLKAEVNCPRCSKPMTVLFSN----RPLSITAGETGIYQAV  437
            Q R KWEG     +      ++AE +CPRCS+ M VLFS+     P   ++   G +QAV
Sbjct  60   QERNKWEGGGGPDEPTPTRRIRAEAHCPRCSRHMQVLFSHGPSPPPAPASSNRGGGFQAV  119

Query  438  NLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNG  560
            N+CP+C+TAFYFRP +L PLQG+F+EIG+V+    E+E  G
Sbjct  120  NICPNCKTAFYFRPHRLVPLQGSFVEIGRVRRDTPEKEKGG  160



>ref|XP_010908120.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Elaeis guineensis]
Length=670

 Score =   228 bits (581),  Expect(3) = 9e-149, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 168/206 (82%), Gaps = 7/206 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    LTNAVVASSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  469   RRHDSSIGFGAPVRANMRTGWLTNAVVASSLLESVESSDLIAYGLIPEFIGRFPILVSLS  528

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQYK++F++NNVKLH T+ AL+ IAKKA+ K+TGARGLR+I
Sbjct  529   ALNEDQLVQVLTEPKNALGKQYKKLFSMNNVKLHVTEAALREIAKKAMVKNTGARGLRAI  588

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LES LTEAM+E+PD + G + VD V+VDEEA+GSLD PGCGAKILQG+      LS    
Sbjct  589   LESTLTEAMYEIPDVKTGTERVDAVVVDEEAIGSLDRPGCGAKILQGDGALEHYLSQ---  645

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
               +KA+ N+  L+GD+ GD ++ASRA
Sbjct  646   --NKADANQ--LEGDLVGDRDLASRA  667


 Score =   187 bits (475),  Expect(3) = 9e-149, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  359   AGYVGEDVESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  418

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH R D IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  419   LLKMLEGTIVNVPEKGARKHPRNDHIQIDTKDILFICGGAFVDLEKTISER  469


 Score =   163 bits (413),  Expect(3) = 9e-149, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 94/120 (78%), Gaps = 11/120 (9%)
 Frame = +3

Query  741   EWTG-LNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             EW G  N+ K LPTPKEICKGLD FV+GQ+RAKKVLSVAVYNHYKRIY AS       + 
Sbjct  246   EWCGGSNLGKDLPTPKEICKGLDTFVIGQQRAKKVLSVAVYNHYKRIYHASL------QK  299

Query  918   GKTVDEQGNFES---DFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G   D  GN E+   D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  300   GSAADP-GNLEAKIDDHVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  358


 Score = 95.5 bits (236),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 68/107 (64%), Gaps = 15/107 (14%)
 Frame = +3

Query  255  IRVIGLG-----LGFQRRCKWEGSSDNYD-----HLKAEVNCPRCSKPMTVLFSNRPLSI  404
            I V+ +G     L  Q R KWEG     +      ++AE +CPRCSK M VLFS+RP   
Sbjct  45   IAVVAVGGRRRELHRQERHKWEGGGGPEEPPQTLRIRAEAHCPRCSKHMEVLFSHRPPPP  104

Query  405  -----TAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
                 T+   G +QAVN+CP+CRTAFYFRP +L PLQG+F+EIG+V+
Sbjct  105  PPAPATSDRGGGFQAVNICPNCRTAFYFRPHRLVPLQGSFVEIGRVR  151



>ref|XP_006376103.1| hypothetical protein POPTR_0013s09570g [Populus trichocarpa]
 gb|ERP53900.1| hypothetical protein POPTR_0013s09570g [Populus trichocarpa]
Length=715

 Score =   216 bits (551),  Expect(3) = 2e-148, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 163/207 (79%), Gaps = 8/207 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA + SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  513   RRQDSSIGFGAPVRANMRAGGVTNAAITSSLLESVESADLIAYGLIPEFIGRFPILVSLA  572

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VLM+P+NAL KQYK++F++NNVKLHFTD AL++IAKKA+AK+TGARGLRSI
Sbjct  573   ALTEDQLVKVLMEPRNALGKQYKKLFSMNNVKLHFTDKALRLIAKKAMAKNTGARGLRSI  632

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G+D VD V++DEE+VGS+  PG G KIL+G+      L+    
Sbjct  633   LESILTEAMYEIPDIKTGSDRVDAVVIDEESVGSVHAPGSGGKILRGDGALEHYLAEYKD  692

Query  2067  STDKAEKNEEALKGDM-DGDCEVASRA  2144
             +        EA  G++ D + EV+SRA
Sbjct  693   TV-------EAADGELQDAESEVSSRA  712


 Score =   192 bits (487),  Expect(3) = 2e-148, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AA+F+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  403   AGYVGEDVESILYKLLSAAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  462

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  463   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKNILFICGGAFVDLEKTISER  513


 Score =   170 bits (430),  Expect(3) = 2e-148, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 98/117 (84%), Gaps = 7/117 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G N+ K+LPTPKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKR+Y +S  +  G ESG 
Sbjct  291   WGGSNLGKELPTPKEICKGLDKFVIGQDRAKKVLSVAVYNHYKRVYHSSLRKGPGAESGT  350

Query  921   -KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + +D++ N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  351   LEAIDDEDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  402


 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 75/174 (43%), Gaps = 54/174 (31%)
 Frame = +3

Query  276  LGFQRRCKWEGSSD--NYDHLKAEVNCPRCSKPMTVLFSNRPLSITA-------------  410
            +G Q R KWE S D  N   ++AE NCPRCSK M VLFSNR    +              
Sbjct  55   IGIQERYKWENSKDDSNVRKIRAEANCPRCSKHMDVLFSNRSFVFSNNSNLDHHHHHHLS  114

Query  411  ------------------------GETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEI  518
                                    G    YQAVN CP+C+TA+YFRP K+ PLQG+F+EI
Sbjct  115  RNNDTANNNTNNTTTADTGACNGNGHNNNYQAVNFCPNCKTAYYFRPDKIAPLQGSFVEI  174

Query  519  GQVKGGVGERENNGNTAAGSENGKAAG---------------KIWEKLRTYSGN  635
            G++      +  N     GS  G+                    WE LR+Y G+
Sbjct  175  GRISNKGNGKNGNKGGKEGSNGGEEGADYANVTNTINNRLRVSFWETLRSYGGD  228



>ref|XP_009616314.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nicotiana tomentosiformis]
Length=693

 Score =   223 bits (569),  Expect(3) = 2e-148, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA V SSLLESVES+D  +YGLIPEF+GRFPI VSLS
Sbjct  486   RRQDSSIGFGAPVRANMRTGGVTNATVTSSLLESVESSDFISYGLIPEFIGRFPILVSLS  545

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNALCKQYK++F++NN KLHFT+ AL++IAKKA+AK+TGARGLR+I
Sbjct  546   ALTEDQLVQVLTEPKNALCKQYKKLFSMNNTKLHFTEGALRLIAKKAMAKNTGARGLRAI  605

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILT+AM+E+PD + G+D VD ++VDEE+VG+++ PGCG K+L+G+ G  +R  +   
Sbjct  606   LESILTDAMYEIPDVKAGDDRVDAIVVDEESVGAVNAPGCGGKVLRGD-GALQRYLAQAH  664

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S D+ E +  A     +G+ EV+SRA
Sbjct  665   SVDQRENHGMAETELQEGESEVSSRA  690


 Score =   186 bits (472),  Expect(3) = 2e-148, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ G++YIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  374   TQAGYVGEDVESILYKLLTVAEFNVQAAQQGMIYIDEVDKITKKAESLNISRDVSGEGVQ  433

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+   RKH RGD IQIDTK+ILFICGGAFI LEKTISER
Sbjct  434   QALLKMLEGTIVNVPEKGQRKHPRGDHIQIDTKDILFICGGAFIDLEKTISER  486


 Score =   169 bits (427),  Expect(3) = 2e-148, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 93/115 (81%), Gaps = 6/115 (5%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LPTPKEICKGLD+FV+GQERAKKVLSV VYNHYKRIY AS  + +G ES +
Sbjct  267   WGGSNLGKNLPTPKEICKGLDKFVIGQERAKKVLSVGVYNHYKRIYHASLQKGSGAESAR  326

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E+       VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  327   DDSEEN------VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  375


 Score =   115 bits (287),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 83/152 (55%), Gaps = 39/152 (26%)
 Frame = +3

Query  276  LGFQRRCKWE--GSSDNYD----HLKAEVNCPRCSKPMTVLFSNR---------------  392
            +G Q R KW+  GSSD Y      ++AE  CPRCSK M +LF+NR               
Sbjct  63   IGVQARYKWDRGGSSDEYRTSPRRIRAEAYCPRCSKHMDLLFTNRNHHLIPPPTNDDDKT  122

Query  393  -------------PLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
                          L   AG  G YQAVNLCP+C+TA+YFRP+K+ PLQG+F EIG+VKG
Sbjct  123  NNSNENSAAAAASNLKSEAGAGGPYQAVNLCPNCKTAYYFRPNKMAPLQGSFFEIGRVKG  182

Query  534  -GVGERENNGNTAAGSENGKAAGKIWEKLRTY  626
             G G+R NN +     EN +     WE L++Y
Sbjct  183  NGNGKRMNNSD----EENKRPRPSFWESLKSY  210



>ref|XP_009781367.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Nicotiana sylvestris]
Length=694

 Score =   222 bits (565),  Expect(3) = 4e-148, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA V SSLLESVES+D  +YGLIPEF+GRFPI V+LS
Sbjct  487   RRQDSSIGFGAPVRANMRTGGVTNATVTSSLLESVESSDFISYGLIPEFIGRFPILVNLS  546

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNALCKQYK++F++NN KLHFT+ AL++IA+KA+AK+TGARGLR+I
Sbjct  547   ALTEDQLVQVLTEPKNALCKQYKKLFSMNNTKLHFTEGALRLIAEKAMAKNTGARGLRAI  606

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILT+AM+E+PD + G+D VD ++VDEE+VG+++ PGCG K+L+G+ G  +R  +   
Sbjct  607   LESILTDAMYEIPDVKAGDDRVDAIVVDEESVGAVNAPGCGGKVLRGD-GALQRYLAQAH  665

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S ++ E N  A     +G+ EV+SRA
Sbjct  666   SVNQRENNGMAETELQEGESEVSSRA  691


 Score =   186 bits (471),  Expect(3) = 4e-148, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ G++YIDEVDKITKKAESLN+ RDVSGEGVQ
Sbjct  375   TQAGYVGEDVESILYKLLTVAEFNVQAAQQGMIYIDEVDKITKKAESLNVSRDVSGEGVQ  434

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+   RKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  435   QALLKMLEGTIVNVPEKGQRKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  487


 Score =   169 bits (428),  Expect(3) = 4e-148, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 93/115 (81%), Gaps = 6/115 (5%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LPTPKEICKGLD+FV+GQERAKKVLSV VYNHYKRIY AS  + +G ES +
Sbjct  268   WGGSNLGKNLPTPKEICKGLDKFVIGQERAKKVLSVGVYNHYKRIYHASLQKGSGAESAR  327

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E+       VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  328   DDSEEN------VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  376


 Score =   116 bits (291),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 84/154 (55%), Gaps = 39/154 (25%)
 Frame = +3

Query  276  LGFQRRCKWE--GSSDNYD----HLKAEVNCPRCSKPMTVLFSNRP--------------  395
            +G Q R KW+  GSSD Y      ++AE  CPRCSK M +LF+NR               
Sbjct  64   IGVQERYKWDRGGSSDEYRTSTRRIRAEAYCPRCSKHMDLLFTNRNHHLIPPPTNDEDKT  123

Query  396  --------------LSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
                          L   AG  G YQAVNLCP+C+TA+YFRP+K+ PLQG+F EIG+VKG
Sbjct  124  NNSNENSAAGAASNLKNEAGAGGPYQAVNLCPNCKTAYYFRPNKMAPLQGSFFEIGRVKG  183

Query  534  -GVGERENNGNTAAGSENGKAAGKIWEKLRTYSG  632
             G G+R NN +     EN +     WE L++Y G
Sbjct  184  NGNGKRMNNSD----EENKRLRPSFWESLKSYGG  213



>ref|XP_006587384.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X1 [Glycine max]
 ref|XP_006587385.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X2 [Glycine max]
Length=713

 Score =   221 bits (564),  Expect(3) = 1e-147, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 162/206 (79%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T++ V SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  508   RRQDSSIGFGAPVRANMRAVGITDSAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLS  567

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL  VL +PKNAL KQYK++F++NNVKLHFT+NAL++IAKKA+AK+TGARGLR++
Sbjct  568   ALTEDQLTMVLTEPKNALGKQYKKLFSMNNVKLHFTENALRLIAKKAMAKNTGARGLRAL  627

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G+D VD V++DEE+VGSL  PGCG KIL G+    + L+    
Sbjct  628   LESILTEAMFEIPDIKTGSDRVDAVVIDEESVGSLTAPGCGGKILHGDGALKQYLAKMKD  687

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S    +  E  L+   +GD E++SRA
Sbjct  688   SAVNVDVGESDLQ---EGDLELSSRA  710


 Score =   191 bits (485),  Expect(3) = 1e-147, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+AADF+V AA+ GI+YIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  399   GYVGEDVESILYKLLVAADFNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQAL  458

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARK+ RGD+IQ+DTKNILFICGGAFI LEKTISER
Sbjct  459   LKMLEGTIVNVPEKGARKNPRGDNIQMDTKNILFICGGAFIDLEKTISER  508


 Score =   162 bits (411),  Expect(3) = 1e-147, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 7/117 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G N+ K  P+PKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY A+  + +  +SG 
Sbjct  286   WGGSNLGKDFPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHATLQKGSAADSGA  345

Query  921   -KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + +D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  346   SEVLDDDDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  397


 Score = 95.9 bits (237),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 11/95 (12%)
 Frame = +3

Query  276  LGFQRRCKWE-GSSDNYD--HLKAEVNCPRCSKPMTVLFSNRPLSITAGETGI-------  425
            +G Q R KW+ G SD+     ++AE NCPRC+K M ++FSNR       E+ +       
Sbjct  52   VGVQERYKWDRGGSDDTSSRKIRAEANCPRCTKDMNLVFSNRHFPTPQIESELGGGEREK  111

Query  426  -YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQV  527
             YQ+VNLCP C+TA+YFRP    PLQG F+EIG+V
Sbjct  112  GYQSVNLCPSCKTAYYFRPYDTTPLQGTFVEIGRV  146



>ref|XP_010930370.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpX-like, mitochondrial [Elaeis guineensis]
Length=664

 Score =   216 bits (551),  Expect(3) = 2e-147, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LTNAVV SSLLESVES+DL AYGLIPEF+GRFP+ VSL 
Sbjct  458   RRQDSSIGFGAPVRANMRTGGLTNAVVTSSLLESVESSDLIAYGLIPEFIGRFPVLVSLL  517

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQ+K++F++NNVKLHFTD AL++IAKKA++K+TGARGLR+I
Sbjct  518   ALNEDQLVQVLMEPKNALGKQFKKLFSMNNVKLHFTDPALRLIAKKAMSKNTGARGLRAI  577

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILT+AM+E+PD +  +  +D V+VDEEAVGS+D  GCGAKIL G  G  ER      
Sbjct  578   LENILTDAMYEIPDVKTSDGQIDAVVVDEEAVGSIDRSGCGAKILCGE-GALERYLKENK  636

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             + D+ E   +  +GD++G+ E++SRA
Sbjct  637   TKDR-EAIVDGSEGDLEGESELSSRA  661


 Score =   190 bits (482),  Expect(3) = 2e-147, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  348   AGYVGEDVESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  407

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  408   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  458


 Score =   168 bits (425),  Expect(3) = 2e-147, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LPTPKEICKGLD++V+GQ+RAKKVLSVAVYNHYKRIY AS  + +G +S  
Sbjct  235   WGGSNLGKDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHASLQKGSGADS--  292

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  E  N + D VELDKSNVLLMGPTGSGKTLLAKTLAR V+VPFVIADATTLTQ
Sbjct  293   TNFEAENDDDDNVELDKSNVLLMGPTGSGKTLLAKTLARFVHVPFVIADATTLTQ  347


 Score =   125 bits (315),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 82/140 (59%), Gaps = 13/140 (9%)
 Frame = +3

Query  228  QHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYD--HLKAEVNCPRCSKPMTVLFSNR-PL  398
             H  PP    R        Q R KW G +D +    ++AE NCPRCSK M +LFSNR P 
Sbjct  42   HHRRPPGXPHR--------QERHKWAGGADEFHTRRIRAEANCPRCSKHMDILFSNRSPP  93

Query  399  SIT-AGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAG  575
            SI  AG+ G YQA+N+CP C+TA+YFRP KL PLQG F+EIG+V+G   ERE    T   
Sbjct  94   SIAGAGDRGGYQALNMCPSCKTAYYFRPHKLVPLQGTFVEIGRVRGPDPERERLSGTGED  153

Query  576  SENG-KAAGKIWEKLRTYSG  632
             E G +     WE LR+  G
Sbjct  154  GEQGNRLKTSFWEALRSSYG  173



>ref|XP_011009777.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Populus euphratica]
Length=714

 Score =   212 bits (539),  Expect(3) = 2e-147, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 163/207 (79%), Gaps = 8/207 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA + SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  512   RRQDSSIGFGAPVRANMRAGGVTNAAITSSLLESVESADLIAYGLIPEFIGRFPILVSLA  571

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VLM+P+NAL KQYK++F++NNVKL+FT+ AL++IAKKA+AK+TGARGLR+I
Sbjct  572   ALTEDQLVRVLMEPRNALGKQYKKLFSMNNVKLNFTEKALRLIAKKAMAKNTGARGLRAI  631

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G+D VD V++DEE+VGS+  PG G KIL+G+      L+    
Sbjct  632   LESILTEAMYEIPDIKTGSDRVDAVVIDEESVGSVHAPGSGGKILRGDGALEHYLAEYKD  691

Query  2067  STDKAEKNEEALKGDM-DGDCEVASRA  2144
             S        EA  G++ D + EV+SRA
Sbjct  692   SV-------EAADGELQDAESEVSSRA  711


 Score =   192 bits (487),  Expect(3) = 2e-147, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AA+F+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  402   AGYVGEDVESILYKLLSAAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  461

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  462   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKNILFICGGAFVDLEKTISER  512


 Score =   171 bits (432),  Expect(3) = 2e-147, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 98/117 (84%), Gaps = 7/117 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G N+ K+LPTPKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY +S  +  G ESG 
Sbjct  290   WGGSNLGKELPTPKEICKGLDKFVIGQDRAKKVLSVAVYNHYKRIYHSSLRKGPGAESGT  349

Query  921   -KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + +D++ N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  350   LEAIDDEDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  401


 Score =   100 bits (250),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 74/173 (43%), Gaps = 53/173 (31%)
 Frame = +3

Query  276  LGFQRRCKWEGSSD--NYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGET----------  419
            +G Q R KWE S D  N   ++AE NCPRCSK M VLFSNR    +              
Sbjct  55   IGIQERYKWENSKDDNNVRKIRAEANCPRCSKHMDVLFSNRSFVFSNNSNLDHHHHPHLS  114

Query  420  --------------------------GIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIG  521
                                        YQAVN CP+C+TA+YFRP K+ PLQG+F+EIG
Sbjct  115  RNNDTANNNTNNTTTADTGANGNGHNNNYQAVNFCPNCKTAYYFRPDKIAPLQGSFVEIG  174

Query  522  QVKGGV---------------GERENNGNTAAGSENGKAAGKIWEKLRTYSGN  635
            ++                   GE   +      + N +     WE LR+Y G+
Sbjct  175  RISNKGNGRNGNKGGKEGSNGGEEGVDYANVTNTINNRLRVSFWETLRSYGGD  227



>gb|KHN24432.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Glycine 
soja]
Length=649

 Score =   219 bits (557),  Expect(3) = 9e-147, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 163/206 (79%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T++ V SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  444   RRQDSSIGFGAPVRANMRAGGITDSAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLS  503

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL+ VL +PKNAL KQYK++F++NNVKLHFT+ AL++IAKKA+AK+TGARGLR++
Sbjct  504   ALTEDQLMMVLTEPKNALGKQYKKLFSMNNVKLHFTEKALRLIAKKAMAKNTGARGLRAL  563

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAMFE+PD + G+D VD V++DEE+VGSL  PGCG KIL+G+    + L+    
Sbjct  564   LENILTEAMFEIPDIKTGSDRVDAVVIDEESVGSLTAPGCGGKILRGDGALEQYLAKMKD  623

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S    +  E  L+   +GD E++SRA
Sbjct  624   SAVNVDVGESDLQ---EGDLELSSRA  646


 Score =   191 bits (486),  Expect(3) = 9e-147, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  1067  RCNNVDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSG  1246
             + + +  GYVGEDVESIL+KLL AADF+V AA+ GI+YIDEVDKITKK++SLNI RDVSG
Sbjct  328   KFSTLQAGYVGEDVESILYKLLTAADFNVAAAQQGIIYIDEVDKITKKSKSLNISRDVSG  387

Query  1247  EGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             EGVQQ LLKMLEGT+VNVP+  ARKH RGD+IQ+DTKNILFICGGAFI LEKTISER
Sbjct  388   EGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQMDTKNILFICGGAFIDLEKTISER  444


 Score =   162 bits (409),  Expect(3) = 9e-147, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 95/119 (80%), Gaps = 7/119 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G N+ K  P+PKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY A+  + +  +SG 
Sbjct  199   WGGSNLGKDFPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHATLQKGSAADSGV  258

Query  921   -KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQVM  1094
              + +D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVI DATTLTQ +
Sbjct  259   SEVLDDDDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVITDATTLTQAI  312


 Score = 63.5 bits (153),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 4/45 (9%)
 Frame = +3

Query  426  YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNG  560
            YQ+VNLCP C+TA+YFRP    PLQG F+EIG+V       +NNG
Sbjct  30   YQSVNLCPSCKTAYYFRPYDTTPLQGTFVEIGRVT----STKNNG  70



>emb|CBI29632.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   216 bits (551),  Expect(3) = 1e-146, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 162/208 (78%), Gaps = 6/208 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LT+AVV SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  339   RRQDSSIGFGAPVRANMRTGGLTDAVVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLS  398

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQYK+M ++NNVKLHFT+NAL++IAKKAIAK+TGAR LR+I
Sbjct  399   ALNEDQLVQVLTEPKNALGKQYKKMLSMNNVKLHFTENALRLIAKKAIAKNTGARSLRAI  458

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE ILTEAMFE+PD + G D VD VLVDEEAV S++  GCGAK+L+G     + L    +
Sbjct  459   LEKILTEAMFEIPDVKTGTDMVDAVLVDEEAVESIEEQGCGAKVLRGEGALEQFLHETKS  518

Query  2067  STD--KAEKNEEALKGDMDGDCEVASRA  2144
             S    + E  +E L  +M    EV+SRA
Sbjct  519   SNPLGRDEMAQELLPREM----EVSSRA  542


 Score =   190 bits (482),  Expect(3) = 1e-146, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL KLLM A+F+VEAA+ GIVYIDEVDKITKKAESLN GRDVSGEGVQQ LL
Sbjct  231   YVGEDVESILHKLLMVAEFNVEAAQQGIVYIDEVDKITKKAESLNTGRDVSGEGVQQALL  290

Query  1271  KMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             KMLEGT+VNVPD   RKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  291   KMLEGTIVNVPDKGGRKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  339


 Score =   165 bits (418),  Expect(3) = 1e-146, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 95/108 (88%), Gaps = 2/108 (2%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             ++LPTPKEICKGLDEFV+GQE+AKKVLSVAVYNHYKRI+ AS  + +G ES K   E  N
Sbjct  123   RELPTPKEICKGLDEFVIGQEQAKKVLSVAVYNHYKRIHHASLQKESGAESTKA--EIDN  180

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              ++D VEL+KSNVLL+GPTGSGKTLLAKTLAR+VNVPFVIADATTLTQ
Sbjct  181   DDNDSVELEKSNVLLLGPTGSGKTLLAKTLARVVNVPFVIADATTLTQ  228


 Score =   132 bits (332),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 3/85 (4%)
 Frame = +3

Query  279  GF-QRRCKWEG-SSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGET-GIYQAVNLCP  449
            GF QRR K +  S D YDH++A+VNCPRCS  M++LFSNRPLSITA E  G+YQA+NLCP
Sbjct  36   GFHQRRLKSDKYSGDTYDHIRADVNCPRCSSQMSILFSNRPLSITAAEPPGVYQALNLCP  95

Query  450  HCRTAFYFRPSKLEPLQGNFIEIGQ  524
            +CRTAFYFRP KL PLQG+FIEIG+
Sbjct  96   NCRTAFYFRPFKLAPLQGSFIEIGR  120



>ref|XP_010063745.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Eucalyptus grandis]
 gb|KCW71000.1| hypothetical protein EUGRSUZ_F04107 [Eucalyptus grandis]
Length=724

 Score =   215 bits (547),  Expect(3) = 2e-146, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 165/207 (80%), Gaps = 3/207 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA V SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  517   RRQDSSIGFGAPVRANMRAGGVTNAAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLS  576

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +P+NAL KQYK++F++NNV+LHFT+ AL++IAKKA+ K+TGARGLR+I
Sbjct  577   ALTEDQLVQVLTEPRNALGKQYKKLFSMNNVRLHFTEKALRLIAKKAMVKNTGARGLRAI  636

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + GN+ VD V+VDEE+VGS++  G G KIL+G+      L  A T
Sbjct  637   LESILTEAMYEIPDIKTGNERVDAVVVDEESVGSIEALGFGGKILRGDNALERYL--AET  694

Query  2067  STDKAEKNEEALKGDM-DGDCEVASRA  2144
                 +  N +A +G+M DG+ +V+SRA
Sbjct  695   KFQNSAANVDAPEGEMQDGESDVSSRA  721


 Score =   187 bits (474),  Expect(3) = 2e-146, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  405   TQAGYVGEDVESILYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQ  464

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH RGD+IQ+DTK+ILF+CGGAF+ LEKTISER
Sbjct  465   QALLKMLEGTIVNVPEKGARKHPRGDNIQMDTKDILFVCGGAFVDLEKTISER  517


 Score =   169 bits (429),  Expect(3) = 2e-146, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 98/117 (84%), Gaps = 8/117 (7%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G N+ K LPTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY AS  + +G ESG 
Sbjct  296   WGGANLGKDLPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYLASQ-KGSGAESGV  354

Query  921   -KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              +T+D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  355   SETLDDDDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  406


 Score =   111 bits (277),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 87/165 (53%), Gaps = 45/165 (27%)
 Frame = +3

Query  276  LGFQRRCKWE-GSSDNYDH--LKAEVNCPRCSKPMTVLFSNRPLSITAGE----------  416
            +G Q R KW+ G SD+  H  ++AE NCPRCSK M +LFSNR  S    +          
Sbjct  70   IGVQERYKWDHGGSDDLRHRKIRAEANCPRCSKSMDLLFSNRHFSPNLDQNFAQHNSGGG  129

Query  417  ------TGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQV------KGGVGERENNG  560
                  +G YQAVNLCP+C++A+YF P ++ PLQG+F+EIG+V        GV +R  NG
Sbjct  130  DGGKAASGGYQAVNLCPNCKSAYYFHPYRIAPLQGSFVEIGRVASTNKNNNGVEKRNKNG  189

Query  561  -----NTAAGSE---------------NGKAAGKIWEKLRTYSGN  635
                 + +AG+                N K     WE LR+YSG+
Sbjct  190  GPRNSSNSAGANSDEDNRGGGGYNDFVNNKLRFSFWETLRSYSGD  234



>ref|XP_008459496.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial, partial [Cucumis melo]
Length=669

 Score =   211 bits (537),  Expect(3) = 3e-146, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 167/206 (81%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM +S  T+A V SSLLESVES+DL AYGLIPEF+GRFPI VSL 
Sbjct  464   RRQDSSIGFGAPVRANMRISGATSAAVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLL  523

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK++F +N VKLH+T+ AL+MIAKKAIAK+TGARGLR+I
Sbjct  524   ALTEDQLVQVLTEPKNALGKQYKKLFGMNKVKLHYTEKALRMIAKKAIAKNTGARGLRAI  583

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + GN+ VD V+VDEE+VG L++ GCG KIL+G+ G  ER   A  
Sbjct  584   LESILTEAMYEIPDVKTGNERVDAVVVDEESVGPLNSRGCGGKILRGD-GALERY-LAEI  641

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
                ++++N E ++   +G+ E++SRA
Sbjct  642   KLKESQENFEVVE-LQEGETELSSRA  666


 Score =   187 bits (474),  Expect(3) = 3e-146, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL AA+F+V+AA+ G++YIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  352   TQAGYVGEDVESILYKLLAAAEFNVQAAQQGMIYIDEVDKITKKAESLNISRDVSGEGVQ  411

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  +RKH RGD+IQIDTK+ILFICGGAF+ LEKTIS+R
Sbjct  412   QALLKMLEGTIVNVPEKGSRKHPRGDNIQIDTKDILFICGGAFVDLEKTISDR  464


 Score =   172 bits (436),  Expect(3) = 3e-146, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 98/118 (83%), Gaps = 7/118 (6%)
 Frame = +3

Query  741   EWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG  920
             EW G N+ K LPTPKEICKGLD+FV+GQE+AKKVLSVAV+NHYKRIY AS  + +G ESG
Sbjct  241   EWGGSNLGKDLPTPKEICKGLDKFVIGQEKAKKVLSVAVHNHYKRIYHASLQKGSGNESG  300

Query  921   K--TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                T+D+      D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  301   TRDTIDDD-----DSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  353


 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 80/160 (50%), Gaps = 41/160 (26%)
 Frame = +3

Query  276  LGFQRRCKWE----GSSDNYDH----------LKAEVNCPRCSKPMTVLFSNR-------  392
            +G Q R KW+    GS D +            ++AE NCPRCSK M +LFSNR       
Sbjct  25   IGVQERYKWDNGGSGSDDFHSQSNITGTPIRKIRAEANCPRCSKHMDILFSNRHFPTLNL  84

Query  393  PLSITA-------GETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGG-----  536
            P S +A       G    Y+AVNLCP+C+TA+YFRP K+ PLQG+FIEIG +        
Sbjct  85   PSSSSADAPPKAGGGREAYEAVNLCPNCKTAYYFRPYKIAPLQGSFIEIGNLNSKPKNSS  144

Query  537  ---VGERENNGNTAAGSE-----NGKAAGKIWEKLRTYSG  632
               +  ++  GN  AG       N +     +E  R++ G
Sbjct  145  ERRITTKDGKGNAIAGFSDENYVNNRLRVSFFETARSFGG  184



>ref|XP_006441855.1| hypothetical protein CICLE_v10019167mg [Citrus clementina]
 gb|ESR55095.1| hypothetical protein CICLE_v10019167mg [Citrus clementina]
Length=675

 Score =   220 bits (561),  Expect(3) = 5e-146, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 169/207 (82%), Gaps = 6/207 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  + +T+A V SSLLESVES+DL AYGLIPEFVGRFPI VSL+
Sbjct  471   RRQDSSIGFGAPVRANMR-AGVTDAAVTSSLLESVESSDLIAYGLIPEFVGRFPILVSLT  529

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL +PKNAL KQYKR+F++NNVKLHFT+ AL++IAKKA AK+TGARGLR+I
Sbjct  530   ALTEDQLVKVLTEPKNALGKQYKRLFSMNNVKLHFTEKALRVIAKKATAKNTGARGLRAI  589

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G+DGVD V+VDEE+VGS+D PGCG KIL+G  G  ER    + 
Sbjct  590   LESILTEAMYEIPDVKTGSDGVDAVVVDEESVGSVDAPGCGGKILRGE-GALERY---LV  645

Query  2067  STDKAEKNEEALKGDM-DGDCEVASRA  2144
               ++ E  E A + ++ + + E+++RA
Sbjct  646   EAERKESAENASERELQESEAEISTRA  672


 Score =   191 bits (484),  Expect(3) = 5e-146, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  A+F+VEAA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  361   AGYVGEDVESILYKLLAQAEFNVEAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  420

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGDSIQ+DTK+ILFICGGAF+ LEKTISER
Sbjct  421   LLKMLEGTIVNVPEKGARKHPRGDSIQMDTKDILFICGGAFVDLEKTISER  471


 Score =   159 bits (402),  Expect(3) = 5e-146, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 90/106 (85%), Gaps = 3/106 (3%)
 Frame = +3

Query  771   LPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFE  950
             LPTPKEICKGLD+FV+GQE+AKKVLSVAVYNHYKRIY A+  + +G E  KT D   N  
Sbjct  258   LPTPKEICKGLDKFVIGQEKAKKVLSVAVYNHYKRIYHANLKKGSGAEP-KTADAVDN--  314

Query  951   SDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  315   DDNVELEKSNVLLMGPTGSGKTLLAKTLARHVNVPFVIADATTLTQ  360


 Score =   107 bits (267),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 71/125 (57%), Gaps = 6/125 (5%)
 Frame = +3

Query  276  LGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNR-----PLSITAGE-TGIYQAV  437
            +G Q R KW+   D +  ++AE NCPRCSK M +LFSN      P+   A + +G YQAV
Sbjct  57   IGIQERYKWDHGGDTFRKIRAEANCPRCSKHMDLLFSNPSNLSPPVPAPAVDGSGGYQAV  116

Query  438  NLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKIWEKL  617
            N+CP+C++A+YFRP ++ PLQG+F+EI            N      S  G      W+ L
Sbjct  117  NICPNCKSAYYFRPHRIAPLQGSFVEISISANNPNNNNTNKRLKKLSSGGSGKLSFWDTL  176

Query  618  RTYSG  632
            R+Y G
Sbjct  177  RSYGG  181



>ref|XP_008788322.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Phoenix dactylifera]
Length=648

 Score =   220 bits (560),  Expect(3) = 6e-146, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NMS   LTN VV SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  470   RRHDSSIGFGAPVRANMSTGGLTNLVVTSSLLESVESSDLVAYGLIPEFIGRFPILVSLS  529

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QL QVL +PKNAL KQYK++F++NNVKLHFT  AL++IAKKA+ K+TGARGLR+I
Sbjct  530   ALNEDQLFQVLTEPKNALGKQYKKLFSMNNVKLHFTKAALRLIAKKAMEKNTGARGLRAI  589

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNA  2033
             LESILTEAM+E+PD + GN+ VD V+VDEEA+GSLD PGCGAKILQG+ 
Sbjct  590   LESILTEAMYEIPDMKTGNERVDGVVVDEEAIGSLDRPGCGAKILQGDG  638


 Score =   187 bits (474),  Expect(3) = 6e-146, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  ADF+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  358   TQAGYVGEDVESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQ  417

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH R D IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  418   QALLKMLEGTIVNVPEKGARKHPRNDHIQIDTKDILFICGGAFVDLEKTISER  470


 Score =   163 bits (412),  Expect(3) = 6e-146, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 95/120 (79%), Gaps = 11/120 (9%)
 Frame = +3

Query  741   EWTG-LNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             EW G  N+ K LPTPKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY AS  + +  + 
Sbjct  247   EWGGGSNLGKDLPTPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLQKGSAADP  306

Query  918   GK---TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             GK    +D       D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  307   GKLEVKID-------DHVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  359


 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 9/101 (9%)
 Frame = +3

Query  285  QRRCKWEGSSDNYD-----HLKAEVNCPRCSKPMTVLFSN----RPLSITAGETGIYQAV  437
            Q R KWEG     +      ++AE +CPRCS+ M VLFS+     P   ++   G +QAV
Sbjct  60   QERNKWEGGGGPDEPTPTRRIRAEAHCPRCSRHMQVLFSHGPSPPPAPASSNRGGGFQAV  119

Query  438  NLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNG  560
            N+CP+C+TAFYFRP +L PLQG+F+EIG+V+    E+E  G
Sbjct  120  NICPNCKTAFYFRPHRLVPLQGSFVEIGRVRRDTPEKEKGG  160



>gb|EEE57209.1| hypothetical protein OsJ_07170 [Oryza sativa Japonica Group]
Length=583

 Score =   214 bits (546),  Expect(3) = 7e-146, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 162/204 (79%), Gaps = 7/204 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  381   RRQDSSIGFGAPVRANMRAGGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLA  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQ+K++F++NNVKLHFTD AL++IAKKA++K+TGARGLR+I
Sbjct  441   ALNEDQLVQVLMEPKNALGKQFKKLFSMNNVKLHFTDAALRIIAKKAMSKNTGARGLRTI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PDA+ G   +D V+VDE+AVG++D PGCGAKIL G+      LS    
Sbjct  501   LENILMDAMYEIPDAKSGEKRIDAVVVDEDAVGAVDQPGCGAKILYGDGAFERYLSQIKV  560

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             + D A    EA     DG+ E++S
Sbjct  561   AGDAA--GSEA-----DGEAELSS  577


 Score =   192 bits (487),  Expect(3) = 7e-146, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  1070  CNNVDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGE  1249
             C  +  GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGE
Sbjct  266   CAFLQAGYVGEDVESILYKLLAVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGE  325

Query  1250  GVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             GVQQ LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  326   GVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   162 bits (411),  Expect(3) = 7e-146, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LPTPKEIC+GLD++V+GQ+RAKKVLSVAVYNHYKRIY  S  + +G + G 
Sbjct  144   WGGSNLGKDLPTPKEICQGLDKYVIGQDRAKKVLSVAVYNHYKRIYHKSLQKGSGADLGG  203

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQVM  1094
                E    + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ +
Sbjct  204   FDGEAD--DDDGVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAI  258


 Score = 65.9 bits (159),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 6/60 (10%)
 Frame = +3

Query  369  MTVLFSNR--PLSITAGETGI----YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
            M +LFS+R  P S  A   G     YQA+NLCP+CR+A++FRP  L PLQG F+EIG+V+
Sbjct  1    MDILFSHRGPPSSFAAAGAGAGGGGYQALNLCPNCRSAYFFRPHLLAPLQGTFVEIGRVR  60



>ref|XP_006599644.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Glycine max]
Length=711

 Score =   218 bits (556),  Expect(3) = 8e-146, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 163/206 (79%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T++ V SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  506   RRQDSSIGFGAPVRANMRAGGITDSAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLS  565

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL+ VL +PKNAL KQYK++F++NNVKLHFT+ AL++IAKKA+AK+TGARGLR++
Sbjct  566   ALTEDQLMMVLTEPKNALGKQYKKLFSMNNVKLHFTEKALRLIAKKAMAKNTGARGLRAL  625

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAMFE+PD + G+D VD V++DEE+VGSL  PGCG KIL+G+    + L+    
Sbjct  626   LENILTEAMFEIPDIKTGSDRVDAVVIDEESVGSLTAPGCGGKILRGDGALEQYLAKMKD  685

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S    +  E  L+   +GD E++SRA
Sbjct  686   SAVNVDVGESDLQ---EGDLELSSRA  708


 Score =   190 bits (483),  Expect(3) = 8e-146, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AADF+V AA+ GI+YIDEVDKITKK++SLNI RDVSGEGVQQ L
Sbjct  397   GYVGEDVESILYKLLTAADFNVAAAQQGIIYIDEVDKITKKSKSLNISRDVSGEGVQQAL  456

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQ+DTKNILFICGGAFI LEKTISER
Sbjct  457   LKMLEGTIVNVPEKGARKHPRGDNIQMDTKNILFICGGAFIDLEKTISER  506


 Score =   160 bits (405),  Expect(3) = 8e-146, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 7/117 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G N+ K  P+PKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY A+  + +  +SG 
Sbjct  284   WGGSNLGKDFPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHATLQKGSAADSGV  343

Query  921   -KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + +D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFV+ DATTLTQ
Sbjct  344   SEVLDDDDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVVTDATTLTQ  395


 Score = 95.1 bits (235),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 62/108 (57%), Gaps = 17/108 (16%)
 Frame = +3

Query  276  LGFQRRCKWE--GSSDNYDH-LKAEVNCPRCSKPMTVLFSNRPLSI----------TAGE  416
            +G Q R KW+  GS DN    ++AE NCPRC+K M ++FSNR                 +
Sbjct  52   VGVQERYKWDRGGSDDNSTRKIRAEANCPRCTKDMNLVFSNRHFPTPSSESELGGGGGEK  111

Query  417  TGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNG  560
               YQ+VNLCP C+TA+YFRP    PLQG F+EIG+V       +NNG
Sbjct  112  EKGYQSVNLCPSCKTAYYFRPYDTTPLQGTFVEIGRVT----STKNNG  155



>ref|XP_008808963.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpX-like, mitochondrial [Phoenix dactylifera]
Length=664

 Score =   214 bits (545),  Expect(3) = 1e-145, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LTNAVV SSLLESVES+DL AYGLIPEF+GRFP+ VSLS
Sbjct  458   RRQDSSIGFGAPVRANMRTGGLTNAVVTSSLLESVESSDLMAYGLIPEFIGRFPVLVSLS  517

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQ+K++F++NNVKL FTD AL++I++KA+AK+TGARGLR+I
Sbjct  518   ALNEDQLVQVLMEPKNALGKQFKKLFSMNNVKLKFTDTALRLISQKAMAKNTGARGLRAI  577

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNA  2033
             LE+ILTEAM+E+PD + G++ +D V+VDEEAVGS+D PGCGAKIL G+ 
Sbjct  578   LENILTEAMYEIPDVKTGDERIDAVVVDEEAVGSVDRPGCGAKILCGDG  626


 Score =   190 bits (483),  Expect(3) = 1e-145, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  348   AGYVGEDVESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  407

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  408   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  458


 Score =   164 bits (416),  Expect(3) = 1e-145, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ K LPTPKEICKGLD++V+GQ+RAKKVLSVAVYNHYKRI+ AS  + +G +SG    E
Sbjct  239   NLGKDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIHHASLQKGSGADSGNF--E  296

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               N + D VELDKSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  297   PENDDDDNVELDKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  347


 Score =   128 bits (321),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 84/141 (60%), Gaps = 13/141 (9%)
 Frame = +3

Query  225  RQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYD--HLKAEVNCPRCSKPMTVLFSNR-P  395
            R H  PP       G+  G Q R KW G +D +    ++AE NCPRCSK M VLFSNR P
Sbjct  40   RHHRRPP-------GIPHG-QERHKWAGGADEFHTRRIRAEANCPRCSKHMDVLFSNRSP  91

Query  396  LSIT-AGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAA  572
             SI  AG+ G YQA+N+CP C+TA+YFRP KL PLQG F+EIG+V+G   ERE       
Sbjct  92   PSIAGAGDRGGYQALNVCPSCKTAYYFRPHKLVPLQGTFVEIGRVRGADSERERPAGAGD  151

Query  573  GSENG-KAAGKIWEKLRTYSG  632
              E G +     WE LR+  G
Sbjct  152  DEEQGNRLKTSFWEALRSSYG  172



>gb|KDP37794.1| hypothetical protein JCGZ_06696 [Jatropha curcas]
Length=726

 Score =   215 bits (547),  Expect(3) = 1e-145, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 164/207 (79%), Gaps = 3/207 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    + NA V SSLLESVES+DL AYGLIPEFVGRFPI VSL 
Sbjct  519   RRQDSSIGFGAPVRANMRAGRVINAAVTSSLLESVESSDLIAYGLIPEFVGRFPILVSLL  578

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV++L +PKNAL KQYK++F++NNV LHFT+ AL++IAKKA+AK+TGARGLR+I
Sbjct  579   ALTEDQLVRILTEPKNALGKQYKKLFSMNNVTLHFTEKALRLIAKKAMAKNTGARGLRAI  638

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAM+E+PD R GND +D V+VDEE+VGS++ PGCG KIL+G       L  A  
Sbjct  639   LENILTEAMYEIPDVRTGNDRIDTVVVDEESVGSVNAPGCGGKILRGEGALEHYL--AEY  696

Query  2067  STDKAEKNEEALKGDM-DGDCEVASRA  2144
                +A +N EA   ++ +G+ EV+SRA
Sbjct  697   KMKQAMENVEAADTELQEGEAEVSSRA  723


 Score =   189 bits (479),  Expect(3) = 1e-145, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  407   TQAGYVGEDVESILYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQ  466

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  467   QALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  519


 Score =   165 bits (417),  Expect(3) = 1e-145, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 96/117 (82%), Gaps = 7/117 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K+LPTPKEICKGLD+FV+GQ++AKKVLSVAVYNHYKRIY AS  + +  E+G 
Sbjct  297   WGGSNLGKELPTPKEICKGLDKFVIGQDKAKKVLSVAVYNHYKRIYHASLPKGSAAEAGN  356

Query  924   T--VDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  +D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADAT LTQ
Sbjct  357   SDAIDDDDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATALTQ  408


 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 75/179 (42%), Gaps = 60/179 (34%)
 Frame = +3

Query  276  LGFQRRCKWEG-------------SSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGE  416
            +G Q R KW+               S++   ++AE NCPRCSK M + FSNR    +   
Sbjct  56   IGLQERYKWDHGFGGGGSGNSSDGDSNDIRKIRAETNCPRCSKHMDLRFSNRHFPSSNNP  115

Query  417  TGI---------------------------YQAVNLCPHCRTAFYFRPSKLEPLQGNFIE  515
                                          Y+AVN CP C+TA+YFRP K+ PLQG+FIE
Sbjct  116  NLDLNPNYHHYSNRSNSTDTNNTTSNSNSSYEAVNFCPSCKTAYYFRPYKIAPLQGSFIE  175

Query  516  IGQVKGGVG----------ERENNG----------NTAAGSENGKAAGKIWEKLRTYSG  632
            IG+V               +  NNG          +T A + + +     W  LR+Y+G
Sbjct  176  IGRVSNNNNHRHNTRNTSIKNSNNGIENSLEDYNTSTNANAISNRLRASFWNTLRSYAG  234



>ref|XP_009379893.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=677

 Score =   223 bits (569),  Expect(3) = 2e-145, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 169/206 (82%), Gaps = 4/206 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LTNAVVASSLLESVES+DL AYGLIPEFVGRFPI VSLS
Sbjct  473   RRQDSSIGFGAPVRANMRSGGLTNAVVASSLLESVESSDLIAYGLIPEFVGRFPILVSLS  532

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL +QYK++F++NNVKLHFTD AL++IAKKA+AK+TGARGLR+I
Sbjct  533   ALSEDQLVQVLTEPKNALGRQYKKLFSMNNVKLHFTDAALRLIAKKAMAKNTGARGLRAI  592

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL EAMFE+PD + G++ +D V+VDEEAVGS+D PGCGAKIL G+    + L   ++
Sbjct  593   LENILIEAMFEIPDVKTGDERIDAVVVDEEAVGSVDKPGCGAKILHGD----DALDHYLS  648

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
                +++   E  +G+++GD E+ S A
Sbjct  649   ENKRSDVIVEVSEGELEGDSELTSGA  674


 Score =   187 bits (476),  Expect(3) = 2e-145, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLN+ RDVSGEGVQQ 
Sbjct  363   AGYVGEDVESILYKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNLSRDVSGEGVQQA  422

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT++NVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  423   LLKMLEGTIINVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  473


 Score =   156 bits (395),  Expect(3) = 2e-145, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ K LPTPKEICKGLD++V+GQERAKKVL+VAVYNHYKRIY AS  + +    G + D 
Sbjct  254   NLGKDLPTPKEICKGLDKYVIGQERAKKVLAVAVYNHYKRIYHASLQEGSEANLGNS-DT  312

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +G+ +++ VEL+KSNVLL+GPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  313   EGDNDNN-VELEKSNVLLLGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  362


 Score =   108 bits (271),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 78/126 (62%), Gaps = 10/126 (8%)
 Frame = +3

Query  270  LGLGFQRRCKWEGSSDNYD--HLKAEVNCPRCSKPMTVLFSN-RPLSITAGETGIYQAVN  440
             GL  Q R KW+G +D +    ++AE  CPRCS  M +LFSN  P SI  G  G YQA+N
Sbjct  69   FGLLRQERHKWDGGADEFHTRRIRAEAQCPRCSHYMDILFSNASPFSIAGGGGGGYQALN  128

Query  441  LCPHCRTAFYFRPSKLEPLQGNFIEIGQVK-GGVGERENNGNTAAGSENGKAAGKIWEKL  617
            LCP C+TA+YFRP+KL PL+G F+E+G+V+  G G+   + +     ++G      WE L
Sbjct  129  LCPSCKTAYYFRPNKLVPLRGTFVEVGRVRDSGPGKEMKDDD-----DHGNRIKNSWEAL  183

Query  618  R-TYSG  632
            R +Y G
Sbjct  184  RLSYGG  189



>ref|XP_006587386.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X3 [Glycine max]
Length=721

 Score =   214 bits (545),  Expect(3) = 2e-145, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 162/214 (76%), Gaps = 11/214 (5%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T++ V SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  508   RRQDSSIGFGAPVRANMRAVGITDSAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLS  567

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNN--------VKLHFTDNalkmiakkaiakST  1862
             AL E+QL  VL +PKNAL KQYK++F++NN        VKLHFT+NAL++IAKKA+AK+T
Sbjct  568   ALTEDQLTMVLTEPKNALGKQYKKLFSMNNVSISVCDRVKLHFTENALRLIAKKAMAKNT  627

Query  1863  GARGLRSILESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGS  2042
             GARGLR++LESILTEAMFE+PD + G+D VD V++DEE+VGSL  PGCG KIL G+    
Sbjct  628   GARGLRALLESILTEAMFEIPDIKTGSDRVDAVVIDEESVGSLTAPGCGGKILHGDGALK  687

Query  2043  ERLSSAMTSTDKAEKNEEALKGDMDGDCEVASRA  2144
             + L+    S    +  E  L+   +GD E++SRA
Sbjct  688   QYLAKMKDSAVNVDVGESDLQ---EGDLELSSRA  718


 Score =   191 bits (484),  Expect(3) = 2e-145, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+AADF+V AA+ GI+YIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  399   GYVGEDVESILYKLLVAADFNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQAL  458

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARK+ RGD+IQ+DTKNILFICGGAFI LEKTISER
Sbjct  459   LKMLEGTIVNVPEKGARKNPRGDNIQMDTKNILFICGGAFIDLEKTISER  508


 Score =   162 bits (411),  Expect(3) = 2e-145, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 7/117 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G N+ K  P+PKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY A+  + +  +SG 
Sbjct  286   WGGSNLGKDFPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHATLQKGSAADSGA  345

Query  921   -KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + +D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  346   SEVLDDDDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  397


 Score = 95.9 bits (237),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 11/95 (12%)
 Frame = +3

Query  276  LGFQRRCKWE-GSSDNYD--HLKAEVNCPRCSKPMTVLFSNRPLSITAGETGI-------  425
            +G Q R KW+ G SD+     ++AE NCPRC+K M ++FSNR       E+ +       
Sbjct  52   VGVQERYKWDRGGSDDTSSRKIRAEANCPRCTKDMNLVFSNRHFPTPQIESELGGGEREK  111

Query  426  -YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQV  527
             YQ+VNLCP C+TA+YFRP    PLQG F+EIG+V
Sbjct  112  GYQSVNLCPSCKTAYYFRPYDTTPLQGTFVEIGRV  146



>ref|XP_008232534.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpX-like, mitochondrial [Prunus mume]
Length=708

 Score =   208 bits (530),  Expect(3) = 3e-145, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSLLESVES+DL AYGLIPEF+GRFPI VSL+
Sbjct  502   RRQDSSIGFGAPVRANMRAGGVTDAVVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLT  561

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK++F +NNVKLHF + AL++IAKKA+AK+TGARGLR++
Sbjct  562   ALTEDQLVQVLTEPKNALGKQYKKLFTMNNVKLHFEEKALRLIAKKAMAKNTGARGLRAL  621

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAM  2063
             LESILTEAM+E+PD + G D +D V+VDEE+VGS++TPGCG K+++G+ G  ER  S +
Sbjct  622   LESILTEAMYEIPDVKTGIDRIDAVVVDEESVGSVNTPGCGGKLVRGD-GALERYLSEI  679


 Score =   185 bits (470),  Expect(3) = 3e-145, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGE-GVQQG  1264
             GYVGEDVESIL+KLLMAA+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGE   QQ 
Sbjct  392   GYVGEDVESILYKLLMAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEXXXQQA  451

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  452   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  502


 Score =   173 bits (439),  Expect(3) = 3e-145, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 98/117 (84%), Gaps = 7/117 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G N+ K LPTPKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY AS  + +GGESG 
Sbjct  279   WGGSNLGKDLPTPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLQKGSGGESGI  338

Query  921   -KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               T+D     + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVI+DATTLTQ
Sbjct  339   PNTID-----DDDKVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVISDATTLTQ  390


 Score = 83.6 bits (205),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 62/112 (55%), Gaps = 28/112 (25%)
 Frame = +3

Query  276  LGFQRRCKWE--GSSDNYD----HLKAEVNCPRCS-KPMTVLFSNRPLSITA--------  410
            +G Q R KW+  GS+   D     ++AE NCPRCS   M +LFS+R L   +        
Sbjct  45   IGVQERYKWDHGGSASGGDVRTRKIRAEANCPRCSFNRMDLLFSDRRLPNLSPPDDSSSS  104

Query  411  -------------GETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQV  527
                          E   YQA+NLCP+C+TA+YFRP ++ PLQG F+EIG++
Sbjct  105  TSTKTTTKTKADDSEFHQYQALNLCPNCKTAYYFRPHQIAPLQGTFVEIGRL  156



>ref|XP_008781975.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Phoenix dactylifera]
Length=666

 Score =   214 bits (544),  Expect(3) = 3e-145, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 166/206 (81%), Gaps = 2/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+R NM  S LTNA V SSLLESVES+D  AYGLIPEFVGRFP+ VSLS
Sbjct  460   RRQDSSIGFGAPIRANMRASGLTNAAVTSSLLESVESSDFIAYGLIPEFVGRFPVLVSLS  519

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVLM+PKNA+ KQ+K++F +NNV LHFTD AL++IAKKA+AK+TGARGLR+I
Sbjct  520   ALSEDQLVQVLMEPKNAIGKQFKKLFRMNNVTLHFTDTALRLIAKKALAKNTGARGLRAI  579

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILT+AM+E+PD + G++ +D V+VDEEAVGS+D PG GAKIL G+ G  E+      
Sbjct  580   LENILTDAMYEIPDVKTGDEQIDAVVVDEEAVGSVDRPGSGAKILHGD-GALEQYLKENK  638

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
               D+    + + +G+++G  E++SRA
Sbjct  639   IKDRVAMVDGS-EGELEGGSELSSRA  663


 Score =   187 bits (474),  Expect(3) = 3e-145, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVES+L+KLL  A+F+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  350   AGYVGEDVESMLYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  409

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  410   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  460


 Score =   166 bits (420),  Expect(3) = 3e-145, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 100/124 (81%), Gaps = 13/124 (10%)
 Frame = +3

Query  735   AGE--WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAG  908
             AGE  W G N+ K+LPTPKEICKGLD++VVGQ+ AKKVLSVAVYNHYKRIY AS  +++G
Sbjct  233   AGEDGWGGANLGKELPTPKEICKGLDKYVVGQDNAKKVLSVAVYNHYKRIYHASLQKVSG  292

Query  909   GESGKTVDEQGNFES----DFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADAT  1076
              +S       GNFE+    D VEL+KSNVLLMG TGSGKTLLAKTLAR VNVPFVIADAT
Sbjct  293   ADS-------GNFEAENDDDNVELEKSNVLLMGLTGSGKTLLAKTLARFVNVPFVIADAT  345

Query  1077  TLTQ  1088
             TLTQ
Sbjct  346   TLTQ  349


 Score =   102 bits (253),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 72/127 (57%), Gaps = 21/127 (17%)
 Frame = +3

Query  285  QRRCKWEGSSD--NYDHLKAEVNCPRCSKPMTVLFSNR-PLSIT-AGETGIYQAVNLCPH  452
            Q R KW G +D  +   ++ E N P C+K M VLFSNR P SI  AG+ G  QAVN+CP 
Sbjct  56   QERHKWAGGADELHTGRIRDEANYPCCTKHMEVLFSNRSPPSIAGAGDRGGCQAVNICPS  115

Query  453  CRTAFYFRPSKLEPLQGNFIEIGQVKG---------GVGERENNGNTAAGSENGKAAGKI  605
            C+TA+YFRP KL  LQG F+EI  V+G         GVGE E  GN    S         
Sbjct  116  CKTAYYFRPHKLVSLQGKFVEIEGVRGPDLEWERDAGVGEDERQGNRLKTS--------F  167

Query  606  WEKLRTY  626
            WE LR++
Sbjct  168  WESLRSW  174



>ref|XP_010915955.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Elaeis guineensis]
Length=568

 Score =   208 bits (529),  Expect(3) = 4e-145, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 160/205 (78%), Gaps = 2/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF AP+R NM   ++TNA VASSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  362   RRHDSSIGFRAPIRANMRTGSVTNAAVASSLLESVESGDLIAYGLIPEFVGRFPILVSLS  421

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLV+VL KPKNA+ KQY ++F +N+V+LHFT+ AL++IAKKA+AK+TGARGLRSI
Sbjct  422   ALNEDQLVEVLTKPKNAVGKQYIKLFQMNDVRLHFTEKALRLIAKKAMAKNTGARGLRSI  481

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAM+E+PD R G + +D V+VDEE+VGS+D+ GCGAKIL G        S    
Sbjct  482   LENILTEAMYEIPDTRTGKEKIDAVVVDEESVGSVDSHGCGAKILCGEGALENYFS--QQ  539

Query  2067  STDKAEKNEEALKGDMDGDCEVASR  2141
             +  +AE   E  +G+ + D E+ SR
Sbjct  540   NLKEAETTFERSEGEPEADLELPSR  564


 Score =   193 bits (491),  Expect(3) = 4e-145, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVES+L+KLL+AADF+V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  253   GYVGEDVESVLYKLLVAADFNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  312

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  313   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  362


 Score =   165 bits (418),  Expect(3) = 4e-145, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 92/117 (79%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+  K PTPKEIC+GLD FV+GQERAKKVLSVAVYNHYKRIY  S ++     +
Sbjct  137   GCWGGSNLGNKFPTPKEICRGLDNFVIGQERAKKVLSVAVYNHYKRIYYESLSKWCA--A  194

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G   +E    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  195   GSNENEASTTDIDTVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  251



>ref|XP_004141515.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Cucumis sativus]
 ref|XP_004163734.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Cucumis sativus]
Length=699

 Score =   208 bits (530),  Expect(3) = 4e-145, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 166/206 (81%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM +   T+A V SSLLESVES+DL AYGLIPEF+GRFPI VSL 
Sbjct  494   RRQDSSIGFGAPVRANMRIGGATSAAVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLL  553

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK++F +N VKLH+T+ AL+MIAKKAIAK+TGARGLR+I
Sbjct  554   ALTEDQLVQVLTEPKNALGKQYKKLFGMNKVKLHYTEKALRMIAKKAIAKNTGARGLRAI  613

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G + VD V+VDEE+VG L++ GCG KIL+G+ G  ER   A T
Sbjct  614   LESILTEAMYEIPDVKTGIERVDAVVVDEESVGPLNSRGCGGKILRGD-GALERY-LAET  671

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
                ++++N E ++   +G+ E++SRA
Sbjct  672   KLKESQENLEVVE-LQEGETELSSRA  696


 Score =   187 bits (474),  Expect(3) = 4e-145, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL AA+F+V+AA+ G++YIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  382   TQAGYVGEDVESILYKLLAAAEFNVQAAQQGMIYIDEVDKITKKAESLNISRDVSGEGVQ  441

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  +RKH RGD+IQIDTK+ILFICGGAF+ LEKTIS+R
Sbjct  442   QALLKMLEGTIVNVPEKGSRKHPRGDNIQIDTKDILFICGGAFVDLEKTISDR  494


 Score =   171 bits (434),  Expect(3) = 4e-145, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 98/118 (83%), Gaps = 7/118 (6%)
 Frame = +3

Query  741   EWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG  920
             EW G N+ K LPTPKEICKGLD+FV+GQE+AKKVLSVAV+NHYKRIY AS  + +G ESG
Sbjct  271   EWGGSNLGKDLPTPKEICKGLDKFVIGQEKAKKVLSVAVHNHYKRIYHASLQKGSGNESG  330

Query  921   K--TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                TVD+      D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQ
Sbjct  331   TQDTVDDD-----DSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVLADATTLTQ  383


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 81/160 (51%), Gaps = 41/160 (26%)
 Frame = +3

Query  276  LGFQRRCKWE----GSSDNYDH----------LKAEVNCPRCSKPMTVLFSNR---PLSI  404
            +G Q R KW+    GS D +            ++AE NCPRCSK M +LFSNR    L++
Sbjct  55   IGVQERYKWDNGGSGSDDFHSQSNITGTPIRKIRAEANCPRCSKHMDILFSNRHFPTLNL  114

Query  405  TAGETG-----------IYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGG-----  536
             +  +G            Y+AVNLCP+C+TA+YFRP K+ PLQG+FIEIG +        
Sbjct  115  PSSSSGDAPPKAGGGREAYEAVNLCPNCKTAYYFRPYKIAPLQGSFIEIGNLNSKPKNSS  174

Query  537  ---VGERENNGNTAAGSE-----NGKAAGKIWEKLRTYSG  632
               +  ++  GN  AG       N +     +E  R++ G
Sbjct  175  ERRITTKDGKGNAIAGFSDENYVNNRLRVSFFETARSFGG  214



>dbj|BAH01586.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73425.1| hypothetical protein OsI_07697 [Oryza sativa Indica Group]
Length=645

 Score =   214 bits (546),  Expect(3) = 5e-145, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 161/204 (79%), Gaps = 7/204 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  443   RRQDSSIGFGAPVRANMRAGGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLA  502

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQ+K++F++NNVKLHFTD AL++IAKKA++K+TGARGLR+I
Sbjct  503   ALNEDQLVQVLMEPKNALGKQFKKLFSMNNVKLHFTDAALRIIAKKAMSKNTGARGLRTI  562

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PDA+ G   +D V+VDE+AVG++D PGCGAKIL G+      LS    
Sbjct  563   LENILMDAMYEIPDAKSGEKRIDAVVVDEDAVGAVDQPGCGAKILYGDGAFERYLSQIKV  622

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             + D A         + DG+ E++S
Sbjct  623   AGDAA-------GSEADGEAELSS  639


 Score =   190 bits (482),  Expect(3) = 5e-145, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  333   AGYVGEDVESILYKLLAVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  392

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  393   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  443


 Score =   162 bits (409),  Expect(3) = 5e-145, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LPTPKEIC+GLD++V+GQ+RAKKVLSVAVYNHYKRIY  S  + +G + G 
Sbjct  220   WGGSNLGKDLPTPKEICQGLDKYVIGQDRAKKVLSVAVYNHYKRIYHKSLQKGSGADLGG  279

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E  +   D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  280   FDGEADD--DDGVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  332


 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 15/97 (15%)
 Frame = +3

Query  285  QRRCKWEGSS-------DNYD--HLKAEVNCPRCSKPMTVLFSNRPLSITAGETGI----  425
            Q R KWEG +       D ++   ++AE +CPRCSK M +LFS+R    ++   G     
Sbjct  40   QERRKWEGPTSSSSSSSDEHEPRRIRAEAHCPRCSKHMDILFSHRAPPSSSAAAGAGAGG  99

Query  426  --YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
              YQA+NLCP+CR+A++FRP  L PLQG F+EIG+V+
Sbjct  100  GGYQALNLCPNCRSAYFFRPHLLAPLQGTFVEIGRVR  136



>ref|XP_006478287.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Citrus sinensis]
Length=675

 Score =   220 bits (561),  Expect(3) = 8e-145, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 169/207 (82%), Gaps = 6/207 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  + +T+A V SSLLESVES+DL AYGLIPEFVGRFPI VSL+
Sbjct  471   RRQDSSIGFGAPVRANMR-AGVTDAAVTSSLLESVESSDLIAYGLIPEFVGRFPILVSLT  529

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL +PKNAL KQYKR+F++NNVKLHFT+ AL++IAKKA AK+TGARGLR+I
Sbjct  530   ALTEDQLVKVLTEPKNALGKQYKRLFSMNNVKLHFTEKALRVIAKKATAKNTGARGLRAI  589

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+PD + G+DGVD V+VDEE+VGS+D PGCG KIL+G  G  ER    + 
Sbjct  590   LESILTEAMYEIPDVKTGSDGVDAVVVDEESVGSVDAPGCGGKILRGE-GALERY---LV  645

Query  2067  STDKAEKNEEALKGDM-DGDCEVASRA  2144
               ++ E  E A + ++ + + E+++RA
Sbjct  646   EAERKESAENASERELQESEAEISTRA  672


 Score =   191 bits (484),  Expect(3) = 8e-145, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+VEAA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  359   TQAGYVGEDVESILYKLLAQAEFNVEAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQ  418

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH RGDSIQ+DTK+ILFICGGAF+ LEKTISER
Sbjct  419   QALLKMLEGTIVNVPEKGARKHPRGDSIQMDTKDILFICGGAFVDLEKTISER  471


 Score =   155 bits (391),  Expect(3) = 8e-145, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 88/106 (83%), Gaps = 3/106 (3%)
 Frame = +3

Query  771   LPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFE  950
              PTPKEICKGLD+FV+GQE+AKKVLSVAVYNHYKRIY A+  + +G E  KT     N  
Sbjct  258   FPTPKEICKGLDKFVIGQEKAKKVLSVAVYNHYKRIYHANLKKGSGAEP-KTAAAVDN--  314

Query  951   SDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  315   DDNVELEKSNVLLMGPTGSGKTLLAKTLARHVNVPFVIADATTLTQ  360


 Score =   107 bits (267),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 71/125 (57%), Gaps = 6/125 (5%)
 Frame = +3

Query  276  LGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNR-----PLSITAGE-TGIYQAV  437
            +G Q R KW+   D +  ++AE NCPRCSK M +LFSN      P+   A + +G YQAV
Sbjct  57   IGIQERYKWDHGGDTFRKIRAEANCPRCSKHMDLLFSNPSNLSPPVPAPAVDGSGGYQAV  116

Query  438  NLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKIWEKL  617
            N+CP+C++A+YFRP ++ PLQG+F+EI            N      S  G      W+ L
Sbjct  117  NICPNCKSAYYFRPHRIAPLQGSFVEISISANNHNNNNTNKRLKKLSSGGSGKLSFWDTL  176

Query  618  RTYSG  632
            R+Y G
Sbjct  177  RSYGG  181



>emb|CDX86004.1| BnaC06g21300D [Brassica napus]
Length=615

 Score =   209 bits (531),  Expect(3) = 1e-144, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  416   RRQDSSIGFGAPVRANMATSGVTSGAITSSLLESVESADLAAYGLIPEFVGRFPILVSLS  475

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL +I+K A+ K+TGARGLR++
Sbjct  476   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALGIISKLAMVKNTGARGLRAL  535

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PDA+ G++ +D V+VDE++ GS  + GC AK+L+G+ G  ER  +   
Sbjct  536   LESILTEAMFEIPDAKKGDERIDAVIVDEDSTGSEASRGCTAKLLRGD-GAFERYLNENK  594

Query  2067  STDKAE  2084
             S D  E
Sbjct  595   SKDATE  600


 Score =   178 bits (452),  Expect(3) = 1e-144, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  307   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  366

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH R D IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  367   LKLLEGTIVNVPGKGARKHPRADHIQIDTKDILFICGGAFVDLEKTIVDR  416


 Score =   177 bits (450),  Expect(3) = 1e-144, Method: Compositional matrix adjust.
 Identities = 113/264 (43%), Positives = 144/264 (55%), Gaps = 43/264 (16%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNF  509
             L+AE NCPRCSK M +LFSNR                         +  P+ L   + + 
Sbjct  74    LRAEPNCPRCSKQMDLLFSNRQ------------------------FPSPNLLHRPEDSD  109

Query  510   IEIGQVKGGVGERENNGNTAAGSEN--GKAAGKIWEKLRTYSGN---------Nsssdvg  656
               IG+V+     R+ +      S N   K     W+ LR+Y                   
Sbjct  110   SNIGRVQSPTTTRKQHSKDLNLSSNHRNKLRSSFWDTLRSYGAEPPEDWSSTPPPPPPPP  169

Query  657   essstsdscsssssseteveesmegsAGEWTGLNVVKKLPTPKEICKGLDEFVVGQERAK  836
              ++S  ++ + +S+   +++         W G ++ +  PTPKEICK LD+FV+GQ RAK
Sbjct  170   LNASPPNNIAPASNGAVKMDTDAAKDVSRWGGASLGRDFPTPKEICKWLDKFVIGQSRAK  229

Query  837   KVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKT  1016
             KVLSVAVYNHYKRIY    T M  G + + +D+  N     VELDKSNVLLMGPTGSGKT
Sbjct  230   KVLSVAVYNHYKRIY---HTSMKKGSAAQPLDDDDN-----VELDKSNVLLMGPTGSGKT  281

Query  1017  LLAKTLARLVNVPFVIADATTLTQ  1088
             LLAKTLARLVNVPFVIADATTLTQ
Sbjct  282   LLAKTLARLVNVPFVIADATTLTQ  305



>gb|KDO42064.1| hypothetical protein CISIN_1g038067mg, partial [Citrus sinensis]
Length=510

 Score =   221 bits (564),  Expect(3) = 1e-144, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 161/201 (80%), Gaps = 4/201 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LT+A+V SSLLESV+S DL AYGLIPEF+GRFPI VSLS
Sbjct  313   RRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLS  372

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL +QYK+MF++NNVKLHFTD+AL++IAKKA+AK+TGARGLR++
Sbjct  373   ALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRAL  432

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAMFE+P+ + G   V+ VLVD+EAVGS+D PGCGAKIL G+      L   + 
Sbjct  433   LENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDG----ELERVLH  488

Query  2067  STDKAEKNEEALKGDMDGDCE  2129
              T  A +N+  +     G C+
Sbjct  489   ETKSAHENDSEVLLKSPGACD  509


 Score =   179 bits (453),  Expect(3) = 1e-144, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 98/113 (87%), Gaps = 3/113 (3%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGED ES+L+KLL AADFDVEAA+ GIVYIDEVDKI K AES N GRDVSGEGVQQ 
Sbjct  202   AGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVK-AESRNNGRDVSGEGVQQA  260

Query  1265  LLKMLEGTVVNVP--DNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVVNVP  DN  RKH RGD+I IDTK+ILFICGGAF+GLEKTISER
Sbjct  261   LLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISER  313


 Score =   165 bits (417),  Expect(3) = 1e-144, Method: Compositional matrix adjust.
 Identities = 114/256 (45%), Positives = 133/256 (52%), Gaps = 92/256 (36%)
 Frame = +3

Query  432   AVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK-----GGVGER--ENNG-NTAAGSENG  587
             AVN CP C+TAFYFRP KL PL+G+FIE+G+VK     GG   +  E+NG  + + +ENG
Sbjct  1     AVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRKDGESNGIESESETENG  60

Query  588   KAAGKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegsAGEWTGLNVVK  767
                     + R   GN                                            
Sbjct  61    N-------RNRNSEGN-------------------------------------------I  70

Query  768   KLPTPKEICKGLDEFVVGQERAKK-----VL----------SVAVYNHYKRIYDAS----  890
              LPTPKEICKGLDEFV+GQERAKK     +L            AVYNHYKRIY +S    
Sbjct  71    DLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKE  130

Query  891   ---------STQMAGGESGKTVDEQGNFESD-FVELDKSNVLLMGPTGSGKTLLAKTLAR  1040
                      S   +G +SG       N E+D  VEL+KSNVLLMGPTGSGKTLLAKTLAR
Sbjct  131   LVSDHLYVDSILGSGVKSGNC-----NVENDEIVELEKSNVLLMGPTGSGKTLLAKTLAR  185

Query  1041  LVNVPFVIADATTLTQ  1088
             +VNVPF I DAT LTQ
Sbjct  186   IVNVPFTITDATALTQ  201



>ref|XP_004952735.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Setaria italica]
Length=647

 Score =   216 bits (550),  Expect(3) = 3e-144, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 166/207 (80%), Gaps = 8/207 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  S +++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  445   RRQDSSIGFGAPVRANMRGSGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLA  504

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQ+K++F++NNVKLHFTD AL++IAKKA++K+TGARGLR+I
Sbjct  505   ALNEDQLVQVLMEPKNALGKQFKKLFSMNNVKLHFTDGALRIIAKKAMSKNTGARGLRTI  564

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PDA+ G   +D V+VDE+AVGS+D PGCGAKIL G+    + LS    
Sbjct  565   LENILMDSMYEIPDAKSGEKRIDAVVVDEDAVGSVDQPGCGAKILYGDGALDQYLSKIKA  624

Query  2067  STDKAEKNEEALKGDMDGDCEVA-SRA  2144
             S D A         ++DG+ E++ SRA
Sbjct  625   SGDGA-------GSEVDGEAELSPSRA  644


 Score =   189 bits (480),  Expect(3) = 3e-144, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  335   AGYVGEDVESILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  394

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  395   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  445


 Score =   158 bits (400),  Expect(3) = 3e-144, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             K LPTPKEICKGLD++V+GQ+RAKKVLSVAVYNHYKRIY  S  + +G +SG    E   
Sbjct  229   KDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQSLQKGSGADSGGFDGEAD-  287

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  288   -DDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  334


 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 65/100 (65%), Gaps = 11/100 (11%)
 Frame = +3

Query  330  LKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNF  509
            ++AE +CPRCSK M +LF++R L   A   G YQA+NLCP+CR+A++FRP  L PLQG F
Sbjct  80   IRAEAHCPRCSKHMDILFAHRGLPPAA--PGGYQALNLCPNCRSAYFFRPHDLAPLQGTF  137

Query  510  IEIGQVKGGVGERENNGNTAAGSENGKAAGKIWEKLRTYS  629
            +EIG+V+  + +     + AA + +       WE +RT S
Sbjct  138  VEIGRVRADLLD-----HPAARARD----SSFWEAIRTSS  168



>ref|XP_007143921.1| hypothetical protein PHAVU_007G113600g [Phaseolus vulgaris]
 gb|ESW15915.1| hypothetical protein PHAVU_007G113600g [Phaseolus vulgaris]
Length=505

 Score =   216 bits (549),  Expect(3) = 3e-144, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 163/207 (79%), Gaps = 5/207 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+R NM  S +T A V S+LLESVES DL AYGLIPEF+GRFPI +SLS
Sbjct  300   RRQDSSIGFGAPIRANMRTSGVTYAAVTSTLLESVESADLIAYGLIPEFIGRFPILISLS  359

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL+QVL +PKNAL KQYK++F +NNVKLHFT+ AL++IAKKA+ K+TGARGLR++
Sbjct  360   ALTEDQLMQVLTEPKNALAKQYKKLFDMNNVKLHFTEKALRLIAKKAMGKNTGARGLRAL  419

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE ILTEAMFE+PD + GN+ +D V+VDEE+VGS+++PGCG KIL G+      L   + 
Sbjct  420   LEIILTEAMFEIPDVKAGNELIDAVVVDEESVGSVNSPGCGGKILCGDGA----LDLYLA  475

Query  2067  STDKAEKNEEALKGDM-DGDCEVASRA  2144
               + +  N +  + D+ +G+ E++SRA
Sbjct  476   KMEGSVVNHDVAEPDLQEGESEISSRA  502


 Score =   193 bits (490),  Expect(3) = 3e-144, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AA+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  191   GYVGEDVESILYKLLAAAEFNVQAAKQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  250

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  251   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKNILFICGGAFVDLEKTISER  300


 Score =   154 bits (390),  Expect(3) = 3e-144, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 93/117 (79%), Gaps = 8/117 (7%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G   G N+ +  PTPKEICKGLD+FV+GQ RAKKVLSVAVYNHYKRI++ S     G ++
Sbjct  81    GWLGGSNLGRDFPTPKEICKGLDKFVIGQHRAKKVLSVAVYNHYKRIFNGS-----GEDA  135

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G +   +G  + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  136   GIS---EGLDDDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  189



>gb|KDP25897.1| hypothetical protein JCGZ_23723 [Jatropha curcas]
Length=580

 Score =   203 bits (516),  Expect(3) = 5e-144, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 7/202 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM   ++T+A V SSLLE+ ES+DL +YGLIPEFVGRFP+ VSLS
Sbjct  375   RRQDSSIGFGAPVRANMRTGSVTSAAVTSSLLETAESSDLISYGLIPEFVGRFPVLVSLS  434

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQYK+MF LN VKLHFT+NAL++IAKKAI K+TGARGLR+I
Sbjct  435   ALTENQLVQVLTEPKNALGKQYKKMFQLNGVKLHFTENALRLIAKKAITKNTGARGLRAI  494

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PD R G D +D V+VDEEAVG+ +  G GAKIL G       LS    
Sbjct  495   LENILMDSMYEIPDVRTGEDILDAVVVDEEAVGT-EGRGTGAKILYGKGAFDRYLSK---  550

Query  2067  STDKAEKNEEALKGDMDGDCEV  2132
                K +  E +L G  DG+ EV
Sbjct  551   --HKLKDTETSLDG-CDGEPEV  569


 Score =   190 bits (483),  Expect(3) = 5e-144, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL++AD++V AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQQ L
Sbjct  266   GYVGEDVESILYKLLLSADYNVAAAQQGIVYIDEVDKITKKAESVNVSRDVSGEGVQQAL  325

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  326   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  375


 Score =   169 bits (429),  Expect(3) = 5e-144, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ +  PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY  S  + + G+SG 
Sbjct  152   WGGSNLGQNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHDSIQKWSAGDSGD  211

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  E  N   D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  212   SKAEAMN--DDGVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  264



>ref|XP_002452300.1| hypothetical protein SORBIDRAFT_04g023280 [Sorghum bicolor]
 gb|EES05276.1| hypothetical protein SORBIDRAFT_04g023280 [Sorghum bicolor]
Length=640

 Score =   216 bits (551),  Expect(3) = 8e-144, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 160/203 (79%), Gaps = 7/203 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  442   RRQDSSIGFGAPVRANMRAGGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLA  501

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQ+K++F++NNVKLHFTD AL++IAKKA++K+TGARGLR+I
Sbjct  502   ALNEDQLVQVLTEPKNALGKQFKKLFSMNNVKLHFTDGALRIIAKKAMSKNTGARGLRTI  561

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PDAR G   +D V+VDE+AVGS+D PGCGAKIL G+    + LS    
Sbjct  562   LETILMDSMYEIPDARSGEKRIDAVVVDEDAVGSVDQPGCGAKILYGDGALDQYLSQIKV  621

Query  2067  STDKAEKNEEALKGDMDGDCEVA  2135
             S D        +  +MDG+ E A
Sbjct  622   SGD-------GVASEMDGETERA  637


 Score =   189 bits (480),  Expect(3) = 8e-144, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  332   AGYVGEDVESILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  391

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  392   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  442


 Score =   156 bits (395),  Expect(3) = 8e-144, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ + LPTPKEICKGLD++V+GQ+RAKKVLSVAVYNHYKRIY  S  + +G + G    E
Sbjct  223   NLGRDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQSLQKGSGADLGGFDGE  282

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  283   AD--DDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  331


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +3

Query  330  LKAEVNCPRCSKPMTVLFSNRPLSITAGETGI---YQAVNLCPHCRTAFYFRPSKLEPLQ  500
            ++AE +CPRCSK M +LFS+R    T    G    YQA+NLCP+CR+A++FRP  L PLQ
Sbjct  73   IRAEAHCPRCSKHMDILFSHRGPPPTTAGAGAAGGYQALNLCPNCRSAYFFRPHVLAPLQ  132

Query  501  GNFIEIGQVK  530
            G F+EIG+V+
Sbjct  133  GTFVEIGRVR  142



>dbj|BAD15818.1| putative ATP-dependent Clp protease ATP-binding subunit ClpX1 
(CLPX) [Oryza sativa Japonica Group]
Length=666

 Score =   214 bits (546),  Expect(3) = 9e-144, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 161/204 (79%), Gaps = 7/204 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  464   RRQDSSIGFGAPVRANMRAGGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLA  523

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQ+K++F++NNVKLHFTD AL++IAKKA++K+TGARGLR+I
Sbjct  524   ALNEDQLVQVLMEPKNALGKQFKKLFSMNNVKLHFTDAALRIIAKKAMSKNTGARGLRTI  583

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PDA+ G   +D V+VDE+AVG++D PGCGAKIL G+      LS    
Sbjct  584   LENILMDAMYEIPDAKSGEKRIDAVVVDEDAVGAVDQPGCGAKILYGDGAFERYLSQIKV  643

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             + D A         + DG+ E++S
Sbjct  644   AGDAA-------GSEADGEAELSS  660


 Score =   185 bits (470),  Expect(3) = 9e-144, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 103/123 (84%), Gaps = 7/123 (6%)
 Frame = +2

Query  1070  CNNVDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKA-------ESLNI  1228
             C  +  GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKA       ESLNI
Sbjct  342   CAFLQAGYVGEDVESILYKLLAVADFNVQAAQQGMVYIDEVDKITKKADVFNMQAESLNI  401

Query  1229  GRDVSGEGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTI  1408
              RDVSGEGVQQ LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTI
Sbjct  402   SRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTI  461

Query  1409  SER  1417
             SER
Sbjct  462   SER  464


 Score =   162 bits (410),  Expect(3) = 9e-144, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LPTPKEIC+GLD++V+GQ+RAKKVLSVAVYNHYKRIY  S  + +G + G 
Sbjct  220   WGGSNLGKDLPTPKEICQGLDKYVIGQDRAKKVLSVAVYNHYKRIYHKSLQKGSGADLGG  279

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQVM  1094
                E    + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ +
Sbjct  280   FDGEAD--DDDGVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAI  334


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 15/97 (15%)
 Frame = +3

Query  285  QRRCKWEGSS-------DNYD--HLKAEVNCPRCSKPMTVLFSNRPLSITAGETGI----  425
            Q R KWEG +       D ++   ++AE +CPRCSK M +LFS+R    ++   G     
Sbjct  40   QERRKWEGPTSSSSSSSDEHEPRRIRAEAHCPRCSKHMDILFSHRAPPSSSAAAGAGAGG  99

Query  426  --YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
              YQA+NLCP+CR+A++FRP  L PLQG F+EIG+V+
Sbjct  100  GGYQALNLCPNCRSAYFFRPHLLAPLQGTFVEIGRVR  136



>gb|KHN05027.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Glycine 
soja]
Length=517

 Score =   213 bits (543),  Expect(3) = 9e-144, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 161/206 (78%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFG+PVR+NM    +TNA V SSLLESVES DL AYGLIPEF+GRFPI +SLS
Sbjct  312   RRQDSSIGFGSPVRSNMRTGGVTNAAVTSSLLESVESADLIAYGLIPEFIGRFPILISLS  371

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL+QVL +PKNAL KQYK++F +NNVKLHFT+ AL++IAKKA+AK+TGARGLR++
Sbjct  372   ALTEDQLMQVLTEPKNALAKQYKKLFNMNNVKLHFTEKALRLIAKKAMAKNTGARGLRAL  431

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + GN+ +  V+VDEE+VGS++ PGCG KIL G+      L+    
Sbjct  432   LESILTEAMFEIPDVKAGNELIGAVVVDEESVGSVNAPGCGGKILCGDGALELYLAKMEG  491

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S       E  L+   +G+ E++SRA
Sbjct  492   SVANGAVAEPDLQ---EGESEISSRA  514


 Score =   194 bits (492),  Expect(3) = 9e-144, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AA+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  202   AGYVGEDVESILYKLLAAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  261

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTKNILFICGGAFI LEKTISER
Sbjct  262   LLKMLEGTMVNVPERGARKHPRGDNIQIDTKNILFICGGAFIDLEKTISER  312


 Score =   155 bits (391),  Expect(3) = 9e-144, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 89/119 (75%), Gaps = 15/119 (13%)
 Frame = +3

Query  744   WTG-LNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG  920
             W G  N+ +  PTPKEICKGLD+FV+GQ RAKKVLSVAVYNHY+RIY            G
Sbjct  90    WVGGSNLGRDFPTPKEICKGLDKFVIGQHRAKKVLSVAVYNHYQRIYQ-----------G  138

Query  921   KTVDE---QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                DE   QG  + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  139   SEADEGLSQGLDDGDDVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  197



>ref|XP_003556404.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Glycine max]
Length=513

 Score =   213 bits (543),  Expect(3) = 1e-143, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 161/206 (78%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFG+PVR+NM    +TNA V SSLLESVES DL AYGLIPEF+GRFPI +SLS
Sbjct  308   RRQDSSIGFGSPVRSNMRTGGVTNAAVTSSLLESVESADLIAYGLIPEFIGRFPILISLS  367

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL+QVL +PKNAL KQYK++F +NNVKLHFT+ AL++IAKKA+AK+TGARGLR++
Sbjct  368   ALTEDQLMQVLTEPKNALAKQYKKLFNMNNVKLHFTEKALRLIAKKAMAKNTGARGLRAL  427

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + GN+ +  V+VDEE+VGS++ PGCG KIL G+      L+    
Sbjct  428   LESILTEAMFEIPDVKAGNELIGAVVVDEESVGSVNAPGCGGKILCGDGALELYLAKMEG  487

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S       E  L+   +G+ E++SRA
Sbjct  488   SVANGAVAEPDLQ---EGESEISSRA  510


 Score =   194 bits (492),  Expect(3) = 1e-143, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AA+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  198   AGYVGEDVESILYKLLAAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  257

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTKNILFICGGAFI LEKTISER
Sbjct  258   LLKMLEGTMVNVPERGARKHPRGDNIQIDTKNILFICGGAFIDLEKTISER  308


 Score =   155 bits (391),  Expect(3) = 1e-143, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 89/119 (75%), Gaps = 15/119 (13%)
 Frame = +3

Query  744   WTG-LNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG  920
             W G  N+ +  PTPKEICKGLD+FV+GQ RAKKVLSVAVYNHY+RIY            G
Sbjct  90    WVGGSNLGRDFPTPKEICKGLDKFVIGQHRAKKVLSVAVYNHYQRIYQ-----------G  138

Query  921   KTVDE---QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                DE   QG  + D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  139   SEADEGLSQGLDDGDDVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  197



>ref|XP_008218637.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Prunus mume]
Length=597

 Score =   213 bits (542),  Expect(3) = 1e-143, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R QDSSIGFGAPVR NM  S LT+A+ AS+LLESVE+ DL AYGLIPEFVGRFPI VSLS
Sbjct  381   RLQDSSIGFGAPVRANMRTSKLTDAISASALLESVETGDLIAYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L+E+QLVQVL +PKNAL KQYK+MF +NNVKLHFTDNAL++IAKKA+AK+TGARGLR+I
Sbjct  441   SLNEDQLVQVLTEPKNALGKQYKKMFNMNNVKLHFTDNALRLIAKKAMAKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LE+ILT+AMFEVP+ +P  + V  VLVDEEAVGS+D PG GAKIL G+
Sbjct  501   LENILTDAMFEVPNIKPETNRVCAVLVDEEAVGSVDAPGLGAKILSGD  548


 Score =   191 bits (485),  Expect(3) = 1e-143, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 2/110 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL++LLM ADFDVEAA+ GIVYIDEVDKITKKAESL+  RDVSGEGVQQ L
Sbjct  274   GYVGEDVESILYRLLMEADFDVEAAQKGIVYIDEVDKITKKAESLS--RDVSGEGVQQAL  331

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVN+PD  ARKH RGDSIQ+DT+NILFICGGAF+GLEK ISER
Sbjct  332   LKMLEGTVVNIPDKGARKHPRGDSIQMDTRNILFICGGAFVGLEKAISER  381


 Score =   157 bits (398),  Expect(3) = 1e-143, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +3

Query  771   LPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFE  950
             LPTPKEI K LD+FVVGQERAKKVLSVAVYNHYKRI+ AS    +G ES  +   QG  +
Sbjct  168   LPTPKEIYKALDDFVVGQERAKKVLSVAVYNHYKRIHHASLQTRSGAESADS-KLQGVLD  226

Query  951   SDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             SD VEL+KSNVLLMGPTGSGKTLLAKTLAR+VNVPF IAD TTLTQ
Sbjct  227   SDSVELEKSNVLLMGPTGSGKTLLAKTLARVVNVPFAIADGTTLTQ  272


 Score =   132 bits (331),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +3

Query  246  PTTIRVIGLGLGFQRRCKWEGSSD-------NYDHLKAEVNCPRCSKPMTVLFSNRPLSI  404
            PT      L    Q+R KWEG           YDH++A+VNCPRCSK M VLFS RPLSI
Sbjct  33   PTHTHSSVLPNHHQQRHKWEGPIGGGRGSGGEYDHIRADVNCPRCSKQMAVLFSTRPLSI  92

Query  405  TAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENN  557
            T  ETG+YQA+NLCP+C+TAFYFRP KL PL G FIEIG++K     R N+
Sbjct  93   TGRETGLYQALNLCPNCKTAFYFRPLKLVPLHGTFIEIGRLKPKDDTRANS  143



>ref|XP_002519956.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
 gb|EEF42560.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
Length=698

 Score =   210 bits (534),  Expect(3) = 3e-143, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 160/209 (77%), Gaps = 7/209 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA V SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  491   RRQDSSIGFGAPVRANMRAGGVTNAAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLS  550

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL +PKNAL KQYK++F++N VKLHFT+ AL++IAKKA+AK+TGARGLR+I
Sbjct  551   ALTEDQLVRVLTEPKNALGKQYKKLFSMNKVKLHFTEKALRLIAKKAMAKNTGARGLRAI  610

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LES LTEAM+E+PD + G+D VD V+VDEE++GS++  G G KIL+G+      L S + 
Sbjct  611   LESTLTEAMYEIPDVKTGSDRVDAVIVDEESIGSVNASGHGGKILRGDGA----LESYLA  666

Query  2067  STDKAEKNEEALKGD---MDGDCEVASRA  2144
                  E  E    GD    DG+ EV+SRA
Sbjct  667   EYKLKESAENVEAGDTELQDGEPEVSSRA  695


 Score =   189 bits (481),  Expect(3) = 3e-143, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  381   AGYVGEDVESILYKLLSVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  440

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  441   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  491


 Score =   161 bits (407),  Expect(3) = 3e-143, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 7/113 (6%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKT--V  929
             N+ K LPTPKEIC+GLD+FV+GQ+RAKKVLSVAVYNHYKRIY AS  +  G ESG +  V
Sbjct  273   NLGKDLPTPKEICRGLDKFVIGQDRAKKVLSVAVYNHYKRIYHASLKKGPGEESGSSDAV  332

Query  930   DEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADAT LTQ
Sbjct  333   DDDDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATALTQ  380


 Score = 93.6 bits (231),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 75/161 (47%), Gaps = 43/161 (27%)
 Frame = +3

Query  276  LGFQRRCKWEGSSDNYD------HLKAEVNCPRCSKPMTVLFSNRPLSITAGETGI----  425
            +G Q R KW+G+ D  +       ++AE NCPRCSK M +LFSNR     +         
Sbjct  53   IGLQERYKWDGNGDGNNNNSDVRKIRAESNCPRCSKHMDLLFSNRHFPSPSSNNNPNLDS  112

Query  426  ------------YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTA  569
                        YQAVN CP C+TA+YFRP K+ PLQG+FIEIG+V  G     N     
Sbjct  113  TSNNNNCNTNNTYQAVNFCPSCKTAYYFRPYKITPLQGSFIEIGRV--GNNSPNNKSRNR  170

Query  570  AGSE-------------------NGKAAGKIWEKLRTYSGN  635
             GS                    +G+     W  LR+Y+G+
Sbjct  171  IGSLTKQHPSTEDLEEGFDSNAISGRLRASFWNTLRSYAGD  211



>ref|XP_006441089.1| hypothetical protein CICLE_v10019480mg [Citrus clementina]
 ref|XP_006493316.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X2 [Citrus sinensis]
 gb|ESR54329.1| hypothetical protein CICLE_v10019480mg [Citrus clementina]
Length=573

 Score =   203 bits (516),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 158/204 (77%), Gaps = 3/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSL+E+VES+DL AYGLIPEFVGRFP+ VSL 
Sbjct  368   RRQDSSIGFGAPVRANMRAGGVTDAVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLL  427

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N VKLHFT+NAL++IAKKAI+K+TGARGLRS+
Sbjct  428   ALTENQLVQVLTEPKNALGKQYRKMFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSL  487

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G++ +D V+VDEEAVGS D  GCGAKIL G  G  +R  +   
Sbjct  488   LENILMDAMYEIPDVRAGDEVIDAVVVDEEAVGSEDR-GCGAKILYGK-GALDRYLAQHK  545

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               D  E N     G+ + + E+ S
Sbjct  546   RKD-LETNVAGADGEPEMETEIPS  568


 Score =   187 bits (475),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  +D++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  259   GYVGEDVESILYKLLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  318

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  319   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  368


 Score =   169 bits (429),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+  K PTPKEICKGLD+FV+GQERAKKVLSVAVYNHY RIY+ SS + + GES
Sbjct  143   GCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQKRSAGES  202

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  203   SSCTTD--GVDDDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQ  257



>ref|XP_006441090.1| hypothetical protein CICLE_v10019480mg [Citrus clementina]
 ref|XP_006493315.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR54330.1| hypothetical protein CICLE_v10019480mg [Citrus clementina]
Length=575

 Score =   203 bits (517),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSL+E+VES+DL AYGLIPEFVGRFP+ VSL 
Sbjct  368   RRQDSSIGFGAPVRANMRAGGVTDAVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLL  427

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N VKLHFT+NAL++IAKKAI+K+TGARGLRS+
Sbjct  428   ALTENQLVQVLTEPKNALGKQYRKMFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSL  487

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G++ +D V+VDEEAVGS D  GCGAKIL G       L+    
Sbjct  488   LENILMDAMYEIPDVRAGDEVIDAVVVDEEAVGSEDR-GCGAKILYGKGALDRYLAQHKR  546

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
                + + N     G+ + + E+ S
Sbjct  547   KDLELQTNVAGADGEPEMETEIPS  570


 Score =   187 bits (475),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  +D++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  259   GYVGEDVESILYKLLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  318

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  319   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  368


 Score =   169 bits (429),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+  K PTPKEICKGLD+FV+GQERAKKVLSVAVYNHY RIY+ SS + + GES
Sbjct  143   GCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQKRSAGES  202

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  203   SSCTTD--GVDDDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQ  257



>ref|XP_010267611.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Nelumbo nucifera]
Length=581

 Score =   212 bits (539),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 162/202 (80%), Gaps = 6/202 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+R NM  S LTNA+VAS+LLE+VES+DL AYGLIPEF+GRFPI VSLS
Sbjct  376   RRQDSSIGFGAPIRANMRTSGLTNAIVASNLLENVESSDLIAYGLIPEFIGRFPILVSLS  435

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL++PKNAL KQY+++F +N VKLHFT+N+L++IA+KA+AK+TGARGLRSI
Sbjct  436   ALTEDQLVKVLIEPKNALGKQYRKLFQMNGVKLHFTENSLRVIARKAMAKNTGARGLRSI  495

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R GND +D V+VDEEAVG+ +  GCGAKIL G+      LS    
Sbjct  496   LENILMDAMYEIPDTRTGNDKIDAVVVDEEAVGAAEGHGCGAKILYGDGALDHYLSQ---  552

Query  2067  STDKAEKNEEALKGDMDGDCEV  2132
               +K   +E  L G  DG+ +V
Sbjct  553   --NKPSDSETILVGS-DGEPDV  571


 Score =   189 bits (480),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  ADF+V AA+ GIVYIDEVDKITKKAESLN+ RDVSGEGVQQ L
Sbjct  267   GYVGEDVESILYKLLAVADFNVTAAQQGIVYIDEVDKITKKAESLNLSRDVSGEGVQQAL  326

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  327   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  376


 Score =   158 bits (400),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N     PTPKEICK LD+FV+GQERAKKVLSVAVYNHYKRIY  S  +    + 
Sbjct  151   GCWGGANFGDHFPTPKEICKRLDKFVIGQERAKKVLSVAVYNHYKRIYYESLRKWPTEDL  210

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  E+   +SD VEL+KSN+LLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  211   DN--GERDEMDSDSVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  265



>gb|KDO54244.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=686

 Score =   203 bits (516),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSL+E+VES+DL AYGLIPEFVGRFP+ VSL 
Sbjct  479   RRQDSSIGFGAPVRANMRAGGVTDAVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLL  538

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N VKLHFT+NAL++IAKKAI+K+TGARGLRS+
Sbjct  539   ALTENQLVQVLTEPKNALGKQYRKMFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSL  598

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G++ +D V+VDEEAVGS D  GCGAKIL G       L+    
Sbjct  599   LENILMDAMYEIPDVRAGDEVIDAVVVDEEAVGSEDR-GCGAKILYGKGALDRYLAQHKR  657

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
                + + N     G+ + + E+ S
Sbjct  658   KDLELQTNVAGADGEPEMETEIPS  681


 Score =   187 bits (475),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  +D++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  370   GYVGEDVESILYKLLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  429

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  430   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  479


 Score =   169 bits (429),  Expect(3) = 5e-143, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+  K PTPKEICKGLD+FV+GQERAKKVLSVAVYNHY RIY+ SS + + GES
Sbjct  254   GCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQKRSAGES  313

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  314   SSCTTD--GVDDDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQ  368



>gb|KDO54245.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=684

 Score =   202 bits (515),  Expect(3) = 8e-143, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 158/204 (77%), Gaps = 3/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSL+E+VES+DL AYGLIPEFVGRFP+ VSL 
Sbjct  479   RRQDSSIGFGAPVRANMRAGGVTDAVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLL  538

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N VKLHFT+NAL++IAKKAI+K+TGARGLRS+
Sbjct  539   ALTENQLVQVLTEPKNALGKQYRKMFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSL  598

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G++ +D V+VDEEAVGS D  GCGAKIL G  G  +R  +   
Sbjct  599   LENILMDAMYEIPDVRAGDEVIDAVVVDEEAVGSEDR-GCGAKILYGK-GALDRYLAQHK  656

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               D  E N     G+ + + E+ S
Sbjct  657   RKD-LETNVAGADGEPEMETEIPS  679


 Score =   187 bits (475),  Expect(3) = 8e-143, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  +D++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  370   GYVGEDVESILYKLLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  429

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  430   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  479


 Score =   169 bits (429),  Expect(3) = 8e-143, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+  K PTPKEICKGLD+FV+GQERAKKVLSVAVYNHY RIY+ SS + + GES
Sbjct  254   GCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQKRSAGES  313

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  314   SSCTTD--GVDDDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQ  368



>ref|XP_009420156.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
 ref|XP_009420157.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
 ref|XP_009420158.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
 ref|XP_009420159.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=671

 Score =   214 bits (545),  Expect(3) = 8e-143, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR N+     TN+ V S+L+ESVES DL AYGLIPEF+GRFP+ VSLS
Sbjct  470   RRQDSSIGFGAPVRANLRTGGTTNSAVTSTLMESVESGDLVAYGLIPEFIGRFPVLVSLS  529

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L+E+QLVQVL +PKNAL KQYK+ F+LN+VKLHFTD AL++IA+KA+ K+TGARGLR+I
Sbjct  530   SLNEDQLVQVLTEPKNALGKQYKKTFSLNDVKLHFTDAALRLIARKAMVKNTGARGLRAI  589

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LES LTEAM+E+PD + GND VD ++VDE+A+GSLD  GCGAKIL+GN
Sbjct  590   LESTLTEAMYEIPDVKTGNDRVDAIVVDEDAIGSLDKSGCGAKILRGN  637


 Score =   183 bits (464),  Expect(3) = 8e-143, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AADF+V+AA+ GIVYIDEVDKI KKAESLN+ RDVSGEGVQQ 
Sbjct  360   AGYVGEDVESILYKLLAAADFNVQAAQQGIVYIDEVDKIAKKAESLNVSRDVSGEGVQQA  419

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+V+VP+  ARK SRG++IQI+TK+ILFICGGAF+ LEKTISER
Sbjct  420   LLKMLEGTMVSVPEKGARKQSRGETIQINTKDILFICGGAFVDLEKTISER  470


 Score =   162 bits (409),  Expect(3) = 8e-143, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LPTPKEICK LD+FV+GQ+RAKKVL+VAVYNHYKRI  +S+ + +G +S  
Sbjct  247   WGGSNLGKDLPTPKEICKALDKFVIGQDRAKKVLAVAVYNHYKRISHSSTKKGSGVDSDN  306

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E+  +  D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  307   VKAEKDEY--DDVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  359


 Score = 89.7 bits (221),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 76/135 (56%), Gaps = 21/135 (16%)
 Frame = +3

Query  288  RRCKWEGSSDNYDHLK---AEVNCPRCSKPMTVLFSNRPLSITAGETGI-----------  425
            RR    G   +  HL+   AE NCPRCSK M VLF+ +P S +A  T             
Sbjct  50   RRRSGAGGGTDATHLRRIRAEANCPRCSKHMEVLFATQPPSPSAAATAAGGGDVRRRGGG  109

Query  426  YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG-GVGERENNGNTAAGSE---NGKA  593
            YQA+NLCP CR++FYF P++L PLQG+F+EIG+V G   G+R+ +   AAG E     + 
Sbjct  110  YQALNLCPSCRSSFYFLPNRLVPLQGSFVEIGRVTGVEEGDRDRD---AAGGEVQTGDRV  166

Query  594  AGKIWEKLRTYSGNN  638
                W+ LR+  G +
Sbjct  167  KASFWDMLRSMYGGD  181



>gb|KDO54243.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=684

 Score =   202 bits (515),  Expect(3) = 8e-143, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 158/204 (77%), Gaps = 3/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSL+E+V+S+DL AYGLIPEFVGRFP+ VSL 
Sbjct  479   RRQDSSIGFGAPVRANMRAGGVTDAVVTSSLMETVKSSDLIAYGLIPEFVGRFPVLVSLL  538

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N VKLHFT+NAL++IAKKAI+K+TGARGLRS+
Sbjct  539   ALTENQLVQVLTEPKNALGKQYRKMFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSL  598

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G++ +D V+VDEEAVGS D  GCGAKIL G  G  +R  +   
Sbjct  599   LENILMDAMYEIPDVRAGDEVIDAVVVDEEAVGSEDR-GCGAKILYGK-GALDRYLAQHK  656

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               D  E N     G+ + + E+ S
Sbjct  657   RKD-LETNVAGADGEPEMETEIPS  679


 Score =   187 bits (475),  Expect(3) = 8e-143, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  +D++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  370   GYVGEDVESILYKLLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  429

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  430   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  479


 Score =   169 bits (428),  Expect(3) = 8e-143, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+  K PTPKEICKGLD+FV+GQERAKKVLSVAVYNHY RIY+ SS + + GES
Sbjct  254   GCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQKRSAGES  313

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  314   SSCTTD--GVDDDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQ  368



>ref|XP_010461164.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=644

 Score =   212 bits (539),  Expect(3) = 9e-143, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 160/296 (54%), Gaps = 51/296 (17%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPLSITA---------GETG--------IYQAVNLCPHCR  458
             L+AE NCPRCSK M +LFSNR    ++           +G         +Q+VN CP C+
Sbjct  68    LRAEPNCPRCSKQMDLLFSNRQFPSSSLLQRPDESDSSSGDGDEDSKTSFQSVNFCPTCK  127

Query  459   TAFYFRPSKLEPLQGNFIEIGQV-------------KGGVGERENNGNTAAG-SENGKAA  596
             TA+ F P  + PLQG FIEIG+V             K    +++++ +   G +   K  
Sbjct  128   TAYGFNPRGVSPLQGTFIEIGRVQSPTTNNTTTTTSKSTRKQQQHSKDPNQGFNYRNKLR  187

Query  597   GKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesmegs------------AG  740
                W+ LR+Y                   ++S  +      +                  
Sbjct  188   SSFWDTLRSYGAEPPEDWSPPPPHPPHPLNASPPNNIAPATNGAVKMDPSPLPDPANDVS  247

Query  741   EWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG  920
              W G ++ +  PTPKEICK LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + 
Sbjct  248   RWGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIY---HTSMKKGSAA  304

Query  921   KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             + +D+  N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  305   QPIDDDDN-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  355


 Score =   179 bits (455),  Expect(3) = 9e-143, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  357   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  416

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  417   LKLLEGTTVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  466


 Score =   167 bits (424),  Expect(3) = 9e-143, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 136/190 (72%), Gaps = 22/190 (12%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  466   RRQDSSIGFGAPVRANMATSGVTSGALTSSLLESVESADLTAYGLIPEFVGRFPILVSLS  525

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++V                     KLHFT+ AL++I+K+A+ K+TGARGLR++
Sbjct  526   ALTEDQLIRV---------------------KLHFTEKALEIISKQAMVKNTGARGLRAL  564

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G++ +D V+VDEE+ GS  + GC AK+L+G+ G  ER  S   
Sbjct  565   LESILTEAMFEIPDDKKGDERIDAVIVDEESTGSEASRGCTAKVLRGD-GAFERYLSENK  623

Query  2067  STDKAEKNEE  2096
             S D  E+  E
Sbjct  624   SKDTTEETVE  633



>ref|XP_009404286.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=682

 Score =   211 bits (537),  Expect(3) = 1e-142, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 164/209 (78%), Gaps = 7/209 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LTNA+V SSLLESVES+DL AYGLIPEFVGRFPI VSL 
Sbjct  475   RRQDSSIGFGAPVRANMRSGGLTNALVTSSLLESVESSDLIAYGLIPEFVGRFPILVSLL  534

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLVQVL +PKNAL +QY+++F++NNVKLHFT  AL++IAKKA+AK+TGARGLR+I
Sbjct  535   SLSEDQLVQVLTEPKNALGRQYRKLFSMNNVKLHFTGTALRLIAKKAMAKNTGARGLRAI  594

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LES+L EAMFE+PD + G + +D V+VDEEA+GS D PGCGAKIL+    G + L   ++
Sbjct  595   LESMLIEAMFEIPDVKTGCERIDAVVVDEEAIGSADKPGCGAKILR----GVDALEGYLS  650

Query  2067  STDKAEK---NEEALKGDMDGDCEVASRA  2144
               DK+      E A+ G+ +G+ E+ S A
Sbjct  651   ENDKSRDLVVEEVAVAGETEGESELTSGA  679


 Score =   187 bits (474),  Expect(3) = 1e-142, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  A+F+V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  365   AGYVGEDVESILYKLLTVAEFNVLAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  424

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  425   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  475


 Score =   160 bits (405),  Expect(3) = 1e-142, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ K  PTPKEICKGLD++V+GQERAKKVL+VAVYNHYKRIY AS  + +  + G   D 
Sbjct  256   NLGKNFPTPKEICKGLDKYVIGQERAKKVLAVAVYNHYKRIYHASLQKGSEADHG-NFDT  314

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +GN   D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  315   EGN-NDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  364


 Score =   105 bits (262),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 75/126 (60%), Gaps = 8/126 (6%)
 Frame = +3

Query  270  LGLGFQRRCKWEGSSDNYD--HLKAEVNCPRCSKPMTVLFSNR-PLSITAGETGI--YQA  434
            LGL  Q R KW+G +D +    ++AE  CPRCS  M +LFSNR P S+  G  G   YQA
Sbjct  68   LGLLRQERHKWDGGADEFHTRRIRAEAQCPRCSHHMDILFSNRSPPSVVGGGGGGGGYQA  127

Query  435  VNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKIWEK  614
            VN CP C+TA+YFRP +L PL+G F+EIG+++     +E   +   GS   +     WE 
Sbjct  128  VNFCPSCKTAYYFRPHRLAPLEGTFVEIGRLRDPESAKERADDEDNGS---RIKNLFWEA  184

Query  615  LRTYSG  632
            L++  G
Sbjct  185  LKSSYG  190



>ref|XP_008681399.1| PREDICTED: uncharacterized protein LOC100272848 isoform X2 [Zea 
mays]
Length=671

 Score =   208 bits (529),  Expect(3) = 1e-142, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 163/207 (79%), Gaps = 8/207 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM +   ++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  469   RRQDSSIGFGAPVRANMRVGGTSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLT  528

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQ+K++F++N+VKLHFTD AL++IA+KA++K+TGARGLR+I
Sbjct  529   ALNEDQLVQVLTEPKNALGKQFKKLFSMNDVKLHFTDGALRIIAEKAMSKNTGARGLRTI  588

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PDA+ G   +D V+VDE+AVGS+D PG GAKIL G+    + LS    
Sbjct  589   LENILMDSMYEIPDAKSGEKRIDAVVVDEDAVGSVDQPGYGAKILYGDGALDQYLSHIKV  648

Query  2067  STDKAEKNEEALKGDMDGDCEVA-SRA  2144
             + D        +  +MDG+ E++ SRA
Sbjct  649   AGD-------GVASEMDGEAELSPSRA  668


 Score =   190 bits (483),  Expect(3) = 1e-142, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  359   AGYVGEDVESILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  418

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  419   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  469


 Score =   160 bits (405),  Expect(3) = 1e-142, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ + LPTPKEICKGLD++V+GQ+RAKKVLSVAVYNHYKRIY  S  + +G + G 
Sbjct  246   WGGSNLGRDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQSLQKGSGADLGG  305

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               D + + +++ VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  306   -FDGEADDDNN-VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  358


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 62/110 (56%), Gaps = 21/110 (19%)
 Frame = +3

Query  237  PPPPTTIRVIGLGLGFQRRCKWEGSSDNYD------------HLKAEVNCPRCSKPMTVL  380
            PPPP            Q R KWE SS +               ++AE +CPRCSK M +L
Sbjct  69   PPPPHR--------RLQERRKWESSSGSGGSSSSSTDEPEPRRIRAEAHCPRCSKHMDIL  120

Query  381  FSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
            FS+R     A   G YQA+NLCP+CR+A++F P  L PLQG F+EIG+V+
Sbjct  121  FSHRGPPTAAAAAG-YQALNLCPNCRSAYFFHPHVLAPLQGTFVEIGRVR  169



>ref|XP_004307989.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Fragaria vesca subsp. vesca]
Length=572

 Score =   202 bits (513),  Expect(3) = 1e-142, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSLLE VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  366   RRQDSSIGFGAPVRANMRTGGVTDAVVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLS  425

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK+MF +N+V+LHFT +AL++IAKKAI+K+TGARGLR+I
Sbjct  426   ALTEDQLVQVLTEPKNALGKQYKKMFQMNDVRLHFTKSALRLIAKKAISKNTGARGLRAI  485

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G+D +D V++DEEAVG+ D  GCGAKIL G  G  +R  S   
Sbjct  486   LETILMDAMYEIPDVRTGDDIIDAVVIDEEAVGT-DGQGCGAKILYGK-GALDRYLSQNK  543

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               D      E    + +G+ E++S
Sbjct  544   EKDVQIATTEGSDVEPEGEAELSS  567


 Score =   187 bits (476),  Expect(3) = 1e-142, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  257   GYVGEDVESILYKLLSVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  316

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  317   LKMLEGTVVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  366


 Score =   169 bits (428),  Expect(3) = 1e-142, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 93/117 (79%), Gaps = 3/117 (3%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+    PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY  S  + + G+S
Sbjct  139   GCWGGSNLGGSFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHESQQKWSAGDS  198

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G   D   +   D VEL+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  199   GNKADAMND---DRVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  252



>ref|XP_002272792.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Vitis vinifera]
 ref|XP_010662855.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Vitis vinifera]
Length=583

 Score =   205 bits (522),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 154/201 (77%), Gaps = 6/201 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM     T+A VASSLLE+VES+DL +YGLIPEFVGRFPI VSLS
Sbjct  377   RRQDSSIGFGAPVRANMRTGGPTDAAVASSLLETVESSDLISYGLIPEFVGRFPILVSLS  436

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT NAL++I++KA++K+TGARGLRSI
Sbjct  437   ALTENQLVEVLTEPKNALGKQYKKMFQMNGVKLHFTKNALRLISRKAMSKNTGARGLRSI  496

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL  AM+E+PD R GND +D V+VD+EAVGS D  G GAKIL G       LS    
Sbjct  497   LENILMNAMYEIPDVRTGNDIIDAVVVDDEAVGS-DGHGFGAKILYGKGALDCYLSQ---  552

Query  2067  STDKAEKNEEALKGDMDGDCE  2129
                K ++ E  ++G  DG+ E
Sbjct  553   --HKLKETETPMEGSSDGEAE  571


 Score =   192 bits (487),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLM AD++V AA+ GIVYIDEVDKITKKAESLN+ RDVSGEGVQQ L
Sbjct  268   GYVGEDVESILYKLLMVADYNVAAAQQGIVYIDEVDKITKKAESLNLSRDVSGEGVQQAL  327

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  328   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  377


 Score =   160 bits (406),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC+GLD+FV+GQERAKKVLSVAVYNHYKRIY  S  +    ++  
Sbjct  154   WGGSNLGHNFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIYHQSLQKWPAEDTSD  213

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               D+    ++D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  214   --DKAEATDNDSVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  266



>ref|XP_009349952.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Pyrus x bretschneideri]
Length=587

 Score =   207 bits (526),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  381   RRQDSSIGFGAPVRANMRTGGVTDAAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT++AL++IA+KAI+K+TGARGLR+I
Sbjct  441   ALTENQLVEVLTEPKNALGKQYKKMFRMNGVKLHFTESALRLIARKAISKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+P+ R G+D +D V++DEEAVG LD  GCGAKIL G  G  +R  S   
Sbjct  501   LENILMDAMYEIPEVRTGDDIIDAVVIDEEAVG-LDGKGCGAKILYGK-GALDRYHSQNK  558

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             + D      E   G+ + + E++S
Sbjct  559   AKDAEIATTEVTDGEPEAETELSS  582


 Score =   189 bits (480),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  272   GYVGEDVESILYKLLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  331

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  332   LKMLEGTVVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   161 bits (408),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 92/116 (79%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC+GLD+FV+GQE+AKKVLSVAVYNHYKRIY  S  + + G+S  
Sbjct  158   WGGSNLGNNFPTPKEICQGLDKFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSTGDSSN  217

Query  924   -TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               VD     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  218   GKVDA---MDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  270



>ref|XP_008681398.1| PREDICTED: uncharacterized protein LOC100272848 isoform X1 [Zea 
mays]
Length=672

 Score =   208 bits (529),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 163/207 (79%), Gaps = 8/207 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM +   ++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  470   RRQDSSIGFGAPVRANMRVGGTSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLT  529

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQ+K++F++N+VKLHFTD AL++IA+KA++K+TGARGLR+I
Sbjct  530   ALNEDQLVQVLTEPKNALGKQFKKLFSMNDVKLHFTDGALRIIAEKAMSKNTGARGLRTI  589

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PDA+ G   +D V+VDE+AVGS+D PG GAKIL G+    + LS    
Sbjct  590   LENILMDSMYEIPDAKSGEKRIDAVVVDEDAVGSVDQPGYGAKILYGDGALDQYLSHIKV  649

Query  2067  STDKAEKNEEALKGDMDGDCEVA-SRA  2144
             + D        +  +MDG+ E++ SRA
Sbjct  650   AGD-------GVASEMDGEAELSPSRA  669


 Score =   190 bits (483),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  360   AGYVGEDVESILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  419

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  420   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  470


 Score =   159 bits (403),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 94/120 (78%), Gaps = 11/120 (9%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ + LPTPKEICKGLD++V+GQ+RAKKVLSVAVYNHYKRIY  S   +  G SG 
Sbjct  246   WGGSNLGRDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQS---LQKGRSGA  302

Query  924   TVDEQGNFESDF-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              +   G F+ +      VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  303   DL---GGFDGEADDDNNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  359


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 62/110 (56%), Gaps = 21/110 (19%)
 Frame = +3

Query  237  PPPPTTIRVIGLGLGFQRRCKWEGSSDNYD------------HLKAEVNCPRCSKPMTVL  380
            PPPP            Q R KWE SS +               ++AE +CPRCSK M +L
Sbjct  69   PPPPHR--------RLQERRKWESSSGSGGSSSSSTDEPEPRRIRAEAHCPRCSKHMDIL  120

Query  381  FSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
            FS+R     A   G YQA+NLCP+CR+A++F P  L PLQG F+EIG+V+
Sbjct  121  FSHRGPPTAAAAAG-YQALNLCPNCRSAYFFHPHVLAPLQGTFVEIGRVR  169



>ref|XP_009352024.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=587

 Score =   207 bits (526),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  381   RRQDSSIGFGAPVRANMRTGGVTDAAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT++AL++IA +AI+K+TGARGLR+I
Sbjct  441   ALTENQLVEVLTEPKNALGKQYKKMFRMNGVKLHFTESALRLIATRAISKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+P+ R G+D +D V++DEEAVG LD  GCGAKIL G  G  +R  S   
Sbjct  501   LENILMDAMYEIPEVRTGDDIIDAVVIDEEAVG-LDGKGCGAKILYGK-GALDRYHSQNK  558

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             + D      E   G+ + + E++S
Sbjct  559   AKDAEIATPEGTDGEPEAETELSS  582


 Score =   189 bits (480),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  272   GYVGEDVESILYKLLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  331

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  332   LKMLEGTVVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   161 bits (408),  Expect(3) = 2e-142, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 92/116 (79%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC+GLD+FV+GQE+AKKVLSVAVYNHYKRIY  S  + + G+S  
Sbjct  158   WGGSNLGNNFPTPKEICQGLDKFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSTGDSSN  217

Query  924   -TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               VD     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  218   GKVDAT---DDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  270



>ref|XP_009119879.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Brassica rapa]
Length=551

 Score =   198 bits (504),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  343   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  402

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL++VL +PKNAL KQYK+M+ +N+VKLHFT+ AL++IA+KAI K+TGARGLR++
Sbjct  403   ALTENQLMEVLTEPKNALGKQYKKMYQMNSVKLHFTETALRLIARKAITKNTGARGLRAL  462

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G D ++ V+VDEEAV      G GAKIL+G    S  LS    
Sbjct  463   LESILMDSMYEIPDEGTGKDMIEAVVVDEEAVEGEGRRGSGAKILRGKGALSLYLSETTK  522

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D     +E  +G+++ + E+ S
Sbjct  523   SKDSPRTTKEGSEGEIEVEAEIPS  546


 Score =   190 bits (482),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  234   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  293

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  294   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  343


 Score =   169 bits (428),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY  SS + + GE+  
Sbjct  120   WGGSNLGSSFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYYESSQKRSTGETEG  179

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +  +   D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  180   TAAKPAD--DDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  232



>gb|AFW71882.1| hypothetical protein ZEAMMB73_870207 [Zea mays]
Length=642

 Score =   207 bits (528),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 163/207 (79%), Gaps = 8/207 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM +   ++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  440   RRQDSSIGFGAPVRANMRVGGTSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLT  499

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQ+K++F++N+VKLHFTD AL++IA+KA++K+TGARGLR+I
Sbjct  500   ALNEDQLVQVLTEPKNALGKQFKKLFSMNDVKLHFTDGALRIIAEKAMSKNTGARGLRTI  559

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PDA+ G   +D V+VDE+AVGS+D PG GAKIL G+    + LS    
Sbjct  560   LENILMDSMYEIPDAKSGEKRIDAVVVDEDAVGSVDQPGYGAKILYGDGALDQYLSHIKV  619

Query  2067  STDKAEKNEEALKGDMDGDCEVA-SRA  2144
             + D        +  +MDG+ E++ SRA
Sbjct  620   AGD-------GVASEMDGEAELSPSRA  639


 Score =   189 bits (481),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  330   AGYVGEDVESILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  389

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  390   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  440


 Score =   160 bits (404),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ + LPTPKEICKGLD++V+GQ+RAKKVLSVAVYNHYKRIY  S  + +G + G 
Sbjct  217   WGGSNLGRDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQSLQKGSGADLG-  275

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               D + + +++ VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  276   GFDGEADDDNN-VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  329


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 62/110 (56%), Gaps = 21/110 (19%)
 Frame = +3

Query  237  PPPPTTIRVIGLGLGFQRRCKWEGSSDNYD------------HLKAEVNCPRCSKPMTVL  380
            PPPP            Q R KWE SS +               ++AE +CPRCSK M +L
Sbjct  40   PPPPHR--------RLQERRKWESSSGSGGSSSSSTDEPEPRRIRAEAHCPRCSKHMDIL  91

Query  381  FSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
            FS+R     A   G YQA+NLCP+CR+A++F P  L PLQG F+EIG+V+
Sbjct  92   FSHRGPPTAAAAAG-YQALNLCPNCRSAYFFHPHVLAPLQGTFVEIGRVR  140



>ref|XP_008234752.1| PREDICTED: mitochondrial clpX-like chaperone MCX1 [Prunus mume]
Length=588

 Score =   204 bits (519),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 158/203 (78%), Gaps = 7/203 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE+VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  381   RRQDSSIGFGAPVRANMRTGGVTDAAVTSSLLETVESSDLIRYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQYK+MF +N VKLHFT++AL++IA+KAI+K+TGARGLR+I
Sbjct  441   ALTENQLVQVLTEPKNALGKQYKKMFRMNGVKLHFTESALRLIARKAISKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G+D +D V++DEEAVGS +  G GAKIL G       LS    
Sbjct  501   LENILMDAMYEIPDVRAGDDIIDAVVIDEEAVGS-EAQGSGAKILYGKGALDHYLSR---  556

Query  2067  STDKAEKNEEA-LKGDMDGDCEV  2132
               +KA++ E A  +G  DG+ EV
Sbjct  557   --NKAKEVETATTEGSSDGEPEV  577


 Score =   189 bits (479),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  272   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  331

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  332   LKMLEGTIVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   164 bits (416),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G ++    PTPKEICKGLD+FV+GQE+AKKVLSVAVYNHYKRIY  S  + + G+SG 
Sbjct  158   WGGSSLGNNFPTPKEICKGLDKFVIGQEQAKKVLSVAVYNHYKRIYHESLQKWSAGDSGN  217

Query  924   T-VDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             + VD     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  218   SKVDA---MDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  270



>ref|XP_008376716.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Malus domestica]
Length=587

 Score =   205 bits (522),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 154/201 (77%), Gaps = 6/201 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  381   RRQDSSIGFGAPVRANMRTGGVTDAAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT++AL++IA+KAI+K+TGARGLR+I
Sbjct  441   ALTENQLVEVLTEPKNALGKQYKKMFRMNGVKLHFTESALRLIARKAISKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G+D +D V++DEEAVG LD  GCGAKIL G       LS    
Sbjct  501   LENILMDAMYEIPDVRTGDDIIDAVVIDEEAVG-LDGKGCGAKILYGKGALDHYLSQ---  556

Query  2067  STDKAEKNEEALKGDMDGDCE  2129
               +K +  E A K   DG+ E
Sbjct  557   --NKPKDVEIAAKEGSDGEPE  575


 Score =   189 bits (479),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  272   GYVGEDVESILYKLLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  331

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  332   LKMLEGTVVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   163 bits (413),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ +  PTPKEIC+GLD+FV+GQE+AKKVLSVAVYNHYKRIY  S  + + G+S  
Sbjct  158   WGGSNLGRNFPTPKEICQGLDKFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSAGDSSN  217

Query  924   -TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               VD     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  218   GKVDA---MDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  270



>ref|XP_010499878.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Camelina sativa]
Length=645

 Score =   210 bits (535),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 156/297 (53%), Gaps = 52/297 (18%)
 Frame = +3

Query  330   LKAEVNCPRCSKPMTVLFSNRPLSITA-----------------GETGIYQAVNLCPHCR  458
             L+AE NCPRCSK M +LFSNR    ++                      +Q+VN CP C+
Sbjct  68    LRAEPNCPRCSKQMDLLFSNRQFPSSSLLQRPDEYDSSSGDGDGDSKTSFQSVNFCPTCK  127

Query  459   TAFYFRPSKLEPLQGNFIEIGQV-------------KGGVGERENNGNTAAG-SENGKAA  596
             TA+ F P  + PLQG FIEIG+V             K    ++ ++ +   G +   K  
Sbjct  128   TAYGFNPRGVSPLQGTFIEIGRVQSPTTNNTTTTTSKSTRKQQHHSKDPNQGFNYRNKLR  187

Query  597   GKIWEKLRTYSGNNsssdvgessstsdscsssssseteveesm-------------egsA  737
                W+ LR+Y                    ++S        +                  
Sbjct  188   SSFWDTLRSYGAEPPEDWSPPPPPHPPHPLNASPPNNIAPATNGAVKMDPSPLPDPANDV  247

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
               W G ++ +  PTPKEICK LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G +
Sbjct  248   SRWGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIY---HTSMKKGSA  304

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + +D+  N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  305   AQPIDDDDN-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  356


 Score =   179 bits (455),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  358   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  417

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH RGD +QIDTK+ILFICGGAF+ LEKTI +R
Sbjct  418   LKLLEGTIVNVPGKGARKHPRGDHLQIDTKDILFICGGAFVDLEKTIVDR  467


 Score =   167 bits (423),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 135/190 (71%), Gaps = 22/190 (12%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  467   RRQDSSIGFGAPVRANMATSGVTSGALTSSLLESVESADLTAYGLIPEFVGRFPILVSLS  526

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++V                     KLHFT+ AL++I+K+A+ K+TGARGLR++
Sbjct  527   ALTEDQLIRV---------------------KLHFTEKALEIISKQAMVKNTGARGLRAL  565

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G++ +D V+VDEE+ GS  + GC AK+L+G+ G  ER  S   
Sbjct  566   LESILTEAMFEIPDDKKGDERIDAVIVDEESTGSEASRGCTAKVLKGD-GAFERYLSENK  624

Query  2067  STDKAEKNEE  2096
             S D  E   E
Sbjct  625   SKDATEATVE  634



>gb|KDO54242.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=684

 Score =   202 bits (515),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 158/204 (77%), Gaps = 3/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSL+E+VES+DL AYGLIPEFVGRFP+ VSL 
Sbjct  479   RRQDSSIGFGAPVRANMRAGGVTDAVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLL  538

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N VKLHFT+NAL++IAKKAI+K+TGARGLRS+
Sbjct  539   ALTENQLVQVLTEPKNALGKQYRKMFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSL  598

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G++ +D V+VDEEAVGS D  GCGAKIL G  G  +R  +   
Sbjct  599   LENILMDAMYEIPDVRAGDEVIDAVVVDEEAVGSEDR-GCGAKILYGK-GALDRYLAQHK  656

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               D  E N     G+ + + E+ S
Sbjct  657   RKD-LETNVAGADGEPEMETEIPS  679


 Score =   185 bits (469),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KLL  +D++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ LL
Sbjct  371   YVGEDVESILYKLLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALL  430

Query  1271  KMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             KMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  431   KMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  479


 Score =   169 bits (429),  Expect(3) = 3e-142, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+  K PTPKEICKGLD+FV+GQERAKKVLSVAVYNHY RIY+ SS + + GES
Sbjct  254   GCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQKRSAGES  313

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  314   SSCTTD--GVDDDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQ  368



>ref|XP_002516670.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
 gb|EEF45689.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
Length=565

 Score =   199 bits (507),  Expect(3) = 4e-142, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 156/206 (76%), Gaps = 11/206 (5%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM + ++T+A V SSLLE+VES DL +YGLIPEFVGRFP+ VSLS
Sbjct  360   RRQDSSIGFGAPVRANMRMGSVTSAAVTSSLLETVESGDLISYGLIPEFVGRFPVLVSLS  419

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQYK+MF +N V+LHFT+NAL++IAKKAI K+TGARGLR+I
Sbjct  420   ALTENQLVQVLTEPKNALGKQYKKMFQMNGVRLHFTENALRLIAKKAITKNTGARGLRAI  479

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGC--GAKILQGNAGGSERLSSA  2060
             LE+IL +AM+E+PD + G D +D V+VDEEAVG   T GC  G +IL G       L+  
Sbjct  480   LENILMDAMYEIPDVKTGEDIIDAVVVDEEAVG---TEGCGTGGRILYGKGALDRYLAE-  535

Query  2061  MTSTDKAEKNEEALKGDMDGDCEVAS  2138
                 +K + +E  + G  DGD EV +
Sbjct  536   ----NKLKDSERTVDGS-DGDPEVET  556


 Score =   193 bits (490),  Expect(3) = 4e-142, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLMAAD++V AA+ GIVYIDEVDKITKKAES+NI RDVSGEGVQQ L
Sbjct  251   GYVGEDVESILYKLLMAADYNVAAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL  310

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  311   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  360


 Score =   164 bits (415),  Expect(3) = 4e-142, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 93/117 (79%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G ++    PTPKEIC+GLD+FV+GQ+RAKKVLSVAVYNHYKRIY  S  + + G+S
Sbjct  135   GCWGGSDLGNNFPTPKEICRGLDKFVIGQDRAKKVLSVAVYNHYKRIYHDSIQKWSAGDS  194

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G    E    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  195   GNNKAEA--MDEDGVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  249



>ref|XP_008380812.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Malus domestica]
Length=587

 Score =   206 bits (525),  Expect(3) = 4e-142, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  381   RRQDSSIGFGAPVRANMRTGGVTDAAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT++AL++IA+KAI+K+TGARGLR+I
Sbjct  441   ALTENQLVEVLTEPKNALGKQYKKMFRMNGVKLHFTESALRLIARKAISKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+P+ R G+D +D V++DEEAVG LD  GCGAKIL G  G  +R  S   
Sbjct  501   LENILMDAMYEIPEVRTGDDIIDAVVIDEEAVG-LDGKGCGAKILYGK-GALDRYHSQNK  558

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             + D      E   G+ + + E++S
Sbjct  559   AKDAEIATTEGSDGEPEAETELSS  582


 Score =   189 bits (480),  Expect(3) = 4e-142, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  272   GYVGEDVESILYKLLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  331

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  332   LKMLEGTVVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   161 bits (407),  Expect(3) = 4e-142, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 91/116 (78%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC+GLD FV+GQE+AKKVLSVAVYNHYKRIY  S  + + G+S  
Sbjct  158   WGGSNLGNNFPTPKEICQGLDTFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSTGDSSN  217

Query  924   -TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               VD     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  218   GKVDA---MDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  270



>ref|XP_007023127.1| ATP-dependent Clp protease isoform 2 [Theobroma cacao]
 gb|EOY25749.1| ATP-dependent Clp protease isoform 2 [Theobroma cacao]
Length=547

 Score =   216 bits (551),  Expect(3) = 5e-142, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 152/183 (83%), Gaps = 1/183 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  S LT A V SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  362   RRQDSSIGFGAPVRANMRSSGLTTAAVTSSLLESVESDDLIAYGLIPEFIGRFPILVSLS  421

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
              L+E+QLV+VLMKPKNAL KQYK+MF++N VKLHFT NAL++I+KKA+AK+TGARGLR+I
Sbjct  422   GLNEDQLVEVLMKPKNALGKQYKKMFSMNGVKLHFTANALRLISKKAMAKNTGARGLRAI  481

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAMFE+PD +  + GV+ VLVDEEAVGS D  GCGAKIL G+ G  +R  +  T
Sbjct  482   LENILTEAMFEIPDTKMESQGVNAVLVDEEAVGSFDETGCGAKILYGD-GELDRFLAKRT  540

Query  2067  STD  2075
               D
Sbjct  541   WKD  543


 Score =   186 bits (473),  Expect(3) = 5e-142, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ A+FDVEAA+HGIVYIDEVDKITKKAES NIGRDVSGEGVQQ L
Sbjct  251   GYVGEDVESILYKLLVEAEFDVEAAQHGIVYIDEVDKITKKAESSNIGRDVSGEGVQQAL  310

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNV  PD  AR++ RGDS QIDTK+ILF+CGGAFI LEKTISER
Sbjct  311   LKLLEGTIVNVPLPDKGARRYPRGDSFQIDTKDILFVCGGAFIDLEKTISER  362


 Score =   154 bits (388),  Expect(3) = 5e-142, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 5/108 (5%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             ++LPTPKEIC  LDEFV+GQ++AKKVLSVAVYNHYKRIY AS    A       + +  N
Sbjct  147   RELPTPKEICGRLDEFVIGQQKAKKVLSVAVYNHYKRIYHASQQNEAC-----ILGDDEN  201

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               +DFVELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPFVI DATTLTQ
Sbjct  202   DANDFVELDKSNVLLIGPTGSGKTLLAKTLARIVNVPFVIVDATTLTQ  249


 Score =   129 bits (324),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  291  RCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFY  470
            R KW+G    YDH++A+VNCPRC   M VLFSNRPLSITA E G+YQA+NLCP+C+TAFY
Sbjct  33   RQKWDGV--EYDHIRADVNCPRCFNQMPVLFSNRPLSITAREPGLYQALNLCPNCKTAFY  90

Query  471  FRPSKLEPLQGNFIEIGQVKG  533
            FRP KL PLQG+F+E+G++ G
Sbjct  91   FRPFKLVPLQGSFVELGRIMG  111



>gb|AFW71881.1| hypothetical protein ZEAMMB73_870207 [Zea mays]
Length=643

 Score =   207 bits (528),  Expect(3) = 6e-142, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 163/207 (79%), Gaps = 8/207 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM +   ++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  441   RRQDSSIGFGAPVRANMRVGGTSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLT  500

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQ+K++F++N+VKLHFTD AL++IA+KA++K+TGARGLR+I
Sbjct  501   ALNEDQLVQVLTEPKNALGKQFKKLFSMNDVKLHFTDGALRIIAEKAMSKNTGARGLRTI  560

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PDA+ G   +D V+VDE+AVGS+D PG GAKIL G+    + LS    
Sbjct  561   LENILMDSMYEIPDAKSGEKRIDAVVVDEDAVGSVDQPGYGAKILYGDGALDQYLSHIKV  620

Query  2067  STDKAEKNEEALKGDMDGDCEVA-SRA  2144
             + D        +  +MDG+ E++ SRA
Sbjct  621   AGD-------GVASEMDGEAELSPSRA  640


 Score =   189 bits (481),  Expect(3) = 6e-142, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  331   AGYVGEDVESILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  390

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  391   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  441


 Score =   159 bits (401),  Expect(3) = 6e-142, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 94/120 (78%), Gaps = 11/120 (9%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ + LPTPKEICKGLD++V+GQ+RAKKVLSVAVYNHYKRIY  S   +  G SG 
Sbjct  217   WGGSNLGRDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQS---LQKGRSGA  273

Query  924   TVDEQGNFESDF-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              +   G F+ +      VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  274   DL---GGFDGEADDDNNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  330


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 62/110 (56%), Gaps = 21/110 (19%)
 Frame = +3

Query  237  PPPPTTIRVIGLGLGFQRRCKWEGSSDNYD------------HLKAEVNCPRCSKPMTVL  380
            PPPP            Q R KWE SS +               ++AE +CPRCSK M +L
Sbjct  40   PPPPHR--------RLQERRKWESSSGSGGSSSSSTDEPEPRRIRAEAHCPRCSKHMDIL  91

Query  381  FSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
            FS+R     A   G YQA+NLCP+CR+A++F P  L PLQG F+EIG+V+
Sbjct  92   FSHRGPPTAAAAAG-YQALNLCPNCRSAYFFHPHVLAPLQGTFVEIGRVR  140



>ref|XP_009357301.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Pyrus x bretschneideri]
Length=587

 Score =   207 bits (527),  Expect(3) = 7e-142, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 154/201 (77%), Gaps = 6/201 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  381   RRQDSSIGFGAPVRANMRTGGVTDAAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT++AL++IA+KAI+K+TGARGLR+I
Sbjct  441   ALTENQLVEVLTEPKNALGKQYKKMFRMNGVKLHFTESALRLIARKAISKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AMFE+PD R G+D +D V++DEEAVG LD  GCGAKIL G       LS    
Sbjct  501   LENILMDAMFEIPDVRTGDDIIDAVVIDEEAVG-LDGKGCGAKILYGKGALDHYLSQ---  556

Query  2067  STDKAEKNEEALKGDMDGDCE  2129
               +K +  E A K   DG+ E
Sbjct  557   --NKPKDVETAAKEGSDGEPE  575


 Score =   188 bits (478),  Expect(3) = 7e-142, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  271   AGYVGEDVESILYKLLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  330

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVVNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  331   LLKMLEGTVVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   160 bits (405),  Expect(3) = 7e-142, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 92/116 (79%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G  + K  PTPKEIC+GLD+FV+GQ++AKKVLSVAVYNHYKRIY  S  + + G+S  
Sbjct  158   WGGSKLGKNFPTPKEICQGLDKFVIGQDKAKKVLSVAVYNHYKRIYHESLQKWSAGDSSN  217

Query  924   -TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               VD     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  218   GKVDA---MDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  270



>emb|CBI23009.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   205 bits (522),  Expect(3) = 9e-142, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 154/201 (77%), Gaps = 6/201 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM     T+A VASSLLE+VES+DL +YGLIPEFVGRFPI VSLS
Sbjct  377   RRQDSSIGFGAPVRANMRTGGPTDAAVASSLLETVESSDLISYGLIPEFVGRFPILVSLS  436

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT NAL++I++KA++K+TGARGLRSI
Sbjct  437   ALTENQLVEVLTEPKNALGKQYKKMFQMNGVKLHFTKNALRLISRKAMSKNTGARGLRSI  496

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL  AM+E+PD R GND +D V+VD+EAVGS D  G GAKIL G       LS    
Sbjct  497   LENILMNAMYEIPDVRTGNDIIDAVVVDDEAVGS-DGHGFGAKILYGKGALDCYLSQ---  552

Query  2067  STDKAEKNEEALKGDMDGDCE  2129
                K ++ E  ++G  DG+ E
Sbjct  553   --HKLKETETPMEGSSDGEAE  571


 Score =   189 bits (481),  Expect(3) = 9e-142, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KLLM AD++V AA+ GIVYIDEVDKITKKAESLN+ RDVSGEGVQQ LL
Sbjct  269   YVGEDVESILYKLLMVADYNVAAAQQGIVYIDEVDKITKKAESLNLSRDVSGEGVQQALL  328

Query  1271  KMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             KMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  329   KMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  377


 Score =   160 bits (406),  Expect(3) = 9e-142, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC+GLD+FV+GQERAKKVLSVAVYNHYKRIY  S  +    ++  
Sbjct  154   WGGSNLGHNFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIYHQSLQKWPAEDTSD  213

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               D+    ++D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  214   --DKAEATDNDSVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  266



>ref|XP_003575174.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Brachypodium distachyon]
Length=640

 Score =   205 bits (521),  Expect(3) = 1e-141, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 155/193 (80%), Gaps = 2/193 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR +M    +++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  438   RRQDSSIGFGAPVRASMRTGGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLA  497

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQ++++F++NNVKLHFTD+AL++IAKKA+ K+TGARGLR+I
Sbjct  498   ALNEDQLVQVLTEPKNALGKQFRKLFSMNNVKLHFTDSALRIIAKKAMCKNTGARGLRTI  557

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSS--A  2060
             LE+IL ++M+E+PD + G   +D V+VDE+AVGS+D PGCGAKIL G+      LS   A
Sbjct  558   LENILMDSMYEIPDTKSGEKRIDAVVVDEDAVGSVDRPGCGAKILYGDGSFDHYLSQIKA  617

Query  2061  MTSTDKAEKNEEA  2099
             M     +E + EA
Sbjct  618   MGDGAGSEADGEA  630


 Score =   190 bits (482),  Expect(3) = 1e-141, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  328   AGYVGEDVESILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  387

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  388   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  438


 Score =   160 bits (405),  Expect(3) = 1e-141, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K  PTPKEI KGLD++V+GQERAKKVLSVAVYNHYKRIY  S  + +G + G 
Sbjct  215   WGGSNLGKDFPTPKEISKGLDKYVIGQERAKKVLSVAVYNHYKRIYHQSVQKGSGADLGS  274

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  E      D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  275   SDGEADG--DDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  327


 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 3/69 (4%)
 Frame = +3

Query  330  LKAEVNCPRCSKPMTVLFSNR--PLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQG  503
            ++AE +CPRCSK M +LFS+R  P S  AG  G YQA+NLCP+CRTA++FRP+ L PLQG
Sbjct  72   IRAEAHCPRCSKHMDILFSHRAPPSSAPAGAGG-YQALNLCPNCRTAYFFRPNILAPLQG  130

Query  504  NFIEIGQVK  530
             F+EIG+V+
Sbjct  131  TFVEIGRVR  139



>ref|XP_007218873.1| hypothetical protein PRUPE_ppa003261mg [Prunus persica]
 gb|EMJ20072.1| hypothetical protein PRUPE_ppa003261mg [Prunus persica]
Length=588

 Score =   204 bits (520),  Expect(3) = 1e-141, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 158/203 (78%), Gaps = 7/203 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE+VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  381   RRQDSSIGFGAPVRANMRTGGVTDAAVTSSLLETVESSDLIRYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQYK+MF +N VKLHFT++AL++IA+KAI+K+TGARGLR+I
Sbjct  441   ALTENQLVQVLTEPKNALGKQYKKMFRMNGVKLHFTESALRLIARKAISKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G+D +D V++DEEAVGS +  G GAKIL G       LS    
Sbjct  501   LENILMDAMYEIPDVRAGDDIIDAVVIDEEAVGS-EAQGSGAKILYGKGALDHYLSQ---  556

Query  2067  STDKAEKNEEA-LKGDMDGDCEV  2132
               +KA++ E A  +G  DG+ EV
Sbjct  557   --NKAKEVETATTEGSSDGEPEV  577


 Score =   186 bits (473),  Expect(3) = 1e-141, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ LL
Sbjct  273   YVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALL  332

Query  1271  KMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             KMLEGT+VNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  333   KMLEGTIVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   164 bits (416),  Expect(3) = 1e-141, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G ++    PTPKEICKGLD+FV+GQE+AKKVLSVAVYNHYKRIY  S  + + G+SG 
Sbjct  158   WGGSSLGNNFPTPKEICKGLDKFVIGQEQAKKVLSVAVYNHYKRIYHESLQKWSAGDSGN  217

Query  924   T-VDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             + VD     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  218   SKVDA---MDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  270



>ref|XP_009352023.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Pyrus x bretschneideri]
Length=588

 Score =   204 bits (520),  Expect(3) = 1e-141, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 157/205 (77%), Gaps = 3/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  381   RRQDSSIGFGAPVRANMRTGGVTDAAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT++AL++IA +AI+K+TGARGLR+I
Sbjct  441   ALTENQLVEVLTEPKNALGKQYKKMFRMNGVKLHFTESALRLIATRAISKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+P+ R G+D +D V++DEEAVG LD  GCGAKIL G  G  +R  S   
Sbjct  501   LENILMDAMYEIPEVRTGDDIIDAVVIDEEAVG-LDGKGCGAKILYGK-GALDRYHSQNK  558

Query  2067  STDKAE-KNEEALKGDMDGDCEVAS  2138
             + D  +    E   G+ + + E++S
Sbjct  559   AKDAEQIATPEGTDGEPEAETELSS  583


 Score =   189 bits (480),  Expect(3) = 1e-141, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  272   GYVGEDVESILYKLLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  331

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  332   LKMLEGTVVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   161 bits (408),  Expect(3) = 1e-141, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 92/116 (79%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC+GLD+FV+GQE+AKKVLSVAVYNHYKRIY  S  + + G+S  
Sbjct  158   WGGSNLGNNFPTPKEICQGLDKFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSTGDSSN  217

Query  924   -TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               VD     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  218   GKVDAT---DDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  270



>ref|NP_568792.1| CLP protease regulatory subunit X [Arabidopsis thaliana]
 dbj|BAB09797.1| ATP-dependent Clp protease regulatory subunit CLPX [Arabidopsis 
thaliana]
 gb|AAK59608.1| putative ATP-dependent Clp protease ATP-binding subunit ClpX1 
[Arabidopsis thaliana]
 gb|AAN13130.1| putative ATP-dependent Clp protease ATP-binding subunit ClpX1 
[Arabidopsis thaliana]
 gb|AED96343.1| CLP protease regulatory subunit X [Arabidopsis thaliana]
Length=579

 Score =   196 bits (499),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  372   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  431

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PKNAL KQYK+M+ +N+VKLHFT++AL++IA+KAI K+TGARGLR++
Sbjct  432   ALTENQLMQVLTEPKNALGKQYKKMYQMNSVKLHFTESALRLIARKAITKNTGARGLRAL  491

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G+D ++ V+VDEEAV      G GAKIL+G  G   R  S   
Sbjct  492   LESILMDSMYEIPDEGTGSDMIEAVVVDEEAVEGEGRRGSGAKILRGK-GALARYLSETN  550

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D  +  +E   G+ + + E+ S
Sbjct  551   SKDSPQTTKEGSDGETEVEAEIPS  574


 Score =   189 bits (481),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  263   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  322

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  323   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  372


 Score =   169 bits (427),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEICKGL++FV+GQERAKKVLSVAVYNHYKRIY  SS + + GE+  
Sbjct  149   WGGSNLGSDFPTPKEICKGLNKFVIGQERAKKVLSVAVYNHYKRIYHESSQKRSAGETDS  208

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  209   TAAKPA--DDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  261



>ref|XP_007136523.1| hypothetical protein PHAVU_009G052400g [Phaseolus vulgaris]
 gb|ESW08517.1| hypothetical protein PHAVU_009G052400g [Phaseolus vulgaris]
Length=520

 Score =   200 bits (509),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 150/204 (74%), Gaps = 4/204 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAP+R NM    +T A VASSLLE+VES+DL AYGLIPEFVGRFPI VSLS
Sbjct  316   RRHDSSIGFGAPIRANMRTGKVTEAAVASSLLETVESSDLIAYGLIPEFVGRFPILVSLS  375

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PKNAL KQY++MF +N VKLHFT+++L  IA+KAI+K+TGARGLRSI
Sbjct  376   ALTENQLIQVLTEPKNALGKQYQKMFQMNGVKLHFTESSLSSIARKAISKNTGARGLRSI  435

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++L +AM+E+PD R G+D +D  +VDEEAVGS+   G GAKIL G       L   +T
Sbjct  436   LENVLVDAMYEIPDVRTGDDVIDAAVVDEEAVGSVGCGGRGAKILYGQGA----LDRYLT  491

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
                   +  E    D + D E+ S
Sbjct  492   KQKNDSETMETSATDHEADPELPS  515


 Score =   191 bits (486),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KLLM AD++V AA+ GI+YIDEVDKITKKAESLNI RDVSGEGVQQ LL
Sbjct  208   YVGEDVESILYKLLMVADYNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQALL  267

Query  1271  KMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             KMLEGT+VNVP+  ARKH RGD+IQIDTKNILFICGGAFI LEKTISER
Sbjct  268   KMLEGTIVNVPEKGARKHPRGDNIQIDTKNILFICGGAFIDLEKTISER  316


 Score =   162 bits (411),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 93/118 (79%), Gaps = 2/118 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASS-TQMAGGE  914
             G W G N+    PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRI++ SS  +   G+
Sbjct  89    GCWGGSNLGTNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIFNESSLPKWPAGD  148

Query  915   SGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             S   V      E D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQ
Sbjct  149   SDDNVKADA-VEDDKVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQ  205



>ref|XP_004146223.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Cucumis sativus]
 gb|KGN57670.1| hypothetical protein Csa_3G239830 [Cucumis sativus]
Length=571

 Score =   210 bits (535),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSS+GFGAPVR NM    +T+A+V SSLLE+VES+DL AYGLIPEFVGRFPI VSLS
Sbjct  368   RRQDSSLGFGAPVRANMRAGGVTDAMVTSSLLETVESSDLIAYGLIPEFVGRFPILVSLS  427

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N+VKLHFT+N+L++IA+KA++K+TGARGLRSI
Sbjct  428   ALTENQLVQVLTEPKNALGKQYRKMFQMNDVKLHFTENSLRLIARKAMSKNTGARGLRSI  487

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++L ++M+E+PD R G D +D V+VDEE+VGS D+PG GAKIL G       LS    
Sbjct  488   LENLLMDSMYEIPDVRTGKDIIDAVIVDEESVGS-DSPGFGAKILYGKGALDRHLSGQKA  546

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             ++  +E+  E  +G+ D    VAS
Sbjct  547   TSQDSEREPEP-EGETDLPSVVAS  569


 Score =   190 bits (483),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLM AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  259   GYVGEDVESILYKLLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  318

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  319   LKMLEGTIVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  368


 Score =   154 bits (388),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G ++    PTPKEI KGLD+FV+GQERAKKVLSV VYNHYKRIY  S  +  G   
Sbjct  144   GCWGGSSLGPNFPTPKEIAKGLDKFVIGQERAKKVLSVGVYNHYKRIYHESLQRPTGDTF  203

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 D     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  204   NNKADAA---DDDKVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  257



>ref|XP_008380808.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Malus domestica]
Length=588

 Score =   204 bits (519),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 158/205 (77%), Gaps = 3/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  381   RRQDSSIGFGAPVRANMRTGGVTDAAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT++AL++IA+KAI+K+TGARGLR+I
Sbjct  441   ALTENQLVEVLTEPKNALGKQYKKMFRMNGVKLHFTESALRLIARKAISKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+P+ R G+D +D V++DEEAVG LD  GCGAKIL G  G  +R  S   
Sbjct  501   LENILMDAMYEIPEVRTGDDIIDAVVIDEEAVG-LDGKGCGAKILYGK-GALDRYHSQNK  558

Query  2067  STDKAE-KNEEALKGDMDGDCEVAS  2138
             + D  +    E   G+ + + E++S
Sbjct  559   AKDAEQIATTEGSDGEPEAETELSS  583


 Score =   189 bits (480),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  272   GYVGEDVESILYKLLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  331

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  332   LKMLEGTVVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   161 bits (407),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 91/116 (78%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC+GLD FV+GQE+AKKVLSVAVYNHYKRIY  S  + + G+S  
Sbjct  158   WGGSNLGNNFPTPKEICQGLDTFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSTGDSSN  217

Query  924   -TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               VD     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  218   GKVDA---MDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  270



>ref|XP_009368656.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Pyrus x bretschneideri]
Length=587

 Score =   205 bits (522),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 154/201 (77%), Gaps = 6/201 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE VES+DL  YGLIPEFVGRFPI VSLS
Sbjct  381   RRQDSSIGFGAPVRANMRTGGVTDAAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLS  440

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT++AL++IA+KAI+K+TGARGLR+I
Sbjct  441   ALTENQLVEVLTEPKNALGKQYKKMFRMNGVKLHFTESALRLIARKAISKNTGARGLRAI  500

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G+D +D V++DEEAVG LD  GCGAKIL G       LS    
Sbjct  501   LENILMDAMYEIPDVRTGDDIIDAVVIDEEAVG-LDGKGCGAKILYGKGALDHFLSQ---  556

Query  2067  STDKAEKNEEALKGDMDGDCE  2129
               +K +  E A K   DG+ E
Sbjct  557   --NKPKDVETAAKEGSDGEPE  575


 Score =   188 bits (478),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  271   AGYVGEDVESILYKLLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  330

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVVNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  331   LLKMLEGTVVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  381


 Score =   160 bits (405),  Expect(3) = 2e-141, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 92/116 (79%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G  + K  PTPKEIC+GLD+FV+GQ++AKKVLSVAVYNHYKRIY  S  + + G+S  
Sbjct  158   WGGSKLGKNFPTPKEICQGLDKFVIGQDKAKKVLSVAVYNHYKRIYHESLQKWSAGDSSN  217

Query  924   -TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               VD     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  218   GKVDA---MDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  270



>ref|XP_002864237.1| hypothetical protein ARALYDRAFT_918413 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40496.1| hypothetical protein ARALYDRAFT_918413 [Arabidopsis lyrata subsp. 
lyrata]
Length=572

 Score =   196 bits (498),  Expect(3) = 3e-141, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  365   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  424

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PKNAL KQYK+M+ +N+VKLHFT++AL++IA+KAI K+TGARGLRS+
Sbjct  425   ALTENQLMQVLTEPKNALGKQYKKMYQMNSVKLHFTESALRLIARKAITKNTGARGLRSL  484

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G+D ++ V+VDEEAV      G GAKIL+G  G   R  S   
Sbjct  485   LESILMDSMYEIPDESTGSDMIEAVVVDEEAVEGEGRRGSGAKILRGK-GALGRYLSETK  543

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D  +  ++   G+ + + E+ S
Sbjct  544   SKDSPQTTKDGSDGETEVEAEIPS  567


 Score =   189 bits (481),  Expect(3) = 3e-141, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  256   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  315

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  316   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  365


 Score =   168 bits (426),  Expect(3) = 3e-141, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEICKGL++FV+GQERAKKVLSVAVYNHYKRIY  SS + + GE+  
Sbjct  142   WGGSNLGSDFPTPKEICKGLNKFVIGQERAKKVLSVAVYNHYKRIYHESSQKRSAGETDS  201

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  202   TAVKPA--DDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  254



>ref|XP_008466827.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Cucumis melo]
 gb|ADN33742.1| ATP-dependent clp protease ATP-binding subunit clpx [Cucumis 
melo subsp. melo]
Length=571

 Score =   210 bits (534),  Expect(3) = 6e-141, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSS+GFGAPVR NM    +T+A+V SSLLE+VES+DL AYGLIPEFVGRFPI VSLS
Sbjct  368   RRQDSSLGFGAPVRANMRAGGVTDAMVTSSLLETVESSDLIAYGLIPEFVGRFPILVSLS  427

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N+VKLHFT+NAL++IA+KA++K+TGARGLRSI
Sbjct  428   ALTENQLVQVLTEPKNALGKQYRKMFQMNDVKLHFTENALRLIARKAMSKNTGARGLRSI  487

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++L ++M+E+PD R G D +D V+VDEE+VGS D+PG GAKIL G  G  +R  S   
Sbjct  488   LENLLMDSMYEIPDIRTGKDIIDAVVVDEESVGS-DSPGFGAKILYGK-GALDRYLSGQK  545

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             +T +  + E   +G+ D    VAS
Sbjct  546   ATSQDSEREPEPEGETDLPSVVAS  569


 Score =   191 bits (484),  Expect(3) = 6e-141, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLM AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  259   GYVGEDVESILYKLLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  318

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  319   LKMLEGTIVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  368


 Score =   152 bits (385),  Expect(3) = 6e-141, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G ++    PTPKEI KGLD+FV+GQ+RAKKVLSV VYNHYKRIY  S  +  G   
Sbjct  144   GCWGGSSLGPNFPTPKEIAKGLDKFVIGQDRAKKVLSVGVYNHYKRIYHESLQRPTGDAF  203

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 D     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  204   NNKADAA---DDDKVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  257



>ref|XP_006645143.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Oryza brachyantha]
Length=503

 Score =   220 bits (560),  Expect(3) = 6e-141, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 164/197 (83%), Gaps = 2/197 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+RTNM  S +T+ +V SSLLESVES DL  YGLIPEF+GR PI VSL+
Sbjct  298   RRQDSSIGFGAPIRTNMRSSGVTDPMVTSSLLESVESGDLARYGLIPEFIGRLPILVSLT  357

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKN+L +QY++MF+LNNVKLHFTD AL+M+A+K++A++TGARGLR+I
Sbjct  358   ALNEDQLVQVLTEPKNSLSRQYRKMFSLNNVKLHFTDGALRMVAQKSMARNTGARGLRAI  417

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LES+L EAM+E+PD + G++ VD V++DEEA+GS+D PGCGAKIL+G+    E +++  T
Sbjct  418   LESLLLEAMYEIPDEKTGSERVDAVVLDEEAIGSIDRPGCGAKILRGDGALEEYITT--T  475

Query  2067  STDKAEKNEEALKGDMD  2117
             +T  + +  E L G+++
Sbjct  476   NTKNSPETNEGLAGELE  492


 Score =   177 bits (448),  Expect(3) = 6e-141, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL KLL+AA+++V+AA+ GIVYIDEVDKITKKAES N+ RDVSGEGVQQ L
Sbjct  189   GYVGEDVESILQKLLVAAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQAL  248

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV++P+  +RK+SR +SIQIDTK+ILFICGGAF+ LEKTISER
Sbjct  249   LKILEGTVVSIPEKGSRKNSRNESIQIDTKDILFICGGAFVDLEKTISER  298


 Score =   156 bits (394),  Expect(3) = 6e-141, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G ++ ++LPTP+E+C+ LDEFV+GQ +AKKVLSVAVYNHYKRIY+A+  +     SG 
Sbjct  75    WGGASLGEELPTPREMCRRLDEFVIGQGKAKKVLSVAVYNHYKRIYNATVQKGCSANSGW  134

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                +  N + + +E+DKSNVLLMGPTGSGKTLLAKTLAR+VNVPF+IADAT+LTQ
Sbjct  135   L--DTANDDQNTIEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFIIADATSLTQ  187



>gb|KFK26956.1| hypothetical protein AALP_AA8G315200 [Arabis alpina]
Length=578

 Score =   198 bits (504),  Expect(3) = 8e-141, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  371   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  430

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PKNAL KQYK+M+ +N+VKLHFT++AL++IA+KAI K+TGARGLR++
Sbjct  431   ALTENQLMQVLTEPKNALGKQYKKMYQMNSVKLHFTESALQLIARKAITKNTGARGLRAL  490

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   GND ++ V+VDEEAV      G GAKIL+G  G   R  S   
Sbjct  491   LESILMDSMYEIPDESTGNDMIEAVVVDEEAVEGEGRRGLGAKILRGK-GALGRYLSETK  549

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D  +  +E   G+++ + E+ S
Sbjct  550   SKDSPQVAKEGSDGEIEVEAEIPS  573


 Score =   190 bits (482),  Expect(3) = 8e-141, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  262   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  321

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  322   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  371


 Score =   164 bits (415),  Expect(3) = 8e-141, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 92/117 (79%), Gaps = 2/117 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC+GL++FV+GQERAKKVLSVAVYNHYKRIY  SS + + GE+  
Sbjct  144   WGGSNLGTNFPTPKEICEGLNKFVIGQERAKKVLSVAVYNHYKRIYYESSQKRSTGEAEA  203

Query  924   TVDEQGN--FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               D       + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  204   EADSTAAKPADDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  260



>ref|XP_010478756.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
Length=661

 Score =   209 bits (531),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  466   RRQDSSIGFGAPVRANMATSRVTSGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLS  525

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL++PKNAL KQYK++F++NNVKLHFT+ AL++I+K+A+ K+TGARGLR++
Sbjct  526   ALTEDQLIRVLVEPKNALGKQYKKLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRAL  585

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G++ +D V+VDEE  GS  + GC AK+L+G+ G  ER  S   
Sbjct  586   LESILTEAMFEIPDDKKGDERIDAVIVDEELTGSEVSRGCTAKVLKGD-GAFERYLSENK  644

Query  2067  STDKAE  2084
             S D  E
Sbjct  645   SKDATE  650


 Score =   180 bits (457),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  357   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  416

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  417   LKLLEGTIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  466


 Score =   163 bits (412),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 91/115 (79%), Gaps = 8/115 (7%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G ++ +  PTPKEICK LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + +
Sbjct  249   WGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIY---HTSMKKGSAAQ  305

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              +D+  N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  306   PIDDDDN-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  355


 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 60/127 (47%), Gaps = 32/127 (25%)
 Frame = +3

Query  246  PTTIRVIGLGLG-------FQRRCKWE--GSSDNYD------HLKAEVNCPRCSKPMTVL  380
            P   R+  L LG        Q R K E  G  D++        L+AE NCPRCSK M +L
Sbjct  22   PLQTRLHSLELGSSSPRRRIQERFKSEQGGGGDDFPVPVTRRKLRAEPNCPRCSKQMDLL  81

Query  381  FSNRPLSIT-----------------AGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNF  509
            FSNR    +                       +Q+VN CP C+TA+ F P  + PLQG F
Sbjct  82   FSNRQFPSSNLLQRPDESDSSSGDGDGDNKTSFQSVNFCPTCKTAYGFNPRGVSPLQGTF  141

Query  510  IEIGQVK  530
            IEIG+V+
Sbjct  142  IEIGRVQ  148



>ref|XP_006280226.1| hypothetical protein CARUB_v10026143mg [Capsella rubella]
 gb|EOA13124.1| hypothetical protein CARUB_v10026143mg [Capsella rubella]
Length=581

 Score =   194 bits (493),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  374   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  433

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PKNAL KQYK+M+ +N+VKLHFT++AL++IA+KAI K+TGARGLR++
Sbjct  434   ALTENQLMQVLTEPKNALGKQYKKMYQMNSVKLHFTESALRLIAQKAITKNTGARGLRAL  493

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD    +D ++ V+VDEEAV      G GAKIL+G  G   R  S   
Sbjct  494   LESILMDSMYEIPDEGTDSDMIEAVVVDEEAVEGEGRRGSGAKILRGK-GALGRYLSETN  552

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D  +  +E   G+++ + E+ S
Sbjct  553   SKDSPQTTKEGSDGEIEVEAEIPS  576


 Score =   189 bits (481),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  265   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  324

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  325   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  374


 Score =   168 bits (426),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEICKGL++FV+GQERAKKVLSVAVYNHYKRIY  SS + + GE+  
Sbjct  151   WGGSNLGSDFPTPKEICKGLNKFVIGQERAKKVLSVAVYNHYKRIYHESSQKRSSGETES  210

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  211   TAAKPA--DDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  263



>ref|XP_006401716.1| hypothetical protein EUTSA_v10013106mg [Eutrema salsugineum]
 gb|ESQ43169.1| hypothetical protein EUTSA_v10013106mg [Eutrema salsugineum]
Length=572

 Score =   197 bits (502),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  365   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  424

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PKNAL KQYK+M+ +N+VKLHFT++AL++IAKKAI K+TGARGLR++
Sbjct  425   ALTENQLMQVLTEPKNALGKQYKKMYQMNSVKLHFTESALRLIAKKAITKNTGARGLRAL  484

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G+D ++ V+VDEEAV      G GAKIL+G    S  LS    
Sbjct  485   LESILMDSMYEIPDESTGSDMIEAVVVDEEAVEGEGRRGSGAKILRGKGALSLYLSET-N  543

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D  +  +E  +G+++ + E+ S
Sbjct  544   SKDSPQTTKEGSEGEIEVEAEIPS  567


 Score =   190 bits (482),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  256   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  315

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  316   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  365


 Score =   164 bits (416),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEICKGL++FV+GQERAKKVLSVAVYNHYKRIY  S  + + GE+  
Sbjct  142   WGGSNLGSDFPTPKEICKGLNKFVIGQERAKKVLSVAVYNHYKRIYYESLQKRSTGETDS  201

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  202   TTAKPA--DDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  254



>gb|AAB88706.1| CLP protease regulatory subunit CLPX [Arabidopsis thaliana]
Length=579

 Score =   197 bits (500),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 154/204 (75%), Gaps = 1/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +T A VAS+L+E+VE++DL AYGLIPEFVGRFP+ VSLS
Sbjct  372   RRHDSSIGFGAPVRANMRAGGVTTAAVASNLMETVETSDLIAYGLIPEFVGRFPVLVSLS  431

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PKNAL KQYK+M+ +N+VKLHFT++AL++IA+KAI K+TGARGLR++
Sbjct  432   ALTENQLMQVLTEPKNALGKQYKKMYQMNSVKLHFTESALRLIARKAITKNTGARGLRAL  491

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G+D ++ V+VDEEAV      G GAKIL+G  G   R  S   
Sbjct  492   LESILMDSMYEIPDEGTGSDMIEAVVVDEEAVEGEGRRGSGAKILRGK-GALARYLSETN  550

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D  +  +E   G+ + + E+ S
Sbjct  551   SKDSPQTTKEGSDGETEVEAEIPS  574


 Score =   186 bits (473),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESL I RDVSGEGVQQ L
Sbjct  263   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLYISRDVSGEGVQQAL  322

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  323   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  372


 Score =   169 bits (427),  Expect(3) = 1e-140, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEICKGL++FV+GQERAKKVLSVAVYNHYKRIY  SS + + GE+  
Sbjct  149   WGGSNLGSDFPTPKEICKGLNKFVIGQERAKKVLSVAVYNHYKRIYHESSQKRSAGETDS  208

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  209   TAAKPA--DDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  261



>ref|XP_009132481.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Brassica rapa]
 emb|CDY47070.1| BnaA03g12280D [Brassica napus]
Length=547

 Score =   195 bits (496),  Expect(3) = 3e-140, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  343   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  402

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PKNAL KQYK+M+ +N+VKLHFT+ AL++IA+KAI K+TGARGLR++
Sbjct  403   ALTENQLMQVLTEPKNALGKQYKKMYQMNSVKLHFTETALRLIARKAITKNTGARGLRAL  462

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G D ++ V+VDEEAV      G GAKIL+G    +  LS    
Sbjct  463   LESILMDSMYEIPDEGTGKDMIEAVVVDEEAVEGEGRRGSGAKILRGKGALALYLSETTK  522

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D  +  +E  +G+ + +  VA+
Sbjct  523   SKDSPQTTKEGSEGETEVEPVVAN  546


 Score =   189 bits (480),  Expect(3) = 3e-140, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  234   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  293

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  294   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  343


 Score =   166 bits (420),  Expect(3) = 3e-140, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC GLD+FV+GQERAKKVLSVAVYNHYKRIY  S  + + GE+  
Sbjct  119   WGGSNLGSSFPTPKEICNGLDKFVIGQERAKKVLSVAVYNHYKRIYYESIQKRSSGETDS  178

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +  + + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  179   TAAKPAD-DDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  232



>ref|XP_010442896.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
Length=579

 Score =   194 bits (492),  Expect(3) = 3e-140, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 153/204 (75%), Gaps = 0/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  371   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  430

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL++VL +PKNAL KQYK+M+ +N+VKLHFT++AL++IA+KAI K+TGARGLR++
Sbjct  431   ALTENQLMEVLTEPKNALGKQYKKMYQMNSVKLHFTESALRLIARKAITKNTGARGLRAL  490

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G+D ++ V+VDEEAV      G GAKIL+G       LS   +
Sbjct  491   LESILMDSMYEIPDESTGSDMIEAVVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETYS  550

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
                  +  +E   G+ + + E+ S
Sbjct  551   KDSSPQTTKEGSDGENEVEAEIPS  574


 Score =   190 bits (482),  Expect(3) = 3e-140, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  262   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  321

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  322   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  371


 Score =   166 bits (421),  Expect(3) = 3e-140, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+  + PTPKEICKGL++FV+GQERAKKVL+VAVYNHYKRIY  S+ + + GE+  
Sbjct  148   WGGSNLGSEFPTPKEICKGLNKFVIGQERAKKVLAVAVYNHYKRIYHESAQKRSTGETES  207

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  208   TAAKPA--DDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  260



>ref|XP_010445728.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
Length=581

 Score =   193 bits (490),  Expect(3) = 4e-140, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 152/202 (75%), Gaps = 3/202 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  372   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  431

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL++VL +PKNAL KQYK+M+ +N+VKLHFT++AL++IA+KAI K+TGARGLR++
Sbjct  432   ALTENQLMEVLTEPKNALGKQYKKMYQMNSVKLHFTESALRLIARKAITKNTGARGLRAL  491

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G+D ++ V+VDEEAV      G GAKIL+G       LS    
Sbjct  492   LESILMDSMYEIPDESTGSDMIEAVVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETTN  551

Query  2067  STDKAEKNEEALKGDMDGDCEV  2132
             S D +    +  K   DG+ EV
Sbjct  552   SKDSS---PQTTKVGSDGENEV  570


 Score =   190 bits (483),  Expect(3) = 4e-140, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  263   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  322

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  323   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  372


 Score =   167 bits (422),  Expect(3) = 4e-140, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+  + PTPKEICKGL++FV+GQERAKKVL+VAVYNHYKRIY  S+ + + GE+  
Sbjct  149   WGGSNLGSEFPTPKEICKGLNKFVIGQERAKKVLAVAVYNHYKRIYHESAQKRSTGETES  208

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  209   TAAKPA--DDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  261



>ref|XP_010035267.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Eucalyptus grandis]
 gb|KCW46558.1| hypothetical protein EUGRSUZ_K00383 [Eucalyptus grandis]
Length=594

 Score =   201 bits (511),  Expect(3) = 4e-140, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 157/202 (78%), Gaps = 7/202 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  S +TNAVVASSLLESVES+DL +YGLIPEFVGRFPI VSLS
Sbjct  389   RRQDSSIGFGAPVRANMRASNVTNAVVASSLLESVESSDLISYGLIPEFVGRFPILVSLS  448

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL +PKNAL KQY++MF +N VKLH+TDNAL++IA+KAIAK+TGARGLRSI
Sbjct  449   ALSEDQLVEVLTEPKNALGKQYRKMFQMNGVKLHYTDNALRLIARKAIAKNTGARGLRSI  508

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL EAM+E+PD R G D +D V+VDEEAVG ++  G GAKIL G       LS    
Sbjct  509   LENILMEAMYEIPDVRTGEDIIDAVVVDEEAVG-IEGRGHGAKILYGKGAFDRYLSQ---  564

Query  2067  STDKAEKNEEALKGDMDGDCEV  2132
                K  K++E      DG+ EV
Sbjct  565   ---KKVKDQETSIESPDGEPEV  583


 Score =   188 bits (477),  Expect(3) = 4e-140, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL KLL AAD++V AA+ GIVYIDEVDKITKKAES+NI RDVSGEGVQQ 
Sbjct  279   AGYVGEDVESILHKLLTAADYNVAAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQA  338

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  339   LLKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  389


 Score =   161 bits (407),  Expect(3) = 4e-140, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N     PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY   S +   G+S  
Sbjct  167   WGGSNWGSNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYH-ESVKRPSGDSED  225

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  226   ARPESA--DDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  278



>ref|XP_010482726.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Camelina sativa]
Length=577

 Score =   193 bits (490),  Expect(3) = 4e-140, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  369   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  428

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL++VL +PKNAL KQYK+M+ +N+VKLHFT++AL++IA+KAI K+TGARGLR++
Sbjct  429   ALTENQLMEVLTEPKNALGKQYKKMYQMNSVKLHFTESALRLIARKAITKNTGARGLRAL  488

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G+D ++ V+VDEEAV      G GAKIL+G       L   ++
Sbjct  489   LESILMDSMYEIPDESTGSDMIEAVVVDEEAVEGEGRRGSGAKILRGKGA----LGRYLS  544

Query  2067  STDKAEKNEEALKGDMDGDCEV  2132
              T+  + + +  K   DG+ EV
Sbjct  545   ETNSKDSSPQTTKEGSDGENEV  566


 Score =   190 bits (483),  Expect(3) = 4e-140, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  260   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  319

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  320   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  369


 Score =   167 bits (422),  Expect(3) = 4e-140, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+  + PTPKEICKGL++FV+GQERAKKVL+VAVYNHYKRIY  S+ + + GE+  
Sbjct  146   WGGSNLGSEFPTPKEICKGLNKFVIGQERAKKVLAVAVYNHYKRIYHESAQKRSTGETES  205

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  206   TAAKPA--DDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  258



>ref|XP_008466826.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Cucumis melo]
Length=576

 Score =   207 bits (526),  Expect(3) = 5e-140, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 159/204 (78%), Gaps = 1/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSS+GFGAPVR NM    +T+A+V SSLLE+VES+DL AYGLIPEFVGRFPI VSLS
Sbjct  368   RRQDSSLGFGAPVRANMRAGGVTDAMVTSSLLETVESSDLIAYGLIPEFVGRFPILVSLS  427

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N+VKLHFT+NAL++IA+KA++K+TGARGLRSI
Sbjct  428   ALTENQLVQVLTEPKNALGKQYRKMFQMNDVKLHFTENALRLIARKAMSKNTGARGLRSI  487

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++L ++M+E+PD R G D +D V+VDEE+VGS D+PG GAKIL G       LS    
Sbjct  488   LENLLMDSMYEIPDIRTGKDIIDAVVVDEESVGS-DSPGFGAKILYGKGALDRYLSGQKV  546

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
                KA   +   + + +G+ ++ S
Sbjct  547   EDRKATSQDSEREPEPEGETDLPS  570


 Score =   190 bits (483),  Expect(3) = 5e-140, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLM AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  259   GYVGEDVESILYKLLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  318

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RG++IQIDTK+ILFICGGAFI LEKTISER
Sbjct  319   LKMLEGTIVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISER  368


 Score =   152 bits (385),  Expect(3) = 5e-140, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G ++    PTPKEI KGLD+FV+GQ+RAKKVLSV VYNHYKRIY  S  +  G   
Sbjct  144   GCWGGSSLGPNFPTPKEIAKGLDKFVIGQDRAKKVLSVGVYNHYKRIYHESLQRPTGDAF  203

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 D     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  204   NNKADAA---DDDKVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  257



>ref|XP_011075988.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Sesamum indicum]
Length=573

 Score =   192 bits (489),  Expect(3) = 5e-140, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLM AD++V AA+ GI+YIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  260   GYVGEDVESILYKLLMVADYNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQAL  319

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  320   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  369


 Score =   189 bits (479),  Expect(3) = 5e-140, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 147/195 (75%), Gaps = 6/195 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAP+R NM    +T+A V SSLLE+VES+DL AYGLIPEFVGRFP+ V+LS
Sbjct  369   RRHDSSIGFGAPIRANMRTGGVTSAAVTSSLLETVESSDLIAYGLIPEFVGRFPVLVNLS  428

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E QLVQVL +PKNAL KQYK+MF +N VKLHFT++AL++IAKKAI K+TGARGLRS+
Sbjct  429   ALSEEQLVQVLTEPKNALGKQYKKMFQMNGVKLHFTEDALRLIAKKAITKNTGARGLRSM  488

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAG-----GSERL  2051
             LE+IL +AM+E+PD R G+D +D V+VD+E+VGS    G  AKIL G           +L
Sbjct  489   LENILMDAMYEIPDVRTGDDIIDAVIVDKESVGS-GGRGSRAKILYGKGALDRYFSQHKL  547

Query  2052  SSAMTSTDKAEKNEE  2096
                 TS++ +E   E
Sbjct  548   KDPETSSEGSEAEAE  562


 Score =   168 bits (426),  Expect(3) = 5e-140, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 95/117 (81%), Gaps = 3/117 (3%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+    PTPKEIC+GLD+FV+GQERAKKVLSVAVYNHYKRIY  SS + AG  +
Sbjct  145   GCWGGSNLGPNFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIYSDSSQRPAGSTN  204

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G   D+    E + VEL+KSN+LLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  205   G---DKTEGKEYENVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  258



>gb|EYU25233.1| hypothetical protein MIMGU_mgv1a003646mg [Erythranthe guttata]
Length=572

 Score =   194 bits (492),  Expect(3) = 9e-140, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM +  +T+A V SSLLE+VES+DL AYGLIPEFVGRFP+ V+LS
Sbjct  367   RRHDSSIGFGAPVRANMRMGGVTSAAVTSSLLETVESSDLIAYGLIPEFVGRFPVLVNLS  426

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E QLVQVL +PKNAL KQY++MF +N VKLHFT++AL++IA+KAI K+TGARGLRS+
Sbjct  427   ALTEEQLVQVLTEPKNALGKQYRKMFQMNGVKLHFTEDALRLIARKAITKNTGARGLRSM  486

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++L +AM+E+PD R G+D +D V+VD+++VGS +  GCGAKIL G  G  +R  S   
Sbjct  487   LENVLMDAMYEIPDERTGDDIIDAVIVDKDSVGS-EGRGCGAKILYGK-GALDRYFSQNK  544

Query  2067  STDKAEKNEEA  2099
             + D    + E 
Sbjct  545   ANDSQVSSSEG  555


 Score =   188 bits (477),  Expect(3) = 9e-140, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GI+YIDEVDKITKKAES+NI RDVSGEGVQQ L
Sbjct  258   GYVGEDVESILYKLLTVADYNVVAAQQGIIYIDEVDKITKKAESMNISRDVSGEGVQQAL  317

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  318   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  367


 Score =   167 bits (422),  Expect(3) = 9e-140, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+    PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY  SS + A G  
Sbjct  146   GSWGGSNLGPDFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYSDSSQRPADGGK  205

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              +  D++       VEL+KSN+LLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  206   TEGADDEN------VELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  256



>ref|XP_004300022.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Fragaria vesca subsp. vesca]
Length=571

 Score =   204 bits (520),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R QDSSIGFGAPVR NM  S L +A+V SSLLESVES+DL AYGLIPEFVGRFPI  SLS
Sbjct  364   RHQDSSIGFGAPVRANMRSSGLIDAIVTSSLLESVESDDLIAYGLIPEFVGRFPILASLS  423

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L+E+QLVQVL +PKNAL KQYK MF +N+VKLHFTD+AL++IA+KA+AK+TGARGLR+I
Sbjct  424   SLNEDQLVQVLTEPKNALGKQYKMMFDMNDVKLHFTDDALRLIARKAMAKNTGARGLRAI  483

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LE+ILTEAMFEVPD +   + +  VLVDEEAVGS+D PG GAKIL G+
Sbjct  484   LENILTEAMFEVPDIKTETNSIHAVLVDEEAVGSVDAPGRGAKILSGD  531


 Score =   193 bits (490),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  A+FDVEAA+ GIVYIDEVDKI KK ES NIGRDVSGEGVQQ L
Sbjct  255   GYVGEDVESILYKLLTEAEFDVEAAQKGIVYIDEVDKIIKKVESSNIGRDVSGEGVQQAL  314

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVPD  ARKH RGDSIQ+DTK+ILFICGGAF+GLEKTISER
Sbjct  315   LKMLEGTVVNVPDKGARKHPRGDSIQMDTKDILFICGGAFVGLEKTISER  364


 Score =   151 bits (382),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = +3

Query  771   LPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-KTVD-EQGN  944
             LPTPKEICK LD+FV+GQERAKKVLSVAVYNHYKRI  +S  +     +G  +VD +  +
Sbjct  146   LPTPKEICKALDDFVIGQERAKKVLSVAVYNHYKRIRHSSQERRRTTRAGVYSVDCKPHS  205

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              ++D VEL+KSNVLLMGPTGSGKTLLAKTLAR+VNVPF IADATTLTQ
Sbjct  206   VDTDSVELEKSNVLLMGPTGSGKTLLAKTLARVVNVPFAIADATTLTQ  253


 Score =   128 bits (321),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 3/84 (4%)
 Frame = +3

Query  285  QRRCKW--EGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCR  458
            QRR K+  EG  + Y+H++AEVNCPRCSK M VLFS RPLSIT  ETG+YQAVNLC +C 
Sbjct  44   QRRHKFSSEGGGE-YEHIRAEVNCPRCSKQMVVLFSTRPLSITGRETGLYQAVNLCSNCN  102

Query  459  TAFYFRPSKLEPLQGNFIEIGQVK  530
            TAFYFRPSKL PL G F+EIG++K
Sbjct  103  TAFYFRPSKLLPLHGTFLEIGRLK  126



>ref|XP_003564797.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Brachypodium distachyon]
Length=617

 Score =   216 bits (549),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 158/197 (80%), Gaps = 2/197 (1%)
 Frame = +3

Query  1509  DYYFCPRRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFP  1688
             D     RRQDSSIGFGAP+RT M  S +TN  V SSLLESVES DL  YGLIPEF+GR P
Sbjct  408   DKTISERRQDSSIGFGAPIRTKMRSSGVTNPTVTSSLLESVESGDLAKYGLIPEFIGRLP  467

Query  1689  IFVSLSALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGA  1868
             I VSL+AL E+QLVQVL +PKN+L +QY++MF+LNNVKLHFTD+AL+++AKKAIA++TGA
Sbjct  468   ILVSLAALHEDQLVQVLTEPKNSLSRQYRKMFSLNNVKLHFTDDALRIVAKKAIARNTGA  527

Query  1869  RGLRSILESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSER  2048
             RGLR+ILESIL EAM+E+PD + GN+ VD V+VDEEA+GS+D PGCGAKIL+G+   ++ 
Sbjct  528   RGLRAILESILLEAMYEIPDEKAGNERVDAVVVDEEAIGSVDRPGCGAKILRGDGALAQY  587

Query  2049  L--SSAMTSTDKAEKNE  2093
             +  +SA  S +  E  E
Sbjct  588   ITRTSAKNSLETNEAGE  604


 Score =   174 bits (441),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL KLL+ A+++V+AA+ GIVYIDEVDKITKKAES N+ RDVSGEGVQQ L
Sbjct  305   GYVGEDVESILQKLLVEAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQAL  364

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV +P+  +RK+SR DSIQIDTK+ILFICGGAF+ L+KTISER
Sbjct  365   LKILEGTVVTIPEKGSRKNSRNDSIQIDTKDILFICGGAFVDLDKTISER  414


 Score =   158 bits (400),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G ++ ++LPTP+E+C+ LDEFV+GQ +AKKVLSVAVYNHYKRIY+A+  + +   SG 
Sbjct  191   WGGASLGEELPTPREMCRRLDEFVIGQGKAKKVLSVAVYNHYKRIYNANVQKGSAANSG-  249

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E  N + + VE+DKSNVLLMGPTGSGKTLLAKTLAR+VNVPF+IADAT+LTQ
Sbjct  250   -CPEAANDDQNTVEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFIIADATSLTQ  303


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 48/95 (51%), Gaps = 13/95 (14%)
 Frame = +3

Query  288  RRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSI---------TAGETGIYQAVN  440
            RRC    S      + A+ NCPRC+  M+V FS +P+ +          A     +   +
Sbjct  21   RRC----SGGTTPRIHADANCPRCTAQMSVQFSLQPIPVPTPAASAADGAHHHHHHDGAS  76

Query  441  LCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGE  545
            +CP CR AF FR  ++EP++G F+EI    GG  E
Sbjct  77   VCPTCRAAFLFRAHRIEPMRGAFLEIPSGVGGEDE  111



>emb|CDY54345.1| BnaC03g14910D [Brassica napus]
Length=546

 Score =   193 bits (491),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  342   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  401

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PKNAL KQYK+M+ +N+VKLHFT+ AL++IA+KAI K+TGARGLR++
Sbjct  402   ALTENQLMQVLTEPKNALGKQYKKMYQMNSVKLHFTETALRLIARKAITKNTGARGLRAL  461

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G D ++ V+VDE+AV      G GAKIL+G    +  LS    
Sbjct  462   LESILMDSMYEIPDEGTGKDMIEAVVVDEKAVEGEGRRGSGAKILRGKGALALYLSETTK  521

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D  +  +E  +G+ + +  VA+
Sbjct  522   SKDSPQTTKEGSEGETEVEPVVAN  545


 Score =   189 bits (480),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  233   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  292

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  293   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  342


 Score =   166 bits (419),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC GLD+FV+GQERAKKVLSVAVYNHYKRIY  S  + + GE+  
Sbjct  118   WGGSNLGSSFPTPKEICNGLDKFVIGQERAKKVLSVAVYNHYKRIYYESLQKRSSGETDS  177

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +  + + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  178   TAAKPAD-DDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  231



>ref|XP_009588204.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nicotiana tomentosiformis]
Length=572

 Score =   192 bits (489),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 159/204 (78%), Gaps = 3/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A V SSLLE VES+DL +YGLIPEFVGRFPI V+LS
Sbjct  368   RRQDSSIGFGAPVRANMRTGGVTSAAVTSSLLEIVESSDLISYGLIPEFVGRFPILVNLS  427

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQYK+MF +N VKLHFT++AL++IAKKAI+K+TGARGLRSI
Sbjct  428   ALTENQLVQVLTEPKNALGKQYKKMFQMNGVKLHFTEDALRLIAKKAISKNTGARGLRSI  487

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL +AM+E+PD R G+D +D V+VDEE+VG+ +  GCGAKIL G  G  +R  S   
Sbjct  488   LESILMDAMYEIPDVRTGDDVIDAVVVDEESVGA-EGRGCGAKILYGK-GAFDRHFSQNR  545

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               D +E N E   GD + + E+ S
Sbjct  546   PKD-SETNLEGSDGDHETEQELPS  568


 Score =   190 bits (482),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  256   TQAGYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQ  315

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  316   QALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  368


 Score =   166 bits (419),  Expect(3) = 1e-139, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 96/116 (83%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQM-AGGESG  920
             W G N+    PTPK++CKGLD+FV+GQERAKKVLSVAVYNHYKRIY+ SS +  AG +S 
Sbjct  145   WGGSNLGSHFPTPKQLCKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSSHKWPAGNDSS  204

Query  921   KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  D     E++ VEL+KSN+LLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  205   EKAD---GAENESVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  257



>ref|XP_010555729.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Tarenaya hassleriana]
Length=574

 Score =   197 bits (501),  Expect(3) = 2e-139, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 156/205 (76%), Gaps = 6/205 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +T+A VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  370   RRHDSSIGFGAPVRANMRAGGVTDATVASTLMETVESSDLIAYGLIPEFVGRFPVLVSLS  429

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQYK+MF +N VKLHFT+ AL+ IA+KAI K+TGARGLR++
Sbjct  430   ALSENQLVQVLTEPKNALGKQYKKMFEMNRVKLHFTEGALRRIARKAITKNTGARGLRAL  489

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLS-SAM  2063
             LESIL ++M+E+PD + G+D V+ V+VDEEAV S      GAKIL+G       LS + M
Sbjct  490   LESILVDSMYEIPDVKTGDDAVEAVVVDEEAVES-----GGAKILRGEGSLDRYLSQTTM  544

Query  2064  TSTDKAEKNEEALKGDMDGDCEVAS  2138
             +    +++ +E  +G+ + + E+ S
Sbjct  545   SDESSSQRRKEGPEGEAEVETELPS  569


 Score =   186 bits (473),  Expect(3) = 2e-139, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD +V AA+ GIVYIDEVDKITKKAE+LNI RDVSGEGVQQ L
Sbjct  261   GYVGEDVESILYKLLTVADHNVAAAQQGIVYIDEVDKITKKAENLNISRDVSGEGVQQAL  320

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  321   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVNIEKTISER  370


 Score =   164 bits (416),  Expect(3) = 2e-139, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEICKGLD FV+GQE+AKKVLSVAVYNHYKRI+  S  +   GESG 
Sbjct  147   WGGSNLGPSFPTPKEICKGLDRFVIGQEKAKKVLSVAVYNHYKRIHYESLQKRPAGESGS  206

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  +  + E  FVEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQ
Sbjct  207   STAKATDDE--FVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVLADATTLTQ  259



>ref|XP_006350541.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Solanum tuberosum]
Length=571

 Score =   190 bits (483),  Expect(3) = 2e-139, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 156/204 (76%), Gaps = 3/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVRTNM    +T+A V SSLLE+VES+DL +YGLIPEFVGRFPI VSLS
Sbjct  367   RRQDSSIGFGAPVRTNMRTGGVTSAAVTSSLLETVESSDLISYGLIPEFVGRFPILVSLS  426

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK+MF +N VKLHF ++AL++IA+KA++K+TGARGLRSI
Sbjct  427   ALTEDQLVQVLTEPKNALGKQYKKMFQMNGVKLHFVEDALRLIARKALSKNTGARGLRSI  486

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G+D +D V+VDEE+VG+ +  GCG KIL G     +       
Sbjct  487   LENILMDAMYEIPDVRTGDDVIDAVVVDEESVGT-EGRGCGGKILYGKGAFDQHF--PQN  543

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
              +  +E N E   GD + + E+ S
Sbjct  544   RSKDSESNMEGSDGDHEAEQELPS  567


 Score =   190 bits (482),  Expect(3) = 2e-139, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  258   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  317

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  318   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  367


 Score =   167 bits (424),  Expect(3) = 2e-139, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQM-AGGESG  920
             W G N+  + PTPK++CKGLD+FV+GQERAKKVLSVAVYNHYKRIY+ SS +  AG +S 
Sbjct  144   WGGSNLGTQFPTPKQLCKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSSHKWPAGNDSS  203

Query  921   KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  D     E++ VEL+KSN+LLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  204   EKTD---GIENESVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  256



>ref|XP_007152420.1| hypothetical protein PHAVU_004G128700g [Phaseolus vulgaris]
 gb|ESW24414.1| hypothetical protein PHAVU_004G128700g [Phaseolus vulgaris]
Length=706

 Score =   213 bits (542),  Expect(3) = 2e-139, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 161/206 (78%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T++VV SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  501   RRQDSSIGFGAPVRANMRNGGITDSVVTSSLLESVESADLIAYGLIPEFIGRFPILVSLS  560

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL+ VL +PKNAL KQYK++F++NNVKLHFT+ AL++IAKKA++K+TGARGLR++
Sbjct  561   ALTEDQLMMVLTEPKNALGKQYKKLFSMNNVKLHFTEKALRLIAKKAMSKNTGARGLRAL  620

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G+D +D V+VDEE+VGS  + GCG KIL+G+    + L     
Sbjct  621   LESILTEAMFEIPDIKTGSDRIDAVVVDEESVGSRTSLGCGGKILRGDGALEQYLDKMKD  680

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S    E  E  L    +GD E++SRA
Sbjct  681   SAVNVEVGESDLH---EGDLELSSRA  703


 Score =   177 bits (448),  Expect(3) = 2e-139, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL AADF+V AA+ GI+YIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  389   TQAGYVGEDVESILYKLLAAADFNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQ  448

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH RGD+IQ+DTKNILFICGGAFI LEKTISER
Sbjct  449   QALLKMLEGTIVNVPEKGARKHPRGDNIQMDTKNILFICGGAFIDLEKTISER  501


 Score =   157 bits (398),  Expect(3) = 2e-139, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 94/115 (82%), Gaps = 6/115 (5%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LP+PKEICKGLD+FV+GQ+RAKKVLSVAVYNHYKRIY A+       + G 
Sbjct  282   WGGSNLGKDLPSPKEICKGLDKFVIGQKRAKKVLSVAVYNHYKRIYHATL------QKGS  335

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             TVD +   + D V+L+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  336   TVDSEVLDDDDNVDLEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  390


 Score = 98.2 bits (243),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 14/98 (14%)
 Frame = +3

Query  276  LGFQRRCKWE--GSSDN-YDHLKAEVNCPRCSKPMTVLFSNR----PLSITAGETGI---  425
            +G Q R KW+  GS DN    ++AE NCPRC+K M ++FSNR    P S +  E G    
Sbjct  51   VGVQERYKWDRGGSDDNPTRKIRAEANCPRCTKDMNLVFSNRHFPSPQSESNSELGGEGE  110

Query  426  ----YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQV  527
                YQAVNLCP C+TA+YFRP    PLQG F+EIG+V
Sbjct  111  REKGYQAVNLCPKCKTAYYFRPYDTTPLQGTFVEIGRV  148



>ref|XP_006647186.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like, partial [Oryza brachyantha]
Length=432

 Score =   196 bits (499),  Expect(3) = 4e-139, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 153/205 (75%), Gaps = 2/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF AP+R+NM    + NA + SSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  226   RRHDSSIGFQAPIRSNMRTGGVINAEITSSLLESVESGDLIAYGLIPEFVGRFPILVSLS  285

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLV+VL KPKNAL +QY ++F +N+VKLHFT+ AL++I+K+AIAK+TGARGLRSI
Sbjct  286   SLSEDQLVEVLTKPKNALGRQYTKLFEMNDVKLHFTEKALRLISKRAIAKNTGARGLRSI  345

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+P+ R G D +D V+VDEE+VG  +  G GAKIL G   G+  L     
Sbjct  346   LESILTEAMYEIPETRTGKDKIDAVVVDEESVGPTNQHGFGAKILCGE--GALDLYLDEH  403

Query  2067  STDKAEKNEEALKGDMDGDCEVASR  2141
             + +   +  E L G+ D D E  SR
Sbjct  404   NKESTPRRPEKLDGEPDIDTEAPSR  428


 Score =   191 bits (484),  Expect(3) = 4e-139, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AADFDV AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQQ L
Sbjct  117   GYVGEDVESILYKLLAAADFDVSAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQAL  176

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVV+VP+  AR+H RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  177   LKMLEGTVVSVPEKGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISER  226


 Score =   159 bits (403),  Expect(3) = 4e-139, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ ++ PTPKEIC+GLD+FV+GQERAKKVLSVAVYNHYKRI+    +  + G+  +
Sbjct  3     WGGSNLGRRFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIHCDLLSSRSAGDCSE  62

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T  +  + ++D VEL+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  63    T--DSCSSDTDGVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  115



>gb|KCW46559.1| hypothetical protein EUGRSUZ_K00383 [Eucalyptus grandis]
Length=561

 Score =   198 bits (504),  Expect(3) = 4e-139, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  S +TNAVVASSLLESVES+DL +YGLIPEFVGRFPI VSLS
Sbjct  389   RRQDSSIGFGAPVRANMRASNVTNAVVASSLLESVESSDLISYGLIPEFVGRFPILVSLS  448

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL +PKNAL KQY++MF +N VKLH+TDNAL++IA+KAIAK+TGARGLRSI
Sbjct  449   ALSEDQLVEVLTEPKNALGKQYRKMFQMNGVKLHYTDNALRLIARKAIAKNTGARGLRSI  508

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQG  2027
             LE+IL EAM+E+PD R G D +D V+VDEEAVG ++  G GAKIL G
Sbjct  509   LENILMEAMYEIPDVRTGEDIIDAVVVDEEAVG-IEGRGHGAKILYG  554


 Score =   187 bits (476),  Expect(3) = 4e-139, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL KLL AAD++V AA+ GIVYIDEVDKITKKAES+NI RDVSGEGVQQ 
Sbjct  279   AGYVGEDVESILHKLLTAADYNVAAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQA  338

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  339   LLKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  389


 Score =   161 bits (407),  Expect(3) = 4e-139, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N     PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY   S +   G+S  
Sbjct  167   WGGSNWGSNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYH-ESVKRPSGDSED  225

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  226   ARPESA--DDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  278



>dbj|BAJ98835.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=637

 Score =   205 bits (521),  Expect(3) = 5e-139, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 157/204 (77%), Gaps = 7/204 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR +M  S +++A V SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  435   RRQDSSIGFGAPVRASMRTSGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLS  494

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQ+K++F++NNVKLHFTD AL++IA+KA+ K+TGARGLR+I
Sbjct  495   ALNEDQLVQVLTEPKNALGKQFKKLFSMNNVKLHFTDAALRIIAQKAMCKNTGARGLRTI  554

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PD + G   +D V+VDE AVG +D PGCGAKIL G+      LS    
Sbjct  555   LENILMDSMYEIPDTKSGEKRIDAVVVDEGAVGLVDQPGCGAKILYGDGAFDRYLSQIKV  614

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               D A         ++DGD +++S
Sbjct  615   MGDGA-------GSEVDGDPDLSS  631


 Score =   190 bits (482),  Expect(3) = 5e-139, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  325   AGYVGEDVESILYKLLSVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  384

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  385   LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  435


 Score =   152 bits (383),  Expect(3) = 5e-139, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ K  PTPKEI KGLD++V+GQ+RAKKVLSVAVYNHYKRIY  S  + +G + G + D 
Sbjct  216   NLGKDFPTPKEISKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQSLQKGSGADLGCS-DG  274

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             + + E D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  275   EADGE-DNVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  324


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 68/121 (56%), Gaps = 25/121 (21%)
 Frame = +3

Query  216  TPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYD---------------HLKAEVNC  350
            +P+   +PPP   +         Q R KWEG S +                  ++AE +C
Sbjct  27   SPAIAAVPPPHRLL---------QDRRKWEGPSSSSGGGSSSSSSNDEPEPRRIRAEAHC  77

Query  351  PRCSKPMTVLFSNRPLSITAGET-GIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQV  527
            PRCSK M +LFS+R    +A    G YQ +NLCP+CRTA++F P+ LEPLQG F+EIG+V
Sbjct  78   PRCSKHMDILFSHRAAPRSAPAAAGGYQTLNLCPNCRTAYFFHPNHLEPLQGTFVEIGRV  137

Query  528  K  530
            +
Sbjct  138  R  138



>ref|XP_009355384.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Pyrus x bretschneideri]
Length=596

 Score =   199 bits (507),  Expect(3) = 5e-139, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R QDSSIGFG PVR NM  S LT+A+V SSLLE VES DL AYGLIPEFVGRFP+  SLS
Sbjct  387   RLQDSSIGFGVPVRANMRTSGLTDAIVTSSLLEYVESGDLIAYGLIPEFVGRFPVLASLS  446

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +LDE+QLVQVL +PKNAL KQYK+MF +NNV+LHFTDNAL++IAKKA+AK+ GARGLR+I
Sbjct  447   SLDEDQLVQVLTEPKNALGKQYKKMFNMNNVQLHFTDNALRLIAKKAMAKNAGARGLRAI  506

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAG  2036
             LE+ILT+AMFEVPD +   +    VLVDEEAVGS DT G GAKIL G+  
Sbjct  507   LENILTDAMFEVPDMKTEANSACAVLVDEEAVGSEDTCGLGAKILSGDGA  556


 Score =   187 bits (476),  Expect(3) = 5e-139, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 101/110 (92%), Gaps = 2/110 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL++LLM ADFDVEAA+ GIVYIDEVDKITKK ESL+  RDVSGEGVQQ L
Sbjct  280   GYVGEDVESILYRLLMEADFDVEAAQKGIVYIDEVDKITKKVESLS--RDVSGEGVQQAL  337

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVV+V D  ARKHSRGDSIQ+DTKNILFICGGAF+GLEKTISER
Sbjct  338   LKMLEGTVVSVSDKGARKHSRGDSIQMDTKNILFICGGAFVGLEKTISER  387


 Score =   159 bits (402),  Expect(3) = 5e-139, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             + LPTPK ICK LDEFV+GQ+RAKKVLSVAVYNHYKRI+ AS   M  G        +G 
Sbjct  171   RDLPTPKFICKALDEFVIGQQRAKKVLSVAVYNHYKRIHHASPKTMRSGAESVDYKLEGV  230

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              +SD VEL+KSNVLLMGPTGSGKTLLAKTLAR+VNVPF IADATTLTQ
Sbjct  231   HDSDSVELEKSNVLLMGPTGSGKTLLAKTLARVVNVPFAIADATTLTQ  278


 Score =   134 bits (337),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 71/97 (73%), Gaps = 15/97 (15%)
 Frame = +3

Query  285  QRRCK-WEGS--------------SDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGET  419
            +RRC  WEG+              S  YDH++AEVNCPRCSK M VLFS RPLSIT+ ET
Sbjct  46   RRRCHNWEGTLGGGGGGGGGGGGGSGEYDHIRAEVNCPRCSKQMAVLFSTRPLSITSRET  105

Query  420  GIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
            G+YQAVNLCP+CRTAFYFRP KL PL G F+EIG++K
Sbjct  106  GLYQAVNLCPNCRTAFYFRPLKLVPLHGTFVEIGRLK  142



>ref|XP_004234968.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Solanum lycopersicum]
Length=570

 Score =   191 bits (485),  Expect(3) = 5e-139, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 159/204 (78%), Gaps = 3/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVRTNM    +T+A V SSLLE+VES+DL +YGLIPEFVGRFPI VSLS
Sbjct  366   RRQDSSIGFGAPVRTNMRTGGVTSAAVTSSLLETVESSDLISYGLIPEFVGRFPILVSLS  425

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK+MF +N VKLHF + AL+++A+KAI+K+TGARGLRSI
Sbjct  426   ALTEDQLVQVLTEPKNALGKQYKKMFQMNGVKLHFVEAALRLVARKAISKNTGARGLRSI  485

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R G+D +D V+VDEE+VG+ +  GCG KIL G  G  +R      
Sbjct  486   LENILMDAMYEIPDVRTGDDVIDAVVVDEESVGT-EGRGCGGKILYGK-GAFDRHFPQNR  543

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D +E N EA  GD + + E+ S
Sbjct  544   SKD-SEANMEASDGDHEAEQELPS  566


 Score =   189 bits (481),  Expect(3) = 5e-139, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  257   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  316

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  317   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  366


 Score =   166 bits (419),  Expect(3) = 5e-139, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQM-AGGESG  920
             W G N+  + PTPK++C+GLD+FV+GQERAKKVLSVAVYNHYKRIY+ SS +  AG +S 
Sbjct  143   WGGSNLGTQFPTPKQLCRGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSSHKWPAGNDSS  202

Query  921   KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  D     E++ VEL+KSN+LLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  203   EKTD---GVENESVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  255



>dbj|BAJ93977.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   212 bits (540),  Expect(3) = 2e-138, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 159/197 (81%), Gaps = 2/197 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+RTN+  S +T+  V SSLLESVES DL  +GLIPEF+GR PI VSL+
Sbjct  414   RRQDSSIGFGAPIRTNIRSSGVTSPTVTSSLLESVESGDLAKFGLIPEFIGRLPILVSLA  473

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKN+L +QY++MF+LNNVKLHFTD AL+++AKKAI K+TGARGLR I
Sbjct  474   ALNEDQLVQVLTEPKNSLSRQYRKMFSLNNVKLHFTDGALRIVAKKAIVKNTGARGLRVI  533

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL EAM+E+PD + GN+ VD V+VDEEA+GS+D PGCGAKIL+G+   ++ +     
Sbjct  534   LETILLEAMYEIPDEKAGNERVDAVVVDEEAIGSVDRPGCGAKILRGDGALAQYI--IRN  591

Query  2067  STDKAEKNEEALKGDMD  2117
             +   + +  EAL G+++
Sbjct  592   NLPNSPETNEALAGELE  608


 Score =   175 bits (443),  Expect(3) = 2e-138, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL KLL+ A+++V+AA+ GIVYIDEVDKITKKAES N+ RDVSGEGVQQ 
Sbjct  304   AGYVGEDVESILQKLLVEAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQA  363

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+LEGTVV +P+  +RK+SR DSIQIDTK+ILFICGGAF+ LEKTISER
Sbjct  364   LLKILEGTVVTIPEKGSRKNSRNDSIQIDTKDILFICGGAFVDLEKTISER  414


 Score =   157 bits (398),  Expect(3) = 2e-138, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G  + ++LPTP+E+C+ LDEFV+GQ +AKKVLSVAVYNHYKR+Y+A+  + +   SG 
Sbjct  191   WGGATLGEELPTPREMCRRLDEFVIGQGKAKKVLSVAVYNHYKRVYNATVQKGSADNSG-  249

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                +  N + D VE+DKSNVLLMGPTGSGKTLLAKTLAR+VNVPFVIADAT+LTQ
Sbjct  250   -CPDAANDDHDNVEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATSLTQ  303


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 12/80 (15%)
 Frame = +3

Query  330  LKAEVNCPRCSKPMTVLFSNRPL-----SITAGETGI----YQAVNLCPHCRTAFYFRPS  482
            + A+ NCPRC+  ++V FS +PL     S +A   G     +   ++CP CR AF FR  
Sbjct  29   IHADANCPRCTANISVQFSLQPLPPPAASCSAEAAGARPHHHDGASVCPACRGAFLFRAH  88

Query  483  KLEPLQGNFIEIGQVKGGVG  542
            +++P++G F+EI     GVG
Sbjct  89   RIDPMRGAFLEI---PSGVG  105



>ref|NP_001045031.1| Os01g0886600 [Oryza sativa Japonica Group]
 dbj|BAD82240.1| putative CLP protease regulatory subunit CLPX [Oryza sativa Japonica 
Group]
 dbj|BAD82124.1| putative CLP protease regulatory subunit CLPX [Oryza sativa Japonica 
Group]
 dbj|BAF06945.1| Os01g0886600 [Oryza sativa Japonica Group]
Length=496

 Score =   213 bits (542),  Expect(3) = 2e-138, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+R NM  S +T+ +V SSLLESVES DL  YGLIPEF+GR PI VSL+
Sbjct  291   RRQDSSIGFGAPIRINMRSSEVTDPMVTSSLLESVESGDLARYGLIPEFIGRLPILVSLT  350

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKN+L +QY++MF+LN VKLHFTD AL+++AKKAIA++TGARGLR+I
Sbjct  351   ALNEDQLVQVLTEPKNSLSRQYRKMFSLNKVKLHFTDGALRIVAKKAIARNTGARGLRAI  410

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LES+L EAM+E+PD + G++ VD V+VDEEA+GS+D PGCGAKIL+G+ G  E+  +   
Sbjct  411   LESLLLEAMYEIPDEKTGSERVDAVVVDEEAIGSIDRPGCGAKILRGD-GALEQYITNTN  469

Query  2067  STDKAEKNEEALKGDMDGDCEVASR  2141
               +  E N E L G+++ D  + SR
Sbjct  470   MKNSMEAN-EGLAGELE-DAYMMSR  492


 Score =   177 bits (448),  Expect(3) = 2e-138, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL KLL+AA+++V+AA+ GIVYIDEVDKITKKAES N+ RDVSGEGVQQ L
Sbjct  182   GYVGEDVESILQKLLVAAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQAL  241

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV++P+  +RK+SR +SIQIDTK+ILFICGGAF+ LEKTISER
Sbjct  242   LKILEGTVVSIPEKGSRKNSRNESIQIDTKDILFICGGAFVDLEKTISER  291


 Score =   154 bits (390),  Expect(3) = 2e-138, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 93/118 (79%), Gaps = 8/118 (7%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G  + ++LPTP+E+C+ LDEFV+GQ +AKKVLSVAVYNHYKRIY+A+  +     SG 
Sbjct  68    WGGATLGEELPTPREMCRRLDEFVIGQGKAKKVLSVAVYNHYKRIYNATVQKGCSTNSGW  127

Query  921   --KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  D+Q N     +E+DKSNVLLMGPTGSGKTLLAKTLAR+VNVPF+IADAT+LTQ
Sbjct  128   LDAASDDQNN-----IEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFIIADATSLTQ  180



>gb|AFW84351.1| hypothetical protein ZEAMMB73_159465 [Zea mays]
Length=624

 Score =   210 bits (535),  Expect(3) = 4e-138, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 157/197 (80%), Gaps = 2/197 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+RTNM  S  +  +V SSLLESVES DL  YGLIPEF+GR PI VSL+
Sbjct  419   RRQDSSIGFGAPIRTNMRSSGASCPMVTSSLLESVESGDLVRYGLIPEFIGRLPILVSLA  478

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E QLVQVL +PKN+L KQY++MF LN VKLHFTD AL+++AKKAIAKSTGARGLR+I
Sbjct  479   ALNEGQLVQVLTEPKNSLSKQYRKMFNLNKVKLHFTDGALRLLAKKAIAKSTGARGLRAI  538

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++L EAM+EVPD + GN+ VD V+VDEEA+GS+D PGCGAKIL+G+    + ++   T
Sbjct  539   LETVLLEAMYEVPDEKTGNERVDAVVVDEEAIGSVDRPGCGAKILRGDGALDQYITR--T  596

Query  2067  STDKAEKNEEALKGDMD  2117
             +    ++  + L G+++
Sbjct  597   NVMNLQETNDGLAGELE  613


 Score =   174 bits (441),  Expect(3) = 4e-138, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL KLL+AA+++V+AA+ GIVYIDE+DKITKKAES N+ RDVSGEGVQQ 
Sbjct  309   AGYVGEDVESILQKLLVAAEYNVQAAQQGIVYIDEIDKITKKAESANVSRDVSGEGVQQA  368

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+LEGTVV++P+  +RK+SR DSIQIDT +ILFICGGAF+ LEKTISER
Sbjct  369   LLKILEGTVVSIPEKGSRKNSRNDSIQIDTTDILFICGGAFVDLEKTISER  419


 Score =   159 bits (402),  Expect(3) = 4e-138, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G ++   LPTP+E+C+ LDEFV+GQ +AKKVLSVAVYNHYKRIY+A+  +   G SG 
Sbjct  196   WGGASLGDDLPTPRELCRRLDEFVIGQAKAKKVLSVAVYNHYKRIYNANVQKEFAGNSG-  254

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                + G+ + + VE+DKSNVLLMGPTGSGKTLLAKTLAR+VNVPFVIADAT+LTQ
Sbjct  255   -FPDAGHDDQNIVEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATSLTQ  308


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 53/113 (47%), Gaps = 26/113 (23%)
 Frame = +3

Query  288  RRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLS---------ITAGETGIYQAVN  440
            RRC     S     ++AE NCPRC   M+V FS + L          I   +   +    
Sbjct  21   RRC-----SGVSGRIRAEANCPRCDAHMSVQFSLQQLPAPPPASAGAIDGAQHHNHDGAG  75

Query  441  LCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAG  599
            +CP CR AF FR  +++PL+G F+EI     GV         AAG E+ ++ G
Sbjct  76   VCPACRGAFLFRAQRIDPLRGAFLEI---PAGV---------AAGDEDAESGG  116



>ref|XP_002458882.1| hypothetical protein SORBIDRAFT_03g042120 [Sorghum bicolor]
 gb|EES04002.1| hypothetical protein SORBIDRAFT_03g042120 [Sorghum bicolor]
Length=623

 Score =   209 bits (532),  Expect(3) = 4e-138, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVRTNM  S  +  +V S+LLESVES DL  YGLIPEF+GR PI VSL+
Sbjct  418   RRQDSSIGFGAPVRTNMRSSGASCPMVTSTLLESVESGDLVRYGLIPEFIGRLPILVSLA  477

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E QLVQVL +PKN+L KQY++MF LN V+LHFTD AL+++AKKAIAKSTGARGLR+I
Sbjct  478   ALNEGQLVQVLTEPKNSLSKQYRKMFNLNKVRLHFTDGALRLVAKKAIAKSTGARGLRAI  537

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LE++L EAM+E+PD + GN+ VD V+VDEEA+GS+D PGCGAKIL+G+
Sbjct  538   LETVLLEAMYEIPDEKTGNERVDAVVVDEEAIGSVDRPGCGAKILRGD  585


 Score =   175 bits (443),  Expect(3) = 4e-138, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL KLL+AA+++V+AA+ GIVYIDE+DKITKKAES N+ RDVSGEGVQQ 
Sbjct  308   AGYVGEDVESILQKLLVAAEYNVQAAQQGIVYIDEIDKITKKAESANVSRDVSGEGVQQA  367

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+LEGTVV++P+  +RK+SR DSIQIDT +ILFICGGAF+ LEKTISER
Sbjct  368   LLKILEGTVVSIPEKGSRKNSRNDSIQIDTTDILFICGGAFVDLEKTISER  418


 Score =   159 bits (402),  Expect(3) = 4e-138, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G ++  +LPTP+E+C+ LDEFV+GQ +AKKVLSVAVYNHYKRIY+A+  + +   SG 
Sbjct  195   WGGASLGDELPTPREMCRRLDEFVIGQAKAKKVLSVAVYNHYKRIYNANVQKESAANSG-  253

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + + G+ + + VE+DKSNVLLMGPTGSGKTLLAKTLAR+VNVPFVIADAT+LTQ
Sbjct  254   -LPDAGHDDQNIVEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATSLTQ  307


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (49%), Gaps = 16/94 (17%)
 Frame = +3

Query  288  RRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGI---------YQAVN  440
            RRC    S  +   ++AE NCPRC   M+V FS + L                  +    
Sbjct  21   RRC----SGGSGSGIRAEANCPRCDAYMSVQFSLQQLPAPPPAAAGAIDAAQHHNHDGAG  76

Query  441  LCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVG  542
            +CP CR AF FR  +++PL+G F+EI    GGVG
Sbjct  77   VCPACRGAFLFRAQRIDPLRGAFLEI---PGGVG  107



>ref|XP_007023126.1| ATP-dependent Clp protease ATP-binding subunit clpX isoform 1 
[Theobroma cacao]
 gb|EOY25748.1| ATP-dependent Clp protease ATP-binding subunit clpX isoform 1 
[Theobroma cacao]
Length=573

 Score =   202 bits (515),  Expect(3) = 6e-138, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 152/209 (73%), Gaps = 27/209 (13%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  S LT A V SSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  362   RRQDSSIGFGAPVRANMRSSGLTTAAVTSSLLESVESDDLIAYGLIPEFIGRFPILVSLS  421

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
              L+E+QLV+VLMKPKNAL KQYK+MF++N VKLHFT NAL++I+KKA+AK+TGARGLR+I
Sbjct  422   GLNEDQLVEVLMKPKNALGKQYKKMFSMNGVKLHFTANALRLISKKAMAKNTGARGLRAI  481

Query  1887  LESILTEAMFEV--------------------------PDARPGNDGVDMVLVDEEAVGS  1988
             LE+ILTEAMFEV                          PD +  + GV+ VLVDEEAVGS
Sbjct  482   LENILTEAMFEVRIWFLLSFGVMTTIQDEGLFSFSPEIPDTKMESQGVNAVLVDEEAVGS  541

Query  1989  LDTPGCGAKILQGNAGGSERLSSAMTSTD  2075
              D  GCGAKIL G+ G  +R  +  T  D
Sbjct  542   FDETGCGAKILYGD-GELDRFLAKRTWKD  569


 Score =   186 bits (473),  Expect(3) = 6e-138, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ A+FDVEAA+HGIVYIDEVDKITKKAES NIGRDVSGEGVQQ L
Sbjct  251   GYVGEDVESILYKLLVEAEFDVEAAQHGIVYIDEVDKITKKAESSNIGRDVSGEGVQQAL  310

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNV  PD  AR++ RGDS QIDTK+ILF+CGGAFI LEKTISER
Sbjct  311   LKLLEGTIVNVPLPDKGARRYPRGDSFQIDTKDILFVCGGAFIDLEKTISER  362


 Score =   154 bits (388),  Expect(3) = 6e-138, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 5/108 (5%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             ++LPTPKEIC  LDEFV+GQ++AKKVLSVAVYNHYKRIY AS    A       + +  N
Sbjct  147   RELPTPKEICGRLDEFVIGQQKAKKVLSVAVYNHYKRIYHASQQNEAC-----ILGDDEN  201

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               +DFVELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPFVI DATTLTQ
Sbjct  202   DANDFVELDKSNVLLIGPTGSGKTLLAKTLARIVNVPFVIVDATTLTQ  249


 Score =   129 bits (324),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  291  RCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFY  470
            R KW+G    YDH++A+VNCPRC   M VLFSNRPLSITA E G+YQA+NLCP+C+TAFY
Sbjct  33   RQKWDGV--EYDHIRADVNCPRCFNQMPVLFSNRPLSITAREPGLYQALNLCPNCKTAFY  90

Query  471  FRPSKLEPLQGNFIEIGQVKG  533
            FRP KL PLQG+F+E+G++ G
Sbjct  91   FRPFKLVPLQGSFVELGRIMG  111



>ref|XP_004164772.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit ClpX-like [Cucumis sativus]
Length=571

 Score =   210 bits (535),  Expect(3) = 8e-138, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSS+GFGAPVR NM    +T+A+V SSLLE+VES+DL AYGLIPEFVGRFPI VSLS
Sbjct  368   RRQDSSLGFGAPVRANMRAGGVTDAMVTSSLLETVESSDLIAYGLIPEFVGRFPILVSLS  427

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N+VKLHFT+N+L++IA+KA++K+TGARGLRSI
Sbjct  428   ALTENQLVQVLTEPKNALGKQYRKMFQMNDVKLHFTENSLRLIARKAMSKNTGARGLRSI  487

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++L ++M+E+PD R G D +D V+VDEE+VGS D+PG GAKIL G       LS    
Sbjct  488   LENLLMDSMYEIPDVRTGKDIIDAVIVDEESVGS-DSPGFGAKILYGKGALDRHLSGQKA  546

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             ++  +E+  E  +G+ D    VAS
Sbjct  547   TSQDSEREPEP-EGETDLPSVVAS  569


 Score =   178 bits (452),  Expect(3) = 8e-138, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLM AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  259   GYVGEDVESILYKLLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  318

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RG++IQIDTK+ILFICG   + L KTISER
Sbjct  319   LKMLEGTIVNVPEKGARKHPRGENIQIDTKDILFICGVPSLXLGKTISER  368


 Score =   154 bits (388),  Expect(3) = 8e-138, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G ++    PTPKEI KGLD+FV+GQERAKKVLSV VYNHYKRIY  S  +  G   
Sbjct  144   GCWGGSSLGPNFPTPKEIAKGLDKFVIGQERAKKVLSVGVYNHYKRIYHESLQRPTGDTF  203

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 D     + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  204   NNKADAA---DDDKVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  257



>ref|XP_010065233.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Eucalyptus grandis]
 ref|XP_010065234.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Eucalyptus grandis]
 ref|XP_010065235.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Eucalyptus grandis]
 ref|XP_010065236.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Eucalyptus grandis]
Length=581

 Score =   206 bits (525),  Expect(3) = 1e-137, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LT+ +VASSLL+SVES DL AYGLIPEFVGRFP+ VSLS
Sbjct  406   RRQDSSIGFGAPVRANMRKGGLTDTLVASSLLQSVESGDLVAYGLIPEFVGRFPVLVSLS  465

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL KPKNAL KQYK+MF +NNV+L FTDNAL++IAKKA+AK+TGARGLR++
Sbjct  466   ALSEDQLVQVLTKPKNALGKQYKKMFRMNNVELQFTDNALRLIAKKALAKNTGARGLRAL  525

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQ  2024
             LE+IL EAMFEVP    G + V  VLVDEEAVG LD PGCGAKI+Q
Sbjct  526   LENILIEAMFEVPQDTAGVNTVSSVLVDEEAVGPLDGPGCGAKIIQ  571


 Score =   184 bits (467),  Expect(3) = 1e-137, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  1082  DTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQ  1261
             + GYVGEDVESI++KLL AADF+VEAA+ GIVYIDEVDKITKKAE +N GRDVSGEGVQQ
Sbjct  295   EAGYVGEDVESIMYKLLAAADFNVEAAQQGIVYIDEVDKITKKAEYVNAGRDVSGEGVQQ  354

Query  1262  GLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
              LLKMLEGTVVN+PD  ARKH  GD I IDTK+ILFICGGAF+ L+KTISER
Sbjct  355   ALLKMLEGTVVNIPDKGARKHLPGDDIWIDTKDILFICGGAFVDLDKTISER  406


 Score =   151 bits (382),  Expect(3) = 1e-137, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 9/112 (8%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             +KLPTPKEICKGLDEFVVGQE AKKVL+VAVYNHYKRIY  S  + + GE        G+
Sbjct  189   RKLPTPKEICKGLDEFVVGQEMAKKVLAVAVYNHYKRIYHTSLGKESDGEL-----SVGD  243

Query  945   FESDF----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             F  D     VEL+KSN+LL+GPTGSGKTLLAKTLAR+V+VPFVIADATTLT+
Sbjct  244   FADDHRYVSVELEKSNILLLGPTGSGKTLLAKTLARVVSVPFVIADATTLTE  295


 Score =   141 bits (356),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +3

Query  285  QRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTA  464
            QRR KW G+   YDH++A+VNCPRCS+ M +LFSNRPLSIT  E G+YQA+NLCPHCRTA
Sbjct  57   QRRQKWGGT--EYDHIRADVNCPRCSRQMPLLFSNRPLSITGREPGVYQALNLCPHCRTA  114

Query  465  FYFRPSKLEPLQGNFIEIGQV  527
            FYFRP KLEPLQG+F+EIG+V
Sbjct  115  FYFRPFKLEPLQGSFVEIGRV  135



>ref|XP_011024834.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Populus euphratica]
Length=575

 Score =   191 bits (484),  Expect(3) = 2e-137, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AAD +V AA+ GI+YIDEVDKITKKAES+NI RDVSGEGVQQ L
Sbjct  261   GYVGEDVESILYKLLTAADHNVAAAQQGIIYIDEVDKITKKAESVNISRDVSGEGVQQAL  320

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVPD  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  321   LKMLEGTVVNVPDKEARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  370


 Score =   190 bits (483),  Expect(3) = 2e-137, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 151/204 (74%), Gaps = 7/204 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A + SSLLE+ ES+DL +YGLIPEFVGRFPI VSLS
Sbjct  370   RRQDSSIGFGAPVRANMRTGGVTSAALTSSLLETAESSDLVSYGLIPEFVGRFPILVSLS  429

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQY+++F +N VKLH TD+AL+ IA+KAI K+TGAR LRSI
Sbjct  430   ALTEDQLVQVLTEPKNALGKQYRKLFQMNGVKLHVTDHALRSIARKAITKNTGARALRSI  489

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PD R G D +D V+VDEEA+G  +  G  AKIL G       LS    
Sbjct  490   LENILMDSMYEIPDVRRGADIIDTVVVDEEAIGPEEC-GARAKILYGRGALDRYLSK---  545

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               +K + +E  ++G  DG+ EV S
Sbjct  546   --NKLKSSEATVEGS-DGEPEVES  566


 Score =   160 bits (405),  Expect(3) = 2e-137, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 93/121 (77%), Gaps = 10/121 (8%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQM----A  905
             G W G N+    PTPK+ICK LD+FV+GQ+RAKKVLSVAVYNHYKRIY  S  +     +
Sbjct  145   GSWGGSNLGSSFPTPKDICKALDKFVIGQQRAKKVLSVAVYNHYKRIYVQSVKKWCNIDS  204

Query  906   GGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLT  1085
             G E  +T+DE+       VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLT
Sbjct  205   GNEKAETMDEEE------VELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLT  258

Query  1086  Q  1088
             Q
Sbjct  259   Q  259



>ref|XP_009421144.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Musa acuminata subsp. malaccensis]
Length=667

 Score =   197 bits (501),  Expect(3) = 2e-137, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 142/176 (81%), Gaps = 4/176 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGA VR NM  S LT+ V +S L       DL AYGL+PEFVGRFP+ VSLS
Sbjct  461   RRQDSSIGFGASVRANMRTSWLTDVVTSSLLESVESG-DLIAYGLVPEFVGRFPVLVSLS  519

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVLM+PKNAL +QYK++F++NNVKLHFTD +L +IAKK++AK+TGARGLR+I
Sbjct  520   ALSENQLVQVLMEPKNALGRQYKKLFSMNNVKLHFTDASLCLIAKKSMAKNTGARGLRAI  579

Query  1887  LESILTEAMFEVPDARPGNDG--VDMVLVDEEAVGSLDTPGCGAKILQGNAGGSER  2048
             LE++L +AM+E+PD +  ++   +D V+VDE+AVGS+D PG GAKIL+G+ G  ER
Sbjct  580   LETVLLDAMYEIPDVKTKDEDEPIDAVVVDEDAVGSVDRPGSGAKILRGD-GALER  634


 Score =   192 bits (488),  Expect(3) = 2e-137, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ GIVYIDEVDKITKK+ESLNI RDVSGEGVQQ 
Sbjct  351   AGYVGEDVESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKSESLNISRDVSGEGVQQA  410

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+N ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  411   LLKMLEGTIVNVPENGARKHPRGDNIQIDTKDILFICGGAFVNLEKTISER  461


 Score =   151 bits (382),  Expect(3) = 2e-137, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 91/114 (80%), Gaps = 9/114 (8%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ K +PTPKEI +GLD++V+GQE AKKVLSVAVYNHYKRIY AS  + AG      VD 
Sbjct  243   NLGKDMPTPKEIYEGLDKYVIGQEHAKKVLSVAVYNHYKRIYHASLQKSAG------VDS  296

Query  936   QGNFES---DFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             + + E    D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPF+IADATTLTQ
Sbjct  297   ENHAEGDDDDNVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFIIADATTLTQ  350


 Score =   101 bits (251),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 76/131 (58%), Gaps = 13/131 (10%)
 Frame = +3

Query  273  GLGFQRRCKWEGSSDNYDH---LKAEVNCPRCSKPMTVLFSNR-PLSITAGETGIY----  428
            GL    R KW+G   +  H   ++AE +CPRCSK M VLF NR   ++T   +G Y    
Sbjct  53   GLLRHDRHKWDGGGADEFHTRRIRAEAHCPRCSKHMRVLFPNRFSPTVTGDGSGDYGAER  112

Query  429  QAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENG-KAAGKI  605
             AVNLCP C+TA+ F P +L PLQG F+EIG+V+G   E+          ENG +A  + 
Sbjct  113  HAVNLCPRCKTAYSFSPHELVPLQGTFVEIGRVRGPNPEKYR----CESEENGIRAKNRF  168

Query  606  WEKLRTYSGNN  638
            W+ LR++ G +
Sbjct  169  WKALRSFYGGD  179



>gb|KCW62577.1| hypothetical protein EUGRSUZ_G00073 [Eucalyptus grandis]
Length=581

 Score =   206 bits (525),  Expect(3) = 4e-137, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    LT+ +VASSLL+SVES DL AYGLIPEFVGRFP+ VSLS
Sbjct  406   RRQDSSIGFGAPVRANMRKGGLTDTLVASSLLQSVESGDLVAYGLIPEFVGRFPVLVSLS  465

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL KPKNAL KQYK+MF +NNV+L FTDNAL++IAKKA+AK+TGARGLR++
Sbjct  466   ALSEDQLVQVLTKPKNALGKQYKKMFRMNNVELQFTDNALRLIAKKALAKNTGARGLRAL  525

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQ  2024
             LE+IL EAMFEVP    G + V  VLVDEEAVG LD PGCGAKI+Q
Sbjct  526   LENILIEAMFEVPQDTAGVNTVSSVLVDEEAVGPLDGPGCGAKIIQ  571


 Score =   182 bits (461),  Expect(3) = 4e-137, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  1082  DTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQ  1261
             +  YVGEDVESI++KLL AADF+VEAA+ GIVYIDEVDKITKKAE +N GRDVSGEGVQQ
Sbjct  295   EASYVGEDVESIMYKLLAAADFNVEAAQQGIVYIDEVDKITKKAEYVNAGRDVSGEGVQQ  354

Query  1262  GLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
              LLKMLEGTVVN+PD  ARKH  GD I IDTK+ILFICGGAF+ L+KTISER
Sbjct  355   ALLKMLEGTVVNIPDKGARKHLPGDDIWIDTKDILFICGGAFVDLDKTISER  406


 Score =   151 bits (382),  Expect(3) = 4e-137, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 9/112 (8%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             +KLPTPKEICKGLDEFVVGQE AKKVL+VAVYNHYKRIY  S  + + GE        G+
Sbjct  189   RKLPTPKEICKGLDEFVVGQEMAKKVLAVAVYNHYKRIYHTSLGKESDGEL-----SVGD  243

Query  945   FESDF----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             F  D     VEL+KSN+LL+GPTGSGKTLLAKTLAR+V+VPFVIADATTLT+
Sbjct  244   FADDHRYVSVELEKSNILLLGPTGSGKTLLAKTLARVVSVPFVIADATTLTE  295


 Score =   142 bits (357),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +3

Query  285  QRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTA  464
            QRR KW G+   YDH++A+VNCPRCS+ M +LFSNRPLSIT  E G+YQA+NLCPHCRTA
Sbjct  57   QRRQKWGGT--EYDHIRADVNCPRCSRQMPLLFSNRPLSITGREPGVYQALNLCPHCRTA  114

Query  465  FYFRPSKLEPLQGNFIEIGQV  527
            FYFRP KLEPLQG+F+EIG+V
Sbjct  115  FYFRPFKLEPLQGSFVEIGRV  135



>ref|XP_010677227.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris]
Length=655

 Score =   210 bits (535),  Expect(3) = 6e-137, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +3

Query  1509  DYYFCPRRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFP  1688
             D     RRQD+SIGFGAPVR N+  + + +AVV S+LLE+VES+DL AYGLIPEF+GRFP
Sbjct  448   DKTISERRQDASIGFGAPVRENLRSAGVASAVVTSALLETVESSDLIAYGLIPEFIGRFP  507

Query  1689  IFVSLSALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGA  1868
             I VSLS+L E+QLVQVL +PKNAL KQYK++F++NNVKLHFT+ AL++IAKK++ K+TGA
Sbjct  508   ILVSLSSLTEDQLVQVLTEPKNALGKQYKKLFSMNNVKLHFTEKALRLIAKKSMVKNTGA  567

Query  1869  RGLRSILESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSER  2048
             RGLR+ LES+LTEAM+E+PD + GNDG++ VLVD+E++GS+ +PGCGAKIL+G+    + 
Sbjct  568   RGLRAQLESVLTEAMYEIPDMKAGNDGINAVLVDDESMGSVSSPGCGAKILRGDGSLKDY  627

Query  2049  LSSA  2060
             L++A
Sbjct  628   LANA  631


 Score =   174 bits (442),  Expect(3) = 6e-137, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AAD++V+AA+ GIVYIDE+DKITKKAE+ N+ RDVSGEGVQQ 
Sbjct  344   AGYVGEDVESILYKLLTAADYNVQAAQQGIVYIDEIDKITKKAENFNVSRDVSGEGVQQA  403

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+LEG++VNVP+   RK  RG+ +QIDTK+ILFICGGAF+ L+KTISER
Sbjct  404   LLKILEGSIVNVPEKGGRKPPRGEHVQIDTKDILFICGGAFVDLDKTISER  454


 Score =   154 bits (390),  Expect(3) = 6e-137, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G  + K LPTPKEICKGLD+FV+GQ  AKKVLSVAV+NHYKRI  AS   + G E+  
Sbjct  235   WGGAQLGKDLPTPKEICKGLDKFVIGQHHAKKVLSVAVHNHYKRIQHAS---LKGSEAQF  291

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E    E+D VEL+KSNV+LMGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQ
Sbjct  292   HAPEA---ENDDVELEKSNVILMGPTGSGKTLLAKTLARFVNVPFVVADATTLTQ  343


 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +3

Query  207  FFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFS  386
             FS  +R+ +  PP+           Q R KW G   N   +KAEVNCPRCS+ + VLFS
Sbjct  19   LFSGDTRREIQAPPSLF--FRFPATNQERFKWGGDFPNRRRIKAEVNCPRCSRIIDVLFS  76

Query  387  -NRPLSITAGETGI-YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIG  521
             NRP +      G   +AV++CP+C++ F+F+PSK+ PL+G+F+EIG
Sbjct  77   SNRPSNGNGNGNGNECEAVSVCPNCKSEFHFQPSKMAPLEGSFLEIG  123



>ref|XP_010677229.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris]
Length=636

 Score =   210 bits (534),  Expect(3) = 1e-136, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQD+SIGFGAPVR N+  + + +AVV S+LLE+VES+DL AYGLIPEF+GRFPI VSLS
Sbjct  454   RRQDASIGFGAPVRENLRSAGVASAVVTSALLETVESSDLIAYGLIPEFIGRFPILVSLS  513

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLVQVL +PKNAL KQYK++F++NNVKLHFT+ AL++IAKK++ K+TGARGLR+ 
Sbjct  514   SLTEDQLVQVLTEPKNALGKQYKKLFSMNNVKLHFTEKALRLIAKKSMVKNTGARGLRAQ  573

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSA  2060
             LES+LTEAM+E+PD + GNDG++ VLVD+E++GS+ +PGCGAKIL+G+    + L++A
Sbjct  574   LESVLTEAMYEIPDMKAGNDGINAVLVDDESMGSVSSPGCGAKILRGDGSLKDYLANA  631


 Score =   174 bits (442),  Expect(3) = 1e-136, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AAD++V+AA+ GIVYIDE+DKITKKAE+ N+ RDVSGEGVQQ 
Sbjct  344   AGYVGEDVESILYKLLTAADYNVQAAQQGIVYIDEIDKITKKAENFNVSRDVSGEGVQQA  403

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+LEG++VNVP+   RK  RG+ +QIDTK+ILFICGGAF+ L+KTISER
Sbjct  404   LLKILEGSIVNVPEKGGRKPPRGEHVQIDTKDILFICGGAFVDLDKTISER  454


 Score =   154 bits (390),  Expect(3) = 1e-136, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G  + K LPTPKEICKGLD+FV+GQ  AKKVLSVAV+NHYKRI  AS   + G E+  
Sbjct  235   WGGAQLGKDLPTPKEICKGLDKFVIGQHHAKKVLSVAVHNHYKRIQHAS---LKGSEAQF  291

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E    E+D VEL+KSNV+LMGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQ
Sbjct  292   HAPEA---ENDDVELEKSNVILMGPTGSGKTLLAKTLARFVNVPFVVADATTLTQ  343


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +3

Query  207  FFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFS  386
             FS  +R+ +  PP+           Q R KW G   N   +KAEVNCPRCS+ + VLFS
Sbjct  19   LFSGDTRREIQAPPSLF--FRFPATNQERFKWGGDFPNRRRIKAEVNCPRCSRIIDVLFS  76

Query  387  -NRPLSITAGETGI-YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIG  521
             NRP +      G   +AV++CP+C++ F+F+PSK+ PL+G+F+EIG
Sbjct  77   SNRPSNGNGNGNGNECEAVSVCPNCKSEFHFQPSKMAPLEGSFLEIG  123



>gb|AES75813.2| ATP-dependent Clp protease regulatory subunit ClpX [Medicago 
truncatula]
Length=662

 Score =   201 bits (511),  Expect(3) = 1e-136, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 159/206 (77%), Gaps = 5/206 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR N+    + ++ VASSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  459   RRQDSSIGFGAPVRANIRSGRIIDSAVASSLLESVESSDLIAYGLIPEFIGRFPILVSLS  518

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E QL+QVL +PK+AL KQYK++  +N VKLHFTD AL+MIAKKA+AK+TGARGLR++
Sbjct  519   ALTEEQLMQVLTEPKHALGKQYKKLVGMNEVKLHFTDKALRMIAKKAMAKNTGARGLRAL  578

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             +E+ILT+AM+E+PD + G+D +D V+VDEE+VGSL  PGCG KIL+G+    + L+    
Sbjct  579   IENILTDAMYEIPDIKTGSDRIDAVVVDEESVGSLTAPGCGGKILRGDGALEQYLAKIKD  638

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S D   ++E       D D + +SRA
Sbjct  639   SEDVVAESEL-----QDRDSDTSSRA  659


 Score =   174 bits (440),  Expect(3) = 1e-136, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AAD++V AA+ GI+YIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  349   AGYVGEDVESILYKLLAAADYNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQA  408

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARK+ RGD+IQIDTKNILFICGGAFI LEKTISER
Sbjct  409   LLKMLEGTIVNVPEKGARKNPRGDNIQIDTKNILFICGGAFIDLEKTISER  459


 Score =   163 bits (413),  Expect(3) = 1e-136, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 96/117 (82%), Gaps = 7/117 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LP+PKEICKGLD+FV+GQ RAKKVLSVAVYNHYKRIY A+  + +G +SG 
Sbjct  237   WGGSNLGKDLPSPKEICKGLDKFVIGQGRAKKVLSVAVYNHYKRIYHATLPKGSGADSGI  296

Query  924   T--VDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  +D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  297   SGILDDDEN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  348


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 79/157 (50%), Gaps = 44/157 (28%)
 Frame = +3

Query  288  RRCKW-EGSSDN-----YDHLKAEVNCPRCSKPMTVLFSNRPL-------------SITA  410
            R+ KW  G SD         ++AE NCPRCSK M + FSNR +             ++ +
Sbjct  11   RKDKWGRGGSDGDMQNPTRKIRAEANCPRCSKDMNLFFSNRHMQSNGGDSGGGNGENLGS  70

Query  411  GETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQV----------------KGGVG  542
               G YQAVNLCP+C+TA++FRP    PLQG F+EIG+V                K G+G
Sbjct  71   NGDGGYQAVNLCPNCKTAYHFRPYNTSPLQGTFVEIGRVSNNNGGSSKTQLSRRFKNGIG  130

Query  543  ERENNGNTA-AGSE----NGKAAG----KIWEKLRTY  626
            +  N+  +   GSE    NG A+      +WE LR Y
Sbjct  131  KDSNSIKSGHHGSEDLGLNGSASNWLEVSMWETLRNY  167



>ref|XP_003523365.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Glycine max]
Length=524

 Score =   192 bits (487),  Expect(3) = 1e-136, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLM AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  212   GYVGEDVESILYKLLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  271

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISE  1414
             LKMLEGTVVNVP+  ARKH RGD+IQIDTKNILFICGGAF+ LEKTISE
Sbjct  272   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKNILFICGGAFVDLEKTISE  320


 Score =   183 bits (465),  Expect(3) = 1e-136, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 152/203 (75%), Gaps = 5/203 (2%)
 Frame = +3

Query  1530  RQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLSA  1709
             R DSSIGFGAP+R NM    +T A VASSLL++VES+DL AYGLIPEFVGRFPI VSLSA
Sbjct  322   RHDSSIGFGAPIRANMRTGKVTEAAVASSLLQTVESSDLVAYGLIPEFVGRFPILVSLSA  381

Query  1710  LDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSIL  1889
             L ENQL+QVL +PKNAL KQYK+MF +N VKLHFT+NAL+ IA+KAI+K+TGARGLRSIL
Sbjct  382   LTENQLIQVLTEPKNALGKQYKKMFQMNGVKLHFTENALRSIARKAISKNTGARGLRSIL  441

Query  1890  ESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMTS  2069
             E++L +AM+E+PD R G+D +D V+VDEEAVG  +  G GAKIL G     + L   ++ 
Sbjct  442   ENVLVDAMYEIPDIRTGDDVIDAVVVDEEAVGG-EGRGRGAKILYGK----DALDRYLSE  496

Query  2070  TDKAEKNEEALKGDMDGDCEVAS  2138
                  +  EA   D + D E+ S
Sbjct  497   QKNDSETMEASAADNEADTELPS  519


 Score =   163 bits (413),  Expect(3) = 1e-136, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIY-DASSTQMAGGE  914
             G W G N+    PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRI+ + SS++   G+
Sbjct  93    GCWGGSNLGNSFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIFNETSSSKWPAGD  152

Query  915   SGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             S     +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQ
Sbjct  153   SDNNNVKTDAVDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQ  210



>ref|XP_011024833.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Populus euphratica]
Length=581

 Score =   191 bits (484),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AAD +V AA+ GI+YIDEVDKITKKAES+NI RDVSGEGVQQ L
Sbjct  267   GYVGEDVESILYKLLTAADHNVAAAQQGIIYIDEVDKITKKAESVNISRDVSGEGVQQAL  326

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVPD  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  327   LKMLEGTVVNVPDKEARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  376


 Score =   190 bits (482),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 151/204 (74%), Gaps = 7/204 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A + SSLLE+ ES+DL +YGLIPEFVGRFPI VSLS
Sbjct  376   RRQDSSIGFGAPVRANMRTGGVTSAALTSSLLETAESSDLVSYGLIPEFVGRFPILVSLS  435

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQY+++F +N VKLH TD+AL+ IA+KAI K+TGAR LRSI
Sbjct  436   ALTEDQLVQVLTEPKNALGKQYRKLFQMNGVKLHVTDHALRSIARKAITKNTGARALRSI  495

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PD R G D +D V+VDEEA+G  +  G  AKIL G       LS    
Sbjct  496   LENILMDSMYEIPDVRRGADIIDTVVVDEEAIGPEEC-GARAKILYGRGALDRYLSK---  551

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               +K + +E  ++G  DG+ EV S
Sbjct  552   --NKLKSSEATVEGS-DGEPEVES  572


 Score =   157 bits (397),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 93/127 (73%), Gaps = 16/127 (13%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQM-----  902
             G W G N+    PTPK+ICK LD+FV+GQ+RAKKVLSVAVYNHYKRIY  S  +      
Sbjct  145   GSWGGSNLGSSFPTPKDICKALDKFVIGQQRAKKVLSVAVYNHYKRIYVQSVKKCTTWEA  204

Query  903   -----AGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIA  1067
                  +G E  +T+DE+       VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIA
Sbjct  205   RCNIDSGNEKAETMDEEE------VELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIA  258

Query  1068  DATTLTQ  1088
             DATTLTQ
Sbjct  259   DATTLTQ  265



>ref|XP_002321405.2| hypothetical protein POPTR_0015s01520g [Populus trichocarpa]
 gb|EEF05532.2| hypothetical protein POPTR_0015s01520g [Populus trichocarpa]
Length=572

 Score =   190 bits (483),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 152/204 (75%), Gaps = 7/204 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+  V SSLLE+ ES+DL +YGLIPEFVGRFPI VSL+
Sbjct  367   RRQDSSIGFGAPVRANMRTGGVTSTAVTSSLLETAESSDLVSYGLIPEFVGRFPILVSLA  426

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK++F +N+VKLH T+NAL+ IA+KAI K+TGAR LRSI
Sbjct  427   ALTEDQLVQVLTEPKNALGKQYKKLFQMNDVKLHVTENALRSIARKAITKNTGARALRSI  486

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PD R G+D +D V+VDE A+GS +    GAKIL G       LS    
Sbjct  487   LENILMDSMYEIPDVRTGDDIIDAVVVDEVAIGS-EERSVGAKILYGRGALDHYLSK---  542

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               +K + +++  +G  DG+ EV S
Sbjct  543   --EKLKCSKKTTEGS-DGEPEVES  563


 Score =   187 bits (476),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KLL AAD++V AA+ GI+YIDE+DKITKKAES+NI RDVSGEGVQQ LL
Sbjct  259   YVGEDVESILYKLLTAADYNVAAAQQGIIYIDEIDKITKKAESVNISRDVSGEGVQQALL  318

Query  1271  KMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             KMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  319   KMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  367


 Score =   160 bits (405),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+    PTPKEICK LD FV+GQ RAKKVLSVAVYNHYKRIY  S  + +  +S
Sbjct  142   GYWGGSNLGSSFPTPKEICKALDNFVIGQRRAKKVLSVAVYNHYKRIYLESVKKWSNTDS  201

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G   ++    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  202   GN--EKSDIMDDDGVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  256



>ref|XP_003526717.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Glycine max]
Length=524

 Score =   194 bits (493),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLLM AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  211   AGYVGEDVESILYKLLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  270

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVVNVP+  ARKH RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  271   LLKMLEGTVVNVPEKGARKHPRGDNIQIDTKNILFICGGAFVDLEKTISER  321


 Score =   183 bits (464),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 152/204 (75%), Gaps = 5/204 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAP+R NM    +T A VASSLLE+VES+DL AYGLIPEFVGRFPI VSLS
Sbjct  321   RRHDSSIGFGAPIRANMRTGKVTEAAVASSLLETVESSDLIAYGLIPEFVGRFPILVSLS  380

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PKNAL KQYK+MF +N VKLHFT+NAL+ IA+KAI+K+TGARGLRSI
Sbjct  381   ALTENQLIQVLSEPKNALGKQYKKMFQMNGVKLHFTENALRSIARKAISKNTGARGLRSI  440

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++L +AM+E+PD R  +D +D V+VDEEAVG  +  G GAKIL G     + LS    
Sbjct  441   LENVLVDAMYEIPDIRTDDDVIDAVVVDEEAVGG-EGRGRGAKILYGKGALDQYLSEQKN  499

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
              ++      EA   D + D E+ S
Sbjct  500   DSETM----EASAADNEADTELPS  519


 Score =   160 bits (405),  Expect(3) = 2e-136, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASS-TQMAGGE  914
             G W G N+    PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRI++ +S  +   G+
Sbjct  94    GCWGGSNLGNSFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIFNETSLPKWPAGD  153

Query  915   SGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             S  +V      + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQ
Sbjct  154   SDNSVKVDAA-DDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQ  210



>ref|XP_011028415.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Populus euphratica]
Length=593

 Score =   201 bits (511),  Expect(3) = 3e-136, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQD+SIGFGAPVR NM   A+TNA+V SSLLESVES DL AYGLIPEFVGRFP+  SL 
Sbjct  394   RRQDASIGFGAPVRANMRAGAITNAMVTSSLLESVESGDLVAYGLIPEFVGRFPVLASLL  453

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQYK++F +NNV L FT NAL++IAKKA+AK+TGARGLR+I
Sbjct  454   ALNEDQLVQVLMEPKNALGKQYKKIFNMNNVNLDFTGNALRLIAKKAMAKNTGARGLRAI  513

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERL  2051
             LE+ILTEAMFE+P+ +  ++ ++ VLVDEEAVG +DTPG GAKI+ G++    +L
Sbjct  514   LENILTEAMFEIPENKSQSNCINAVLVDEEAVGLMDTPGRGAKIIHGDSALEHKL  568


 Score =   172 bits (435),  Expect(3) = 3e-136, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ ++F+VEAA+ GIVYIDEVDKIT KA S +IGRDVSGEGVQQ L
Sbjct  283   GYVGEDVESILYKLLVVSEFNVEAAQRGIVYIDEVDKITMKAGSSSIGRDVSGEGVQQAL  342

Query  1268  LKMLEGTVVN--VPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT +N  VPD    KH RGD+IQ+DTK+ILFICGGAF+ LEKTISER
Sbjct  343   LKMLEGTALNVPVPDKGPGKHPRGDTIQVDTKDILFICGGAFVNLEKTISER  394


 Score =   164 bits (416),  Expect(3) = 3e-136, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 93/108 (86%), Gaps = 2/108 (2%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             ++LPTPKEICKGLDEFV+GQ++AKKVLSVAVYNHYKRIY AS  + +      +  E  N
Sbjct  176   RELPTPKEICKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASKQKKSHAPWSHSDGE--N  233

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              E++F+ELDKSNVLLMGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQ
Sbjct  234   DENEFIELDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATTLTQ  281


 Score =   144 bits (362),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +3

Query  210  FSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSN  389
            F++ S + L    T+ +   LGLGF RR   + ++D YD++KA+VNCPRC+  M VLFSN
Sbjct  24   FTSASTKPLILSQTSTKT--LGLGFIRRLSDKTTTD-YDYIKADVNCPRCTSHMPVLFSN  80

Query  390  RPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
            RPLSIT  ETGIYQAVN CP C+TAFYFRP KLEPLQGNFIE+G+VKG
Sbjct  81   RPLSITGRETGIYQAVNFCPTCKTAFYFRPFKLEPLQGNFIELGRVKG  128



>ref|XP_011028416.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Populus euphratica]
 ref|XP_011028417.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Populus euphratica]
Length=592

 Score =   201 bits (511),  Expect(3) = 3e-136, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQD+SIGFGAPVR NM   A+TNA+V SSLLESVES DL AYGLIPEFVGRFP+  SL 
Sbjct  393   RRQDASIGFGAPVRANMRAGAITNAMVTSSLLESVESGDLVAYGLIPEFVGRFPVLASLL  452

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQYK++F +NNV L FT NAL++IAKKA+AK+TGARGLR+I
Sbjct  453   ALNEDQLVQVLMEPKNALGKQYKKIFNMNNVNLDFTGNALRLIAKKAMAKNTGARGLRAI  512

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERL  2051
             LE+ILTEAMFE+P+ +  ++ ++ VLVDEEAVG +DTPG GAKI+ G++    +L
Sbjct  513   LENILTEAMFEIPENKSQSNCINAVLVDEEAVGLMDTPGRGAKIIHGDSALEHKL  567


 Score =   172 bits (435),  Expect(3) = 3e-136, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ ++F+VEAA+ GIVYIDEVDKIT KA S +IGRDVSGEGVQQ L
Sbjct  282   GYVGEDVESILYKLLVVSEFNVEAAQRGIVYIDEVDKITMKAGSSSIGRDVSGEGVQQAL  341

Query  1268  LKMLEGTVVN--VPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT +N  VPD    KH RGD+IQ+DTK+ILFICGGAF+ LEKTISER
Sbjct  342   LKMLEGTALNVPVPDKGPGKHPRGDTIQVDTKDILFICGGAFVNLEKTISER  393


 Score =   164 bits (416),  Expect(3) = 3e-136, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 93/108 (86%), Gaps = 2/108 (2%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             ++LPTPKEICKGLDEFV+GQ++AKKVLSVAVYNHYKRIY AS  + +      +  E  N
Sbjct  175   RELPTPKEICKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASKQKKSHAPWSHSDGE--N  232

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              E++F+ELDKSNVLLMGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQ
Sbjct  233   DENEFIELDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATTLTQ  280


 Score =   144 bits (362),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +3

Query  210  FSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSN  389
            F++ S + L    T+ +   LGLGF RR   + ++D YD++KA+VNCPRC+  M VLFSN
Sbjct  24   FTSASTKPLILSQTSTKT--LGLGFIRRLSDKTTTD-YDYIKADVNCPRCTSHMPVLFSN  80

Query  390  RPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
            RPLSIT  ETGIYQAVN CP C+TAFYFRP KLEPLQGNFIE+G+VKG
Sbjct  81   RPLSITGRETGIYQAVNFCPTCKTAFYFRPFKLEPLQGNFIELGRVKG  128



>gb|KHN19496.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Glycine 
soja]
Length=497

 Score =   190 bits (482),  Expect(3) = 3e-136, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KLLM AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ LL
Sbjct  186   YVGEDVESILYKLLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALL  245

Query  1271  KMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISE  1414
             KMLEGTVVNVP+  ARKH RGD+IQIDTKNILFICGGAF+ LEKTISE
Sbjct  246   KMLEGTVVNVPEKGARKHPRGDNIQIDTKNILFICGGAFVDLEKTISE  293


 Score =   183 bits (465),  Expect(3) = 3e-136, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 152/203 (75%), Gaps = 5/203 (2%)
 Frame = +3

Query  1530  RQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLSA  1709
             R DSSIGFGAP+R NM    +T A VASSLL++VES+DL AYGLIPEFVGRFPI VSLSA
Sbjct  295   RHDSSIGFGAPIRANMRTGKVTEAAVASSLLQTVESSDLVAYGLIPEFVGRFPILVSLSA  354

Query  1710  LDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSIL  1889
             L ENQL+QVL +PKNAL KQYK+MF +N VKLHFT+NAL+ IA+KAI+K+TGARGLRSIL
Sbjct  355   LTENQLIQVLTEPKNALGKQYKKMFQMNGVKLHFTENALRSIARKAISKNTGARGLRSIL  414

Query  1890  ESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMTS  2069
             E++L +AM+E+PD R G+D +D V+VDEEAVG  +  G GAKIL G     + L   ++ 
Sbjct  415   ENVLVDAMYEIPDIRTGDDVIDAVVVDEEAVGG-EGRGRGAKILYGK----DALDRYLSE  469

Query  2070  TDKAEKNEEALKGDMDGDCEVAS  2138
                  +  EA   D + D E+ S
Sbjct  470   QKNDSETMEASAADNEADTELPS  492


 Score =   164 bits (414),  Expect(3) = 3e-136, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIY-DASSTQMAGGE  914
             G W G N+    PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRI+ + SS++   G+
Sbjct  66    GCWGGSNLGNSFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIFNETSSSKWPAGD  125

Query  915   SGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             S     +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQ
Sbjct  126   SDNNNVKTDAVDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQ  183



>ref|XP_010520973.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Tarenaya hassleriana]
Length=576

 Score =   187 bits (476),  Expect(3) = 4e-136, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  260   GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  319

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQ+DTK+ILFICGGAF+ +EKTISER
Sbjct  320   LKMLEGTIVNVPEKGARKHPRGDNIQMDTKDILFICGGAFVDIEKTISER  369


 Score =   181 bits (459),  Expect(3) = 4e-136, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  369   RRHDSSIGFGAPVRANMRAGGVTNATVASTLMETVESSDLIAYGLIPEFVGRFPVLVSLS  428

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQYK++F +N VKLHFT  AL ++A+KAI+K+ GARGLR++
Sbjct  429   ALTENQLVQVLTEPKNALGKQYKKLFDMNGVKLHFTKGALSLVARKAISKNIGARGLRAL  488

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD + G+D +D V+VDEEAV S    G GAKIL+G  G  +R  S   
Sbjct  489   LESILMDSMYEIPDVKAGDDVIDAVVVDEEAVESEGRRGNGAKILRGE-GALDRYLSKTK  547

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D +E  E + +G+ + + E+ S
Sbjct  548   SKDSSEMKEGS-EGETEVEIELPS  570


 Score =   168 bits (425),  Expect(3) = 4e-136, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEICKGLD FV+GQERAKKVLSVAVYNHYKRIY  SS + + GE G 
Sbjct  148   WGGSNLGPNFPTPKEICKGLDNFVIGQERAKKVLSVAVYNHYKRIYYESSQKRSAGEPGS  207

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             T   +G+   + VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  208   TT-ARGD---ELVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  258



>gb|EEC71918.1| hypothetical protein OsI_04712 [Oryza sativa Indica Group]
Length=630

 Score =   213 bits (543),  Expect(3) = 5e-136, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 165/205 (80%), Gaps = 3/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+RTNM  S +T+ +V SSLLESVES DL  YGLIPEF+GR PI VSL+
Sbjct  425   RRQDSSIGFGAPIRTNMRSSEVTDPMVTSSLLESVESGDLARYGLIPEFIGRLPILVSLT  484

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKN+L +QY++MF+LN VKLHFTD AL+++AKKAIA++TGARGLR+I
Sbjct  485   ALNEDQLVQVLTEPKNSLSRQYRKMFSLNKVKLHFTDGALRIVAKKAIARNTGARGLRAI  544

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LES+L EAM+E+PD + G++ VD V+VDEEA+GS+D PGCGAKIL+G+ G  E+  +   
Sbjct  545   LESLLLEAMYEIPDEKTGSERVDAVVVDEEAIGSIDRPGCGAKILRGD-GALEQYITNTN  603

Query  2067  STDKAEKNEEALKGDMDGDCEVASR  2141
               +  E N E L G+++ D  + SR
Sbjct  604   MKNSMEAN-EGLAGELE-DAYMMSR  626


 Score =   176 bits (447),  Expect(3) = 5e-136, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL KLL+AA+++V+AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQQ 
Sbjct  315   AGYVGEDVESILQKLLVAAEYNVQAAQQGIVYIDEVDKITKKAESVNVSRDVSGEGVQQA  374

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+LEGTVV++P+  +RK+SR +SIQIDTK+ILFICGGAF+ LEKTISER
Sbjct  375   LLKILEGTVVSIPEKGSRKNSRNESIQIDTKDILFICGGAFVDLEKTISER  425


 Score =   147 bits (370),  Expect(3) = 5e-136, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 93/127 (73%), Gaps = 17/127 (13%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVL---------SVAVYNHYKRIYDASST  896
             W G  + ++LPTP+E+C+ LDEFV+GQ +AKKVL         SVAVYNHYKRIY+A+  
Sbjct  193   WGGATLGEELPTPREMCRRLDEFVIGQGKAKKVLEGACHNWVLSVAVYNHYKRIYNATVQ  252

Query  897   QMAGGESG---KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIA  1067
             +     SG      D+Q N     +E+DKSNVLLMGPTGSGKTLLAKTLAR+VNVPF+IA
Sbjct  253   KGCSTNSGWLDAASDDQNN-----IEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFIIA  307

Query  1068  DATTLTQ  1088
             DAT+LTQ
Sbjct  308   DATSLTQ  314


 Score = 66.2 bits (160),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 48/95 (51%), Gaps = 15/95 (16%)
 Frame = +3

Query  288  RRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSIT------------AGETGIYQ  431
            RRC    S      ++AE NCPRC+  M+V FS +PLS                ++  + 
Sbjct  21   RRC---CSGGGGGRIRAEANCPRCAAHMSVQFSLQPLSTPPPAAAAGGGGGDGSQSHHHD  77

Query  432  AVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGG  536
              ++CP C  AF FR  ++EPL+G F+EI    GG
Sbjct  78   GASVCPACSAAFLFRAHRIEPLRGAFLEIPPGVGG  112



>ref|XP_011044639.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Populus euphratica]
Length=539

 Score =   188 bits (477),  Expect(3) = 7e-136, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AAD++V AA+ GI+YIDE+DKITKK+ES+NI RDVSGEGVQQ L
Sbjct  258   GYVGEDVESILYKLLTAADYNVAAAQQGIIYIDEIDKITKKSESVNISRDVSGEGVQQAL  317

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  318   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  367


 Score =   187 bits (475),  Expect(3) = 7e-136, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 138/173 (80%), Gaps = 3/173 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+  V SSLLE+ ES+DL +YGLIPEFVGRFPI VSL+
Sbjct  367   RRQDSSIGFGAPVRANMRTGGVTSTAVTSSLLETAESSDLVSYGLIPEFVGRFPILVSLA  426

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK++F +N+VKLH T+NAL+ IA+KAI K+TGAR LRSI
Sbjct  427   ALTEDQLVQVLTEPKNALGKQYKKLFQMNDVKLHVTENALRSIARKAITKNTGARALRSI  486

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQG--NAGG  2039
             LE+IL ++M+E+PD R G+D +D V+VDE A+GS +    GA IL G  N GG
Sbjct  487   LENILMDSMYEIPDVRTGDDIIDAVVVDEVAIGS-EERSIGATILYGRENHGG  538


 Score =   160 bits (406),  Expect(3) = 7e-136, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+    PTPKEICK LD FV+GQ RAKKVLSVAVYNHYKRIY  S  + +  +S
Sbjct  142   GYWGGSNLGSSFPTPKEICKALDNFVIGQRRAKKVLSVAVYNHYKRIYLESVKKWSNTDS  201

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G   ++    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  202   GN--EKADTMDDDGVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  256



>ref|XP_006385093.1| hypothetical protein POPTR_0004s23830g [Populus trichocarpa]
 gb|ERP62890.1| hypothetical protein POPTR_0004s23830g [Populus trichocarpa]
Length=601

 Score =   202 bits (515),  Expect(3) = 1e-135, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQD+SIGFGAPVR NM   A+TNA+V SSLLESVES DL AYGLIPEFVGRFP+  SL 
Sbjct  402   RRQDASIGFGAPVRANMRAGAITNAMVTSSLLESVESGDLVAYGLIPEFVGRFPVLASLL  461

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQYK++F +NNV LHFT NAL++IAKKA+AK+TGARGLR+I
Sbjct  462   ALNEDQLVQVLMEPKNALGKQYKKIFNMNNVNLHFTGNALRLIAKKAMAKNTGARGLRAI  521

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERL  2051
             LE+ILTEAMFE P+ +  ++ +  VLVDEEAVG +DTPG GAKI+ G++    +L
Sbjct  522   LENILTEAMFETPENKSQSNCITAVLVDEEAVGLMDTPGRGAKIIHGDSALEHKL  576


 Score =   168 bits (425),  Expect(3) = 1e-135, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 98/119 (82%), Gaps = 9/119 (8%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKK-------AESLNIGRDVSG  1246
             GYVGEDVESIL+KLL+ A+F+VEAA+ GIVYIDEVDKIT K       A S +IGRDVSG
Sbjct  284   GYVGEDVESILYKLLVVAEFNVEAAQRGIVYIDEVDKITMKVYDFCVQAGSSSIGRDVSG  343

Query  1247  EGVQQGLLKMLEGTVVN--VPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             EGVQQ LLKMLEGTV+N  VPD    KH RGD+IQ+DTK+ILFICGGAF+ LEKTISER
Sbjct  344   EGVQQALLKMLEGTVINVPVPDKGPGKHPRGDTIQVDTKDILFICGGAFVNLEKTISER  402


 Score =   164 bits (416),  Expect(3) = 1e-135, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             ++LPTPKEICKGLDEFV+GQ++AKKVLSVAVYNHYKRIY AS  + +      +  E  N
Sbjct  170   RELPTPKEICKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASKQKKSHAPWSHSDGE--N  227

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQVML  1097
              E++F+ELDKSNVLLMGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQ  L
Sbjct  228   DENEFIELDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATTLTQASL  278


 Score =   144 bits (363),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +3

Query  210  FSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSN  389
            F++P  + L    T+ +   LGLGF RR   + ++D YD++KA+VNCPRC+  M VLFSN
Sbjct  24   FTSPPTKPLILSQTSTKT--LGLGFIRRLSDKTTAD-YDYIKADVNCPRCTSHMPVLFSN  80

Query  390  RPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
            RPLSIT  ETGIYQAVN CP C+TAFYFRP KLEPLQGNFIE+G+VKG
Sbjct  81   RPLSITGRETGIYQAVNFCPACKTAFYFRPFKLEPLQGNFIELGRVKG  128



>ref|XP_011044638.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Populus euphratica]
Length=572

 Score =   188 bits (477),  Expect(3) = 1e-135, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AAD++V AA+ GI+YIDE+DKITKK+ES+NI RDVSGEGVQQ L
Sbjct  258   GYVGEDVESILYKLLTAADYNVAAAQQGIIYIDEIDKITKKSESVNISRDVSGEGVQQAL  317

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  318   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  367


 Score =   186 bits (472),  Expect(3) = 1e-135, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+  V SSLLE+ ES+DL +YGLIPEFVGRFPI VSL+
Sbjct  367   RRQDSSIGFGAPVRANMRTGGVTSTAVTSSLLETAESSDLVSYGLIPEFVGRFPILVSLA  426

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQYK++F +N+VKLH T+NAL+ IA+KAI K+TGAR LRSI
Sbjct  427   ALTEDQLVQVLTEPKNALGKQYKKLFQMNDVKLHVTENALRSIARKAITKNTGARALRSI  486

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQG  2027
             LE+IL ++M+E+PD R G+D +D V+VDE A+GS +    GA IL G
Sbjct  487   LENILMDSMYEIPDVRTGDDIIDAVVVDEVAIGS-EERSIGATILYG  532


 Score =   161 bits (407),  Expect(3) = 1e-135, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+    PTPKEICK LD FV+GQ RAKKVLSVAVYNHYKRIY  S  + +  +S
Sbjct  142   GYWGGSNLGSSFPTPKEICKALDNFVIGQRRAKKVLSVAVYNHYKRIYLESVKKWSNTDS  201

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G   ++    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  202   GN--EKADTMDDDGVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  256



>ref|XP_010671440.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=580

 Score =   189 bits (480),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 139/176 (79%), Gaps = 1/176 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM     T+A +ASSLL++VES+DL AYGLIPEFVGRFP+ V+LS
Sbjct  379   RRHDSSIGFGAPVRANMRTGGATSAAIASSLLDNVESSDLIAYGLIPEFVGRFPVLVNLS  438

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFTD AL++IAKKAI K+TGARGLR+I
Sbjct  439   ALTENQLVEVLTEPKNALGKQYKKMFQMNGVKLHFTDEALRLIAKKAINKNTGARGLRAI  498

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLS  2054
             LE++L +AM+E+PD R G+  +D V+VDEEA+G L+  G G  IL G       LS
Sbjct  499   LENVLMDAMYEIPDTRTGDSIIDAVIVDEEAIG-LEGKGRGGNILYGKGSLDRYLS  553


 Score =   189 bits (479),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  +D++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  270   GYVGEDVESILYKLLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  329

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  330   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  379


 Score =   157 bits (396),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 95/117 (81%), Gaps = 4/117 (3%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G ++    PTPKEIC+GLD+FV+GQE+AKKVLSVAVYNHYKRIY  +  +    +S
Sbjct  156   GCWGGSSLGSSFPTPKEICRGLDKFVIGQEKAKKVLSVAVYNHYKRIYYETLQR----QS  211

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G++ + + +   + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  212   GESANGKLDPADEVVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  268



>ref|XP_004970835.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X2 [Setaria italica]
Length=618

 Score =   206 bits (525),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+RTNM  S  ++ ++ SSLLESVES DL  YGLIPEF GR PI VSL+
Sbjct  413   RRQDSSIGFGAPIRTNMRSSGASSPMITSSLLESVESGDLVRYGLIPEFTGRLPILVSLA  472

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKN+L +QY++MF LN V+LHFTD AL++IAKKAIAK+TGARGLR+I
Sbjct  473   ALNEDQLVQVLTEPKNSLSRQYRKMFNLNKVRLHFTDGALRLIAKKAIAKNTGARGLRAI  532

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LE+IL EAM+E+PD + GN+ VD V+VDEEA+GS D PGCGAKIL+G+
Sbjct  533   LETILLEAMYEIPDEKAGNERVDAVVVDEEAIGSADRPGCGAKILRGD  580


 Score =   173 bits (438),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL KLL+AA+++V+AA+ GIVYIDE+DKITKKAES N+ RDVSGEGVQQ 
Sbjct  303   AGYVGEDVESILQKLLVAAEYNVQAAQQGIVYIDEIDKITKKAESANVSRDVSGEGVQQA  362

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+LEGTVV++P+  +RK+SR +SIQIDT +ILFICGGAF+ LEKTISER
Sbjct  363   LLKILEGTVVSIPEKGSRKNSRSESIQIDTTDILFICGGAFVDLEKTISER  413


 Score =   155 bits (391),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G ++  +LPTP+E+C+ LDEFV+GQ +AKKVLSVAVYNHYKRIY+A+  + +   SG 
Sbjct  190   WGGASLGDELPTPREMCRRLDEFVIGQAKAKKVLSVAVYNHYKRIYNANVQKESVANSG-  248

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                +    + + VE+DKSNVLLMGPTGSGKTLLAKTLAR+VNVPFVIADAT+LTQ
Sbjct  249   -FPDAAQDDQNIVEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATSLTQ  302


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 51/103 (50%), Gaps = 15/103 (15%)
 Frame = +3

Query  288  RRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLS---------ITAGETGIYQAVN  440
            RRC   G S     ++A+ NCPRC   M+V FS + L          + A +   +    
Sbjct  21   RRCS--GGS----RIRADANCPRCDAHMSVQFSLQQLPAPPPAAAGVVDASQNHKHDGEG  74

Query  441  LCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTA  569
            +CP CR AF FR  +++PL+G F+EI    GG  E  + G  A
Sbjct  75   VCPACRAAFLFRAHRIDPLRGAFLEIPGAIGGEEEDADRGGFA  117



>ref|XP_010908125.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Elaeis guineensis]
Length=649

 Score =   187 bits (474),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  359   AGYVGEDVESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  418

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH R D IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  419   LLKMLEGTIVNVPEKGARKHPRNDHIQIDTKDILFICGGAFVDLEKTISER  469


 Score =   184 bits (466),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 149/206 (72%), Gaps = 28/206 (14%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    LTNAVVASSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  469   RRHDSSIGFGAPVRANMRTGWLTNAVVASSLLESVESSDLIAYGLIPEFIGRFPILVSLS  528

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQV                     KLH T+ AL+ IAKKA+ K+TGARGLR+I
Sbjct  529   ALNEDQLVQV---------------------KLHVTEAALREIAKKAMVKNTGARGLRAI  567

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LES LTEAM+E+PD + G + VD V+VDEEA+GSLD PGCGAKILQG+      LS    
Sbjct  568   LESTLTEAMYEIPDVKTGTERVDAVVVDEEAIGSLDRPGCGAKILQGDGALEHYLSQ---  624

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
               +KA+ N+  L+GD+ GD ++ASRA
Sbjct  625   --NKADANQ--LEGDLVGDRDLASRA  646


 Score =   163 bits (413),  Expect(3) = 2e-135, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 94/120 (78%), Gaps = 11/120 (9%)
 Frame = +3

Query  741   EWTG-LNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             EW G  N+ K LPTPKEICKGLD FV+GQ+RAKKVLSVAVYNHYKRIY AS       + 
Sbjct  246   EWCGGSNLGKDLPTPKEICKGLDTFVIGQQRAKKVLSVAVYNHYKRIYHASL------QK  299

Query  918   GKTVDEQGNFES---DFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             G   D  GN E+   D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  300   GSAADP-GNLEAKIDDHVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  358


 Score = 95.5 bits (236),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 68/107 (64%), Gaps = 15/107 (14%)
 Frame = +3

Query  255  IRVIGLG-----LGFQRRCKWEGSSDNYD-----HLKAEVNCPRCSKPMTVLFSNRPLSI  404
            I V+ +G     L  Q R KWEG     +      ++AE +CPRCSK M VLFS+RP   
Sbjct  45   IAVVAVGGRRRELHRQERHKWEGGGGPEEPPQTLRIRAEAHCPRCSKHMEVLFSHRPPPP  104

Query  405  -----TAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
                 T+   G +QAVN+CP+CRTAFYFRP +L PLQG+F+EIG+V+
Sbjct  105  PPAPATSDRGGGFQAVNICPNCRTAFYFRPHRLVPLQGSFVEIGRVR  151



>ref|XP_007039051.1| CLP protease regulatory subunit X isoform 1 [Theobroma cacao]
 gb|EOY23552.1| CLP protease regulatory subunit X isoform 1 [Theobroma cacao]
Length=594

 Score =   187 bits (476),  Expect(3) = 4e-135, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  280   GYVGEDVESILYKLLVVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  339

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RG++IQIDTK+ILFICGGAFI +EKTISER
Sbjct  340   LKMLEGTIVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDIEKTISER  389


 Score =   183 bits (465),  Expect(3) = 4e-135, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 156/204 (76%), Gaps = 3/204 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA VAS+L+ESVES+DL AYGLIPEFVGRFP+ VSL 
Sbjct  389   RRQDSSIGFGAPVRANMRAGGVTNAAVASTLMESVESSDLIAYGLIPEFVGRFPVLVSLL  448

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E QLVQVL +PKNAL KQYKRMF +N VKLH T+NALK+IA+KAI+K+TGARGLR+I
Sbjct  449   ALTEEQLVQVLTEPKNALGKQYKRMFQMNGVKLHITENALKLIARKAISKNTGARGLRAI  508

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PD R G+D +D V+VDEEAVGS +  G GAKIL G  G  +R  S   
Sbjct  509   LENILMDSMYEIPDVRTGDDVIDAVVVDEEAVGS-EGRGTGAKILYGK-GALDRYLSQQK  566

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D  E   E   G+ + + E+ S
Sbjct  567   SKD-LETTAEGSDGEPEVETELPS  589


 Score =   162 bits (410),  Expect(3) = 4e-135, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+    PTPK+ICKGLD+FV+GQERAKKVLSVAVYNHY RIY  S  +   G+S
Sbjct  164   GCWGGSNLGHNFPTPKDICKGLDKFVIGQERAKKVLSVAVYNHYMRIYHESLQKRPAGDS  223

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                + +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  224   VSNIADV--LDDDIVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  278



>ref|XP_004970834.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X1 [Setaria italica]
Length=640

 Score =   206 bits (524),  Expect(3) = 4e-135, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+RTNM  S  ++ ++ SSLLESVES DL  YGLIPEF GR PI VSL+
Sbjct  413   RRQDSSIGFGAPIRTNMRSSGASSPMITSSLLESVESGDLVRYGLIPEFTGRLPILVSLA  472

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKN+L +QY++MF LN V+LHFTD AL++IAKKAIAK+TGARGLR+I
Sbjct  473   ALNEDQLVQVLTEPKNSLSRQYRKMFNLNKVRLHFTDGALRLIAKKAIAKNTGARGLRAI  532

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LE+IL EAM+E+PD + GN+ VD V+VDEEA+GS D PGCGAKIL+G+
Sbjct  533   LETILLEAMYEIPDEKAGNERVDAVVVDEEAIGSADRPGCGAKILRGD  580


 Score =   173 bits (438),  Expect(3) = 4e-135, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL KLL+AA+++V+AA+ GIVYIDE+DKITKKAES N+ RDVSGEGVQQ 
Sbjct  303   AGYVGEDVESILQKLLVAAEYNVQAAQQGIVYIDEIDKITKKAESANVSRDVSGEGVQQA  362

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+LEGTVV++P+  +RK+SR +SIQIDT +ILFICGGAF+ LEKTISER
Sbjct  363   LLKILEGTVVSIPEKGSRKNSRSESIQIDTTDILFICGGAFVDLEKTISER  413


 Score =   154 bits (390),  Expect(3) = 4e-135, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G ++  +LPTP+E+C+ LDEFV+GQ +AKKVLSVAVYNHYKRIY+A+  + +   SG 
Sbjct  190   WGGASLGDELPTPREMCRRLDEFVIGQAKAKKVLSVAVYNHYKRIYNANVQKESVANSG-  248

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                +    + + VE+DKSNVLLMGPTGSGKTLLAKTLAR+VNVPFVIADAT+LTQ
Sbjct  249   -FPDAAQDDQNIVEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATSLTQ  302


 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 51/103 (50%), Gaps = 15/103 (15%)
 Frame = +3

Query  288  RRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLS---------ITAGETGIYQAVN  440
            RRC   G S     ++A+ NCPRC   M+V FS + L          + A +   +    
Sbjct  21   RRCS--GGS----RIRADANCPRCDAHMSVQFSLQQLPAPPPAAAGVVDASQNHKHDGEG  74

Query  441  LCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTA  569
            +CP CR AF FR  +++PL+G F+EI    GG  E  + G  A
Sbjct  75   VCPACRAAFLFRAHRIDPLRGAFLEIPGAIGGEEEDADRGGFA  117



>ref|XP_009421145.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Musa acuminata subsp. malaccensis]
Length=665

 Score =   192 bits (488),  Expect(3) = 7e-135, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  ADF+V+AA+ GIVYIDEVDKITKK+ESLNI RDVSGEGVQQ 
Sbjct  351   AGYVGEDVESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKSESLNISRDVSGEGVQQA  410

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+N ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  411   LLKMLEGTIVNVPENGARKHPRGDNIQIDTKDILFICGGAFVNLEKTISER  461


 Score =   189 bits (479),  Expect(3) = 7e-135, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGA VR NM  S LT+ V +S L       DL AYGL+PEFVGRFP+ VSLS
Sbjct  461   RRQDSSIGFGASVRANMRTSWLTDVVTSSLLESVESG-DLIAYGLVPEFVGRFPVLVSLS  519

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVLM+PKNAL +QYK++F++NN  LHFTD +L +IAKK++AK+TGARGLR+I
Sbjct  520   ALSENQLVQVLMEPKNALGRQYKKLFSMNN--LHFTDASLCLIAKKSMAKNTGARGLRAI  577

Query  1887  LESILTEAMFEVPDARPGNDG--VDMVLVDEEAVGSLDTPGCGAKILQGNAGGSER  2048
             LE++L +AM+E+PD +  ++   +D V+VDE+AVGS+D PG GAKIL+G+ G  ER
Sbjct  578   LETVLLDAMYEIPDVKTKDEDEPIDAVVVDEDAVGSVDRPGSGAKILRGD-GALER  632


 Score =   152 bits (383),  Expect(3) = 7e-135, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 91/114 (80%), Gaps = 9/114 (8%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ K +PTPKEI +GLD++V+GQE AKKVLSVAVYNHYKRIY AS  + AG      VD 
Sbjct  243   NLGKDMPTPKEIYEGLDKYVIGQEHAKKVLSVAVYNHYKRIYHASLQKSAG------VDS  296

Query  936   QGNFES---DFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             + + E    D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPF+IADATTLTQ
Sbjct  297   ENHAEGDDDDNVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFIIADATTLTQ  350


 Score =   101 bits (251),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 76/131 (58%), Gaps = 13/131 (10%)
 Frame = +3

Query  273  GLGFQRRCKWEGSSDNYDH---LKAEVNCPRCSKPMTVLFSNR-PLSITAGETGIY----  428
            GL    R KW+G   +  H   ++AE +CPRCSK M VLF NR   ++T   +G Y    
Sbjct  53   GLLRHDRHKWDGGGADEFHTRRIRAEAHCPRCSKHMRVLFPNRFSPTVTGDGSGDYGAER  112

Query  429  QAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENG-KAAGKI  605
             AVNLCP C+TA+ F P +L PLQG F+EIG+V+G   E+          ENG +A  + 
Sbjct  113  HAVNLCPRCKTAYSFSPHELVPLQGTFVEIGRVRGPNPEKYR----CESEENGIRAKNRF  168

Query  606  WEKLRTYSGNN  638
            W+ LR++ G +
Sbjct  169  WKALRSFYGGD  179



>ref|XP_003619595.1| ATP-dependent Clp protease ATP-binding subunit clpX [Medicago 
truncatula]
Length=672

 Score =   193 bits (490),  Expect(3) = 5e-134, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 159/216 (74%), Gaps = 15/216 (7%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR N+    + ++ VASSLLESVES+DL AYGLIPEF+GRFPI VSLS
Sbjct  459   RRQDSSIGFGAPVRANIRSGRIIDSAVASSLLESVESSDLIAYGLIPEFIGRFPILVSLS  518

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNV----------KLHFTDNalkmiakkaiak  1856
             AL E QL+QVL +PK+AL KQYK++  +N V          KLHFTD AL+MIAKKA+AK
Sbjct  519   ALTEEQLMQVLTEPKHALGKQYKKLVGMNEVSIYVCVFVRVKLHFTDKALRMIAKKAMAK  578

Query  1857  STGARGLRSILESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAG  2036
             +TGARGLR+++E+ILT+AM+E+PD + G+D +D V+VDEE+VGSL  PGCG KIL+G+  
Sbjct  579   NTGARGLRALIENILTDAMYEIPDIKTGSDRIDAVVVDEESVGSLTAPGCGGKILRGDGA  638

Query  2037  GSERLSSAMTSTDKAEKNEEALKGDMDGDCEVASRA  2144
               + L+    S D   ++E       D D + +SRA
Sbjct  639   LEQYLAKIKDSEDVVAESEL-----QDRDSDTSSRA  669


 Score =   174 bits (440),  Expect(3) = 5e-134, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AAD++V AA+ GI+YIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  349   AGYVGEDVESILYKLLAAADYNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQA  408

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARK+ RGD+IQIDTKNILFICGGAFI LEKTISER
Sbjct  409   LLKMLEGTIVNVPEKGARKNPRGDNIQIDTKNILFICGGAFIDLEKTISER  459


 Score =   163 bits (412),  Expect(3) = 5e-134, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 96/117 (82%), Gaps = 7/117 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LP+PKEICKGLD+FV+GQ RAKKVLSVAVYNHYKRIY A+  + +G +SG 
Sbjct  237   WGGSNLGKDLPSPKEICKGLDKFVIGQGRAKKVLSVAVYNHYKRIYHATLPKGSGADSGI  296

Query  924   T--VDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  +D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  297   SGILDDDEN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  348


 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 79/157 (50%), Gaps = 44/157 (28%)
 Frame = +3

Query  288  RRCKW-EGSSDN-----YDHLKAEVNCPRCSKPMTVLFSNRPL-------------SITA  410
            R+ KW  G SD         ++AE NCPRCSK M + FSNR +             ++ +
Sbjct  11   RKDKWGRGGSDGDMQNPTRKIRAEANCPRCSKDMNLFFSNRHMQSNGGDSGGGNGENLGS  70

Query  411  GETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQV----------------KGGVG  542
               G YQAVNLCP+C+TA++FRP    PLQG F+EIG+V                K G+G
Sbjct  71   NGDGGYQAVNLCPNCKTAYHFRPYNTSPLQGTFVEIGRVSNNNGGSSKTQLSRRFKNGIG  130

Query  543  ERENNGNTA-AGSE----NGKAAG----KIWEKLRTY  626
            +  N+  +   GSE    NG A+      +WE LR Y
Sbjct  131  KDSNSIKSGHHGSEDLGLNGSASNWLEVSMWETLRNY  167



>ref|XP_010234150.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Brachypodium distachyon]
Length=546

 Score =   193 bits (491),  Expect(3) = 7e-134, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF APVR+NM   ++ NA + S+LLE+VES DL AYGLIPEFVGRFP+ VSLS
Sbjct  343   RRHDSSIGFQAPVRSNMRTGSVINAEITSTLLETVESGDLIAYGLIPEFVGRFPVLVSLS  402

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLV+VL KPKNAL +QY ++F +N+VKLHFT+ AL++I+K+AI+K+TGARGLRSI
Sbjct  403   SLSEDQLVEVLTKPKNALGRQYTKLFEMNDVKLHFTEKALRLISKRAISKNTGARGLRSI  462

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQG  2027
             LES+LTEAM+E+P+ R G D +D V+VDEE++GS +  G GAKIL G
Sbjct  463   LESVLTEAMYEIPEIRTGKDKIDAVVVDEESIGSSNQHGFGAKILSG  509


 Score =   174 bits (440),  Expect(3) = 7e-134, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AADFD+ AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQQ L
Sbjct  234   GYVGEDVESILYKLLAAADFDIAAAQQGIVYIDEVDKITKKAESMNLSRDVSGEGVQQAL  293

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVV+VP+  AR+H RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  294   LKMLEGTVVSVPEKGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISER  343


 Score =   162 bits (409),  Expect(3) = 7e-134, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ ++ PTPKEIC+GLD+FV+GQERAKKVLSVAVYNHYKRI   S +  + G+S +
Sbjct  120   WGGSNLGRQFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRISCESFSSRSAGDSSE  179

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +  +    ++D VEL+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  180   S--DTCTSDTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  232



>ref|XP_001774045.1| predicted protein [Physcomitrella patens]
 gb|EDQ61097.1| predicted protein [Physcomitrella patens]
Length=392

 Score =   187 bits (474),  Expect(3) = 2e-133, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+QDSSIGFG+PVR +M  + LT++ + SSLLE VES+DL +YGLIPEF+GRFP+ VSLS
Sbjct  213   RKQDSSIGFGSPVRASMRGNKLTDSAITSSLLEMVESSDLISYGLIPEFIGRFPVLVSLS  272

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +P+NAL KQYK+MF++NNVKLH+TD AL+ IA+KAI K+TGARGLRSI
Sbjct  273   ALNEDQLVQVLTEPRNALGKQYKKMFSMNNVKLHYTDGALRRIAQKAIVKNTGARGLRSI  332

Query  1887  LESILTEAMFEVPDARPGND-GVDMVLVDEEAVGSLDTPGCGAKILQG  2027
             +E++LTEAM++VPD     D  VD V++DEEAVG+ D  G  AKIL+G
Sbjct  333   METLLTEAMYQVPDTILNRDEHVDAVVLDEEAVGAPDGNGERAKILRG  380


 Score =   182 bits (463),  Expect(3) = 2e-133, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLM ++F+V AA+ GIVYIDEVDKITKKAES++I RDVSGEGVQQ L
Sbjct  104   GYVGEDVESILYKLLMVSEFNVPAAQQGIVYIDEVDKITKKAESVSISRDVSGEGVQQAL  163

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD IQIDTK+ILFICGGAFI L KT++ER
Sbjct  164   LKMLEGTIVNVPEKGARKHPRGDHIQIDTKDILFICGGAFIELAKTVAER  213


 Score =   158 bits (400),  Expect(3) = 2e-133, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 89/115 (77%), Gaps = 13/115 (11%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G  + K LPTP+EIC+ LD+FVVGQERAKK+LSVAVYNHYKRIY  S           
Sbjct  1     WGGSFLGKDLPTPREICQALDKFVVGQERAKKILSVAVYNHYKRIYHESV----------  50

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                ++G+ E D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPF+IADATTLTQ
Sbjct  51    ---QKGSEEDDVVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFIIADATTLTQ  102



>ref|XP_004502651.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
isoform X1 [Cicer arietinum]
Length=576

 Score =   194 bits (494),  Expect(3) = 6e-133, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL AAD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  261   TQAGYVGEDVESILYKLLSAADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQ  320

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGTVVNVP+  ARKH RGD+IQIDTKNILFICGGAFI LEKTISER
Sbjct  321   QALLKMLEGTVVNVPEKGARKHPRGDNIQIDTKNILFICGGAFIDLEKTISER  373


 Score =   176 bits (446),  Expect(3) = 6e-133, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 152/206 (74%), Gaps = 9/206 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR  M    +T+  +ASSLL +VES+DL AYGLIPEFVGRFPI VSLS
Sbjct  373   RRQDSSIGFGAPVRAKMKAGGVTDGAIASSLLGTVESSDLIAYGLIPEFVGRFPILVSLS  432

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QV  +PKNAL KQY++MF +N VKLH+T++AL+ IA+KAI+K+TGARGLR+I
Sbjct  433   ALTENQLIQVFTEPKNALGKQYRKMFQMNGVKLHYTESALRSIARKAISKNTGARGLRAI  492

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGC--GAKILQGNAGGSERLSSA  2060
             LES+L ++MFE+PD R G+D +D V+VDE++VG     GC  GAKIL G       L   
Sbjct  493   LESVLVDSMFEIPDIRTGDDVIDAVVVDEDSVGG---EGCVKGAKILHGRGA----LDRY  545

Query  2061  MTSTDKAEKNEEALKGDMDGDCEVAS  2138
             ++   K  ++ E   GD + + E+ S
Sbjct  546   LSEEKKDSESMEVSGGDQEAETELPS  571


 Score =   155 bits (393),  Expect(3) = 6e-133, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+    PTPKEICKGLD++V+GQERAKKVLSVAVYNHYKRI+  SS +      
Sbjct  145   GCWGGSNLGGSFPTPKEICKGLDKYVIGQERAKKVLSVAVYNHYKRIFHESSPKSMWPAG  204

Query  918   GKTVDEQGNFESDF-VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               + D + +   D  VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  205   DSSNDGKADDVDDDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  262



>gb|EYU19646.1| hypothetical protein MIMGU_mgv1a003999mg [Erythranthe guttata]
Length=550

 Score =   184 bits (466),  Expect(3) = 1e-132, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLLM AD++V AA+ GI+YIDEVDKI KKAES+NI RDVSGEGVQQ 
Sbjct  235   AGYVGEDVESILYKLLMVADYNVAAAQQGIIYIDEVDKIIKKAESVNISRDVSGEGVQQA  294

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILF+CGGAF  LEKTISER
Sbjct  295   LLKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFLCGGAFNDLEKTISER  345


 Score =   183 bits (465),  Expect(3) = 1e-132, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 154/202 (76%), Gaps = 2/202 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    LT+A V SSLLE+VES+DL AYGLIPEFVGRFP+ V+L 
Sbjct  345   RRHDSSIGFGAPVRANMRNGGLTSAAVTSSLLETVESSDLIAYGLIPEFVGRFPVLVNLL  404

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLVQVL +PKNAL KQY++MF +N VKLHFT+++L++IA+K + K+TGARGLRS+
Sbjct  405   ALTENQLVQVLTEPKNALGKQYRKMFQMNGVKLHFTEDSLRLIAQKTLTKNTGARGLRSM  464

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++L +AM+E+PD R G+D +D V+VD E+VGS D  GCGAKIL G  G  +R  S   
Sbjct  465   LENLLMDAMYEIPDVREGDDVIDAVVVDTESVGS-DGRGCGAKILYGK-GALDRYFSQHE  522

Query  2067  STDKAEKNEEALKGDMDGDCEV  2132
               D  +  E + +G+ + + E+
Sbjct  523   FKDSKKTAEGSCEGEAEVEHEL  544


 Score =   158 bits (400),  Expect(3) = 1e-132, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 92/115 (80%), Gaps = 3/115 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEIC+GLD+FV+GQERAKKVLSVAVYNHYKRI+  S  + AG  S  
Sbjct  123   WGGSNLGMDFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIHSDSLQRTAG--SSD  180

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 +G  + D VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  181   NDKAEGKDDED-VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  234



>ref|XP_010442897.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=562

 Score =   194 bits (492),  Expect(3) = 1e-132, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 153/204 (75%), Gaps = 0/204 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  354   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  413

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL++VL +PKNAL KQYK+M+ +N+VKLHFT++AL++IA+KAI K+TGARGLR++
Sbjct  414   ALTENQLMEVLTEPKNALGKQYKKMYQMNSVKLHFTESALRLIARKAITKNTGARGLRAL  473

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G+D ++ V+VDEEAV      G GAKIL+G       LS   +
Sbjct  474   LESILMDSMYEIPDESTGSDMIEAVVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETYS  533

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
                  +  +E   G+ + + E+ S
Sbjct  534   KDSSPQTTKEGSDGENEVEAEIPS  557


 Score =   168 bits (426),  Expect(3) = 1e-132, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 95/116 (82%), Gaps = 2/116 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+  + PTPKEICKGL++FV+GQERAKKVL+VAVYNHYKRIY  S+ + + GE+  
Sbjct  148   WGGSNLGSEFPTPKEICKGLNKFVIGQERAKKVLAVAVYNHYKRIYHESAQKRSTGETES  207

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQV  1091
             T  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQV
Sbjct  208   TAAKPA--DDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQV  261


 Score =   163 bits (412),  Expect(3) = 1e-132, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +2

Query  1127  LLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLLKMLEGTVVNVPD  1306
             L   AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ LLKMLEGT+VNVP+
Sbjct  258   LTQVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  317

Query  1307  NRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
               ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  318   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  354



>ref|XP_010445732.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=564

 Score =   193 bits (491),  Expect(3) = 2e-132, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 152/202 (75%), Gaps = 3/202 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM    +TNA VAS+L+E+VES+DL AYGLIPEFVGRFP+ VSLS
Sbjct  355   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  414

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL++VL +PKNAL KQYK+M+ +N+VKLHFT++AL++IA+KAI K+TGARGLR++
Sbjct  415   ALTENQLMEVLTEPKNALGKQYKKMYQMNSVKLHFTESALRLIARKAITKNTGARGLRAL  474

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESIL ++M+E+PD   G+D ++ V+VDEEAV      G GAKIL+G       LS    
Sbjct  475   LESILMDSMYEIPDESTGSDMIEAVVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETTN  534

Query  2067  STDKAEKNEEALKGDMDGDCEV  2132
             S D +    +  K   DG+ EV
Sbjct  535   SKDSS---PQTTKVGSDGENEV  553


 Score =   168 bits (426),  Expect(3) = 2e-132, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 95/116 (82%), Gaps = 2/116 (2%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+  + PTPKEICKGL++FV+GQERAKKVL+VAVYNHYKRIY  S+ + + GE+  
Sbjct  149   WGGSNLGSEFPTPKEICKGLNKFVIGQERAKKVLAVAVYNHYKRIYHESAQKRSTGETES  208

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQV  1091
             T  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQV
Sbjct  209   TAAKPA--DDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQV  262


 Score =   163 bits (412),  Expect(3) = 2e-132, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +2

Query  1127  LLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLLKMLEGTVVNVPD  1306
             L   AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ LLKMLEGT+VNVP+
Sbjct  259   LTQVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  318

Query  1307  NRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
               ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  319   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  355



>ref|XP_002864018.1| hypothetical protein ARALYDRAFT_495043 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40277.1| hypothetical protein ARALYDRAFT_495043 [Arabidopsis lyrata subsp. 
lyrata]
Length=605

 Score =   206 bits (523),  Expect(3) = 5e-132, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNMS S  ++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  410   RQHDASIGFGASVRTNMSTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  469

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  470   ALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  529

Query  1887  LESILTEAMFEVPDA-RPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAM  2063
             LESILTEAMFEVPD+   G+  +  VLVDEEAVGS+ TPGCGAKIL+G+      L   +
Sbjct  530   LESILTEAMFEVPDSVTEGSQSIKAVLVDEEAVGSVGTPGCGAKILKGD----NVLQQFV  585

Query  2064  TSTDKAEKNEE  2096
               T+  EK +E
Sbjct  586   EETESKEKRKE  596


 Score =   160 bits (405),  Expect(3) = 5e-132, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK+T K+ S N GRDVSGEGVQQ L
Sbjct  301   GYVGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSL  360

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV +P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  361   LKLLEGTVVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  410


 Score =   157 bits (397),  Expect(3) = 5e-132, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = +3

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQG  941
             V KLPTPKEIC+GLDEFV+GQE+AKKVLSVAVYNHYKRIY AS  +     S     E  
Sbjct  193   VIKLPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKKGFVSRSDNLDMEDE  252

Query  942   NFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             N   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  253   NI--DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  299


 Score =   130 bits (327),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 8/91 (9%)
 Frame = +3

Query  282  FQRRCKWEGSS-------DNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVN  440
            F RR  W+  S       D+YDH++++VNCPRCS  M V+FSNRPLS+TA E GIYQAVN
Sbjct  54   FSRRI-WDSCSGGGGRGGDDYDHIRSDVNCPRCSAQMHVIFSNRPLSLTAREPGIYQAVN  112

Query  441  LCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
             C  C+TAFYFRP KL PLQG+FIE+G+VKG
Sbjct  113  FCSQCKTAFYFRPFKLSPLQGSFIELGKVKG  143



>ref|XP_008460586.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Cucumis melo]
Length=617

 Score =   196 bits (497),  Expect(3) = 5e-132, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 140/165 (85%), Gaps = 4/165 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ DSSIGFGAPVR +M  + LT  +V SS+LE+VES+DL  YGLIPEFVGR PI VSLS
Sbjct  415   RQHDSSIGFGAPVRASMRTARLTEDLVTSSMLENVESSDLVTYGLIPEFVGRCPILVSLS  474

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             ALDE+QLVQVL KPKNAL KQYK+MF +N+V+LHFT+NAL+MIA+KA+ K+TGARGLRSI
Sbjct  475   ALDEDQLVQVLTKPKNALGKQYKKMFRMNDVELHFTENALRMIARKAMKKNTGARGLRSI  534

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKIL  2021
             LE+ILTEAMFEVP++    + +  VLVD E+VGS+D PGCGAKIL
Sbjct  535   LENILTEAMFEVPES----NSIKAVLVDGESVGSVDAPGCGAKIL  575


 Score =   187 bits (474),  Expect(3) = 5e-132, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ A+F+VEAA+ GIVYIDEVDKITKK+ES+N GRDVSGEGVQQ L
Sbjct  306   GYVGEDVESILYKLLLDAEFNVEAAQRGIVYIDEVDKITKKSESINSGRDVSGEGVQQAL  365

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVV+VPD  AR+H RGD+IQ+DTKNILFICGGAF+GLEK IS+R
Sbjct  366   LKMLEGTVVDVPDTGARRHPRGDTIQMDTKNILFICGGAFVGLEKCISDR  415


 Score =   140 bits (353),  Expect(3) = 5e-132, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             +L TPKEI   LD+FVVGQE+AKKVLSVAVYNHYKRIY +S  + +G   G    E  N 
Sbjct  200   QLLTPKEISLALDKFVVGQEKAKKVLSVAVYNHYKRIYHSSLQKTSG--QGSLGTELEND  257

Query  948   ESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +++ VEL+KSN+LLMGPTGSGKTLLAKTLAR+VNVPF IADAT LTQ
Sbjct  258   DNETVELEKSNLLLMGPTGSGKTLLAKTLARVVNVPFTIADATALTQ  304


 Score =   142 bits (359),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 5/106 (5%)
 Frame = +3

Query  219  PSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPL  398
            PS+ H  P      V  L L  Q+R  W+G+SD YD+++A+VNCPRCSK M V+FSNRPL
Sbjct  38   PSKPHAAPRSA---VFTLWLS-QKRHSWKGASD-YDYIRADVNCPRCSKQMPVIFSNRPL  92

Query  399  SITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGG  536
            SIT  ETG+YQA+NLCP+C+TAFYFRP KL PL G FIEIG+VKG 
Sbjct  93   SITGRETGVYQALNLCPNCKTAFYFRPLKLVPLHGTFIEIGRVKGA  138



>ref|XP_001773526.1| predicted protein [Physcomitrella patens]
 gb|EDQ61726.1| predicted protein [Physcomitrella patens]
Length=433

 Score =   191 bits (485),  Expect(3) = 6e-132, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLLMAA+F+V AA+ GIVYIDEVDKITKKAE++NI RDVSGEGVQQ 
Sbjct  143   AGYVGEDVESILYKLLMAAEFNVPAAQQGIVYIDEVDKITKKAENMNISRDVSGEGVQQA  202

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVVNVP+  ARKH RGD IQ+DTK+ILFICGGAFI LEKTI+ER
Sbjct  203   LLKMLEGTVVNVPEKGARKHPRGDHIQVDTKDILFICGGAFIELEKTIAER  253


 Score =   190 bits (482),  Expect(3) = 6e-132, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +3

Query  1518  FCPRRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFV  1697
                RRQDSSIGFGAPVR NM ++ L NA V SSLLE VES+DL +YGLIPEF+GRFP+ V
Sbjct  250   IAERRQDSSIGFGAPVRANMRVNKLVNAAVTSSLLELVESSDLISYGLIPEFIGRFPVLV  309

Query  1698  SLSALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGL  1877
             SL+AL+E+QLVQVL +P+NAL KQYK+MFA+NNVKLH+T+ AL+ IA+KA+ K+TGARGL
Sbjct  310   SLAALNEDQLVQVLTEPRNALGKQYKKMFAMNNVKLHYTEGALRRIAQKAMIKNTGARGL  369

Query  1878  RSILESILTEAMFEVPDARPGND-GVDMVLVDEEAVGSLDTPGCGAKILQG  2027
             RSI+E++LT++M++VPD+    D  +D V++DE+AVG  D  G GAKIL+G
Sbjct  370   RSIMEALLTDSMYQVPDSVSETDEKIDAVVLDEDAVGPPDGVGSGAKILRG  420


 Score =   141 bits (356),  Expect(3) = 6e-132, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 92/129 (71%), Gaps = 14/129 (11%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKK------------VLSVAVYNHYKRIYDA  887
             W G  + K+LPTP+EI + LD+FVVGQE+AKK            +LSVAVYNHYKRI+  
Sbjct  14    WGGAALGKELPTPREISQALDKFVVGQEKAKKAFSLFPSFNSLAILSVAVYNHYKRIHYE  73

Query  888   S--STQMAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFV  1061
             S   + +   + G    +  + E+D VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFV
Sbjct  74    SLLKSNIRLTDEGAGHSDMEDEENDGVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFV  133

Query  1062  IADATTLTQ  1088
             IADATTLTQ
Sbjct  134   IADATTLTQ  142



>ref|XP_002318424.2| hypothetical protein POPTR_0012s02260g [Populus trichocarpa]
 gb|EEE96644.2| hypothetical protein POPTR_0012s02260g [Populus trichocarpa]
Length=597

 Score =   190 bits (483),  Expect(3) = 9e-132, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 150/204 (74%), Gaps = 7/204 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+A + SSLLE+ ES+DL +YGLIPEFVGRFPI VSLS
Sbjct  392   RRQDSSIGFGAPVRANMRTGGVTSAAMTSSLLETAESSDLVSYGLIPEFVGRFPILVSLS  451

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQY+++F +N VKLH T++AL+ IA KAI K+TGAR LRSI
Sbjct  452   ALTEDQLVQVLTEPKNALGKQYRKLFQMNGVKLHVTEHALRSIAIKAITKNTGARALRSI  511

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PD + G D +D V+VDEEA+G     G GAKIL G       LS    
Sbjct  512   LENILMDSMYEIPDVKRGADIIDAVVVDEEAIGP-KQRGAGAKILYGRGALDHYLSK---  567

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
               +K + +E  ++G  DG+ EV S
Sbjct  568   --NKLKSSEATVEGS-DGEPEVES  588


 Score =   188 bits (478),  Expect(3) = 9e-132, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVES+L+KLL AAD++V AA+ GI+YIDEVDKITKKAES+NI RDVSGEGVQQ LL
Sbjct  284   YVGEDVESMLYKLLTAADYNVAAAQQGIIYIDEVDKITKKAESVNISRDVSGEGVQQALL  343

Query  1271  KMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             KMLEGTVVNVPD  ARKH RGD+IQI+TK+ILFICGGAFI LEKTISER
Sbjct  344   KMLEGTVVNVPDKEARKHPRGDNIQINTKDILFICGGAFIDLEKTISER  392


 Score =   144 bits (362),  Expect(3) = 9e-132, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 91/143 (64%), Gaps = 32/143 (22%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMA----  905
             G W G  +    PTPK+ICK LD+FV+GQ+RAKKVLSVAVYNHYKRI+  S  + +    
Sbjct  145   GSWGGSKLGSSFPTPKDICKALDKFVIGQQRAKKVLSVAVYNHYKRIHLESVKKWSVLFL  204

Query  906   ----------------------GGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTL  1019
                                     E  +T+DE+       VEL+KSN+LLMGPTGSGKTL
Sbjct  205   SMALVNPFFPFPVTVMVCLYFPCNEKAETMDEEE------VELEKSNILLMGPTGSGKTL  258

Query  1020  LAKTLARLVNVPFVIADATTLTQ  1088
             LAKTLAR VNVPFVIADATTLTQ
Sbjct  259   LAKTLARFVNVPFVIADATTLTQ  281



>ref|XP_004142810.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Cucumis sativus]
Length=619

 Score =   193 bits (490),  Expect(3) = 1e-131, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ DSSIGFGAPVR +M    LT  +V SS+LE+VES DL  YGLIPEFVGR PI VSLS
Sbjct  415   RQHDSSIGFGAPVRASMRTGKLTEDLVTSSMLENVESGDLITYGLIPEFVGRCPILVSLS  474

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             ALDE+QLVQVL KPKNAL KQYK+M  +N+V+LHFT+NAL+MIA+KA+ K+TGARGLRSI
Sbjct  475   ALDEDQLVQVLTKPKNALGKQYKKMLRMNDVELHFTENALRMIARKAMKKNTGARGLRSI  534

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKIL  2021
             LE+ILTEAMFEVP++    + +  VLVDEEAVGS+D  GCGAKIL
Sbjct  535   LENILTEAMFEVPES----NSIKAVLVDEEAVGSVDASGCGAKIL  575


 Score =   189 bits (480),  Expect(3) = 1e-131, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ A+F+VEAA+ GIVYIDEVDKITKK+ESLN GRDVSGEGVQQ L
Sbjct  306   GYVGEDVESILYKLLLDAEFNVEAAQRGIVYIDEVDKITKKSESLNSGRDVSGEGVQQAL  365

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVV+VPD  ARKH RGD+IQ+DTKNILFICGGAF+GLEK IS+R
Sbjct  366   LKMLEGTVVDVPDTGARKHPRGDTIQMDTKNILFICGGAFVGLEKCISDR  415


 Score =   139 bits (351),  Expect(3) = 1e-131, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             +L TPKEI   LD+FVVGQE+AKKVLSVAVYNHYKRIY +S  + +G   G    E  N 
Sbjct  200   QLLTPKEISLALDKFVVGQEKAKKVLSVAVYNHYKRIYHSSLQKTSG--QGPLGIELEND  257

Query  948   ESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +++ VEL+KSN+LLMGPTGSGKTLLAKTLAR+VNVPF IADAT LTQ
Sbjct  258   DNETVELEKSNLLLMGPTGSGKTLLAKTLARVVNVPFTIADATALTQ  304


 Score =   143 bits (360),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 80/107 (75%), Gaps = 7/107 (7%)
 Frame = +3

Query  219  PSRQHLPPPPTTIRVIGLGLGF-QRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRP  395
            PS+ H  P     R     L F Q+R  W+G+SD YD+++A+VNCPRCSK M V+FSNRP
Sbjct  38   PSKPHAAP-----RSAVFTLWFSQKRHSWKGASD-YDYIRADVNCPRCSKQMPVIFSNRP  91

Query  396  LSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGG  536
            LSIT  ETG+YQA+NLCP+C+TAFYFRP KL PL G FIEIG+VKG 
Sbjct  92   LSITGRETGVYQALNLCPNCKTAFYFRPLKLVPLHGTFIEIGRVKGA  138



>ref|XP_006412459.1| hypothetical protein EUTSA_v10024710mg [Eutrema salsugineum]
 gb|ESQ53912.1| hypothetical protein EUTSA_v10024710mg [Eutrema salsugineum]
Length=604

 Score =   207 bits (526),  Expect(3) = 2e-131, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 155/191 (81%), Gaps = 5/191 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNMS S  ++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  409   RQHDASIGFGASVRTNMSTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  468

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  469   ALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  528

Query  1887  LESILTEAMFEVPDA-RPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAM  2063
             LESILTEAMFEVPD+   G+ G+  VLVDEE+VGS+ TPGCGAKIL+G+    + +   +
Sbjct  529   LESILTEAMFEVPDSITEGSQGIKAVLVDEESVGSVGTPGCGAKILKGD----DVMQPFL  584

Query  2064  TSTDKAEKNEE  2096
               T+  EK +E
Sbjct  585   EETESQEKRKE  595


 Score =   159 bits (402),  Expect(3) = 2e-131, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQG  941
             VKKLPTPKEIC+GLDEFV+GQE+AKKVL+VAVYNHYKRIY AS  + +   S     E  
Sbjct  190   VKKLPTPKEICQGLDEFVIGQEKAKKVLAVAVYNHYKRIYHASRKKGSASASDNLDMEDD  249

Query  942   NFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  250   SI--DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFTIADATSLTQ  296


 Score =   155 bits (391),  Expect(3) = 2e-131, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK++ K+ S N GRDVSGEGVQQ L
Sbjct  298   GYVGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMSMKSHSSNGGRDVSGEGVQQSL  357

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  358   LKLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  409


 Score =   134 bits (336),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +3

Query  282  FQRRCKWEGSS-DNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCR  458
            F RR  W+ S  D+YDH++ +VNCPRCS  M V+FSNRPLS+TA E GIYQAVN C  C+
Sbjct  57   FSRRI-WDSSGGDDYDHIRTDVNCPRCSSQMLVVFSNRPLSLTAREPGIYQAVNFCSQCK  115

Query  459  TAFYFRPSKLEPLQGNFIEIGQVKGGVGER  548
            TAFYFRP KL PLQG+FIE+G+VK G GER
Sbjct  116  TAFYFRPFKLSPLQGSFIELGKVK-GTGER  144



>dbj|BAA98151.1| CLP protease regulatory subunit CLPX-like [Arabidopsis thaliana]
Length=608

 Score =   202 bits (514),  Expect(3) = 3e-131, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNMS S L++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  413   RQHDASIGFGASVRTNMSTSGLSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  472

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +NNV+L FT+ A ++IA+KA++K+TGARGLRSI
Sbjct  473   ALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLQFTEGATRLIARKAMSKNTGARGLRSI  532

Query  1887  LESILTEAMFEVPDA-RPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAMFEVPD+   G+  +  VLVDEEAVGS+ +PGCGAKIL+G+
Sbjct  533   LESILTEAMFEVPDSITEGSQSIKAVLVDEEAVGSVGSPGCGAKILKGD  581


 Score =   162 bits (409),  Expect(3) = 3e-131, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQG  941
             V KLPTPKEIC+GLDEFV+GQE+AKKVLSVAVYNHYKRIY AS  + +  ES     E  
Sbjct  194   VIKLPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKKGSASESYNIDMEDD  253

Query  942   NFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             N   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  254   NI--DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  300


 Score =   156 bits (395),  Expect(3) = 3e-131, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK+T K+ S N GRDVSGEGVQQ L
Sbjct  302   GYVGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSL  361

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  362   LKLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  413


 Score =   130 bits (326),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 69/92 (75%), Gaps = 9/92 (10%)
 Frame = +3

Query  282  FQRRCKWEGSS--------DNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAV  437
            F RR  W+  S        D+YDH++++VNCPRCS  M V+FSNRPLS+TA E GIYQAV
Sbjct  54   FSRRI-WDSCSGGGGGGGGDDYDHIRSDVNCPRCSAQMHVIFSNRPLSLTAREPGIYQAV  112

Query  438  NLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
            N C  C+TAFYFRP KL PLQG+FIE+G+VKG
Sbjct  113  NFCSQCKTAFYFRPFKLSPLQGSFIELGKVKG  144



>gb|EEE56773.1| hypothetical protein OsJ_06335 [Oryza sativa Japonica Group]
Length=479

 Score =   194 bits (493),  Expect(3) = 4e-131, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 154/206 (75%), Gaps = 2/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF AP+R+NM    + NA + SSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  273   RRHDSSIGFQAPIRSNMRTGGVINAEITSSLLESVESGDLIAYGLIPEFVGRFPILVSLS  332

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLV+VL KPKNAL +QY ++F +N+VKLHFT+ AL++I+K+AIAK+TGARGLRSI
Sbjct  333   SLSEDQLVEVLTKPKNALGRQYTKLFEMNDVKLHFTEKALRLISKRAIAKNTGARGLRSI  392

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LES+LTE+M+E+P+ R G D +D V+VDE++VGS +  G GAKIL G   G+  L     
Sbjct  393   LESLLTESMYEIPEIRTGKDKIDAVVVDEDSVGSTNQHGSGAKILCGE--GALDLYLDEH  450

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             + +   +  E + G+ D D E  SR 
Sbjct  451   NKESTLRRSEKVDGEPDIDTEAPSRV  476


 Score =   172 bits (436),  Expect(3) = 4e-131, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AADFDV AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQQ L
Sbjct  164   GYVGEDVESILYKLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQAL  223

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVV+VP+  AR+H RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  224   LKMLEGTVVSVPEKGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISER  273


 Score =   154 bits (388),  Expect(3) = 4e-131, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ ++ PTPKEIC+GLD+FV+GQERAKKVLSVAVYNHYKRI+    +  + G+  +T  +
Sbjct  54    NLGRRFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIHCELLSSRSAGDCSET--D  111

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 ++D VEL+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  112   SCASDTDGVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  162



>ref|XP_009119914.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Brassica rapa]
Length=579

 Score =   203 bits (516),  Expect(3) = 5e-131, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  +++ V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  384   RQHDASIGFGASVRTNMNTSGFSSSAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  443

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +P++AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  444   ALNEDQLVQVLTEPRSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  503

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAMFEVPD++  G+  +  VLVDEEAVGS+ +PGCGAKIL+G+
Sbjct  504   LESILTEAMFEVPDSKSEGSQSIKAVLVDEEAVGSVGSPGCGAKILKGD  552


 Score =   162 bits (409),  Expect(3) = 5e-131, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             KLPTPKEIC+GLD+FV+GQ++AKKVLSVAVYNHYKRIY +S  + +G ES   V E  + 
Sbjct  164   KLPTPKEICQGLDQFVIGQDKAKKVLSVAVYNHYKRIYHSSKIKGSGSESVNLVMEDDDD  223

Query  948   ES-DFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +S D VELDKSNVLL+GPTGSGKTLLAKTLARLVNVPF IADAT+LTQ
Sbjct  224   DSIDLVELDKSNVLLLGPTGSGKTLLAKTLARLVNVPFAIADATSLTQ  271


 Score =   155 bits (391),  Expect(3) = 5e-131, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK++ K+ S N GRDVSGEGVQQ L
Sbjct  273   GYVGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMSMKSHSSNGGRDVSGEGVQQSL  332

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  333   LKLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  384


 Score =   129 bits (323),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (65%), Gaps = 23/113 (20%)
 Frame = +3

Query  192  PLKLPFFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPM  371
            P   PFFS+                       RR  ++ S  +YD+++++VNCPRCS  M
Sbjct  38   PFPFPFFSS-----------------------RRSIYDSSGGDYDYIRSDVNCPRCSAHM  74

Query  372  TVLFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
             V+FSNRPLS+TA E GIYQAVN CP C++AFYFRP KL PLQG+FIE+G+VK
Sbjct  75   LVVFSNRPLSLTAREPGIYQAVNFCPQCKSAFYFRPFKLSPLQGSFIELGKVK  127



>ref|XP_009119913.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Brassica rapa]
Length=580

 Score =   202 bits (514),  Expect(3) = 9e-131, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  +++ V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  384   RQHDASIGFGASVRTNMNTSGFSSSAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  443

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +P++AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  444   ALNEDQLVQVLTEPRSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  503

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAMFEVPD++  G+  +  VLVDEEAVGS+ +PGCGAKIL+G+
Sbjct  504   LESILTEAMFEVPDSKSEGSQSIKAVLVDEEAVGSVGSPGCGAKILKGD  552


 Score =   162 bits (409),  Expect(3) = 9e-131, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             KLPTPKEIC+GLD+FV+GQ++AKKVLSVAVYNHYKRIY +S  + +G ES   V E  + 
Sbjct  164   KLPTPKEICQGLDQFVIGQDKAKKVLSVAVYNHYKRIYHSSKIKGSGSESVNLVMEDDDD  223

Query  948   ES-DFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +S D VELDKSNVLL+GPTGSGKTLLAKTLARLVNVPF IADAT+LTQ
Sbjct  224   DSIDLVELDKSNVLLLGPTGSGKTLLAKTLARLVNVPFAIADATSLTQ  271


 Score =   154 bits (390),  Expect(3) = 9e-131, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK++ K+ S N GRDVSGEGVQQ L
Sbjct  273   GYVGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMSMKSHSSNGGRDVSGEGVQQSL  332

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  333   LKLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  384


 Score =   129 bits (323),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (65%), Gaps = 23/113 (20%)
 Frame = +3

Query  192  PLKLPFFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPM  371
            P   PFFS+                       RR  ++ S  +YD+++++VNCPRCS  M
Sbjct  38   PFPFPFFSS-----------------------RRSIYDSSGGDYDYIRSDVNCPRCSAHM  74

Query  372  TVLFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVK  530
             V+FSNRPLS+TA E GIYQAVN CP C++AFYFRP KL PLQG+FIE+G+VK
Sbjct  75   LVVFSNRPLSLTAREPGIYQAVNFCPQCKSAFYFRPFKLSPLQGSFIELGKVK  127



>gb|EEE55774.1| hypothetical protein OsJ_04339 [Oryza sativa Japonica Group]
Length=572

 Score =   212 bits (539),  Expect(3) = 4e-130, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+R NM  S +T+ +V SSLLESVES DL  YGLIPEF+GR PI VSL+
Sbjct  218   RRQDSSIGFGAPIRINMRSSEVTDPMVTSSLLESVESGDLARYGLIPEFIGRLPILVSLT  277

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKN+L +QY++MF+LN VKLHFTD AL+++AKKAIA++TGARGLR+I
Sbjct  278   ALNEDQLVQVLTEPKNSLSRQYRKMFSLNKVKLHFTDGALRIVAKKAIARNTGARGLRAI  337

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LES+L EAM+E+PD + G++ VD V+VDEEA+GS+D PGCGAKIL+G+ G  E+  +   
Sbjct  338   LESLLLEAMYEIPDEKTGSERVDAVVVDEEAIGSIDRPGCGAKILRGD-GALEQYITNTN  396

Query  2067  STDKAEKNEEALKGDMDGDCEVASR  2141
               +  E N E L G+++ D  + SR
Sbjct  397   MKNSMEAN-EGLAGELE-DAYMMSR  419


 Score =   176 bits (445),  Expect(3) = 4e-130, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL KLL+AA+++V+AA+ GIVYIDEVDKITKKAES N+ RDVSGEGVQQ 
Sbjct  108   AGYVGEDVESILQKLLVAAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQA  167

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+LEGTVV++P+  +RK+SR +SIQIDTK+ILFICGGAF+ LEKTISER
Sbjct  168   LLKILEGTVVSIPEKGSRKNSRNESIQIDTKDILFICGGAFVDLEKTISER  218


 Score =   129 bits (324),  Expect(3) = 4e-130, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 82/112 (73%), Gaps = 17/112 (15%)
 Frame = +3

Query  789   ICKGLDEFVVGQERAKKVL---------SVAVYNHYKRIYDASSTQMAGGESG---KTVD  932
             +C+ LDEFV+GQ +AKKVL         SVAVYNHYKRIY+A+  +     SG      D
Sbjct  1     MCRRLDEFVIGQGKAKKVLEGACQNWVLSVAVYNHYKRIYNATVQKGCSTNSGWLDAASD  60

Query  933   EQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +Q N     +E+DKSNVLLMGPTGSGKTLLAKTLAR+VNVPF+IADAT+LTQ
Sbjct  61    DQNN-----IEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFIIADATSLTQ  107



>ref|XP_004952279.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X2 [Setaria italica]
Length=560

 Score =   185 bits (470),  Expect(3) = 4e-130, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 150/205 (73%), Gaps = 2/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF A VR+NM    + NA + SSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  354   RRHDSSIGFRAQVRSNMRTGGVINAEITSSLLESVESGDLIAYGLIPEFVGRFPILVSLS  413

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLV+VL +PKNAL +QY ++F +N+VKLHFT+ AL++IAK+AI K+TGARGLRSI
Sbjct  414   SLSEDQLVEVLTEPKNALGRQYTKLFEMNDVKLHFTEKALRLIAKRAIVKNTGARGLRSI  473

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAM+E+P+ R G D +D V+V EE+VGS +  G GAKIL G  G  E   +   
Sbjct  474   LESILTEAMYEIPETRTGQDKIDAVVV-EESVGSANQHGIGAKILCGE-GALELYLAKHD  531

Query  2067  STDKAEKNEEALKGDMDGDCEVASR  2141
             + +   +  E   G+ + D E  SR
Sbjct  532   NKESMHQQLEKSNGESEIDAEAPSR  556


 Score =   176 bits (445),  Expect(3) = 4e-130, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL AADFDV AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQ
Sbjct  242   TQAGYVGEDVESILYKLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQ  301

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGTVV+VP+  AR+H RGD+IQIDTKNILFICGGAF+GLEKTISER
Sbjct  302   QALLKMLEGTVVSVPEKGARRHPRGDNIQIDTKNILFICGGAFVGLEKTISER  354


 Score =   155 bits (393),  Expect(3) = 4e-130, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ ++ PTPKEIC+GLD+FV+GQ+RAKKVLSVAVYNHYKRIY  S +  + G   ++  +
Sbjct  135   NLGRRFPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCESLSSRSAGNCSES--D  192

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 ++D VEL+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  193   SCMSDTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  243



>emb|CDY14359.1| BnaA10g06960D [Brassica napus]
Length=580

 Score =   203 bits (516),  Expect(3) = 1e-129, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  +++ V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  385   RQHDASIGFGASVRTNMNTSGFSSSAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  444

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +P++AL KQYK++F +NNV+LHFT+ A ++IA++A++K+TGARGLRSI
Sbjct  445   ALNEDQLVQVLTEPRSALGKQYKKLFRMNNVQLHFTEGATRLIARRAMSKNTGARGLRSI  504

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAMFEVPD++  G+  +  VLVDEEAVGS+ +PGCGAKIL+G+
Sbjct  505   LESILTEAMFEVPDSKSEGSQSIKAVLVDEEAVGSVGSPGCGAKILKGD  553


 Score =   159 bits (403),  Expect(3) = 1e-129, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             KLPTPKEIC+GLD+FV+GQ++AKKVLSVAVYNHYKRIY +S  + +G ES   V E  + 
Sbjct  164   KLPTPKEICQGLDQFVIGQDKAKKVLSVAVYNHYKRIYHSSKIKGSGSESVNFVMEDDDD  223

Query  948   ES--DFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +   D VELDKSNVLL+GPTGSGKTLLAKTLARLVNVPF IADAT+LTQ
Sbjct  224   DDSIDLVELDKSNVLLLGPTGSGKTLLAKTLARLVNVPFAIADATSLTQ  272


 Score =   153 bits (386),  Expect(3) = 1e-129, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK++ K+ S N GRDVSGEGVQQ LL
Sbjct  275   YVGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMSMKSHSSNGGRDVSGEGVQQSLL  334

Query  1271  KMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             K+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  335   KLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  385


 Score =   130 bits (326),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  RRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAF  467
            RR  ++ S  +YD+++++VNCPRCS  M V+FSNRPLS+TA E GIYQAVN CP C++AF
Sbjct  47   RRSIYDSSGGDYDYIRSDVNCPRCSAHMLVVFSNRPLSLTAREPGIYQAVNFCPQCKSAF  106

Query  468  YFRPSKLEPLQGNFIEIGQVKGG  536
            YFRP KL PLQG+FIE+G+VK G
Sbjct  107  YFRPFKLSPLQGSFIELGKVKKG  129



>ref|XP_010482282.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=609

 Score =   197 bits (500),  Expect(3) = 1e-129, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  ++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  414   RQHDASIGFGASVRTNMNTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  473

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  474   ALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  533

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAM+EVPD+   G+  +  VLVDEEAVG + T GCGAKIL+G+
Sbjct  534   LESILTEAMYEVPDSMTGGSQSIKAVLVDEEAVGLVGTQGCGAKILKGD  582


 Score =   162 bits (411),  Expect(3) = 1e-129, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQG  941
             V KLPTPKEIC+GLDEFV+GQE+AKKVLSVAVYNHYKRIY AS  + +  ESG    E  
Sbjct  195   VIKLPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKKGSASESGNLDMEDD  254

Query  942   NFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  255   SI--DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  301


 Score =   156 bits (394),  Expect(3) = 1e-129, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK+T K+ S N GRDVSGEGVQ
Sbjct  300   TQAGYVGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQ  359

Query  1259  QGLLKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLK+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  360   QSLLKLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  414


 Score =   128 bits (322),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 77/117 (66%), Gaps = 10/117 (9%)
 Frame = +3

Query  201  LPFFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEG------SSDNYDHLKAEVNCPRCS  362
            L F S P   H+P    +   +     F RR  WE         D+YDH++++VNCPRCS
Sbjct  35   LSFNSLP---HIPLLRPSSNTLIPSSSFSRRI-WESCSGGGSGGDDYDHIRSDVNCPRCS  90

Query  363  KPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
              M V+FSNRPLS+TA E GIYQAVN C  CRTAFYFRP KL PLQG+FIE+G+VKG
Sbjct  91   AQMHVIFSNRPLSLTAREPGIYQAVNYCSQCRTAFYFRPFKLSPLQGSFIELGKVKG  147



>ref|XP_010441212.1| PREDICTED: mitochondrial clpX-like chaperone MCX1 isoform X1 
[Camelina sativa]
 ref|XP_010441216.1| PREDICTED: mitochondrial clpX-like chaperone MCX1 isoform X2 
[Camelina sativa]
Length=625

 Score =   196 bits (499),  Expect(3) = 1e-129, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  ++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  430   RQHDASIGFGASVRTNMNTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  489

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  490   ALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  549

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAM+EVPD+   G+  +  VLVDEEAVG + T GCGAKIL+G+
Sbjct  550   LESILTEAMYEVPDSMTGGSQSIKAVLVDEEAVGLVGTQGCGAKILKGD  598


 Score =   162 bits (411),  Expect(3) = 1e-129, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQG  941
             V KLPTPKEIC+GLDEFV+GQE+AKKVLSVAVYNHYKRIY AS  + +  ESG    E  
Sbjct  211   VIKLPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKKGSASESGNLDMEDD  270

Query  942   NFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  271   SI--DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  317


 Score =   156 bits (394),  Expect(3) = 1e-129, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK+T K+ S N GRDVSGEGVQQ L
Sbjct  319   GYVGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSL  378

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  379   LKLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  430


 Score =   132 bits (331),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 78/117 (67%), Gaps = 10/117 (9%)
 Frame = +3

Query  201  LPFFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSS------DNYDHLKAEVNCPRCS  362
            L F S P   H+P    +   +     F RR  W+  S      D+YDH++++VNCPRCS
Sbjct  51   LSFDSLP---HIPLLRPSSNTLIPSSSFSRRI-WDSCSGGGGGGDDYDHIRSDVNCPRCS  106

Query  363  KPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
              M V+FSNRPLS+TA E GIYQAVN C  CRTAFYFRP KL PLQG+FIE+G+VKG
Sbjct  107  AQMHVIFSNRPLSLTAREPGIYQAVNYCSQCRTAFYFRPFKLSPLQGSFIELGKVKG  163



>gb|AFW70872.1| ATP-dependent Clp protease ATP-binding subunit clpX [Zea mays]
Length=559

 Score =   188 bits (478),  Expect(3) = 2e-129, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF A VR+NM    + NA + SSLL+SVES DL AYGLIPEFVGRFPI V LS
Sbjct  352   RRHDSSIGFRAQVRSNMRSGGVINAEITSSLLKSVESGDLIAYGLIPEFVGRFPILVGLS  411

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLV+VL +PKNAL +QY ++F +N+VKLHFT+ AL++IAK+AI+K+TGARGLRSI
Sbjct  412   SLSEDQLVEVLTEPKNALGRQYTKLFEMNDVKLHFTEEALRLIAKRAISKNTGARGLRSI  471

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQG  2027
             LESILTEAM+E+P+ R G D +D V+VDEE+VGS++  G GAKIL G
Sbjct  472   LESILTEAMYEIPETRTGKDKIDAVVVDEESVGSVNQHGIGAKILCG  518


 Score =   173 bits (438),  Expect(3) = 2e-129, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AADFDV AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQQ 
Sbjct  242   AGYVGEDVESILYKLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQA  301

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVV+VP+  AR+H RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  302   LLKMLEGTVVSVPEKGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISER  352


 Score =   153 bits (387),  Expect(3) = 2e-129, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ ++ PTPKEIC+GLD+FV+GQ+RAKKVLSVAVYNHYKRIY  S    +  +  ++  +
Sbjct  133   NLGRRFPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCESLINRSAADCSQS--D  190

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 ++D VEL+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQ
Sbjct  191   SCTSDTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQ  241



>ref|XP_001768014.1| predicted protein [Physcomitrella patens]
 gb|EDQ67289.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   190 bits (482),  Expect(3) = 2e-129, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+QDSSIGFGAPVR NM  + L +A + SSLLE+VES+DL +YGLIPEF+GRFP+ VSLS
Sbjct  229   RKQDSSIGFGAPVRANMRGNKLIDAAITSSLLETVESSDLISYGLIPEFIGRFPVIVSLS  288

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             ALDE+QLVQVL +P+NAL KQYK+MFA+NNVKLH+T+  L+ IA+KA+ K+TGARGLRS 
Sbjct  289   ALDEDQLVQVLTEPRNALGKQYKKMFAMNNVKLHYTEGGLRRIAQKAVVKNTGARGLRST  348

Query  1887  LESILTEAMFEVPDARPGNDG--VDMVLVDEEAVGSLDTPGCGAKILQG  2027
             LE++LTEAM++VPD+   N+G  VD V++DE+AVG+ D  G GAKIL+G
Sbjct  349   LETVLTEAMYQVPDS-ISNEGEQVDAVVLDEDAVGAPDGNGEGAKILRG  396


 Score =   180 bits (456),  Expect(3) = 2e-129, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ A+F+V AA+ GI+YIDEVDKITKKAES NI RDVSGEGVQQ L
Sbjct  120   GYVGEDVESILYKLLVEAEFNVLAAQQGIIYIDEVDKITKKAESKNISRDVSGEGVQQAL  179

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RG+ IQIDTK+ILFICGGAF+ LEK+I+ER
Sbjct  180   LKMLEGTVVNVPEKGARKHPRGEHIQIDTKDILFICGGAFVELEKSIAER  229


 Score =   145 bits (365),  Expect(3) = 2e-129, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 9/121 (7%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKK--VLSVAVYNHYKRIYDASSTQMAGGES  917
             W G ++ K LPTP+EIC+ LD+FVVGQE+AKK  +LSVAVYNHYKRIY  S   M  G +
Sbjct  1     WGGSSLGKVLPTPREICQALDKFVVGQEQAKKARILSVAVYNHYKRIYFES---MRKGNA  57

Query  918   GKTVDEQG----NFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLT  1085
               T +  G      E + VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADAT+LT
Sbjct  58    KPTNEGFGVSEVECEENDVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATSLT  117

Query  1086  Q  1088
             Q
Sbjct  118   Q  118



>dbj|BAD21479.1| putative ATP-dependent Clp protease ATP-binding subunit ClpX1 
(CLPX) [Oryza sativa Japonica Group]
Length=554

 Score =   190 bits (482),  Expect(3) = 2e-129, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF AP+R+NM    + NA + SSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  361   RRHDSSIGFQAPIRSNMRTGGVINAEITSSLLESVESGDLIAYGLIPEFVGRFPILVSLS  420

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLV+VL KPKNAL +QY ++F +N+VKLHFT+ AL++I+K+AIAK+TGARGLRSI
Sbjct  421   SLSEDQLVEVLTKPKNALGRQYTKLFEMNDVKLHFTEKALRLISKRAIAKNTGARGLRSI  480

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQG  2027
             LES+LTE+M+E+P+ R G D +D V+VDE++VGS +  G GAKIL G
Sbjct  481   LESLLTESMYEIPEIRTGKDKIDAVVVDEDSVGSTNQHGSGAKILCG  527


 Score =   172 bits (436),  Expect(3) = 2e-129, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AADFDV AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQQ L
Sbjct  252   GYVGEDVESILYKLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQAL  311

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVV+VP+  AR+H RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  312   LKMLEGTVVSVPEKGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISER  361


 Score =   152 bits (383),  Expect(3) = 2e-129, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             ++ PTPKEIC+GLD+FV+GQERAKKVLSVAVYNHYKRI+    +  + G+  +T  +   
Sbjct  145   RRFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIHCELLSSRSAGDCSET--DSCA  202

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              ++D VEL+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  203   SDTDGVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  250



>ref|NP_001147507.1| ATP-dependent Clp protease ATP-binding subunit clpX [Zea mays]
 gb|ACG27758.1| ATP-dependent Clp protease ATP-binding subunit clpX [Zea mays]
Length=559

 Score =   187 bits (476),  Expect(3) = 3e-129, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF A VR+NM    + NA + SSLL+SVES DL AYGLIPEFVGRFPI V LS
Sbjct  352   RRHDSSIGFRAQVRSNMRSGGVINAEITSSLLKSVESGDLIAYGLIPEFVGRFPILVGLS  411

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLV+VL +PKNAL +QY ++F +N+VKLHFT+ AL++IAK+AI+K+TGARGLRSI
Sbjct  412   SLSEDQLVEVLTEPKNALGRQYTKLFEMNDVKLHFTEEALRLIAKRAISKNTGARGLRSI  471

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQG  2027
             LESILTEAM+E+P+ R G D +D V+VDEE+VGS++  G GAKIL G
Sbjct  472   LESILTEAMYEIPETRIGKDKIDAVVVDEESVGSVNQHGIGAKILCG  518


 Score =   173 bits (438),  Expect(3) = 3e-129, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AADFDV AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQQ 
Sbjct  242   AGYVGEDVESILYKLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQA  301

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVV+VP+  AR+H RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  302   LLKMLEGTVVSVPEKGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISER  352


 Score =   153 bits (387),  Expect(3) = 3e-129, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ ++ PTPKEIC+GLD+FV+GQ+RAKKVLSVAVYNHYKRIY  S    +  +  ++  +
Sbjct  133   NLGRRFPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCESLINRSAADCSQS--D  190

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 ++D VEL+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQ
Sbjct  191   SCTSDTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQ  241



>ref|XP_010442456.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=604

 Score =   196 bits (498),  Expect(3) = 2e-128, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  ++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  409   RQHDASIGFGASVRTNMNTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  468

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  469   ALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  528

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAM+EVPD+   G+  +  VLVDEEA+G + T GCGAKIL+G+
Sbjct  529   LESILTEAMYEVPDSMTGGSQSIKAVLVDEEAIGLVGTQGCGAKILKGD  577


 Score =   163 bits (412),  Expect(3) = 2e-128, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQG  941
             V KLPTPKEIC+GLDEFV+GQE+AKKVLSVAVYNHYKRIY AS  + +  ESG    E  
Sbjct  190   VIKLPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKKESASESGNLDIEDD  249

Query  942   NFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  250   SI--DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  296


 Score =   152 bits (383),  Expect(3) = 2e-128, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK+T K++S N GRDVS EGVQQ L
Sbjct  298   GYVGEDVESILYKLYVEARCNVEEAQRGIVYIDEVDKMTMKSQSSNGGRDVSREGVQQSL  357

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+V  P+   ++  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  358   LKLLEGTVVSVPIPEKGLQRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  409


 Score =   132 bits (332),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = +3

Query  201  LPFFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVL  380
            +P     S   +P  P + R+          C      D+YDH++++VNCPRCS  M V+
Sbjct  40   IPLLRPSSNTLIPSSPFSRRIWD-------SCSGGSGGDDYDHIRSDVNCPRCSAQMHVI  92

Query  381  FSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
            FSNRPLS+TA E GIYQAVN C  CRTAFYFRP KL PLQG+FIE+G+VKG
Sbjct  93   FSNRPLSLTAREPGIYQAVNYCSQCRTAFYFRPFKLSPLQGSFIELGKVKG  143



>ref|XP_004952278.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X1 [Setaria italica]
Length=644

 Score =   181 bits (459),  Expect(3) = 3e-128, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF A VR+NM    + NA + SSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  354   RRHDSSIGFRAQVRSNMRTGGVINAEITSSLLESVESGDLIAYGLIPEFVGRFPILVSLS  413

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLV+VL +PKNAL +QY ++F +N+VKLHFT+ AL++IAK+AI K+TGARGLRSI
Sbjct  414   SLSEDQLVEVLTEPKNALGRQYTKLFEMNDVKLHFTEKALRLIAKRAIVKNTGARGLRSI  473

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQG  2027
             LESILTEAM+E+P+ R G D +D V+V EE+VGS +  G GAKIL G
Sbjct  474   LESILTEAMYEIPETRTGQDKIDAVVV-EESVGSANQHGIGAKILCG  519


 Score =   174 bits (440),  Expect(3) = 3e-128, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AADFDV AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQQ L
Sbjct  245   GYVGEDVESILYKLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQAL  304

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVV+VP+  AR+H RGD+IQIDTKNILFICGGAF+GLEKTISER
Sbjct  305   LKMLEGTVVSVPEKGARRHPRGDNIQIDTKNILFICGGAFVGLEKTISER  354


 Score =   155 bits (393),  Expect(3) = 3e-128, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ ++ PTPKEIC+GLD+FV+GQ+RAKKVLSVAVYNHYKRIY  S +  + G   ++  +
Sbjct  135   NLGRRFPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCESLSSRSAGNCSES--D  192

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 ++D VEL+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  193   SCMSDTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  243



>gb|KFK32966.1| hypothetical protein AALP_AA6G312500 [Arabis alpina]
Length=555

 Score =   197 bits (500),  Expect(3) = 2e-127, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 151/191 (79%), Gaps = 8/191 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  ++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  363   RQHDASIGFGASVRTNMNTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  422

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  423   ALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  482

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAM  2063
             LESILTEAMFEVPD+   G+  +  VLVDEEAVG   TPGCGAKIL+G+    +     +
Sbjct  483   LESILTEAMFEVPDSMTEGSQSIKAVLVDEEAVG---TPGCGAKILKGD----DMFQQFV  535

Query  2064  TSTDKAEKNEE  2096
               T+  EK +E
Sbjct  536   EDTESKEKRKE  546


 Score =   157 bits (398),  Expect(3) = 2e-127, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KL + A  DVE A+ GIVYIDEVDK+T K+ S N GRDVSGEGVQQ L
Sbjct  252   GYVGEDVESILYKLYVEAGCDVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSL  311

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+V  P+   R+  RGDSIQ+DTK+ILFICGGAFI LEKT+SER
Sbjct  312   LKLLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSER  363


 Score =   154 bits (388),  Expect(3) = 2e-127, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 87/107 (81%), Gaps = 15/107 (14%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             KLPTPKEIC+GLD+FV+GQE+AKKVLSVAVYNHYKRIY AS T             +GN 
Sbjct  159   KLPTPKEICRGLDDFVIGQEKAKKVLSVAVYNHYKRIYHASRT-------------KGN-  204

Query  948   ESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               D +ELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  205   -DDSIELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  250


 Score =   124 bits (311),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +3

Query  300  WE---GSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFY  470
            W+   G   +YDH++++VNCPRCS  M V+FSNRPLS+TA E GIYQAVN C  C+TAFY
Sbjct  53   WDSCGGGGGDYDHIRSDVNCPRCSAQMHVVFSNRPLSLTAREPGIYQAVNFCSQCKTAFY  112

Query  471  FRPSKLEPLQGNFIEIGQVKG  533
             RP KL PLQG+FIE+G+VKG
Sbjct  113  LRPFKLSPLQGSFIELGKVKG  133



>gb|EYU25234.1| hypothetical protein MIMGU_mgv1a003646mg [Erythranthe guttata]
Length=499

 Score =   189 bits (479),  Expect(3) = 2e-127, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  AD++V AA+ GI+YIDEVDKITKKAES+NI RDVSGEGVQQ L
Sbjct  258   GYVGEDVESILYKLLTVADYNVVAAQQGIIYIDEVDKITKKAESMNISRDVSGEGVQQAL  317

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  318   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  367


 Score =   164 bits (414),  Expect(3) = 2e-127, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+    PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY  SS + A G  
Sbjct  146   GSWGGSNLGPDFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYSDSSQRPADGGK  205

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              +  D++       VEL+KSN+LLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  206   TEGADDEN------VELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  256


 Score =   155 bits (392),  Expect(3) = 2e-127, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGFGAPVR NM +  +T+A V SSLLE+VES+DL AYGLIPEFVGRFP+ V+LS
Sbjct  367   RRHDSSIGFGAPVRANMRMGGVTSAAVTSSLLETVESSDLIAYGLIPEFVGRFPVLVNLS  426

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E QLVQVL +PKNAL KQY++MF +N VKLHFT++AL++IA+KAI K+TGARGLRS+
Sbjct  427   ALTEEQLVQVLTEPKNALGKQYRKMFQMNGVKLHFTEDALRLIARKAITKNTGARGLRSM  486

Query  1887  LESILTEAMFEV  1922
             LE++L +AM+E+
Sbjct  487   LENVLMDAMYEM  498



>gb|KCW46560.1| hypothetical protein EUGRSUZ_K00383 [Eucalyptus grandis]
Length=529

 Score =   188 bits (477),  Expect(3) = 2e-127, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL KLL AAD++V AA+ GIVYIDEVDKITKKAES+NI RDVSGEGVQQ L
Sbjct  280   GYVGEDVESILHKLLTAADYNVAAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL  339

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  340   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  389


 Score =   162 bits (411),  Expect(3) = 2e-127, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  S +TNAVVASSLLESVES+DL +YGLIPEFVGRFPI VSLS
Sbjct  389   RRQDSSIGFGAPVRANMRASNVTNAVVASSLLESVESSDLISYGLIPEFVGRFPILVSLS  448

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VL +PKNAL KQY++MF +N VKLH+TDNAL++IA+KAIAK+TGARGLRSI
Sbjct  449   ALSEDQLVEVLTEPKNALGKQYRKMFQMNGVKLHYTDNALRLIARKAIAKNTGARGLRSI  508

Query  1887  LESILTEAMFEV  1922
             LE+IL EAM+EV
Sbjct  509   LENILMEAMYEV  520


 Score =   157 bits (397),  Expect(3) = 2e-127, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N     PTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY   S +   G+S  
Sbjct  167   WGGSNWGSNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYH-ESVKRPSGDSED  225

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  226   ARPESA--DDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  278



>ref|XP_010478757.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=640

 Score =   180 bits (457),  Expect(3) = 3e-127, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVG+DVESIL KLL  A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  357   GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  416

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNVP   ARKH RGD IQIDTK+ILFICGGAF+ LEKTI +R
Sbjct  417   LKLLEGTIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDR  466


 Score =   164 bits (415),  Expect(3) = 3e-127, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 133/186 (72%), Gaps = 22/186 (12%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM+ S +T+  + SSLLESVES DLTAYGLIPEFVGRFPI VSLS
Sbjct  466   RRQDSSIGFGAPVRANMATSRVTSGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLS  525

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++                     VKLHFT+ AL++I+K+A+ K+TGARGLR++
Sbjct  526   ALTEDQLIR---------------------VKLHFTEKALEIISKQAMVKNTGARGLRAL  564

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G++ +D V+VDEE  GS  + GC AK+L+G+ G  ER  S   
Sbjct  565   LESILTEAMFEIPDDKKGDERIDAVIVDEELTGSEVSRGCTAKVLKGD-GAFERYLSENK  623

Query  2067  STDKAE  2084
             S D  E
Sbjct  624   SKDATE  629


 Score =   163 bits (412),  Expect(3) = 3e-127, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 91/115 (79%), Gaps = 8/115 (7%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G ++ +  PTPKEICK LD+FV+GQ RAKKVLSVAVYNHYKRIY    T M  G + +
Sbjct  249   WGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIY---HTSMKKGSAAQ  305

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              +D+  N     VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  306   PIDDDDN-----VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  355


 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 60/127 (47%), Gaps = 32/127 (25%)
 Frame = +3

Query  246  PTTIRVIGLGLG-------FQRRCKWE--GSSDNYD------HLKAEVNCPRCSKPMTVL  380
            P   R+  L LG        Q R K E  G  D++        L+AE NCPRCSK M +L
Sbjct  22   PLQTRLHSLELGSSSPRRRIQERFKSEQGGGGDDFPVPVTRRKLRAEPNCPRCSKQMDLL  81

Query  381  FSNRPLSIT-----------------AGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNF  509
            FSNR    +                       +Q+VN CP C+TA+ F P  + PLQG F
Sbjct  82   FSNRQFPSSNLLQRPDESDSSSGDGDGDNKTSFQSVNFCPTCKTAYGFNPRGVSPLQGTF  141

Query  510  IEIGQVK  530
            IEIG+V+
Sbjct  142  IEIGRVQ  148



>ref|XP_010442455.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
Length=606

 Score =   196 bits (498),  Expect(3) = 5e-127, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  ++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  411   RQHDASIGFGASVRTNMNTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  470

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  471   ALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  530

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAM+EVPD+   G+  +  VLVDEEA+G + T GCGAKIL+G+
Sbjct  531   LESILTEAMYEVPDSMTGGSQSIKAVLVDEEAIGLVGTQGCGAKILKGD  579


 Score =   163 bits (412),  Expect(3) = 5e-127, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQG  941
             V KLPTPKEIC+GLDEFV+GQE+AKKVLSVAVYNHYKRIY AS  + +  ESG    E  
Sbjct  190   VIKLPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKKESASESGNLDIEDD  249

Query  942   NFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  250   SI--DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  296


 Score =   147 bits (372),  Expect(3) = 5e-127, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK+T K++S N GRDVS EGVQQ L
Sbjct  298   GYVGEDVESILYKLYVEARCNVEEAQRGIVYIDEVDKMTMKSQSSNGGRDVSREGVQQSL  357

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQI--DTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+V  P+   ++  RGDSIQ+  DTK+ILFICGGAFI LEKT+SER
Sbjct  358   LKLLEGTVVSVPIPEKGLQRDPRGDSIQVNMDTKDILFICGGAFIDLEKTVSER  411


 Score =   132 bits (332),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = +3

Query  201  LPFFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVL  380
            +P     S   +P  P + R+          C      D+YDH++++VNCPRCS  M V+
Sbjct  40   IPLLRPSSNTLIPSSPFSRRIWD-------SCSGGSGGDDYDHIRSDVNCPRCSAQMHVI  92

Query  381  FSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
            FSNRPLS+TA E GIYQAVN C  CRTAFYFRP KL PLQG+FIE+G+VKG
Sbjct  93   FSNRPLSLTAREPGIYQAVNYCSQCRTAFYFRPFKLSPLQGSFIELGKVKG  143



>emb|CAN75136.1| hypothetical protein VITISV_040753 [Vitis vinifera]
Length=600

 Score =   203 bits (516),  Expect(3) = 5e-127, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 152/201 (76%), Gaps = 6/201 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM     T A VASSLLE+VES+DL +YGLIPEFVGRFPI VSLS
Sbjct  394   RRQDSSIGFGAPVRANMRTGGPTXAAVASSLLETVESSDLISYGLIPEFVGRFPILVSLS  453

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQLV+VL +PKNAL KQYK+MF +N VKLHFT NAL++I++KA +K+TGARGLRS 
Sbjct  454   ALTENQLVEVLTEPKNALGKQYKKMFQMNGVKLHFTKNALRLISRKAXSKNTGARGLRSX  513

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R GND +D V+VD+EAVGS D  G GAKIL G       LS    
Sbjct  514   LENILMBAMYEIPDVRTGNDIIDAVVVDDEAVGS-DGHGFGAKILYGKGALDCYLSQ---  569

Query  2067  STDKAEKNEEALKGDMDGDCE  2129
                K ++ E  ++G  DG+ E
Sbjct  570   --HKLKETETPMEGSSDGEAE  588


 Score =   193 bits (491),  Expect(3) = 5e-127, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +2

Query  1070  CNNVDT-GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSG  1246
             C N+ T GYVGEDVESIL+KLLM AD++V AA+ GIVYIDEVDKITKKAESLN+ RDVSG
Sbjct  278   CQNLGTAGYVGEDVESILYKLLMVADYNVVAAQQGIVYIDEVDKITKKAESLNLSRDVSG  337

Query  1247  EGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             EGVQQ LLKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  338   EGVQQALLKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  394


 Score =   110 bits (274),  Expect(3) = 5e-127, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 66/96 (69%), Gaps = 5/96 (5%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDAS-----STQMAG  908
             W G N+    PTPKEIC+GLD+FV+GQERAKKVLSVAVYNHYKRIY  S      T    
Sbjct  154   WGGSNLGHNFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIYHZSLQKCDPTWRIR  213

Query  909   GESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKT  1016
                  + D+    ++D VEL+KSN+LLMGPTGSG T
Sbjct  214   PAEDTSDDKAEATDNDSVELEKSNILLMGPTGSGST  249



>ref|XP_010442457.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Camelina sativa]
Length=593

 Score =   196 bits (497),  Expect(3) = 8e-127, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ D+SIGFGA VRTNM+ S  ++A V SSLLES++S DL AYGLIPEFVGR PI VSLS
Sbjct  411   RQHDASIGFGASVRTNMNTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLS  470

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PK+AL KQYK++F +NNV+LHFT+ A ++IA+KA++K+TGARGLRSI
Sbjct  471   ALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSI  530

Query  1887  LESILTEAMFEVPDARP-GNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LESILTEAM+EVPD+   G+  +  VLVDEEA+G + T GCGAKIL+G+
Sbjct  531   LESILTEAMYEVPDSMTGGSQSIKAVLVDEEAIGLVGTQGCGAKILKGD  579


 Score =   162 bits (411),  Expect(3) = 8e-127, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  762   VKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQG  941
             V KLPTPKEIC+GLDEFV+GQE+AKKVLSVAVYNHYKRIY AS  + +  ESG    E  
Sbjct  190   VIKLPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKKESASESGNLDIEDD  249

Query  942   NFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +   D VELDKSNVLL+GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQ
Sbjct  250   SI--DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQ  296


 Score =   147 bits (371),  Expect(3) = 8e-127, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KL + A  +VE A+ GIVYIDEVDK+T K++S N GRDVS EGVQQ L
Sbjct  298   GYVGEDVESILYKLYVEARCNVEEAQRGIVYIDEVDKMTMKSQSSNGGRDVSREGVQQSL  357

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQI--DTKNILFICGGAFIGLEKTISER  1417
             LK+LEGTVV+V  P+   ++  RGDSIQ+  DTK+ILFICGGAFI LEKT+SER
Sbjct  358   LKLLEGTVVSVPIPEKGLQRDPRGDSIQVNMDTKDILFICGGAFIDLEKTVSER  411


 Score =   132 bits (331),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = +3

Query  201  LPFFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVL  380
            +P     S   +P  P + R+          C      D+YDH++++VNCPRCS  M V+
Sbjct  40   IPLLRPSSNTLIPSSPFSRRI-------WDSCSGGSGGDDYDHIRSDVNCPRCSAQMHVI  92

Query  381  FSNRPLSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
            FSNRPLS+TA E GIYQAVN C  CRTAFYFRP KL PLQG+FIE+G+VKG
Sbjct  93   FSNRPLSLTAREPGIYQAVNYCSQCRTAFYFRPFKLSPLQGSFIELGKVKG  143



>ref|XP_007039052.1| CLP protease regulatory subunit X isoform 2 [Theobroma cacao]
 gb|EOY23553.1| CLP protease regulatory subunit X isoform 2 [Theobroma cacao]
Length=526

 Score =   187 bits (476),  Expect(3) = 1e-125, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ AD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  280   GYVGEDVESILYKLLVVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  339

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RG++IQIDTK+ILFICGGAFI +EKTISER
Sbjct  340   LKMLEGTIVNVPEKGARKHPRGENIQIDTKDILFICGGAFIDIEKTISER  389


 Score =   159 bits (403),  Expect(3) = 1e-125, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+    PTPK+ICKGLD+FV+GQERAKKVLSVAVYNHY RIY  S  +   G+S
Sbjct  164   GCWGGSNLGHNFPTPKDICKGLDKFVIGQERAKKVLSVAVYNHYMRIYHESLQKRPAGDS  223

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                + +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  224   VSNIADV--LDDDIVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  278


 Score =   154 bits (389),  Expect(3) = 1e-125, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA VAS+L+ESVES+DL AYGLIPEFVGRFP+ VSL 
Sbjct  389   RRQDSSIGFGAPVRANMRAGGVTNAAVASTLMESVESSDLIAYGLIPEFVGRFPVLVSLL  448

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E QLVQVL +PKNAL KQYKRMF +N VKLH T+NALK+IA+KAI+K+TGARGLR+I
Sbjct  449   ALTEEQLVQVLTEPKNALGKQYKRMFQMNGVKLHITENALKLIARKAISKNTGARGLRAI  508

Query  1887  LESILTEAMFEV  1922
             LE+IL +++F++
Sbjct  509   LENILMDSIFQM  520



>gb|AES72507.2| ATP-dependent Clp protease regulatory subunit ClpX [Medicago 
truncatula]
Length=581

 Score =   179 bits (453),  Expect(3) = 8e-125, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AAD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  269   GYVGEDVESILYKLLAAADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  328

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTKNILFICGGAFI LEKTISER
Sbjct  329   LKMLEGTIVNVPEKGARKHPRGDNIQIDTKNILFICGGAFIDLEKTISER  378


 Score =   171 bits (434),  Expect(3) = 8e-125, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 150/204 (74%), Gaps = 5/204 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR  M   ++T A +ASSLL +VES+DL AYGLIPEFVGRFPI VSLS
Sbjct  378   RRQDSSIGFGAPVRAKMKAGSVTEASIASSLLGTVESSDLIAYGLIPEFVGRFPILVSLS  437

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QVL +PK+AL KQYK+ F +N VKLHFT++A K IA++A++K+TGARGLR+I
Sbjct  438   ALTENQLIQVLTEPKSALEKQYKKTFQINGVKLHFTESARKSIARQAMSKNTGARGLRAI  497

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             +ESIL +AM+E+PD R G+D +D V+VDE++VG  +    GAKIL G       LS    
Sbjct  498   IESILVDAMYEIPDIRTGDDVIDAVVVDEDSVGG-EGSVRGAKILYGRGAFDRYLSKEKN  556

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
              ++  E +     GD + + E+ S
Sbjct  557   DSETTEVS----GGDQEAETELPS  576


 Score =   149 bits (375),  Expect(3) = 8e-125, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+    PTPKEICKGLD+ V+GQERAKKVLSVAVYNHYKRIY       AG  +  
Sbjct  154   WGGSNMGGTFPTPKEICKGLDKHVIGQERAKKVLSVAVYNHYKRIYH-EKLWHAGDSNID  212

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  213   GKADVVVDDDDDVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  267



>gb|EMT28446.1| ATP-dependent Clp protease ATP-binding subunit clpX [Aegilops 
tauschii]
Length=588

 Score =   216 bits (550),  Expect(3) = 8e-120, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+RTNM  S +T+  V SSLLESVES DL  +GLIPEF+GR PI VSL+
Sbjct  223   RRQDSSIGFGAPIRTNMRSSGVTSPTVTSSLLESVESGDLAKFGLIPEFIGRLPILVSLA  282

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             ALDE+QLVQVL +PKN+L +QY++MF+LNNVKLHFTD AL+++AKKAI K+TGARGLR++
Sbjct  283   ALDEDQLVQVLTEPKNSLSRQYRKMFSLNNVKLHFTDGALRIVAKKAIVKNTGARGLRAL  342

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL EAM+E+PD + GN+ VD V+VDEEA+GS+D PGCGAKIL+G+   ++ +     
Sbjct  343   LETILLEAMYEIPDEKAGNERVDAVVVDEEAIGSVDRPGCGAKILRGDGALAQYI--IRN  400

Query  2067  STDKAEKNEEALKGDMDGDCEVASR  2141
             +   + +  EAL G+++ D  + SR
Sbjct  401   NIPNSPETNEALAGELE-DAYMLSR  424


 Score =   174 bits (442),  Expect(3) = 8e-120, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = +2

Query  1046  KCSFCHCRCNNVDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLN  1225
             +  F H        GYVGEDVESIL KLL+ A+++V+AA+ GIVYIDEVDKITKKAES N
Sbjct  104   RSRFLHSEL----AGYVGEDVESILQKLLVEAEYNVQAAQQGIVYIDEVDKITKKAESAN  159

Query  1226  IGRDVSGEGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKT  1405
             + RDVSGEGVQQ LLK+LEGTVV +P+  +RK+SR DSIQIDTK+ILFICGGAF+ LEKT
Sbjct  160   VSRDVSGEGVQQALLKILEGTVVTIPEKGSRKNSRNDSIQIDTKDILFICGGAFVDLEKT  219

Query  1406  ISER  1417
             ISER
Sbjct  220   ISER  223


 Score = 91.7 bits (226),  Expect(3) = 8e-120, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 2/77 (3%)
 Frame = +3

Query  789   ICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVEL  968
             +C+ LDEFV+GQ +AKKVLSVAVYNHYKR+Y+A+  + +   SG    +  N + D VE+
Sbjct  1     MCRRLDEFVIGQGKAKKVLSVAVYNHYKRVYNATVQKGSADNSG--CPDAANADHDNVEI  58

Query  969   DKSNVLLMGPTGSGKTL  1019
             DKSNVLLMGPTGS  TL
Sbjct  59    DKSNVLLMGPTGSEFTL  75



>ref|XP_008460588.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Cucumis melo]
Length=589

 Score =   196 bits (497),  Expect(3) = 1e-118, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 140/165 (85%), Gaps = 4/165 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ DSSIGFGAPVR +M  + LT  +V SS+LE+VES+DL  YGLIPEFVGR PI VSLS
Sbjct  387   RQHDSSIGFGAPVRASMRTARLTEDLVTSSMLENVESSDLVTYGLIPEFVGRCPILVSLS  446

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             ALDE+QLVQVL KPKNAL KQYK+MF +N+V+LHFT+NAL+MIA+KA+ K+TGARGLRSI
Sbjct  447   ALDEDQLVQVLTKPKNALGKQYKKMFRMNDVELHFTENALRMIARKAMKKNTGARGLRSI  506

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKIL  2021
             LE+ILTEAMFEVP++    + +  VLVD E+VGS+D PGCGAKIL
Sbjct  507   LENILTEAMFEVPES----NSIKAVLVDGESVGSVDAPGCGAKIL  547


 Score =   187 bits (474),  Expect(3) = 1e-118, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
             +GYVGEDVESIL+KLL+ A+F+VEAA+ GIVYIDEVDKITKK+ES+N GRDVSGEGVQQ 
Sbjct  277   SGYVGEDVESILYKLLLDAEFNVEAAQRGIVYIDEVDKITKKSESINSGRDVSGEGVQQA  336

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVV+VPD  AR+H RGD+IQ+DTKNILFICGGAF+GLEK IS+R
Sbjct  337   LLKMLEGTVVDVPDTGARRHPRGDTIQMDTKNILFICGGAFVGLEKCISDR  387


 Score = 96.3 bits (238),  Expect(3) = 1e-118, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             +L TPKEI   LD+FVVGQE+AKKVLSVAVYNHYKRIY +S  + +G   G    E  N 
Sbjct  200   QLLTPKEISLALDKFVVGQEKAKKVLSVAVYNHYKRIYHSSLQKTSG--QGSLGTELEND  257

Query  948   ESDFVELDKSNVLLMGPTGSG  1010
             +++ VEL+KSN+LLMGPTGSG
Sbjct  258   DNETVELEKSNLLLMGPTGSG  278


 Score =   142 bits (358),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 5/106 (5%)
 Frame = +3

Query  216  TPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRP  395
             PS+ H  P      V  L L  Q+R  W+G+SD YD+++A+VNCPRCSK M V+FSNRP
Sbjct  37   VPSKPHAAPRSA---VFTLWLS-QKRHSWKGASD-YDYIRADVNCPRCSKQMPVIFSNRP  91

Query  396  LSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
            LSIT  ETG+YQA+NLCP+C+TAFYFRP KL PL G FIEIG+VKG
Sbjct  92   LSITGRETGVYQALNLCPNCKTAFYFRPLKLVPLHGTFIEIGRVKG  137



>ref|XP_007023129.1| ATP-dependent Clp protease ATP-binding subunit clpX isoform 4 
[Theobroma cacao]
 gb|EOY25751.1| ATP-dependent Clp protease ATP-binding subunit clpX isoform 4 
[Theobroma cacao]
Length=403

 Score =   249 bits (635),  Expect(3) = 4e-118, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 170/266 (64%), Gaps = 49/266 (18%)
 Frame = +3

Query  291   RCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQAVNLCPHCRTAFY  470
             R KW+G    YDH++A+VNCPRC   M VLFSNRPLSITA E G+YQA+NLCP+C+TAFY
Sbjct  33    RQKWDGV--EYDHIRADVNCPRCFNQMPVLFSNRPLSITAREPGLYQALNLCPNCKTAFY  90

Query  471   FRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKIWEKLRTYSGNNsssd  650
             FRP KL PLQG+F+E+G++ G            A   +GK  G+I    +   GN+ + +
Sbjct  91    FRPFKLVPLQGSFVELGRIMGD-----------AEGISGKEPGQIG---KLSDGNDDADE  136

Query  651   vgessstsdscsssssseteveesmegsAGEWTGLNVVKKLPTPKEICKGLDEFVVGQER  830
               +                                 + ++LPTPKEIC  LDEFV+GQ++
Sbjct  137   DKDD----------------------------VARRLERELPTPKEICGRLDEFVIGQQK  168

Query  831   AKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSG  1010
             AKKVLSVAVYNHYKRIY AS    A       + +  N  +DFVELDKSNVLL+GPTGSG
Sbjct  169   AKKVLSVAVYNHYKRIYHASQQNEAC-----ILGDDENDANDFVELDKSNVLLIGPTGSG  223

Query  1011  KTLLAKTLARLVNVPFVIADATTLTQ  1088
             KTLLAKTLAR+VNVPFVI DATTLTQ
Sbjct  224   KTLLAKTLARIVNVPFVIVDATTLTQ  249


 Score =   186 bits (472),  Expect(3) = 4e-118, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+ A+FDVEAA+HGIVYIDEVDKITKKAES NIGRDVSGEGVQQ L
Sbjct  251   GYVGEDVESILYKLLVEAEFDVEAAQHGIVYIDEVDKITKKAESSNIGRDVSGEGVQQAL  310

Query  1268  LKMLEGTVVNV--PDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LK+LEGT+VNV  PD  AR++ RGDS QIDTK+ILF+CGGAFI LEKTISER
Sbjct  311   LKLLEGTIVNVPLPDKGARRYPRGDSFQIDTKDILFVCGGAFIDLEKTISER  362


 Score = 41.6 bits (96),  Expect(3) = 4e-118, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALT  1595
             RRQDSSIGFGAPVR NM  S LT
Sbjct  362   RRQDSSIGFGAPVRANMRSSGLT  384



>gb|KCW71001.1| hypothetical protein EUGRSUZ_F04107 [Eucalyptus grandis]
Length=621

 Score =   186 bits (473),  Expect(3) = 3e-117, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQ
Sbjct  405   TQAGYVGEDVESILYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQ  464

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+  ARKH RGD+IQ+DTK+ILF+CGGAF+ LEKTISER
Sbjct  465   QALLKMLEGTIVNVPEKGARKHPRGDNIQMDTKDILFVCGGAFVDLEKTISER  517


 Score =   167 bits (422),  Expect(3) = 3e-117, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 98/118 (83%), Gaps = 8/118 (7%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G N+ K LPTPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY AS  + +G ESG 
Sbjct  296   WGGANLGKDLPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYLASQ-KGSGAESGV  354

Query  921   -KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQV  1091
              +T+D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ 
Sbjct  355   SETLDDDDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQA  407


 Score =   120 bits (302),  Expect(3) = 3e-117, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA V SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  517   RRQDSSIGFGAPVRANMRAGGVTNAAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLS  576

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNV  1799
             AL E+QLVQVL +P+NAL KQYK++F++NNV
Sbjct  577   ALTEDQLVQVLTEPRNALGKQYKKLFSMNNV  607


 Score =   107 bits (267),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 89/165 (54%), Gaps = 45/165 (27%)
 Frame = +3

Query  276  LGFQRRCKWE-GSSDNYDH--LKAEVNCPRCSKPMTVLFSNRPLSITAGE----------  416
            +G Q R KW+ G SD+  H  ++AE NCPRCSK M +LFSNR  S    +          
Sbjct  70   IGVQERYKWDHGGSDDLRHRKIRAEANCPRCSKSMDLLFSNRHFSPNLDQNFAQHNSGGG  129

Query  417  ------TGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQV------KGGVGERENNG  560
                  +G YQAVNLCP+C++A+YF P ++ PLQG+F+EIG+V        GV +R  NG
Sbjct  130  DGGKAASGGYQAVNLCPNCKSAYYFHPYRIAPLQGSFVEIGRVASTNKNNNGVEKRNKNG  189

Query  561  -----NTAAGS---ENGKAAG------------KIWEKLRTYSGN  635
                 + +AG+   E+ +  G              WE LR+YSG+
Sbjct  190  GPRNSSNSAGANSDEDNRGGGGYNDFVNNKLRFSFWETLRSYSGD  234



>ref|XP_010912710.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Elaeis guineensis]
Length=350

 Score =   215 bits (548),  Expect(3) = 3e-117, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 169/206 (82%), Gaps = 2/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSS+GFGAPVR NM    LTNAVV SSLLESVES+DL AYGLIPEF+GRFP+ VSLS
Sbjct  144   RRQDSSMGFGAPVRANMRTGGLTNAVVTSSLLESVESSDLIAYGLIPEFIGRFPVLVSLS  203

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLV+VLM+PKNA+ KQ+K++F++N+VKLHFTD AL++IAKKA+AK+TGARGLR+I
Sbjct  204   ALSEDQLVRVLMEPKNAVGKQFKKLFSMNSVKLHFTDTALRLIAKKALAKNTGARGLRAI  263

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD + G++ +D V+VDEEAVGS+D PGCGAKIL+G+ G  E       
Sbjct  264   LENILIDAMYEIPDLKTGDERIDAVVVDEEAVGSVDRPGCGAKILRGD-GALEHYLKENK  322

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
               D+    + +  G+++G+ E++SRA
Sbjct  323   IKDRTAMTDGS-GGELEGESELSSRA  347


 Score =   193 bits (490),  Expect(3) = 3e-117, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLLM A+F+V+AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  35    GYVGEDVESILYKLLMVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  94

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  95    LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  144


 Score = 65.1 bits (157),  Expect(3) = 3e-117, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  990   MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             MGPTGSGKTLLAKTLAR VNVP VIADATTLTQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPIVIADATTLTQ  33



>ref|XP_008643592.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX 
isoform X1 [Zea mays]
Length=506

 Score =   173 bits (439),  Expect(3) = 9e-117, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AADFDV AA+ GIVYIDEVDKITKKAES+N+ RDVSGEGVQQ 
Sbjct  242   AGYVGEDVESILYKLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQA  301

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGTVV+VP+  AR+H RGD+IQIDTKNILFICGGAF+ LEKTISER
Sbjct  302   LLKMLEGTVVSVPEKGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISER  352


 Score =   151 bits (382),  Expect(3) = 9e-117, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +3

Query  756   NVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDE  935
             N+ ++ PTPKEIC+GLD+FV+GQ+RAKKVLSVAVYNHYKRIY  S    +  +  ++  +
Sbjct  133   NLGRRFPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCESLINRSAADCSQS--D  190

Query  936   QGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                 ++D VEL+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQ
Sbjct  191   SCTSDTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQ  241


 Score =   147 bits (371),  Expect(3) = 9e-117, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF A VR+NM    + NA + SSLL+SVES DL AYGLIPEFVGRFPI V LS
Sbjct  352   RRHDSSIGFRAQVRSNMRSGGVINAEITSSLLKSVESGDLIAYGLIPEFVGRFPILVGLS  411

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L E+QLV+VL +PKNAL +QY ++F +N+VKLHFT+ AL++IAK+AI+K+TGARGLRSI
Sbjct  412   SLSEDQLVEVLTEPKNALGRQYTKLFEMNDVKLHFTEEALRLIAKRAISKNTGARGLRSI  471

Query  1887  LESILTEAMFE  1919
             LESILTEAM+E
Sbjct  472   LESILTEAMYE  482



>ref|XP_008783202.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Phoenix dactylifera]
Length=350

 Score =   210 bits (534),  Expect(3) = 2e-116, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 159/205 (78%), Gaps = 2/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RR DSSIGF AP+R NM   ++TNA VASSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  144   RRHDSSIGFRAPIRANMRTGSVTNAAVASSLLESVESGDLIAYGLIPEFVGRFPILVSLS  203

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLV+VL KPKNA+ KQY ++F +N+VKLHFT+ AL++IAKKA+ K+TGARGLRSI
Sbjct  204   ALNEDQLVEVLSKPKNAIGKQYIKLFQMNDVKLHFTEKALRLIAKKAMQKNTGARGLRSI  263

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAM+E+PD R G + +D V+VDEE+VGS+D+ GCGAKIL G        S    
Sbjct  264   LENILTEAMYEIPDTRTGKEKIDAVVVDEESVGSVDSHGCGAKILCGEGALEHYFSQ--Q  321

Query  2067  STDKAEKNEEALKGDMDGDCEVASR  2141
             +  +AE   E  +G+ + D E+ SR
Sbjct  322   NLKEAETTFERSEGEPEADLELPSR  346


 Score =   193 bits (490),  Expect(3) = 2e-116, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL+AADF+V AA+ GIVYIDEVDKITK+AESLNI RDVSGEGVQQ L
Sbjct  35    GYVGEDVESILYKLLVAADFNVAAAQQGIVYIDEVDKITKRAESLNISRDVSGEGVQQAL  94

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  95    LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  144


 Score = 68.2 bits (165),  Expect(3) = 2e-116, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  990   MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  33



>ref|XP_004961402.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Setaria italica]
Length=488

 Score =   174 bits (441),  Expect(3) = 2e-116, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 117/166 (70%), Gaps = 1/166 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R Q   +GFG P+   +     T    +  +       DL AYGLIPEF+GR PI VSL+
Sbjct  253   RNQHCPVGFGIPICHELRNRGWTTLQESCYIDAVEND-DLIAYGLIPEFIGRLPIIVSLT  311

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
              L E QLVQVL +PKNA+ KQYK++F +NNVKLHFT+NAL +IAKKA AK TGARGLRSI
Sbjct  312   NLSEEQLVQVLREPKNAIGKQYKKLFKMNNVKLHFTENALHLIAKKASAKETGARGLRSI  371

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQ  2024
             +E ILTEAMFE+P+AR G + +  VLVDEE+VG L   GCGAKI Q
Sbjct  372   MEDILTEAMFEIPEAREGKEKIIAVLVDEESVGPLHHRGCGAKIFQ  417


 Score =   155 bits (393),  Expect(3) = 2e-116, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  1082  DTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQ  1261
               GY GEDVES+++KLL+AADF+VEAAE GIVYIDEVDK+TKKAE     RDVSGEGVQQ
Sbjct  142   QAGYSGEDVESVIYKLLVAADFNVEAAERGIVYIDEVDKLTKKAECREDRRDVSGEGVQQ  201

Query  1262  GLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER*YH  1426
              LLK+ EGTV+NVP  R + +     +++DT+NILFICGGAF GLEK ISER  H
Sbjct  202   ALLKIFEGTVINVPRKRNQDNVPHGYVEVDTRNILFICGGAFFGLEKIISERNQH  256


 Score =   141 bits (355),  Expect(3) = 2e-116, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 8/108 (7%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQ-MAGGESGKTVDEQGN  944
             + PTPKEI +GLDEFVVGQ++AKKVLSVAV+NHYKRIY+  S + +  G+ G + D++  
Sbjct  42    RFPTPKEIRRGLDEFVVGQDKAKKVLSVAVHNHYKRIYNEPSNKCLVRGDVGTSGDDE--  99

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +EL+KSN+LL+GPTGSGKTLLAKTLAR VNVPFVIADAT +TQ
Sbjct  100   -----IELEKSNILLIGPTGSGKTLLAKTLARYVNVPFVIADATAITQ  142



>gb|KDO54247.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=575

 Score =   188 bits (477),  Expect(3) = 3e-116, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  +D++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  370   GYVGEDVESILYKLLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  429

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  430   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  479


 Score =   166 bits (420),  Expect(3) = 3e-116, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+  K PTPKEICKGLD+FV+GQERAKKVLSVAVYNHY RIY+ SS + + GES
Sbjct  254   GCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQKRSAGES  313

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  314   SSCTTD--GVDDDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQ  368


 Score =   116 bits (291),  Expect(3) = 3e-116, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSL+E+VES+DL AYGLIPEFVGRFP+ VSL 
Sbjct  479   RRQDSSIGFGAPVRANMRAGGVTDAVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLL  538

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNV  1799
             AL ENQLVQVL +PKNAL KQY++MF +N V
Sbjct  539   ALTENQLVQVLTEPKNALGKQYRKMFQMNGV  569



>ref|XP_007222159.1| hypothetical protein PRUPE_ppa007724mg [Prunus persica]
 gb|EMJ23358.1| hypothetical protein PRUPE_ppa007724mg [Prunus persica]
Length=358

 Score =   217 bits (553),  Expect(3) = 4e-116, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 159/201 (79%), Gaps = 7/201 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R QDSSIGFGAPVR NM  S LT+A+ AS+LLESVE+ DL AYGLIPEFVGRFPI VSLS
Sbjct  142   RLQDSSIGFGAPVRANMRTSELTDAISASALLESVETGDLIAYGLIPEFVGRFPILVSLS  201

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             +L+E+QLVQVL +PKNAL KQYK+MF +NNVKLHFTDNAL++IAKKA+AK+TGARGLR+I
Sbjct  202   SLNEDQLVQVLTEPKNALGKQYKKMFNMNNVKLHFTDNALRLIAKKAMAKNTGARGLRAI  261

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILT+AMFEVP+ +P  +GV  VLVDEEAVGS+D PG GAKIL G+    + L     
Sbjct  262   LENILTDAMFEVPNIKPETNGVCAVLVDEEAVGSVDAPGLGAKILSGDGALEQFLH----  317

Query  2067  STDKAEKNEEALKGDMDGDCE  2129
                + +  E   KG +DG  E
Sbjct  318   ---ETKSGEHMGKGGVDGRGE  335


 Score =   188 bits (478),  Expect(3) = 4e-116, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 100/109 (92%), Gaps = 2/109 (2%)
 Frame = +2

Query  1091  YVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLL  1270
             YVGEDVESIL++LLM ADFDVEAA+ GIVYIDEVDKITKKAESL+  RDVSGEGVQQ LL
Sbjct  36    YVGEDVESILYRLLMEADFDVEAAQKGIVYIDEVDKITKKAESLS--RDVSGEGVQQALL  93

Query  1271  KMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             KMLEGTVVN+PD  ARKH RGDSIQ+DT+NILFICGGAF+GLEK ISER
Sbjct  94    KMLEGTVVNIPDKGARKHPRGDSIQMDTRNILFICGGAFVGLEKAISER  142


 Score = 65.1 bits (157),  Expect(3) = 4e-116, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  990   MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             MGPTGSGKTLLAKTLAR+VNVPF IAD+TTLTQ
Sbjct  1     MGPTGSGKTLLAKTLARVVNVPFAIADSTTLTQ  33



>gb|KDO54246.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=581

 Score =   187 bits (476),  Expect(3) = 9e-116, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  +D++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  370   GYVGEDVESILYKLLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  429

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  430   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  479


 Score =   166 bits (420),  Expect(3) = 9e-116, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+  K PTPKEICKGLD+FV+GQERAKKVLSVAVYNHY RIY+ SS + + GES
Sbjct  254   GCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQKRSAGES  313

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  314   SSCTTD--GVDDDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQ  368


 Score =   115 bits (288),  Expect(3) = 9e-116, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSL+E+VES+DL AYGLIPEFVGRFP+ VSL 
Sbjct  479   RRQDSSIGFGAPVRANMRAGGVTDAVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLL  538

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALN  1793
             AL ENQLVQVL +PKNAL KQY++MF +N
Sbjct  539   ALTENQLVQVLTEPKNALGKQYRKMFQMN  567



>ref|XP_010267612.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Nelumbo nucifera]
Length=468

 Score =   189 bits (481),  Expect(3) = 1e-113, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  ADF+V AA+ GIVYIDEVDKITKKAESLN+ RDVSGEGVQQ L
Sbjct  267   GYVGEDVESILYKLLAVADFNVTAAQQGIVYIDEVDKITKKAESLNLSRDVSGEGVQQAL  326

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  327   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  376


 Score =   155 bits (392),  Expect(3) = 1e-113, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N     PTPKEICK LD+FV+GQERAKKVLSVAVYNHYKRIY  S  +    + 
Sbjct  151   GCWGGANFGDHFPTPKEICKRLDKFVIGQERAKKVLSVAVYNHYKRIYYESLRKWPTEDL  210

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  E+   +SD VEL+KSN+LLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ
Sbjct  211   DNG--ERDEMDSDSVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  265


 Score =   117 bits (292),  Expect(3) = 1e-113, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+R NM  S LTNA+VAS+LLE+VES+DL AYGLIPEF+GRFPI VSLS
Sbjct  376   RRQDSSIGFGAPIRANMRTSGLTNAIVASNLLENVESSDLIAYGLIPEFIGRFPILVSLS  435

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALN  1793
             AL E+QLV+VL++PKNAL KQY+++F +N
Sbjct  436   ALTEDQLVKVLIEPKNALGKQYRKLFQMN  464



>emb|CDO97670.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   240 bits (613),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  + LT+A V SSLLESVES DL AYGLIPEFVGRFPI VSLS
Sbjct  139   RRQDSSIGFGAPVRANMRQAGLTDAAVTSSLLESVESGDLIAYGLIPEFVGRFPILVSLS  198

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             ALDE+QLVQVL +PKNALCKQYKRMFA+N  KLHF DNAL+++AKKAIAK TGARGLR+I
Sbjct  199   ALDEDQLVQVLTQPKNALCKQYKRMFAMNKAKLHFEDNALRLVAKKAIAKKTGARGLRAI  258

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+ILTEAMFE+PDA  G + +D+VLVDE+AVGSLD PG GAKI+ GN GG ER S   T
Sbjct  259   LENILTEAMFEIPDAGSGRNLIDLVLVDEDAVGSLDRPGLGAKIIHGN-GGLER-SPYET  316

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
                  ++  E ++ D+DG+ EV+S A
Sbjct  317   ELRDGQEGGEMVRVDLDGELEVSSAA  342


 Score =   192 bits (489),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLLM ADF+VEAA+ GIVYIDE+DK+TKKAE+L+ GRDVSGEGVQQ 
Sbjct  29    AGYVGEDVESILYKLLMVADFNVEAAQKGIVYIDEMDKMTKKAENLSAGRDVSGEGVQQA  88

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVPDNRAR++  GDSIQIDTKNILFICGGAF+ LEKTISER
Sbjct  89    LLKMLEGTIVNVPDNRARRNPHGDSIQIDTKNILFICGGAFVDLEKTISER  139



>ref|XP_004502652.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
isoform X2 [Cicer arietinum]
Length=381

 Score =   194 bits (493),  Expect(3) = 2e-111, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL AAD++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  69    GYVGEDVESILYKLLSAADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  128

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTKNILFICGGAFI LEKTISER
Sbjct  129   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKNILFICGGAFIDLEKTISER  178


 Score =   176 bits (447),  Expect(3) = 2e-111, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 152/206 (74%), Gaps = 9/206 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR  M    +T+  +ASSLL +VES+DL AYGLIPEFVGRFPI VSLS
Sbjct  178   RRQDSSIGFGAPVRAKMKAGGVTDGAIASSLLGTVESSDLIAYGLIPEFVGRFPILVSLS  237

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL ENQL+QV  +PKNAL KQY++MF +N VKLH+T++AL+ IA+KAI+K+TGARGLR+I
Sbjct  238   ALTENQLIQVFTEPKNALGKQYRKMFQMNGVKLHYTESALRSIARKAISKNTGARGLRAI  297

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGC--GAKILQGNAGGSERLSSA  2060
             LES+L ++MFE+PD R G+D +D V+VDE++VG     GC  GAKIL G       L   
Sbjct  298   LESVLVDSMFEIPDIRTGDDVIDAVVVDEDSVGG---EGCVKGAKILHGRGA----LDRY  350

Query  2061  MTSTDKAEKNEEALKGDMDGDCEVAS  2138
             ++   K  ++ E   GD + + E+ S
Sbjct  351   LSEEKKDSESMEVSGGDQEAETELPS  376


 Score = 84.0 bits (206),  Expect(3) = 2e-111, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +3

Query  960   VELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  25    VELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  67



>ref|XP_006655521.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like, partial [Oryza brachyantha]
Length=444

 Score =   180 bits (456),  Expect(3) = 9e-111, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQ+  +GFG P   ++     TNA+  S  +ES+E++DL AYGLIPEF+GR PI V L+
Sbjct  208   RRQNCHLGFGLPASGDLRNCGWTNALGESCYVESIENDDLIAYGLIPEFIGRLPITVGLN  267

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
              L E QLVQ+LM+PKNA+ KQYK++F +NNVKLHFT+NAL++IAKKA A+ TGAR LRSI
Sbjct  268   GLTEAQLVQILMEPKNAIGKQYKKLFKMNNVKLHFTENALRLIAKKAAARQTGARELRSI  327

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQ  2024
             +E ILTEAMFE+PDAR G + +  VLVDEE+VGSL + GCGAKI +
Sbjct  328   MEDILTEAMFEIPDAREGKEKIIAVLVDEESVGSLHSRGCGAKIFR  373


 Score =   138 bits (347),  Expect(3) = 9e-111, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 10/107 (9%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             + PTPKEI +GLDEFVVGQ++AKKVL VAV+NHYKRIY+ SS +     SG+        
Sbjct  1     RFPTPKEIRRGLDEFVVGQDKAKKVLCVAVHNHYKRIYNESSNKCYVSSSGE--------  52

Query  948   ESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               D +EL+KSN+LL+GPTGSGKTLLAKTLAR  +VPFVIADAT +TQ
Sbjct  53    --DDIELEKSNILLVGPTGSGKTLLAKTLARFADVPFVIADATAITQ  97


 Score =   134 bits (338),  Expect(3) = 9e-111, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GY GEDVESI+  LL+AA+F+VEA E GIVYIDEVDK+ KK E     RDVSGEGVQ  
Sbjct  98    AGYSGEDVESIICNLLVAANFNVEATERGIVYIDEVDKLIKKVECHEDRRDVSGEGVQHA  157

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+ EGTV+NVP  R + +     ++++TKNILFICGG+F GL K +SER
Sbjct  158   LLKIFEGTVINVPRKRNQDNISDGHVEVNTKNILFICGGSFSGLGKIVSER  208



>ref|XP_008460587.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Cucumis melo]
Length=611

 Score =   195 bits (496),  Expect(3) = 9e-111, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 140/165 (85%), Gaps = 4/165 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R+ DSSIGFGAPVR +M  + LT  +V SS+LE+VES+DL  YGLIPEFVGR PI VSLS
Sbjct  409   RQHDSSIGFGAPVRASMRTARLTEDLVTSSMLENVESSDLVTYGLIPEFVGRCPILVSLS  468

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             ALDE+QLVQVL KPKNAL KQYK+MF +N+V+LHFT+NAL+MIA+KA+ K+TGARGLRSI
Sbjct  469   ALDEDQLVQVLTKPKNALGKQYKKMFRMNDVELHFTENALRMIARKAMKKNTGARGLRSI  528

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKIL  2021
             LE+ILTEAMFEVP++    + +  VLVD E+VGS+D PGCGAKIL
Sbjct  529   LENILTEAMFEVPES----NSIKAVLVDGESVGSVDAPGCGAKIL  569


 Score =   159 bits (402),  Expect(3) = 9e-111, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 91/103 (88%), Gaps = 2/103 (2%)
 Frame = +2

Query  1109  ESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLLKMLEGT  1288
             E+ LF L   A+F+VEAA+ GIVYIDEVDKITKK+ES+N GRDVSGEGVQQ LLKMLEGT
Sbjct  309   EARLFDL--DAEFNVEAAQRGIVYIDEVDKITKKSESINSGRDVSGEGVQQALLKMLEGT  366

Query  1289  VVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             VV+VPD  AR+H RGD+IQ+DTKNILFICGGAF+GLEK IS+R
Sbjct  367   VVDVPDTGARRHPRGDTIQMDTKNILFICGGAFVGLEKCISDR  409


 Score = 97.8 bits (242),  Expect(3) = 9e-111, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             +L TPKEI   LD+FVVGQE+AKKVLSVAVYNHYKRIY +S  + +G   G    E  N 
Sbjct  200   QLLTPKEISLALDKFVVGQEKAKKVLSVAVYNHYKRIYHSSLQKTSG--QGSLGTELEND  257

Query  948   ESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVP  1055
             +++ VEL+KSN+LLMGPTGSG+    +    ++  P
Sbjct  258   DNETVELEKSNLLLMGPTGSGRLCRRRCGIDIIQAP  293


 Score =   142 bits (357),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 5/106 (5%)
 Frame = +3

Query  216  TPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRP  395
             PS+ H  P      V  L L  Q+R  W+G+SD YD+++A+VNCPRCSK M V+FSNRP
Sbjct  37   VPSKPHAAPRSA---VFTLWLS-QKRHSWKGASD-YDYIRADVNCPRCSKQMPVIFSNRP  91

Query  396  LSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
            LSIT  ETG+YQA+NLCP+C+TAFYFRP KL PL G FIEIG+VKG
Sbjct  92   LSITGRETGVYQALNLCPNCKTAFYFRPLKLVPLHGTFIEIGRVKG  137



>gb|EEC79584.1| hypothetical protein OsI_20758 [Oryza sativa Indica Group]
Length=495

 Score =   172 bits (437),  Expect(3) = 1e-108, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R ++  +GFG P   ++     TNA+  S  +E++ES+DL AYGLIPEF+GR PI V L+
Sbjct  259   RHRNCHMGFGLPTSGDLRNCGWTNAIGESCCVEAIESDDLIAYGLIPEFIGRLPITVGLN  318

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
              L E QLVQVLM+PKNA+ KQYK++F +N+VKLHFT+NAL++IAKKA ++ TGAR LRSI
Sbjct  319   DLSEAQLVQVLMEPKNAIGKQYKKLFKMNDVKLHFTENALRLIAKKAASRETGARELRSI  378

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQ  2024
             +E ILTEAMFE+PDAR G + +  VLVDEE+VGS+ + GCGAKI +
Sbjct  379   MEDILTEAMFEIPDAREGKEKIIAVLVDEESVGSVHSRGCGAKIFR  424


 Score =   137 bits (346),  Expect(3) = 1e-108, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGN  944
             ++ PTPKEI +GLDEFVVGQ++AKKVL VAV+NHYKRIY  SS       +   V   G+
Sbjct  44    RRFPTPKEIRRGLDEFVVGQDKAKKVLCVAVHNHYKRIYSESSNCSMKSSACGDVSMSGD  103

Query  945   FESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                D +EL+KSN+LL+GPTGSGKTLLAKTLAR  +VPFVIADAT +TQ
Sbjct  104   ---DDIELEKSNILLIGPTGSGKTLLAKTLARFADVPFVIADATAITQ  148


 Score =   135 bits (339),  Expect(3) = 1e-108, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GY GEDVESI+  LL AA F+VEA E GIVYIDEVDK+ KK E     RDVSGEGVQ  
Sbjct  149   AGYSGEDVESIICNLLAAAKFNVEATERGIVYIDEVDKLIKKVECNEDRRDVSGEGVQHA  208

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+ EGTV+NVP  R +       ++++TKNILFICGG+F GLEK +SER
Sbjct  209   LLKIFEGTVINVPRKRNQDSISDGYVEVNTKNILFICGGSFSGLEKIVSER  259



>ref|XP_010231123.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Brachypodium distachyon]
Length=486

 Score =   163 bits (412),  Expect(3) = 1e-107, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R      GFG P    +   A TNA+  SSLLE +E++DL AYGL PEF+GR PI V L+
Sbjct  250   RHHRCPFGFGTPKCRELQDYASTNALEESSLLEVIENDDLIAYGLTPEFIGRLPITVGLA  309

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
              L E+QL+QVL +PKNA+ KQYK+ F +NNVKLH T+NAL++IA+KA A+ TGARGLRSI
Sbjct  310   HLTEDQLIQVLREPKNAIGKQYKKWFKMNNVKLHLTENALRLIARKAAARETGARGLRSI  369

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQ  2024
             +ESILTEAMFE+PDA  G   V  V+VDEE+VG L   GCGAKI +
Sbjct  370   MESILTEAMFEIPDAGEGKQKVIAVVVDEESVGPLSRQGCGAKIFR  415


 Score =   143 bits (360),  Expect(3) = 1e-107, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GY GEDVESIL+KLL AAD +VEAAE GI+YIDEVDK+TKK       RD+SGEGVQQ 
Sbjct  140   AGYSGEDVESILYKLLAAADCNVEAAERGIIYIDEVDKLTKKVGCQEDWRDISGEGVQQA  199

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKM EGTV+NVP  R +       +++DTKNILFICGGAF  L K ISER
Sbjct  200   LLKMFEGTVINVPRKRNQHSVSHGYVEVDTKNILFICGGAFSDLGKIISER  250


 Score =   135 bits (340),  Expect(3) = 1e-107, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             + PTPKEI +GLD+FVVGQ++AKKVL VAV+NHYKRIY+  S+      +          
Sbjct  33    RFPTPKEIRRGLDQFVVGQDKAKKVLCVAVHNHYKRIYNEPSSNKCSAVTSAADCNVSTS  92

Query  948   ESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               D +EL+KSN+LL+GPTGSGKTLLAKTLAR  NVPFVIADAT +TQ
Sbjct  93    GDDDIELEKSNILLIGPTGSGKTLLAKTLARFANVPFVIADATAITQ  139



>gb|KDO54248.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=570

 Score =   187 bits (476),  Expect(3) = 2e-107, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  +D++V AA+ GIVYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  370   GYVGEDVESILYKLLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL  429

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGTVVNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ +EKTISER
Sbjct  430   LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISER  479


 Score =   166 bits (420),  Expect(3) = 2e-107, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  738   GEWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGES  917
             G W G N+  K PTPKEICKGLD+FV+GQERAKKVLSVAVYNHY RIY+ SS + + GES
Sbjct  254   GCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQKRSAGES  313

Query  918   GKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                  +    + D VEL+KSN+LLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  314   SSCTTD--GVDDDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQ  368


 Score = 87.8 bits (216),  Expect(3) = 2e-107, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 68/91 (75%), Gaps = 5/91 (5%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T+AVV SSL+E+VES+DL AYGLIPEFVGRFP+ VSL 
Sbjct  479   RRQDSSIGFGAPVRANMRAGGVTDAVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLL  538

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNV  1799
             AL ENQLVQ    P+      YK   +L+N+
Sbjct  539   ALTENQLVQKCHFPRF-----YKLPMSLSNL  564



>ref|XP_010677235.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Beta vulgaris subsp. vulgaris]
Length=546

 Score =   175 bits (443),  Expect(3) = 2e-107, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL AAD++V+AA+ GIVYIDE+DKITKKAE+ N+ RDVSGEGVQQ 
Sbjct  344   AGYVGEDVESILYKLLTAADYNVQAAQQGIVYIDEIDKITKKAENFNVSRDVSGEGVQQA  403

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+LEG++VNVP+   RK  RG+ +QIDTK+ILFICGGAF+ L+KTISER
Sbjct  404   LLKILEGSIVNVPEKGGRKPPRGEHVQIDTKDILFICGGAFVDLDKTISER  454


 Score =   150 bits (379),  Expect(3) = 2e-107, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G  + K LPTPKEICKGLD+FV+GQ  AKKVLSVAV+NHYKRI  AS   + G E+  
Sbjct  235   WGGAQLGKDLPTPKEICKGLDKFVIGQHHAKKVLSVAVHNHYKRIQHAS---LKGSEAQF  291

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
                E    E+D VEL+KSNV+LMGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQ
Sbjct  292   HAPEA---ENDDVELEKSNVILMGPTGSGKTLLAKTLARFVNVPFVVADATTLTQ  343


 Score =   115 bits (289),  Expect(3) = 2e-107, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  1509  DYYFCPRRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFP  1688
             D     RRQD+SIGFGAPVR N+  + + +AVV S+LLE+VES+DL AYGLIPEF+GRFP
Sbjct  448   DKTISERRQDASIGFGAPVRENLRSAGVASAVVTSALLETVESSDLIAYGLIPEFIGRFP  507

Query  1689  IFVSLSALDENQLVQVLMKPKNALCKQYKRMFALNNVKL  1805
             I VSLS+L E+QLVQVL +PKNAL KQYK++F++NN +L
Sbjct  508   ILVSLSSLTEDQLVQVLTEPKNALGKQYKKLFSMNNKRL  546


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +3

Query  207  FFSTPSRQHLPPPPTTIRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFS  386
             FS  +R+ +  PP+           Q R KW G   N   +KAEVNCPRCS+ + VLFS
Sbjct  19   LFSGDTRREIQAPPSLF--FRFPATNQERFKWGGDFPNRRRIKAEVNCPRCSRIIDVLFS  76

Query  387  -NRPLSITAGETGIY-QAVNLCPHCRTAFYFRPSKLEPLQGNFIEIG  521
             NRP +      G   +AV++CP+C++ F+F+PSK+ PL+G+F+EIG
Sbjct  77   SNRPSNGNGNGNGNECEAVSVCPNCKSEFHFQPSKMAPLEGSFLEIG  123



>gb|KHN27868.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Glycine 
soja]
Length=635

 Score =   222 bits (565),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 162/206 (79%), Gaps = 3/206 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +T++ V SSLLESVES DL AYGLIPEF+GRFPI VSLS
Sbjct  430   RRQDSSIGFGAPVRANMRAVGITDSAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLS  489

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL  VL +PKNAL KQYK++F++NNVKLHFT+NAL++IAKKA+AK+TGARGLR++
Sbjct  490   ALTEDQLTMVLTEPKNALGKQYKKLFSMNNVKLHFTENALRLIAKKAMAKNTGARGLRAL  549

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LESILTEAMFE+PD + G+D VD V++DEE+VGSL  PGCG KIL G+    + L+    
Sbjct  550   LESILTEAMFEIPDIKTGSDRVDAVVIDEESVGSLTAPGCGGKILHGDGALKQYLAKMKD  609

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             S    +  E  L+   +GD E++SRA
Sbjct  610   SAVNVDVGESDLQ---EGDLELSSRA  632


 Score =   194 bits (492),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +2

Query  1049  CSFCHCRCNNVDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNI  1228
              +    + + +  GYVGEDVESIL+KLL+AADF+V AA+ GI+YIDEVDKITKKAESLNI
Sbjct  308   TTLTQAKDSTLQAGYVGEDVESILYKLLVAADFNVAAAQQGIIYIDEVDKITKKAESLNI  367

Query  1229  GRDVSGEGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTI  1408
              RDVSGEGVQQ LLKMLEGT+VNVP+  ARK+ RGD+IQ+DTKNILFICGGAFI LEKTI
Sbjct  368   SRDVSGEGVQQALLKMLEGTIVNVPEKGARKNPRGDNIQMDTKNILFICGGAFIDLEKTI  427

Query  1409  SER  1417
             SER
Sbjct  428   SER  430


 Score =   159 bits (403),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 7/117 (6%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG-  920
             W G N+ K  P+PKEICKGLD+FV+GQ+RAKKVLSVAVYNHYK IY A+  + +  +SG 
Sbjct  201   WGGSNLGKDFPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKGIYHATLQKGSAADSGA  260

Query  921   -KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              + +D+  N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  261   SEVLDDDDN-----VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  312


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 8/61 (13%)
 Frame = +3

Query  369  MTVLFSNRPLSITAGETGI--------YQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQ  524
            M ++FSNR       E+ +        YQ+VNLCP C+TA+YFRP    PLQG F+EIG+
Sbjct  1    MNLVFSNRHFPTPQIESELGGGEREKGYQSVNLCPSCKTAYYFRPYDTTPLQGTFVEIGR  60

Query  525  V  527
            V
Sbjct  61   V  61



>ref|XP_009781368.1| PREDICTED: uncharacterized protein LOC104230301 isoform X2 [Nicotiana 
sylvestris]
Length=620

 Score =   186 bits (471),  Expect(3) = 3e-106, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  1079  VDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQ  1258
                GYVGEDVESIL+KLL  A+F+V+AA+ G++YIDEVDKITKKAESLN+ RDVSGEGVQ
Sbjct  375   TQAGYVGEDVESILYKLLTVAEFNVQAAQQGMIYIDEVDKITKKAESLNVSRDVSGEGVQ  434

Query  1259  QGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             Q LLKMLEGT+VNVP+   RKH RGD+IQIDTK+ILFICGGAFI LEKTISER
Sbjct  435   QALLKMLEGTIVNVPEKGQRKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  487


 Score =   165 bits (417),  Expect(3) = 3e-106, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 93/116 (80%), Gaps = 6/116 (5%)
 Frame = +3

Query  744   WTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGK  923
             W G N+ K LPTPKEICKGLD+FV+GQERAKKVLSV VYNHYKRIY AS  + +G ES +
Sbjct  268   WGGSNLGKNLPTPKEICKGLDKFVIGQERAKKVLSVGVYNHYKRIYHASLQKGSGAESAR  327

Query  924   TVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQV  1091
                E+       VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ 
Sbjct  328   DDSEEN------VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQA  377


 Score = 86.7 bits (213),  Expect(3) = 3e-106, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 64/87 (74%), Gaps = 4/87 (5%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +TNA V SSLLESVES+D  +YGLIPEF+GRFPI V+LS
Sbjct  487   RRQDSSIGFGAPVRANMRTGGVTNATVTSSLLESVESSDFISYGLIPEFIGRFPILVNLS  546

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFA  1787
             AL E+QLVQVL       C  +   FA
Sbjct  547   ALTEDQLVQVLF----IFCFAFSFYFA  569


 Score =   112 bits (280),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 84/154 (55%), Gaps = 39/154 (25%)
 Frame = +3

Query  276  LGFQRRCKWE--GSSDNYD----HLKAEVNCPRCSKPMTVLFSNRP--------------  395
            +G Q R KW+  GSSD Y      ++AE  CPRCSK M +LF+NR               
Sbjct  64   IGVQERYKWDRGGSSDEYRTSTRRIRAEAYCPRCSKHMDLLFTNRNHHLIPPPTNDEDKT  123

Query  396  --------------LSITAGETGIYQAVNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKG  533
                          L   AG  G YQAVNLCP+C+TA+YFRP+K+ PLQG+F EIG+VKG
Sbjct  124  NNSNENSAAGAASNLKNEAGAGGPYQAVNLCPNCKTAYYFRPNKMAPLQGSFFEIGRVKG  183

Query  534  -GVGERENNGNTAAGSENGKAAGKIWEKLRTYSG  632
             G G+R NN +     EN +     WE L++Y G
Sbjct  184  NGNGKRMNNSD----EENKRLRPSFWESLKSYGG  213



>ref|XP_010099789.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Morus notabilis]
 gb|EXB80407.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Morus notabilis]
Length=379

 Score =   215 bits (547),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 163/206 (79%), Gaps = 8/206 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  + +T+A+V SSLLESVES DL AYG+IPEFVGR PI V LS
Sbjct  179   RRQDSSIGFGAPVRMNMQSNRVTDALVTSSLLESVESGDLIAYGMIPEFVGRLPILVCLS  238

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQYK+MF+LNNVKLH T+NAL++IAKKA+AK+TGARGLRSI
Sbjct  239   ALNEDQLVQVLTQPKNALGKQYKKMFSLNNVKLHVTENALRLIAKKAMAKNTGARGLRSI  298

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE++L EAMFEVPD++ G D +D VLVDEEAVGS+D  GCGAK+L+G+ G  E+    M 
Sbjct  299   LENVLMEAMFEVPDSKKGIDIIDAVLVDEEAVGSVDYSGCGAKLLRGH-GAFEQFLHEME  357

Query  2067  STDKAEKNEEALKGDMDGDCEVASRA  2144
             +     ++E+       G  E+ SRA
Sbjct  358   TEKPMVEHEQ-------GKSEIQSRA  376


 Score =   197 bits (502),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 108/130 (83%), Gaps = 9/130 (7%)
 Frame = +2

Query  1028  DTSSSRKCSFCHCRCNNVDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITK  1207
             D+ + R+C            GYVGEDVESIL+KLL+ ADF+VEAA+ GIVYIDEVDKITK
Sbjct  59    DSDTWRRCLIA---------GYVGEDVESILYKLLVEADFNVEAAQRGIVYIDEVDKITK  109

Query  1208  KAESLNIGRDVSGEGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAF  1387
             K ES+NIGRDVSGEGVQQ LLKMLEGTVVNVPD  ARKH RGD+IQIDTKNILFICGGAF
Sbjct  110   KGESINIGRDVSGEGVQQALLKMLEGTVVNVPDKGARKHPRGDTIQIDTKNILFICGGAF  169

Query  1388  IGLEKTISER  1417
             I LEKTISER
Sbjct  170   INLEKTISER  179



>ref|XP_008676716.1| PREDICTED: uncharacterized protein LOC100272327 isoform X1 [Zea 
mays]
 gb|AFW62659.1| hypothetical protein ZEAMMB73_067276 [Zea mays]
 gb|AFW62660.1| hypothetical protein ZEAMMB73_067276 [Zea mays]
 gb|AFW62661.1| hypothetical protein ZEAMMB73_067276 [Zea mays]
 gb|AFW62662.1| hypothetical protein ZEAMMB73_067276 [Zea mays]
Length=346

 Score =   219 bits (557),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 163/204 (80%), Gaps = 7/204 (3%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  144   RRQDSSIGFGAPVRANMRAGGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLA  203

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL++PKNAL KQ+K++F++NNVKLHFTD AL++IAKKA++K+TGARGLR+I
Sbjct  204   ALNEDQLVQVLIEPKNALGKQFKKLFSMNNVKLHFTDGALRIIAKKAMSKNTGARGLRTI  263

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PDA+ G   +D V+VDE+AVGS+D PGCGAKIL G+    + LS    
Sbjct  264   LENILMDSMYEIPDAKSGEKRIDAVVVDEDAVGSVDQPGCGAKILYGDGALDQYLSQIKV  323

Query  2067  STDKAEKNEEALKGDMDGDCEVAS  2138
             S D        +  +MDG+ E++S
Sbjct  324   SGD-------GVGSEMDGEAELSS  340


 Score =   191 bits (484),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 109/143 (76%), Gaps = 1/143 (1%)
 Frame = +2

Query  992   GSNWLGQDVTCKDTSSSRKCSFCHCRCNNV-DTGYVGEDVESILFKLLMAADFDVEAAEH  1168
             G    G+ +  K  +      F       +   GYVGEDVESIL+KLL  ADF+V+AA+ 
Sbjct  2     GPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADFNVQAAQQ  61

Query  1169  GIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQI  1348
             G+VYIDEVDKITKKAESLNI RDVSGEGVQQ LLKMLEGT+VNVP+  ARKH RGD+IQI
Sbjct  62    GMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQI  121

Query  1349  DTKNILFICGGAFIGLEKTISER  1417
             DTK+ILFICGGAF+ LEKTISER
Sbjct  122   DTKDILFICGGAFVDLEKTISER  144


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  990   MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  33



>ref|XP_010112073.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Morus notabilis]
 gb|EXC32492.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Morus notabilis]
Length=653

 Score =   223 bits (569),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 169/213 (79%), Gaps = 3/213 (1%)
 Frame = +3

Query  1509  DYYFCPRRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFP  1688
             D     RRQDSSIGFGAPVR NM  S +TNA + SSLLESVES+DL AYGLIPEF+GRFP
Sbjct  440   DKTISERRQDSSIGFGAPVRANMRTSGVTNAAITSSLLESVESSDLIAYGLIPEFIGRFP  499

Query  1689  IFVSLSALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGA  1868
             I VSLSAL E+QLVQVLM+PKNAL KQYK++F++NNVKLHFT+ AL+MIA KA+AK+TGA
Sbjct  500   ILVSLSALTEDQLVQVLMEPKNALGKQYKKLFSMNNVKLHFTEKALRMIANKAMAKNTGA  559

Query  1869  RGLRSILESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSER  2048
             RGLR+ILE+ILTEAM+E+PD + GN+ +D V+VDEE+V S++  GCG KIL G+ G  ER
Sbjct  560   RGLRAILETILTEAMYEIPDVKTGNERIDAVVVDEESVASVNGLGCGGKILHGD-GALER  618

Query  2049  LSSAMTSTDKAEKNEEALKGDM-DGDCEVASRA  2144
               +     D  E N E  +G++ DG+ E++SRA
Sbjct  619   YLAESKLKDSVE-NVEGTEGELQDGESELSSRA  650


 Score =   183 bits (465),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 4/139 (3%)
 Frame = +2

Query  1013  DVTCKDTSSSRKCSFCHCRCNNVDTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEV  1192
             +V     + S K          V+ GYVGEDVESIL+KLL AA+F+V+AA+ GIVYIDEV
Sbjct  308   NVLLMGPTGSGKTLLAKTLARFVNAGYVGEDVESILYKLLAAAEFNVQAAQQGIVYIDEV  367

Query  1193  DKITKKAESLNIGRDVSG----EGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKN  1360
             DKITKKAESLNI RDVSG    EGVQQ LLKMLE T+VNVP+  ARKH RGD+IQI+TK+
Sbjct  368   DKITKKAESLNISRDVSGEGVHEGVQQALLKMLEATIVNVPEKGARKHPRGDNIQINTKD  427

Query  1361  ILFICGGAFIGLEKTISER  1417
             ILFICGGAFI L+KTISER
Sbjct  428   ILFICGGAFIDLDKTISER  446


 Score =   129 bits (323),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 10/119 (8%)
 Frame = +3

Query  741   EWTGLNVVKKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESG  920
             +W G N+ K LPTPK+IC GLD+FV+GQ  AKKVLSV VYNHYKRIY AS  +       
Sbjct  239   QWGGSNLGKDLPTPKQICMGLDKFVIGQHTAKKVLSVGVYNHYKRIYQASLQK-------  291

Query  921   KTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQVML  1097
             KT  +  +     VEL+KSNVLLMGPTGSGKTLLAKTLAR VN  +V  D  ++   +L
Sbjct  292   KTGGDDDDDN---VELEKSNVLLMGPTGSGKTLLAKTLARFVNAGYVGEDVESILYKLL  347


 Score = 73.2 bits (178),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 19/97 (20%)
 Frame = +3

Query  285  QRRCKWE--GSSDNYD--------HLKAEVNCPRCS---KPMTVLFSNRPL----SITAG  413
            QRR KW+  GS D            ++AE NCPRCS     M   FS+       +    
Sbjct  34   QRRHKWDQGGSRDENQSGGRSERRKIRAEANCPRCSFNRMGMDFFFSDTKFPNLDAHDND  93

Query  414  ETGIYQ--AVNLCPHCRTAFYFRPSKLEPLQGNFIEI  518
            ++  YQ  A+NLCP+C+TA+YFRP ++ PLQG F+EI
Sbjct  94   KSHHYQGEALNLCPNCKTAYYFRPHRIAPLQGTFVEI  130



>ref|XP_006647394.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Oryza brachyantha]
Length=386

 Score =   216 bits (550),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  184   RRQDSSIGFGAPVRANMRAGGVSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLA  243

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVLM+PKNAL KQ+K++F++NNVKLHFTD AL++I+KKA++K+TGARGLR+I
Sbjct  244   ALNEDQLVQVLMEPKNALGKQFKKLFSMNNVKLHFTDAALRIISKKAMSKNTGARGLRTI  303

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PDA+ G   +D V+VDE+AVGS+D PGCGAKIL G+ G  +R  S M 
Sbjct  304   LENILMDAMYEIPDAKSGEKRIDAVVVDEDAVGSVDQPGCGAKILYGD-GAFDRYLSEMK  362

Query  2067  STDKAEKNE  2093
             +   A  +E
Sbjct  363   AAGDAAGSE  371


 Score =   191 bits (484),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 126/211 (60%), Gaps = 41/211 (19%)
 Frame = +2

Query  809   VCSWARESQK--GALCGSLQ-----SLQKNI*CLLNPNGRWRIRQNCR*TRKL*K*FC*V  967
             VC WAR SQ+  G   G         L+K+   L+ P G                     
Sbjct  7     VCDWARSSQEDLGGFDGEADDDDGVELEKSNVLLMGPTGS--------------------  46

Query  968   G*EQRVIDGSNWLGQDVTCKDTSSSRKCSFCHCRCNNV-DTGYVGEDVESILFKLLMAAD  1144
                          G+ +  K  +      F       +   GYVGEDVESIL+KLL  AD
Sbjct  47    -------------GKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLTVAD  93

Query  1145  FDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLLKMLEGTVVNVPDNRARKH  1324
             F+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ LLKMLEGT+VNVP+  ARKH
Sbjct  94    FNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKH  153

Query  1325  SRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
              RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  154   PRGDNIQIDTKDILFICGGAFVDLEKTISER  184


 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 53/70 (76%), Gaps = 6/70 (9%)
 Frame = +3

Query  879   YDASSTQMAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPF  1058
             +  SS +  GG  G+  D+ G      VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPF
Sbjct  10    WARSSQEDLGGFDGEADDDDG------VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPF  63

Query  1059  VIADATTLTQ  1088
             VIADATTLTQ
Sbjct  64    VIADATTLTQ  73



>dbj|BAJ91098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=491

 Score =   158 bits (399),  Expect(3) = 2e-103, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 116/169 (69%), Gaps = 3/169 (2%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R      GFG P+R  +   AL N   +       +  DL AYGL PEF+GR PI V L+
Sbjct  257   RLHHCPFGFGTPIRHELRDYALMNEQSSLFEEIEND--DLIAYGLTPEFIGRLPIIVGLT  314

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
              L E+QL+QV+ +PKNA+ KQYK++F +N+VKLH T+NAL++IAKKA  + TGARGLRSI
Sbjct  315   HLTEDQLIQVIREPKNAIGKQYKKLFKMNDVKLHITENALRLIAKKASVRETGARGLRSI  374

Query  1887  LESILTEAMFEVP-DARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGN  2030
             LE ILTEAMFE+P D   G + + +VLVDEE+VG+    GCGAKI + N
Sbjct  375   LEGILTEAMFEIPDDGGEGQEKIIVVLVDEESVGTPTRQGCGAKIFRDN  423


 Score =   142 bits (358),  Expect(3) = 2e-103, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GY GEDVESI++KLL+AADF+VEAAE GI+YIDEVDK+ KK       RDVSGEGVQQ 
Sbjct  147   AGYSGEDVESIVYKLLVAADFNVEAAERGIIYIDEVDKLAKKVGCQEDRRDVSGEGVQQA  206

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER*YH  1426
             LLKM EGTV++VP  R++       +++DT NILFICGGAF  L K ISER +H
Sbjct  207   LLKMFEGTVISVPRKRSQNGLSHGCVEVDTTNILFICGGAFSDLGKIISERLHH  260


 Score =   127 bits (320),  Expect(3) = 2e-103, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 80/106 (75%), Gaps = 10/106 (9%)
 Frame = +3

Query  783   KEICKGLDEFVVGQERAKKVLSVAVYNHYKRIY----DASSTQMAGGESGKTVDEQGNFE  950
             KEI +GLD++VVGQ++AKKVL VAV+NHYKRIY    + SS+Q + G    T  E     
Sbjct  47    KEIRRGLDQYVVGQDKAKKVLCVAVHNHYKRIYSEPSNKSSSQASAGRDAGTAAE-----  101

Query  951   SDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              D  EL+KSN+LL+GPTGSGKTLLAKTLAR  NVPFVIADAT +TQ
Sbjct  102   -DDTELEKSNILLLGPTGSGKTLLAKTLARFANVPFVIADATAVTQ  146



>ref|XP_010266546.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nelumbo nucifera]
Length=361

 Score =   187 bits (476),  Expect(3) = 1e-102, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 136/181 (75%), Gaps = 1/181 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPV  NM    LTNA V SSLLE+ E  DL AYGLIPEF+GRF I VSLS
Sbjct  154   RRQDSSIGFGAPVHANMKTGGLTNAFVTSSLLETAEGGDLIAYGLIPEFIGRFQILVSLS  213

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QL++VL +PKNAL KQY+++F +N VKLHFT+ AL++IA+KA+ K TGARGLRSI
Sbjct  214   ALTEDQLIEVLAEPKNALAKQYRKLFQMNGVKLHFTEKALRLIARKAMLKDTGARGLRSI  273

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL +AM+E+PD R GND +D V+VDEE + +     C AKIL G+      LS   +
Sbjct  274   LENILMDAMYEIPDTRTGNDKIDAVVVDEEVIVAAGHH-CSAKILYGDGALDHYLSQHKS  332

Query  2067  S  2069
             S
Sbjct  333   S  333


 Score =   154 bits (389),  Expect(3) = 1e-102, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  1127  LLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLLKMLEGTVVNVPD  1306
             L   ADF+V AA+ GIVYIDEVDKITKK ESLN+ RDVSGEGVQQ LLKMLE TVVNVP+
Sbjct  58    LTQVADFNVAAAQQGIVYIDEVDKITKKTESLNLSRDVSGEGVQQALLKMLEETVVNVPE  117

Query  1307  NRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
               ARKH RGD+IQIDTK+ILFICGGAFI LEKT  ER
Sbjct  118   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTTLER  154


 Score = 83.6 bits (205),  Expect(3) = 1e-102, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +3

Query  900   MAGGESGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATT  1079
             M    SG   DE    ++D VEL+KSN+LLMGPTGSGKTLLAKTL +LVNVPF+I DATT
Sbjct  1     MLNDSSGGEGDE---IDNDSVELEKSNILLMGPTGSGKTLLAKTLTQLVNVPFIIVDATT  57

Query  1080  LTQV  1091
             LTQV
Sbjct  58    LTQV  61



>gb|KDO42937.1| hypothetical protein CISIN_1g0057621mg, partial [Citrus sinensis]
 gb|KDO42938.1| hypothetical protein CISIN_1g0057621mg, partial [Citrus sinensis]
 gb|KDO42939.1| hypothetical protein CISIN_1g0057621mg, partial [Citrus sinensis]
Length=541

 Score =   190 bits (483),  Expect(3) = 1e-102, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GYVGEDVESIL+KLL  A+F+VEAA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ 
Sbjct  364   AGYVGEDVESILYKLLAQAEFNVEAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  423

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKMLEGT+VNVP+  ARKH RGDSIQ+DTK+ILFICGGAF+ LEKTISER
Sbjct  424   LLKMLEGTIVNVPEKGARKHPRGDSIQMDTKDILFICGGAFVDLEKTISER  474


 Score =   152 bits (385),  Expect(3) = 1e-102, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 90/110 (82%), Gaps = 7/110 (6%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGE--SGKTVDEQ  938
             + LPTPKEICKGLD+FV+GQE+AKKVLSVAVYNHYKRIY A+  + +G E  +   VD  
Sbjct  259   EDLPTPKEICKGLDKFVIGQEKAKKVLSVAVYNHYKRIYHANLKKGSGAEPKTAAAVDND  318

Query  939   GNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              N     VEL+KSNVLLMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  319   DN-----VELEKSNVLLMGPTGSGKTLLAKTLARHVNVPFVIADATTLTQ  363


 Score = 81.6 bits (200),  Expect(3) = 1e-102, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM  + +T+A V SSLLESVES+DL AYGLIPEFVGRFPI VSL+
Sbjct  474   RRQDSSIGFGAPVRANMR-AGVTDAAVTSSLLESVESSDLIAYGLIPEFVGRFPILVSLT  532

Query  1707  ALDENQLVQ  1733
             AL E+QLV+
Sbjct  533   ALTEDQLVK  541


 Score =   103 bits (257),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 71/125 (57%), Gaps = 6/125 (5%)
 Frame = +3

Query  276  LGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNR-----PLSITAGE-TGIYQAV  437
            +G Q R KW+   D +  ++AE NCPRCSK M +LFSN      P+   A + +G YQAV
Sbjct  57   IGIQERYKWDHGGDTFRKIRAEANCPRCSKHMDLLFSNPSNLSPPVPAPAVDGSGGYQAV  116

Query  438  NLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGKIWEKL  617
            N+CP+C++A+YFRP ++ PLQG+F+EI            N      S  G      W+ L
Sbjct  117  NICPNCKSAYYFRPHRIAPLQGSFVEISISANNHNNNNTNKRLKKLSSGGSGKLSFWDTL  176

Query  618  RTYSG  632
            R+Y G
Sbjct  177  RSYGG  181



>emb|CDP11543.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   212 bits (540),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 162/207 (78%), Gaps = 3/207 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR N+    +TNA V SSLLESVES+DL AYGLIPEFVGRFPI V+LS
Sbjct  132   RRQDSSIGFGAPVRANLRTGGITNATVTSSLLESVESSDLIAYGLIPEFVGRFPILVNLS  191

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL E+QLVQVL +PKNAL KQY+++F +NNVKLHFT+ AL +IAKKA+AK+TGARGLR+I
Sbjct  192   ALTEDQLVQVLAEPKNALGKQYQKLFNMNNVKLHFTEKALGLIAKKAMAKNTGARGLRAI  251

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE ILT+AM+E+PD R G D VD V+VDEE+VG++D  GCG KIL+G+  G+     A T
Sbjct  252   LEGILTDAMYEIPDIRGGMDRVDAVVVDEESVGTIDAAGCGGKILRGD--GALECYLAKT  309

Query  2067  STDKAEKNEEALKGDMDG-DCEVASRA  2144
                   +N  A + D+ G + EV+SRA
Sbjct  310   KLKDQVENAAASEADLQGVESEVSSRA  336


 Score =   190 bits (483),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 106/125 (85%), Gaps = 2/125 (2%)
 Frame = +2

Query  1046  KCSFCHCRCNNVD-TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESL  1222
             K  FC C  N ++  GYVGEDVESIL KLL  A+F+V+AA+ G+VYIDEVDKITKKAESL
Sbjct  9     KKVFC-CNLNVINLAGYVGEDVESILHKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESL  67

Query  1223  NIGRDVSGEGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEK  1402
             NI RDVSGEGVQQ LLKMLEGT+VNVP+  ARKH RGD IQIDTKNILFICGGAFI LEK
Sbjct  68    NISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDHIQIDTKNILFICGGAFIDLEK  127

Query  1403  TISER  1417
             TISER
Sbjct  128   TISER  132



>ref|NP_001140773.1| uncharacterized protein LOC100272848 [Zea mays]
 gb|ACF84596.1| unknown [Zea mays]
Length=346

 Score =   210 bits (534),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 163/207 (79%), Gaps = 8/207 (4%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM +   ++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  144   RRQDSSIGFGAPVRANMRVGGTSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLT  203

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL +PKNAL KQ+K++F++N+VKLHFTD AL++IA+KA++K+TGARGLR+I
Sbjct  204   ALNEDQLVQVLTEPKNALGKQFKKLFSMNDVKLHFTDGALRIIAEKAMSKNTGARGLRTI  263

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL ++M+E+PDA+ G   +D V+VDE+AVGS+D PG GAKIL G+    + LS    
Sbjct  264   LENILMDSMYEIPDAKSGEKRIDAVVVDEDAVGSVDQPGYGAKILYGDGALDQYLSHIKV  323

Query  2067  STDKAEKNEEALKGDMDGDCEVA-SRA  2144
             + D        +  +MDG+ E++ SRA
Sbjct  324   AGD-------GVASEMDGEAELSPSRA  343


 Score =   191 bits (486),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 109/143 (76%), Gaps = 1/143 (1%)
 Frame = +2

Query  992   GSNWLGQDVTCKDTSSSRKCSFCHCRCNNV-DTGYVGEDVESILFKLLMAADFDVEAAEH  1168
             G    G+ +  K  +      F       +   GYVGEDVESIL+KLL  ADF+V+AA+ 
Sbjct  2     GPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADFNVQAAQQ  61

Query  1169  GIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQI  1348
             G+VYIDEVDKITKKAESLNI RDVSGEGVQQ LLKMLEGT+VNVP+  ARKH RGD+IQI
Sbjct  62    GMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQI  121

Query  1349  DTKNILFICGGAFIGLEKTISER  1417
             DTK+ILFICGGAF+ LEKTISER
Sbjct  122   DTKDILFICGGAFVDLEKTISER  144


 Score = 68.2 bits (165),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  990   MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  33



>ref|XP_010231124.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Brachypodium distachyon]
Length=467

 Score =   163 bits (412),  Expect(3) = 1e-101, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R      GFG P    +   A TNA+  SSLLE +E++DL AYGL PEF+GR PI V L+
Sbjct  231   RHHRCPFGFGTPKCRELQDYASTNALEESSLLEVIENDDLIAYGLTPEFIGRLPITVGLA  290

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
              L E+QL+QVL +PKNA+ KQYK+ F +NNVKLH T+NAL++IA+KA A+ TGARGLRSI
Sbjct  291   HLTEDQLIQVLREPKNAIGKQYKKWFKMNNVKLHLTENALRLIARKAAARETGARGLRSI  350

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQ  2024
             +ESILTEAMFE+PDA  G   V  V+VDEE+VG L   GCGAKI +
Sbjct  351   MESILTEAMFEIPDAGEGKQKVIAVVVDEESVGPLSRQGCGAKIFR  396


 Score =   135 bits (340),  Expect(3) = 1e-101, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  768   KLPTPKEICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNF  947
             + PTPKEI +GLD+FVVGQ++AKKVL VAV+NHYKRIY+  S+      +          
Sbjct  33    RFPTPKEIRRGLDQFVVGQDKAKKVLCVAVHNHYKRIYNEPSSNKCSAVTSAADCNVSTS  92

Query  948   ESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
               D +EL+KSN+LL+GPTGSGKTLLAKTLAR  NVPFVIADAT +TQ
Sbjct  93    GDDDIELEKSNILLIGPTGSGKTLLAKTLARFANVPFVIADATAITQ  139


 Score =   123 bits (308),  Expect(3) = 1e-101, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 74/111 (67%), Gaps = 19/111 (17%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GY GEDVESIL+KLL AAD +VEAAE GI+YIDEVDK+TKK       RD+SGEGVQQ 
Sbjct  140   AGYSGEDVESILYKLLAAADCNVEAAERGIIYIDEVDKLTKKVGCQEDWRDISGEGVQQA  199

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLKM EGTV                   DTKNILFICGGAF  L K ISER
Sbjct  200   LLKMFEGTV-------------------DTKNILFICGGAFSDLGKIISER  231



>ref|XP_002440133.1| hypothetical protein SORBIDRAFT_09g026620 [Sorghum bicolor]
 gb|EES18563.1| hypothetical protein SORBIDRAFT_09g026620 [Sorghum bicolor]
Length=546

 Score =   167 bits (423),  Expect(3) = 2e-101, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +3

Query  1530  RQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLSA  1709
             R    +GFG P+   +   + T A+  S  +++VE++DL AYGLIPEF+GR PI V L+ 
Sbjct  311   RHQHPVGFGIPICHELRNCSWTTALQESCSIDTVENDDLIAYGLIPEFIGRLPITVGLNN  370

Query  1710  LDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSIL  1889
             L E QLVQVL +PKNA+ KQYK++F +N+VKL+FTDNAL+MIAKKA AK TGARGLRSI+
Sbjct  371   LSEEQLVQVLREPKNAIGKQYKKLFKMNDVKLYFTDNALRMIAKKAAAKETGARGLRSIM  430

Query  1890  ESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQ  2024
             E ILTEAMFE+PDAR G + V  VLVDEE+VG L   G GAKI +
Sbjct  431   EDILTEAMFEIPDAREGKEKVIAVLVDEESVGPLHHRGYGAKIFR  475


 Score =   152 bits (383),  Expect(3) = 2e-101, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  1082  DTGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQ  1261
               GY GEDVES+++KLL+AADF+++AAEHGIVYIDEVDK+TKKA+     RDVSGEGVQQ
Sbjct  200   QAGYSGEDVESVIYKLLVAADFNIKAAEHGIVYIDEVDKLTKKADCREDRRDVSGEGVQQ  259

Query  1262  GLLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER*YH  1426
              LLK+ EGTV++VP  R++ +     ++++T+NILFICGGAF GLEK ++ER  H
Sbjct  260   ALLKIFEGTVISVPRKRSQDNMPQGYVEVNTRNILFICGGAFFGLEKIVAERHQH  314


 Score =   102 bits (253),  Expect(3) = 2e-101, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 6/88 (7%)
 Frame = +3

Query  831   AKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFES--DFVELDKSNVLLMGPTG  1004
             A +VLSVAV+NHYKRIY+ SS +     S K++   G   S  D +EL+KSN+LL+GPTG
Sbjct  117   AVQVLSVAVHNHYKRIYNESSNKC----SVKSLARGGVTASCDDDIELEKSNILLIGPTG  172

Query  1005  SGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             +GKTLLAKTLAR VNVPFVIADAT +TQ
Sbjct  173   TGKTLLAKTLARYVNVPFVIADATAITQ  200



>gb|AFW62663.1| hypothetical protein ZEAMMB73_067276 [Zea mays]
Length=324

 Score =   191 bits (485),  Expect(3) = 3e-101, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  1088  GYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGL  1267
             GYVGEDVESIL+KLL  ADF+V+AA+ G+VYIDEVDKITKKAESLNI RDVSGEGVQQ L
Sbjct  35    GYVGEDVESILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQAL  94

Query  1268  LKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LKMLEGT+VNVP+  ARKH RGD+IQIDTK+ILFICGGAF+ LEKTISER
Sbjct  95    LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISER  144


 Score =   161 bits (408),  Expect(3) = 3e-101, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAPVR NM    +++A V SSLLESVES DL AYGLIPEF+GRFPI VSL+
Sbjct  144   RRQDSSIGFGAPVRANMRAGGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLA  203

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             AL+E+QLVQVL++PKNAL KQ+K++F++NNVKLHFTD AL++IAKKA++K+TGARGLR+I
Sbjct  204   ALNEDQLVQVLIEPKNALGKQFKKLFSMNNVKLHFTDGALRIIAKKAMSKNTGARGLRTI  263

Query  1887  LESILTEAMFEV  1922
             LE+IL ++M+EV
Sbjct  264   LENILMDSMYEV  275


 Score = 68.2 bits (165),  Expect(3) = 3e-101, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  990   MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
             MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ  33



>gb|EEE64480.1| hypothetical protein OsJ_19330 [Oryza sativa Japonica Group]
Length=504

 Score =   172 bits (436),  Expect(3) = 5e-101, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             R ++  +GFG P   ++     TNA+  S  +E++ES+DL AYGLIPEF+GR PI V L+
Sbjct  268   RHRNCHMGFGLPTSGDLRNCGWTNAIGESCCVEAIESDDLIAYGLIPEFIGRLPITVGLN  327

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
              L E QLVQVLM+PKNA+ KQYK++F +N+VKLHFT+NAL++IAKKA ++ TGAR LRSI
Sbjct  328   DLSEAQLVQVLMEPKNAIGKQYKKLFKMNDVKLHFTENALRLIAKKAASRETGARELRSI  387

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQ  2024
             +E ILTEAMFE+PDAR G + +  VLVDEE+VGS+ + GCGAKI +
Sbjct  388   MEDILTEAMFEIPDAREGKEKIIAVLVDEESVGSVHSRGCGAKIFR  433


 Score =   135 bits (339),  Expect(3) = 5e-101, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +2

Query  1085  TGYVGEDVESILFKLLMAADFDVEAAEHGIVYIDEVDKITKKAESLNIGRDVSGEGVQQG  1264
              GY GEDVESI+  LL AA F+VEA E GIVYIDEVDK+ KK E     RDVSGEGVQ  
Sbjct  158   AGYSGEDVESIICNLLAAAKFNVEATERGIVYIDEVDKLIKKVECNEDRRDVSGEGVQHA  217

Query  1265  LLKMLEGTVVNVPDNRARKHSRGDSIQIDTKNILFICGGAFIGLEKTISER  1417
             LLK+ EGTV+NVP  R +       ++++TKNILFICGG+F GLEK +SER
Sbjct  218   LLKIFEGTVINVPRKRNQDSISDGYVEVNTKNILFICGGSFSGLEKIVSER  268


 Score =   112 bits (280),  Expect(3) = 5e-101, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 81/118 (69%), Gaps = 14/118 (12%)
 Frame = +3

Query  765   KKLPTPKEICKGLDEFVVGQERAKKV----------LSVAVYNHYKRIYDASSTQMAGGE  914
             ++ PTPKEI +GLDEFVVGQ++AKKV          L VAV+   + I ++S+  M    
Sbjct  44    RRFPTPKEIRRGLDEFVVGQDKAKKVNETSLLVGVVLCVAVHITPRGIQNSSNCSMKSSA  103

Query  915   SGKTVDEQGNFESDFVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ  1088
              G  V   G+   D +EL+KSN+LL+GPTGSGKTLLAKTLAR  +VPFVIADAT +TQ
Sbjct  104   CGD-VSMSGD---DDIELEKSNILLIGPTGSGKTLLAKTLARFADVPFVIADATAITQ  157



>gb|EMS53220.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Triticum 
urartu]
Length=401

 Score =   217 bits (553),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = +3

Query  1527  RRQDSSIGFGAPVRTNMSLSALTnavvassllesvesnDLTAYGLIPEFVGRFPIFVSLS  1706
             RRQDSSIGFGAP+RTNM  S +T+  V SSLLESVES DL  +GLIPEF+GR PI VSL+
Sbjct  196   RRQDSSIGFGAPIRTNMRSSGVTSPTVTSSLLESVESGDLAKFGLIPEFIGRLPILVSLA  255

Query  1707  ALDENQLVQVLMKPKNALCKQYKRMFALNNVKLHFTDNalkmiakkaiakSTGARGLRSI  1886
             ALDE+QLVQVL +PKN+L +QY++MF+LNNVKLHFTD AL+++AKKAI K+TGARGLR++
Sbjct  256   ALDEDQLVQVLTEPKNSLSRQYRKMFSLNNVKLHFTDGALRIVAKKAIVKNTGARGLRAL  315

Query  1887  LESILTEAMFEVPDARPGNDGVDMVLVDEEAVGSLDTPGCGAKILQGNAGGSERLSSAMT  2066
             LE+IL EAM+E+PD + GN+ VD V+VDEEA+GS+D PGCGAKIL+G+   ++ +     
Sbjct  316   LETILLEAMYEIPDEKAGNERVDAVVVDEEAIGSVDRPGCGAKILRGDGALAQYI--IRN  373

Query  2067  STDKAEKNEEALKGDMDGDCEVASR  2141
             +   + +  EAL G+++ D  + SR
Sbjct  374   NIPNSPETNEALAGELE-DAYMLSR  397


 Score =   179 bits (453),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 109/144 (76%), Gaps = 5/144 (3%)
 Frame = +2

Query  986   IDGSNWLGQDVTCKDTSSSRKCSFCHCRCNNVDTGYVGEDVESILFKLLMAADFDVEAAE  1165
             ID SN L         + S K          V+ GYVGEDVESIL KLL+ A+++V+AA+
Sbjct  58    IDKSNVL-----LMGPTGSGKTLLAKTLARIVNAGYVGEDVESILQKLLVEAEYNVQAAQ  112

Query  1166  HGIVYIDEVDKITKKAESLNIGRDVSGEGVQQGLLKMLEGTVVNVPDNRARKHSRGDSIQ  1345
              GIVYIDEVDKITKKAES N+ RDVSGEGVQQ LLK+LEGTVV +P+  +RK+SR DSIQ
Sbjct  113   QGIVYIDEVDKITKKAESANVSRDVSGEGVQQALLKILEGTVVTIPEKGSRKNSRNDSIQ  172

Query  1346  IDTKNILFICGGAFIGLEKTISER  1417
             IDTK+ILFICGGAF+ LEKTISER
Sbjct  173   IDTKDILFICGGAFVDLEKTISER  196


 Score =   121 bits (303),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 82/109 (75%), Gaps = 3/109 (3%)
 Frame = +3

Query  789   ICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVEL  968
             +C+ LDEFV+GQ +AKKVLSVAVYNHYKR+Y+A+  + +   SG    +  N + D VE+
Sbjct  1     MCRRLDEFVIGQGKAKKVLSVAVYNHYKRVYNATVQKGSADNSG--CPDAANDDHDNVEI  58

Query  969   DKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ-VMLERMWN  1112
             DKSNVLLMGPTGSGKTLLAKTLAR+VN  +V  D  ++ Q +++E  +N
Sbjct  59    DKSNVLLMGPTGSGKTLLAKTLARIVNAGYVGEDVESILQKLLVEAEYN  107



>emb|CDO97669.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   322 bits (825),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 200/343 (58%), Positives = 233/343 (68%), Gaps = 11/343 (3%)
 Frame = +3

Query  75    MSAIFRYNKTKLRHHFTFKITFlsftsskfpsnsssltpPLKLPFFSTPSRQHLPPPPTT  254
             MS IFRY KTKLR     KIT LS +SSKF S+       +   F     R HL P    
Sbjct  1     MSGIFRY-KTKLRS-LAPKITTLSLSSSKFQSSPRKTLSKISEYFPHPQPRPHLNP----  54

Query  255   IRVIGLGLGFQRRCKWEGSSDNYDHLKAEVNCPRCSKPMTVLFSNRPLSITAGETGIYQA  434
                +G     Q R KW GSSDNYDH+KAEVNCPRCSK M+VLFSNRPLSI+  E G+YQA
Sbjct  55    ---LGFVSHIQERHKWHGSSDNYDHIKAEVNCPRCSKLMSVLFSNRPLSISRSEPGVYQA  111

Query  435   VNLCPHCRTAFYFRPSKLEPLQGNFIEIGQVKGGVGERENNGNTAAGSENGKAAGK-IWE  611
             VNLCP+CRTAFYFRP KLEPLQG+FIE+G++KGG  + E N  +      G   GK IWE
Sbjct  112   VNLCPNCRTAFYFRPFKLEPLQGSFIELGRLKGGKVDMEGNSESGGTGGRGGENGKKIWE  171

Query  612   KLRTYSGNNsssdvgessstsdscsssssseteve-esmegsAGEWTGLNVVKKLPTPKE  788
             KLR YSG +S+S       +S+S               +    GE+ G N+ K+LPTPKE
Sbjct  172   KLRNYSGGSSASSNNVKEGSSNSGGDVEEKAVGPAWVEVGSGGGEFEGANLGKELPTPKE  231

Query  789   ICKGLDEFVVGQERAKKVLSVAVYNHYKRIYDASSTQMAGGESGKTVDEQGNFESDFVEL  968
             I +GLD+FVVGQERAKKVLSVAVYNHYKRIY AS    +G E   T  + G+F++D VEL
Sbjct  232   ISRGLDDFVVGQERAKKVLSVAVYNHYKRIYHASLHGESGAEYRSTDGKIGDFDADDVEL  291

Query  969   DKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQVML  1097
             +KSNVL+MGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQ  L
Sbjct  292   EKSNVLMMGPTGSGKTLLAKTLARVVNVPFVIADATTLTQAGL  334



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7111009506740