BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25204_g1_i4 len=2283 path=[3290:0-166 13208:167-283 3457:284-327
3501:328-365 3539:366-388 @3562@!:389-902 4076:903-1035
4209:1036-1330 16780:1331-1334 16784:1335-1358 22823:1359-2282]

Length=2283
                                                                      Score     E

ref|XP_004245024.1|  PREDICTED: RNA polymerase II degradation fac...    338   6e-104   
ref|XP_009624289.1|  PREDICTED: DNA ligase 1-like isoform X2            333   8e-102   
ref|XP_009800881.1|  PREDICTED: uncharacterized protein LOC104246...    331   8e-101   
ref|XP_009624287.1|  PREDICTED: DNA ligase 1-like isoform X1            330   2e-100   
ref|XP_009800879.1|  PREDICTED: uncharacterized protein LOC104246...    327   3e-99    
ref|XP_006364924.1|  PREDICTED: micronuclear linker histone polyp...    324   3e-98    
ref|XP_009589926.1|  PREDICTED: RNA polymerase II degradation fac...    315   4e-95    
ref|XP_009589928.1|  PREDICTED: neurofilament medium polypeptide-...    309   2e-93    
ref|XP_009589924.1|  PREDICTED: RNA polymerase II degradation fac...    310   2e-93    
ref|XP_009803431.1|  PREDICTED: histone H1-I-like isoform X2            309   1e-92    
ref|XP_010322718.1|  PREDICTED: RNA polymerase II degradation fac...    309   1e-92    
ref|XP_010322717.1|  PREDICTED: RNA polymerase II degradation fac...    309   2e-92    
ref|XP_010322719.1|  PREDICTED: RNA polymerase II degradation fac...    308   5e-92    
ref|XP_009589927.1|  PREDICTED: RNA polymerase II degradation fac...    305   1e-91    
ref|XP_004241776.1|  PREDICTED: RNA polymerase II degradation fac...    305   4e-91    
ref|XP_009803432.1|  PREDICTED: histone H1-I-like isoform X3            304   5e-91    
ref|XP_009803429.1|  PREDICTED: histone H1-I-like isoform X1            304   6e-91    
ref|XP_011070147.1|  PREDICTED: protein WVD2-like 1 isoform X3          298   1e-88    
ref|XP_011069988.1|  PREDICTED: protein WVD2-like 1 isoform X1          295   2e-87    
ref|XP_011070068.1|  PREDICTED: protein WVD2-like 1 isoform X2          294   6e-87    
emb|CDP13518.1|  unnamed protein product                                293   6e-87    
ref|XP_010322721.1|  PREDICTED: serine/arginine repetitive matrix...    287   2e-84    
ref|XP_010322720.1|  PREDICTED: serine/arginine repetitive matrix...    287   2e-84    
ref|XP_007011861.1|  TPX2 family protein, putative                      272   7e-79    
gb|KDP33592.1|  hypothetical protein JCGZ_07163                         272   8e-79    
ref|XP_002515513.1|  conserved hypothetical protein                     270   1e-78    Ricinus communis
ref|XP_007223133.1|  hypothetical protein PRUPE_ppa005440mg             262   5e-75    
emb|CBI21044.3|  unnamed protein product                                260   1e-74    
ref|XP_008219499.1|  PREDICTED: neurofilament heavy polypeptide i...    260   2e-74    
ref|XP_008219498.1|  PREDICTED: neurofilament heavy polypeptide i...    259   5e-74    
ref|XP_008219500.1|  PREDICTED: neurofilament heavy polypeptide i...    258   1e-73    
ref|XP_010648669.1|  PREDICTED: nucleolar and coiled-body phospho...    256   2e-73    
ref|XP_006353688.1|  PREDICTED: protein WVD2-like 1-like                251   3e-73    
ref|XP_009376921.1|  PREDICTED: serine/arginine repetitive matrix...    256   9e-73    
ref|XP_009376920.1|  PREDICTED: serine/arginine repetitive matrix...    255   1e-72    
ref|XP_009355746.1|  PREDICTED: titin-like isoform X2                   254   3e-72    
ref|XP_009376919.1|  PREDICTED: serine/arginine repetitive matrix...    254   3e-72    
gb|EYU20263.1|  hypothetical protein MIMGU_mgv1a007003mg                253   3e-72    
ref|XP_009355744.1|  PREDICTED: titin-like isoform X1                   253   6e-72    
gb|EYU32347.1|  hypothetical protein MIMGU_mgv1a007026mg                251   2e-71    
ref|XP_010048967.1|  PREDICTED: uncharacterized protein LOC104437670    250   5e-71    
ref|XP_011036553.1|  PREDICTED: uncharacterized protein LOC105134...    249   1e-70    
ref|XP_009376914.1|  PREDICTED: titin-like isoform X2                   249   3e-70    
ref|XP_008394082.1|  PREDICTED: neurofilament heavy polypeptide-l...    248   4e-70    
ref|XP_008352059.1|  PREDICTED: neurofilament heavy polypeptide-l...    248   5e-70    
ref|XP_008378378.1|  PREDICTED: neurofilament heavy polypeptide-l...    248   6e-70    
ref|XP_008394080.1|  PREDICTED: neurofilament heavy polypeptide-l...    248   9e-70    
ref|XP_008352057.1|  PREDICTED: neurofilament heavy polypeptide-l...    247   1e-69    
ref|XP_002309627.2|  hypothetical protein POPTR_0006s27050g             246   2e-69    Populus trichocarpa [western balsam poplar]
gb|KCW81395.1|  hypothetical protein EUGRSUZ_C02774                     244   6e-69    
gb|KHG18348.1|  Abnormal spindle-like microcephaly-associated pro...    244   9e-69    
ref|XP_006483365.1|  PREDICTED: enolase-phosphatase E1-like isofo...    244   1e-68    
ref|XP_011036554.1|  PREDICTED: uncharacterized protein LOC105134...    242   4e-68    
ref|XP_002324860.2|  hypothetical protein POPTR_0018s01730g             241   8e-68    Populus trichocarpa [western balsam poplar]
ref|XP_006450433.1|  hypothetical protein CICLE_v10008326mg             241   9e-68    
gb|KDO61734.1|  hypothetical protein CISIN_1g013648mg                   241   1e-67    
gb|ABK95344.1|  unknown                                                 239   4e-67    Populus trichocarpa [western balsam poplar]
ref|XP_011039686.1|  PREDICTED: ankyrin repeat domain-containing ...    238   1e-66    
ref|XP_010102672.1|  hypothetical protein L484_000806                   237   7e-66    
ref|XP_004291456.1|  PREDICTED: uncharacterized protein LOC101310775    236   2e-65    
emb|CAN82789.1|  hypothetical protein VITISV_030600                     233   1e-64    Vitis vinifera
ref|XP_003522613.1|  PREDICTED: neurofilament heavy polypeptide i...    233   3e-64    
ref|XP_006578145.1|  PREDICTED: neurofilament heavy polypeptide i...    233   3e-64    
ref|XP_009376913.1|  PREDICTED: titin-like isoform X1                   232   5e-64    
ref|XP_006578144.1|  PREDICTED: neurofilament heavy polypeptide i...    233   6e-64    
ref|XP_008378379.1|  PREDICTED: neurofilament heavy polypeptide-l...    231   6e-64    
ref|XP_008378377.1|  PREDICTED: neurofilament heavy polypeptide-l...    231   7e-64    
ref|XP_003526407.1|  PREDICTED: neurofilament heavy polypeptide-l...    228   9e-63    
ref|XP_010525961.1|  PREDICTED: protein WVD2-like 1 isoform X2          225   4e-62    
ref|XP_010525960.1|  PREDICTED: protein WVD2-like 1 isoform X1          224   9e-62    
ref|XP_010526215.1|  PREDICTED: peptidyl-prolyl isomerase cwc-27-...    224   1e-61    
ref|XP_010250125.1|  PREDICTED: uncharacterized protein LOC104592447    226   1e-61    
ref|XP_010696225.1|  PREDICTED: uncharacterized protein LOC104908...    225   2e-61    
ref|XP_007137018.1|  hypothetical protein PHAVU_009G093100g             225   2e-61    
ref|XP_008466404.1|  PREDICTED: probable GPI-anchored adhesin-lik...    225   4e-61    
ref|XP_010696215.1|  PREDICTED: uncharacterized protein LOC104908...    224   5e-61    
ref|XP_010437921.1|  PREDICTED: uncharacterized protein LOC104721...    222   1e-60    
ref|XP_010546566.1|  PREDICTED: protein WVD2-like 1 isoform X1          221   3e-60    
ref|XP_007161209.1|  hypothetical protein PHAVU_001G051200g             221   5e-60    
ref|XP_004501334.1|  PREDICTED: uncharacterized protein DDB_G0284...    221   8e-60    
ref|XP_010526217.1|  PREDICTED: peptidyl-prolyl isomerase cwc-27-...    219   9e-60    
ref|XP_004136350.1|  PREDICTED: uncharacterized protein LOC101207396    221   1e-59    
ref|XP_010437923.1|  PREDICTED: uncharacterized protein LOC104721...    217   6e-59    
ref|XP_004173325.1|  PREDICTED: uncharacterized protein LOC101231649    218   9e-59    
ref|XP_010546567.1|  PREDICTED: protein WVD2-like 1 isoform X2          216   2e-58    
gb|ACL52672.1|  unknown                                                 213   3e-58    Zea mays [maize]
ref|NP_001130992.1|  uncharacterized protein LOC100192097               213   4e-58    Zea mays [maize]
ref|NP_567893.1|  TPX2 (targeting protein for Xklp2) protein family     214   8e-58    Arabidopsis thaliana [mouse-ear cress]
gb|KDO80221.1|  hypothetical protein CISIN_1g012146mg                   214   8e-58    
ref|XP_002869282.1|  hypothetical protein ARALYDRAFT_491495             214   9e-58    
ref|XP_006475866.1|  PREDICTED: uncharacterized protein LOC102610...    214   1e-57    
ref|XP_006450903.1|  hypothetical protein CICLE_v10008193mg             214   1e-57    
ref|XP_010447404.1|  PREDICTED: uncharacterized protein LOC104730...    214   1e-57    
gb|KDO80219.1|  hypothetical protein CISIN_1g012146mg                   214   1e-57    
ref|XP_006450904.1|  hypothetical protein CICLE_v10008193mg             214   1e-57    
ref|XP_006450901.1|  hypothetical protein CICLE_v10008193mg             214   1e-57    
ref|XP_006283755.1|  hypothetical protein CARUB_v10004833mg             213   1e-57    
ref|XP_006475864.1|  PREDICTED: uncharacterized protein LOC102610...    214   1e-57    
ref|XP_006475865.1|  PREDICTED: uncharacterized protein LOC102610...    214   1e-57    
ref|XP_002438655.1|  hypothetical protein SORBIDRAFT_10g023700          211   2e-57    Sorghum bicolor [broomcorn]
ref|XP_006450902.1|  hypothetical protein CICLE_v10008193mg             214   2e-57    
ref|XP_010437922.1|  PREDICTED: general transcriptional corepress...    212   3e-57    
ref|XP_003545471.1|  PREDICTED: micronuclear linker histone polyp...    213   4e-57    
gb|AFK45470.1|  unknown                                                 212   4e-57    
gb|AES73638.2|  TPX2 (targeting protein for Xklp2) family protein       212   4e-57    
ref|XP_010447406.1|  PREDICTED: uncharacterized protein LOC104730...    211   8e-57    
ref|XP_006842059.1|  hypothetical protein AMTR_s00078p00037340          211   2e-56    
ref|XP_004498741.1|  PREDICTED: serine-rich adhesin for platelets...    211   2e-56    
ref|XP_010048196.1|  PREDICTED: cylicin-1-like                          210   2e-56    
ref|XP_004965929.1|  PREDICTED: neurofilament heavy polypeptide-like    208   2e-56    
ref|XP_006412486.1|  hypothetical protein EUTSA_v10025240mg             209   3e-56    
ref|XP_006412488.1|  hypothetical protein EUTSA_v10025240mg             209   3e-56    
ref|XP_003549281.1|  PREDICTED: protein gar2-like isoform X1            211   3e-56    
ref|NP_974659.1|  TPX2 (targeting protein for Xklp2) protein family     209   4e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447403.1|  PREDICTED: uncharacterized protein LOC104730...    209   4e-56    
ref|XP_006656223.1|  PREDICTED: neurofilament heavy polypeptide-like    207   5e-56    
ref|NP_001058026.1|  Os06g0606800                                       206   1e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003588767.1|  Seed specific protein Bn15D14A                     208   1e-55    
gb|AES59018.2|  TPX2 (targeting protein for Xklp2) family protein       208   1e-55    
ref|XP_006596104.1|  PREDICTED: micronuclear linker histone polyp...    208   3e-55    
ref|XP_010447405.1|  PREDICTED: uncharacterized protein LOC104730...    206   3e-55    
ref|NP_001046221.1|  Os02g0200800                                       203   3e-55    Oryza sativa Japonica Group [Japonica rice]
gb|ACG45595.1|  WDL1                                                    204   5e-55    Zea mays [maize]
dbj|BAD15848.1|  putative BRI1-KD interacting protein                   204   6e-55    Oryza sativa Japonica Group [Japonica rice]
gb|EAY84904.1|  hypothetical protein OsI_06272                          204   8e-55    Oryza sativa Indica Group [Indian rice]
ref|XP_007161211.1|  hypothetical protein PHAVU_001G051200g             206   9e-55    
ref|NP_001159176.1|  hypothetical protein                               204   1e-54    Zea mays [maize]
emb|CDY23322.1|  BnaA08g12240D                                          204   1e-54    
ref|XP_006412487.1|  hypothetical protein EUTSA_v10025240mg             205   1e-54    
ref|XP_006601154.1|  PREDICTED: protein gar2-like isoform X3            206   1e-54    
ref|XP_009108881.1|  PREDICTED: protein WVD2-like 1 isoform X2          204   2e-54    
ref|XP_006647040.1|  PREDICTED: microtubule-associated protein 1B...    203   2e-54    
emb|CBI28213.3|  unnamed protein product                                203   3e-54    
ref|NP_001168424.1|  hypothetical protein                               201   5e-54    Zea mays [maize]
ref|XP_009108879.1|  PREDICTED: protein WVD2-like 1 isoform X1          202   5e-54    
gb|AFW70700.1|  hypothetical protein ZEAMMB73_271181                    201   6e-54    
ref|XP_002282218.1|  PREDICTED: troponin T, skeletal muscle-like        203   6e-54    Vitis vinifera
ref|XP_003603388.1|  BRI1-KD interacting protein 118-like protein       199   4e-53    
gb|EMS64350.1|  hypothetical protein TRIUR3_26680                       200   4e-53    
emb|CDX72356.1|  BnaC07g43780D                                          200   6e-53    
ref|XP_003603387.1|  BRI1-KD interacting protein 118-like protein       200   7e-53    
ref|NP_001148491.1|  LOC100282106                                       198   9e-53    Zea mays [maize]
ref|XP_002451734.1|  hypothetical protein SORBIDRAFT_04g006860          197   1e-52    Sorghum bicolor [broomcorn]
emb|CDX68836.1|  BnaC01g06170D                                          198   3e-52    
emb|CDY13483.1|  BnaA03g52010D                                          197   3e-52    
ref|XP_009138078.1|  PREDICTED: uncharacterized protein LOC103862...    197   3e-52    
ref|XP_009126143.1|  PREDICTED: serine/arginine repetitive matrix...    197   3e-52    
emb|CDX75236.1|  BnaA01g04660D                                          197   8e-52    
ref|XP_002878856.1|  hypothetical protein ARALYDRAFT_481399             195   1e-51    
ref|XP_010436296.1|  PREDICTED: transcriptional regulator ATRX ho...    190   6e-51    
ref|XP_009138080.1|  PREDICTED: uncharacterized protein LOC103862...    193   1e-50    
ref|XP_003563653.1|  PREDICTED: protein WVD2-like 1                     191   2e-50    
ref|XP_009126164.1|  PREDICTED: serine/arginine repetitive matrix...    193   2e-50    
gb|AAD20707.1|  unknown protein                                         189   2e-49    Arabidopsis thaliana [mouse-ear cress]
ref|NP_180118.2|  TPX2 (targeting protein for Xklp2) family protein     187   6e-49    Arabidopsis thaliana [mouse-ear cress]
gb|EMS54637.1|  hypothetical protein TRIUR3_19981                       186   2e-48    
gb|EMT24340.1|  hypothetical protein F775_04460                         183   2e-47    
gb|EMT11734.1|  hypothetical protein F775_32274                         182   9e-46    
gb|KHG28502.1|  putative basic-leucine zipper transcription factor M    173   6e-45    
ref|XP_009392362.1|  PREDICTED: serine/arginine repetitive matrix...    175   2e-44    
ref|XP_006483366.1|  PREDICTED: enolase-phosphatase E1-like isofo...    171   2e-44    
ref|XP_010917924.1|  PREDICTED: uncharacterized protein LOC105042421    175   4e-44    
ref|XP_009412316.1|  PREDICTED: uncharacterized protein LOC103993842    173   2e-43    
gb|EPS64572.1|  hypothetical protein M569_10209                         163   7e-43    
ref|XP_009415304.1|  PREDICTED: uncharacterized protein LOC103996173    168   9e-42    
ref|XP_009415983.1|  PREDICTED: uncharacterized protein LOC103996729    167   1e-41    
ref|XP_006826420.1|  hypothetical protein AMTR_s00004p00160730          166   2e-40    
ref|XP_008790219.1|  PREDICTED: uncharacterized protein LOC103707486    161   3e-39    
ref|XP_009405789.1|  PREDICTED: neurofilament heavy polypeptide-l...    159   4e-39    
ref|XP_006662975.1|  PREDICTED: protein WAVE-DAMPENED 2-like            156   2e-38    
ref|XP_009405787.1|  PREDICTED: uncharacterized protein LOC103988...    155   2e-37    
ref|XP_006481634.1|  PREDICTED: neurofilament heavy polypeptide-l...    155   7e-37    
gb|EEC68390.1|  hypothetical protein OsI_36542                          152   2e-36    Oryza sativa Indica Group [Indian rice]
ref|NP_001068122.1|  Os11g0571900                                       152   2e-36    Oryza sativa Japonica Group [Japonica rice]
gb|EPS68122.1|  hypothetical protein M569_06652                         143   3e-36    
gb|KEH39832.1|  TPX2 (targeting protein for Xklp2) family protein       150   3e-36    
ref|XP_010263081.1|  PREDICTED: uncharacterized protein LOC104601...    152   4e-36    
ref|XP_010263082.1|  PREDICTED: uncharacterized protein LOC104601...    152   5e-36    
ref|XP_002308335.2|  hypothetical protein POPTR_0006s21470g             152   6e-36    Populus trichocarpa [western balsam poplar]
ref|XP_011047144.1|  PREDICTED: uncharacterized protein LOC105141583    152   6e-36    
ref|XP_010247903.1|  PREDICTED: uncharacterized protein LOC104590...    152   6e-36    
ref|XP_010247933.1|  PREDICTED: uncharacterized protein LOC104590...    152   6e-36    
ref|XP_010541818.1|  PREDICTED: general transcriptional corepress...    151   8e-36    
ref|NP_565829.1|  TPX2 (targeting protein for Xklp2)-like protein       150   1e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881415.1|  hypothetical protein ARALYDRAFT_482558             150   2e-35    
ref|XP_006410758.1|  hypothetical protein EUTSA_v10016634mg             150   2e-35    
ref|XP_007028041.1|  TPX2 family protein, putative isoform 2            150   2e-35    
ref|XP_006481633.1|  PREDICTED: neurofilament heavy polypeptide-l...    150   2e-35    
ref|XP_006430022.1|  hypothetical protein CICLE_v10012108mg             150   2e-35    
ref|XP_007028040.1|  TPX2 family protein, putative isoform 1            150   2e-35    
ref|XP_007028042.1|  TPX2 family protein, putative isoform 3            149   2e-35    
tpg|DAA42159.1|  TPA: hypothetical protein ZEAMMB73_567014              145   2e-35    
ref|XP_008387137.1|  PREDICTED: neurofilament heavy polypeptide-like    150   2e-35    
gb|KDP36079.1|  hypothetical protein JCGZ_08723                         150   4e-35    
ref|XP_002449726.1|  hypothetical protein SORBIDRAFT_05g022180          149   4e-35    Sorghum bicolor [broomcorn]
ref|XP_008241097.1|  PREDICTED: nucleolar and coiled-body phospho...    149   4e-35    
ref|XP_010505111.1|  PREDICTED: protein WAVE-DAMPENED 2-like            143   7e-35    
emb|CDX79632.1|  BnaC03g19680D                                          147   7e-35    
ref|XP_004979518.1|  PREDICTED: protein WVD2-like 1-like                148   9e-35    
ref|XP_009133052.1|  PREDICTED: general transcriptional corepress...    147   1e-34    
ref|XP_010106961.1|  hypothetical protein L484_016889                   148   1e-34    
ref|XP_006604667.1|  PREDICTED: micronuclear linker histone polyp...    147   1e-34    
ref|XP_006604669.1|  PREDICTED: micronuclear linker histone polyp...    147   1e-34    
ref|XP_011094204.1|  PREDICTED: uncharacterized protein LOC105173962    148   1e-34    
tpg|DAA42158.1|  TPA: lymphoid organ expressed yellow head virus ...    147   2e-34    
emb|CDX84593.1|  BnaA03g16370D                                          147   2e-34    
ref|NP_001149997.1|  LOC100283624                                       147   2e-34    Zea mays [maize]
ref|XP_006295617.1|  hypothetical protein CARUB_v10024730mg             147   2e-34    
ref|NP_001140809.1|  uncharacterized protein LOC100272884               147   3e-34    Zea mays [maize]
ref|XP_008676785.1|  PREDICTED: uncharacterized protein LOC100272...    147   3e-34    
gb|EEE65987.1|  hypothetical protein OsJ_21919                          146   4e-34    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002323363.2|  hypothetical protein POPTR_0016s06690g             146   5e-34    Populus trichocarpa [western balsam poplar]
ref|XP_010516794.1|  PREDICTED: general transcriptional corepress...    145   5e-34    
ref|XP_011042551.1|  PREDICTED: uncharacterized protein LOC105138210    146   5e-34    
ref|XP_002524093.1|  conserved hypothetical protein                     146   6e-34    Ricinus communis
emb|CDX75079.1|  BnaA05g08250D                                          145   1e-33    
ref|XP_009143624.1|  PREDICTED: neurofilament heavy polypeptide-like    144   1e-33    
gb|KHG09829.1|  30S ribosomal S8                                        144   2e-33    
ref|XP_009362663.1|  PREDICTED: uncharacterized protein LOC103952721    145   2e-33    
emb|CDX84165.1|  BnaC04g09270D                                          144   2e-33    
ref|XP_010509545.1|  PREDICTED: general transcriptional corepress...    144   2e-33    
gb|EPS60828.1|  hypothetical protein M569_13974                         137   3e-33    
ref|XP_004497628.1|  PREDICTED: biorientation of chromosomes in c...    143   5e-33    
ref|XP_004303390.1|  PREDICTED: uncharacterized protein LOC101300076    144   5e-33    
emb|CDP10567.1|  unnamed protein product                                142   9e-33    
ref|XP_010677582.1|  PREDICTED: protein WVD2-like 1                     142   1e-32    
ref|XP_006431338.1|  hypothetical protein CICLE_v10003186mg             140   1e-32    
ref|XP_011077774.1|  PREDICTED: micronuclear linker histone polyp...    141   2e-32    
ref|XP_007163000.1|  hypothetical protein PHAVU_001G197800g             140   2e-32    
gb|KDO45898.1|  hypothetical protein CISIN_1g0150552mg                  140   2e-32    
ref|XP_006838831.1|  hypothetical protein AMTR_s00002p00263250          140   2e-32    
dbj|BAK04989.1|  predicted protein                                      140   3e-32    
gb|KDO45899.1|  hypothetical protein CISIN_1g0150552mg                  140   3e-32    
ref|XP_006489531.1|  PREDICTED: uncharacterized protein LOC102620...    139   4e-32    
ref|XP_009348636.1|  PREDICTED: uncharacterized protein LOC103940268    140   4e-32    
ref|XP_006420125.1|  hypothetical protein CICLE_v10005113mg             139   4e-32    
ref|XP_002517010.1|  conserved hypothetical protein                     139   5e-32    Ricinus communis
gb|EMT19041.1|  hypothetical protein F775_30851                         140   5e-32    
ref|XP_011030549.1|  PREDICTED: uncharacterized protein LOC105129...    139   6e-32    
ref|XP_011030546.1|  PREDICTED: uncharacterized protein LOC105129...    139   7e-32    
ref|XP_006410757.1|  hypothetical protein EUTSA_v10016634mg             139   7e-32    
ref|XP_009398385.1|  PREDICTED: protein WVD2-like 1 isoform X1          138   7e-32    
ref|XP_003575947.1|  PREDICTED: E3 ubiquitin-protein ligase TRIP12      139   7e-32    
gb|EYU32521.1|  hypothetical protein MIMGU_mgv1a024698mg                136   7e-32    
gb|ABK93119.1|  unknown                                                 139   8e-32    Populus trichocarpa [western balsam poplar]
ref|XP_009398386.1|  PREDICTED: protein WVD2-like 1 isoform X2          137   8e-32    
ref|XP_011030548.1|  PREDICTED: uncharacterized protein LOC105129...    138   9e-32    
gb|AFK46777.1|  unknown                                                 138   9e-32    
ref|XP_003519103.1|  PREDICTED: uncharacterized protein DDB_G0284...    139   1e-31    
ref|XP_002314647.2|  hypothetical protein POPTR_0010s08670g             139   1e-31    Populus trichocarpa [western balsam poplar]
ref|XP_009408478.1|  PREDICTED: protein WVD2-like 1                     137   1e-31    
ref|XP_006378356.1|  hypothetical protein POPTR_0010s08670g             139   1e-31    
dbj|BAD36112.1|  BRI1-KD interacting protein 118-like                   131   1e-31    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009791345.1|  PREDICTED: rab11 family-interacting protein ...    139   1e-31    
ref|XP_009608539.1|  PREDICTED: rab11 family-interacting protein ...    138   3e-31    
ref|XP_002312576.1|  hypothetical protein POPTR_0008s16270g             137   3e-31    Populus trichocarpa [western balsam poplar]
gb|KHG06100.1|  hypothetical protein F383_32475                         137   3e-31    
ref|XP_011029866.1|  PREDICTED: uncharacterized protein LOC105129481    137   3e-31    
ref|XP_003535829.1|  PREDICTED: uncharacterized protein DDB_G0284...    137   4e-31    
gb|KDP40285.1|  hypothetical protein JCGZ_02283                         137   4e-31    
ref|XP_008806231.1|  PREDICTED: protein WVD2-like 1                     136   4e-31    
gb|KHG06101.1|  hypothetical protein F383_32475                         136   4e-31    
ref|XP_010278108.1|  PREDICTED: protein WVD2-like 1                     137   4e-31    
ref|XP_009347796.1|  PREDICTED: uncharacterized protein LOC103939433    136   6e-31    
ref|XP_007145768.1|  hypothetical protein PHAVU_007G266000g             136   8e-31    
ref|XP_009378794.1|  PREDICTED: uncharacterized protein LOC103967244    135   8e-31    
ref|XP_008360383.1|  PREDICTED: uncharacterized protein LOC103424087    135   8e-31    
ref|XP_008224418.1|  PREDICTED: uncharacterized protein LOC103324158    135   9e-31    
gb|KEH41827.1|  TPX2 (targeting protein for Xklp2) family protein       136   1e-30    
emb|CAA16958.1|  putative protein                                       135   1e-30    Arabidopsis thaliana [mouse-ear cress]
emb|CAA22560.1|  putative protein                                       135   1e-30    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389025.1|  PREDICTED: protein WVD2-like 1 isoform X2          134   1e-30    
ref|XP_009389023.1|  PREDICTED: protein WVD2-like 1 isoform X1          134   1e-30    
ref|XP_009389026.1|  PREDICTED: protein WVD2-like 1 isoform X3          134   2e-30    
ref|XP_010905445.1|  PREDICTED: protein WVD2-like 1                     135   2e-30    
ref|XP_010650007.1|  PREDICTED: protein WVD2-like 1 isoform X2          134   2e-30    
ref|XP_002284360.1|  PREDICTED: protein WVD2-like 1 isoform X1          134   2e-30    Vitis vinifera
ref|XP_009397016.1|  PREDICTED: protein WVD2-like 1                     134   2e-30    
ref|XP_004288445.1|  PREDICTED: uncharacterized protein LOC101300956    134   3e-30    
ref|XP_007034996.1|  TPX2 family protein, putative isoform 6            134   3e-30    
ref|XP_007034991.1|  TPX2 family protein, putative isoform 1            134   3e-30    
ref|XP_009412486.1|  PREDICTED: protein WVD2-like 1                     133   3e-30    
ref|XP_010274160.1|  PREDICTED: protein WVD2-like 1                     134   3e-30    
emb|CBI26373.3|  unnamed protein product                                134   3e-30    
ref|XP_010932896.1|  PREDICTED: protein WVD2-like 1                     133   5e-30    
ref|XP_004489868.1|  PREDICTED: uncharacterized protein LOC101509998    129   6e-30    
gb|AAP37969.1|  seed specific protein Bn15D14A                          130   7e-30    
ref|XP_009413924.1|  PREDICTED: protein WVD2-like 1 isoform X1          130   9e-30    
ref|XP_003590791.1|  hypothetical protein MTR_1g075310                  132   1e-29    
ref|XP_003590792.1|  hypothetical protein MTR_1g075310                  131   1e-29    
ref|XP_009413929.1|  PREDICTED: protein WVD2-like 1 isoform X2          130   1e-29    
ref|XP_010312207.1|  PREDICTED: cell wall protein RBR3                  132   1e-29    
emb|CDY10352.1|  BnaC05g29270D                                          131   1e-29    
ref|XP_006588462.1|  PREDICTED: uncharacterized protein LOC100798...    132   1e-29    
ref|XP_009145236.1|  PREDICTED: protein WVD2-like 1 isoform X2          131   1e-29    
emb|CDY10699.1|  BnaA05g16630D                                          131   1e-29    
ref|NP_001242515.1|  uncharacterized protein LOC100798109               132   1e-29    
ref|XP_004228629.1|  PREDICTED: uncharacterized protein LOC101249396    132   1e-29    
ref|XP_010466609.1|  PREDICTED: protein WVD2-like 1 isoform X2          130   2e-29    
gb|EYU18154.1|  hypothetical protein MIMGU_mgv1a006530mg                132   2e-29    
ref|XP_006588461.1|  PREDICTED: uncharacterized protein LOC100798...    132   2e-29    
ref|XP_010488352.1|  PREDICTED: protein WVD2-like 1 isoform X6          130   2e-29    
ref|XP_006348433.1|  PREDICTED: micronuclear linker histone polyp...    132   2e-29    
ref|XP_010050026.1|  PREDICTED: uncharacterized protein LOC104438...    129   2e-29    
gb|KHN07077.1|  hypothetical protein glysoja_023260                     132   2e-29    
gb|EYU38708.1|  hypothetical protein MIMGU_mgv1a007088mg                131   2e-29    
ref|XP_010488349.1|  PREDICTED: protein WVD2-like 1 isoform X3          130   2e-29    
gb|AFK35533.1|  unknown                                                 130   3e-29    
ref|XP_010050027.1|  PREDICTED: uncharacterized protein LOC104438...    128   3e-29    
ref|XP_010050025.1|  PREDICTED: uncharacterized protein LOC104438...    128   4e-29    
ref|XP_011073495.1|  PREDICTED: uncharacterized protein LOC105158433    130   5e-29    
ref|XP_010058838.1|  PREDICTED: uncharacterized protein LOC104446...    130   5e-29    
ref|XP_010058833.1|  PREDICTED: uncharacterized protein LOC104446...    130   5e-29    
ref|XP_010058844.1|  PREDICTED: uncharacterized protein LOC104446...    130   5e-29    
ref|XP_001780208.1|  predicted protein                                  123   5e-29    
ref|XP_010058819.1|  PREDICTED: uncharacterized protein LOC104446...    130   5e-29    
ref|XP_009617728.1|  PREDICTED: uncharacterized protein LOC104110016    130   5e-29    
dbj|BAJ98831.1|  predicted protein                                      129   6e-29    
ref|XP_010069153.1|  PREDICTED: uncharacterized protein LOC104456...    129   7e-29    
gb|KDO70678.1|  hypothetical protein CISIN_1g011063mg                   129   7e-29    
ref|NP_001239708.1|  uncharacterized protein LOC100797456               129   7e-29    
ref|XP_010087790.1|  hypothetical protein L484_016361                   129   9e-29    
ref|XP_004136531.1|  PREDICTED: uncharacterized protein LOC101211881    130   9e-29    
gb|KCW57408.1|  hypothetical protein EUGRSUZ_H00191                     129   1e-28    
ref|XP_004495344.1|  PREDICTED: protein WVD2-like 1-like                129   1e-28    
ref|XP_006339180.1|  PREDICTED: micronuclear linker histone polyp...    130   1e-28    
gb|KGN59238.1|  hypothetical protein Csa_3G783840                       130   1e-28    
ref|XP_006297932.1|  hypothetical protein CARUB_v10013976mg             129   1e-28    
ref|XP_004161284.1|  PREDICTED: uncharacterized LOC101211881            130   1e-28    
ref|XP_009779666.1|  PREDICTED: uncharacterized protein LOC104228...    129   1e-28    
ref|XP_008442957.1|  PREDICTED: neurofilament heavy polypeptide i...    130   1e-28    
ref|XP_008442956.1|  PREDICTED: neurofilament heavy polypeptide i...    130   1e-28    
ref|XP_004168160.1|  PREDICTED: uncharacterized LOC101216353            124   2e-28    
ref|XP_009145235.1|  PREDICTED: protein WVD2-like 1 isoform X1          128   2e-28    
ref|XP_010466611.1|  PREDICTED: protein WVD2-like 1 isoform X3          127   2e-28    
ref|XP_010488350.1|  PREDICTED: protein WVD2-like 1 isoform X4          127   2e-28    
ref|XP_010466608.1|  PREDICTED: protein WVD2-like 1 isoform X1          127   2e-28    
ref|XP_009779665.1|  PREDICTED: uncharacterized protein LOC104228...    129   2e-28    
ref|XP_010488347.1|  PREDICTED: protein WVD2-like 1 isoform X1          127   3e-28    
ref|XP_010466612.1|  PREDICTED: protein WVD2-like 1 isoform X4          127   3e-28    
ref|XP_011091146.1|  PREDICTED: uncharacterized protein LOC105171...    127   3e-28    
gb|AFK47616.1|  unknown                                                 127   3e-28    
ref|XP_011091144.1|  PREDICTED: uncharacterized protein LOC105171...    127   4e-28    
ref|XP_008777693.1|  PREDICTED: protein WVD2-like 1                     125   4e-28    
ref|XP_010512047.1|  PREDICTED: protein WVD2-like 1                     126   4e-28    
ref|XP_011091142.1|  PREDICTED: uncharacterized protein LOC105171...    127   4e-28    
ref|XP_011091145.1|  PREDICTED: uncharacterized protein LOC105171...    127   4e-28    
ref|XP_001753322.1|  predicted protein                                  120   4e-28    
gb|KEH24283.1|  targeting protein for Xklp2 protein                     127   5e-28    
ref|XP_009629654.1|  PREDICTED: uncharacterized protein LOC104119779    127   6e-28    
ref|NP_188950.1|  targeting protein for Xklp2-like protein              126   6e-28    
ref|XP_004150404.1|  PREDICTED: uncharacterized protein LOC101216353    127   6e-28    
ref|XP_006406091.1|  hypothetical protein EUTSA_v10021164mg             125   7e-28    
ref|XP_010532606.1|  PREDICTED: protein WVD2-like 1 isoform X2          126   7e-28    
gb|KGN61623.1|  hypothetical protein Csa_2G190800                       127   9e-28    
ref|XP_008392000.1|  PREDICTED: uncharacterized protein LOC103454187    127   9e-28    
ref|XP_010532605.1|  PREDICTED: protein WVD2-like 1 isoform X1          126   1e-27    
dbj|BAB02101.1|  unnamed protein product                                126   1e-27    
gb|KHN13150.1|  hypothetical protein glysoja_040430                     126   1e-27    
ref|XP_008465198.1|  PREDICTED: axoneme-associated protein mst101(2)    126   1e-27    
ref|XP_009783701.1|  PREDICTED: protein WVD2-like 1                     127   1e-27    
ref|XP_009417120.1|  PREDICTED: protein WVD2-like 1                     122   2e-27    
ref|XP_008391162.1|  PREDICTED: protein WVD2-like 1                     124   2e-27    
ref|XP_006663019.1|  PREDICTED: protein WVD2-like 1-like                125   2e-27    
ref|XP_006430026.1|  hypothetical protein CICLE_v10012108mg             125   2e-27    
gb|EYU32991.1|  hypothetical protein MIMGU_mgv1a009668mg                124   2e-27    
ref|XP_006297933.1|  hypothetical protein CARUB_v10013976mg             125   2e-27    
gb|KDO70677.1|  hypothetical protein CISIN_1g011063mg                   124   2e-27    
ref|XP_004247651.1|  PREDICTED: protein WVD2-like 1                     125   2e-27    
ref|XP_010069150.1|  PREDICTED: uncharacterized protein LOC104456...    125   2e-27    
ref|XP_007144068.1|  hypothetical protein PHAVU_007G125800g             125   3e-27    
ref|XP_002267972.2|  PREDICTED: protein WVD2-like 1                     124   5e-27    
ref|NP_001189952.1|  targeting protein for Xklp2-like protein           123   5e-27    
emb|CDO99169.1|  unnamed protein product                                124   5e-27    
ref|XP_003557299.1|  PREDICTED: protein WVD2-like 1                     123   6e-27    
ref|XP_008784649.1|  PREDICTED: protein WVD2-like 1                     123   6e-27    
ref|XP_011032377.1|  PREDICTED: protein WVD2-like 1 isoform X2          123   7e-27    
ref|XP_011032376.1|  PREDICTED: protein WVD2-like 1 isoform X1          123   7e-27    
ref|XP_006352123.1|  PREDICTED: protein WVD2-like 1-like isoform X1     124   8e-27    
ref|NP_001068194.1|  Os11g0592600                                       123   9e-27    
dbj|BAD11344.1|  BRI1-KD interacting protein 116                        121   1e-26    
emb|CBI35180.3|  unnamed protein product                                124   1e-26    
ref|NP_001051574.1|  Os03g0799100                                       122   1e-26    
ref|XP_006651911.1|  PREDICTED: protein WVD2-like 1-like                122   2e-26    
ref|XP_006382819.1|  hypothetical protein POPTR_0005s05770g             122   2e-26    
ref|XP_004955687.1|  PREDICTED: protein WVD2-like 1-like                122   2e-26    
gb|ABF99369.1|  Targeting protein for Xklp2 containing protein, e...    121   2e-26    
ref|XP_004302065.1|  PREDICTED: protein WVD2-like 1-like                122   2e-26    
ref|XP_006481635.1|  PREDICTED: neurofilament heavy polypeptide-l...    121   3e-26    
emb|CAN66334.1|  hypothetical protein VITISV_000602                     122   3e-26    
ref|XP_006430023.1|  hypothetical protein CICLE_v10012108mg             121   3e-26    
ref|XP_010932425.1|  PREDICTED: protein WVD2-like 1 isoform X1          121   3e-26    
ref|XP_010932433.1|  PREDICTED: protein WVD2-like 1 isoform X2          120   4e-26    
ref|NP_001149188.1|  seed specific protein Bn15D14A                     120   5e-26    
ref|XP_009772405.1|  PREDICTED: axoneme-associated protein mst101...    120   5e-26    
gb|EEC80940.1|  hypothetical protein OsI_23645                          120   6e-26    
ref|XP_009772404.1|  PREDICTED: axoneme-associated protein mst101...    120   7e-26    
emb|CDP06837.1|  unnamed protein product                                121   9e-26    
ref|XP_004981415.1|  PREDICTED: protein WVD2-like 1-like                120   9e-26    
gb|KDO48759.1|  hypothetical protein CISIN_1g022294mg                   119   1e-25    
ref|XP_003577402.1|  PREDICTED: protein WVD2-like 1                     120   1e-25    
ref|XP_009595859.1|  PREDICTED: axoneme-associated protein mst101...    119   1e-25    
gb|ACH87178.1|  unknown protein                                         119   1e-25    
ref|XP_006423984.1|  hypothetical protein CICLE_v10028698mg             119   2e-25    
ref|XP_006487778.1|  PREDICTED: protein WAVE-DAMPENED 2-like            119   2e-25    
ref|NP_001152149.1|  WDL1                                               119   2e-25    
gb|ACR34932.1|  unknown                                                 119   2e-25    
ref|XP_003557461.1|  PREDICTED: uncharacterized protein LOC100827305    119   2e-25    
ref|XP_004230080.1|  PREDICTED: protein WVD2-like 1                     119   3e-25    
ref|XP_011038550.1|  PREDICTED: protein WVD2-like 1                     118   3e-25    
ref|XP_006347730.1|  PREDICTED: protein WVD2-like 1-like                119   4e-25    
ref|XP_010525946.1|  PREDICTED: hepatoma-derived growth factor-re...    119   5e-25    
ref|XP_008677395.1|  PREDICTED: WDL1 isoform X1                         118   6e-25    
ref|XP_010102276.1|  hypothetical protein L484_024558                   117   1e-24    
ref|XP_002531270.1|  conserved hypothetical protein                     116   1e-24    
ref|XP_007030534.1|  TPX2 family protein, putative isoform 1            117   1e-24    
ref|XP_002319646.1|  hypothetical protein POPTR_0013s04010g             116   2e-24    
ref|XP_002466283.1|  hypothetical protein SORBIDRAFT_01g005000          116   2e-24    
ref|XP_007030535.1|  TPX2 family protein, putative isoform 2            116   2e-24    
ref|XP_002961055.1|  hypothetical protein SELMODRAFT_437498             117   2e-24    
ref|XP_002966957.1|  hypothetical protein SELMODRAFT_439827             117   2e-24    
ref|XP_009108247.1|  PREDICTED: protein WVD2-like 1 isoform X2          115   3e-24    
emb|CBI75536.1|  Targeting protein for Xklp2 domain containing pr...    115   3e-24    
gb|EMT24638.1|  hypothetical protein F775_07554                         115   3e-24    
ref|XP_007205299.1|  hypothetical protein PRUPE_ppa006738mg             115   4e-24    
gb|EMS49189.1|  hypothetical protein TRIUR3_05320                       116   4e-24    
ref|XP_010527393.1|  PREDICTED: protein WVD2-like 1 isoform X5          114   5e-24    
ref|NP_001240042.1|  uncharacterized protein LOC100810060               115   5e-24    
ref|XP_009614952.1|  PREDICTED: protein WVD2-like 1                     115   6e-24    
ref|XP_010527392.1|  PREDICTED: protein WVD2-like 1 isoform X4          114   6e-24    
gb|EYU30529.1|  hypothetical protein MIMGU_mgv1a0140052mg               111   6e-24    
ref|XP_009803173.1|  PREDICTED: protein WVD2-like 1                     115   6e-24    
ref|XP_010527391.1|  PREDICTED: protein WVD2-like 1 isoform X3          114   7e-24    
dbj|BAC83008.1|  putative seed specific protein                         114   7e-24    
ref|NP_001130050.1|  hypothetical protein                               114   7e-24    
ref|XP_008218285.1|  PREDICTED: protein WVD2-like 1                     114   8e-24    
gb|KHN14839.1|  hypothetical protein glysoja_021012                     114   8e-24    
ref|XP_008680938.1|  PREDICTED: hypothetical protein isoform X1         114   8e-24    
ref|XP_006589186.1|  PREDICTED: protein WVD2-like 1-like isoform X1     114   9e-24    
ref|XP_006589187.1|  PREDICTED: protein WVD2-like 1-like isoform X2     114   9e-24    
ref|XP_008680939.1|  PREDICTED: hypothetical protein isoform X2         114   9e-24    
gb|AFW67333.1|  hypothetical protein ZEAMMB73_335177                    114   9e-24    
ref|XP_004979598.1|  PREDICTED: protein WVD2-like 1-like                114   9e-24    
gb|KHG02276.1|  Adenine deaminase                                       114   1e-23    
gb|KCW60435.1|  hypothetical protein EUGRSUZ_H03155                     113   1e-23    
gb|KCW60433.1|  hypothetical protein EUGRSUZ_H03155                     113   1e-23    
ref|XP_010527389.1|  PREDICTED: uncharacterized protein LOC104804...    114   1e-23    
ref|XP_010527390.1|  PREDICTED: protein WVD2-like 1 isoform X2          114   1e-23    
gb|AFK40699.1|  unknown                                                 113   1e-23    
ref|XP_010024021.1|  PREDICTED: uncharacterized protein LOC104414569    113   1e-23    
gb|KCW60438.1|  hypothetical protein EUGRSUZ_H03155                     112   1e-23    
ref|XP_010672103.1|  PREDICTED: protein WVD2-like 1 isoform X1          114   1e-23    
emb|CDY63032.1|  BnaCnng41280D                                          114   1e-23    
ref|XP_004155694.1|  PREDICTED: uncharacterized protein LOC101225508    113   2e-23    
ref|XP_004142531.1|  PREDICTED: uncharacterized protein LOC101212959    113   2e-23    
ref|XP_008462704.1|  PREDICTED: protein WVD2-like 1                     113   2e-23    
ref|XP_004241023.1|  PREDICTED: uncharacterized protein LOC101253093    113   2e-23    
gb|EEC81633.1|  hypothetical protein OsI_25164                          113   2e-23    
ref|XP_006657512.1|  PREDICTED: protein WVD2-like 1-like                112   2e-23    
ref|XP_006350667.1|  PREDICTED: uncharacterized protein LOC102588...    113   2e-23    
gb|EEE66701.1|  hypothetical protein OsJ_23365                          112   2e-23    
ref|XP_007144838.1|  hypothetical protein PHAVU_007G188500g             112   2e-23    
ref|XP_011091942.1|  PREDICTED: protein WVD2-like 1 isoform X1          112   3e-23    
ref|XP_010025003.1|  PREDICTED: protein WVD2-like 1 isoform X3          112   3e-23    
ref|XP_011091943.1|  PREDICTED: protein WVD2-like 1 isoform X2          112   3e-23    
ref|XP_010025002.1|  PREDICTED: protein WVD2-like 1 isoform X2          112   3e-23    
ref|XP_009108244.1|  PREDICTED: protein WVD2-like 1 isoform X1          112   3e-23    
ref|XP_010025001.1|  PREDICTED: protein WVD2-like 1 isoform X1          112   3e-23    
gb|EYU26857.1|  hypothetical protein MIMGU_mgv1a010751mg                110   9e-23    
ref|XP_004495607.1|  PREDICTED: protein WVD2-like 1-like                110   1e-22    
ref|XP_008668042.1|  PREDICTED: seed specific protein Bn15D14A is...    110   1e-22    
ref|NP_001149912.1|  seed specific protein Bn15D14A                     110   1e-22    
ref|XP_007147185.1|  hypothetical protein PHAVU_006G102900g             110   1e-22    
ref|XP_006604850.1|  PREDICTED: protein WVD2-like 1-like isoform X5     110   1e-22    
ref|XP_006604848.1|  PREDICTED: protein WVD2-like 1-like isoform X3     110   1e-22    
gb|ACN28912.1|  unknown                                                 110   2e-22    
ref|NP_001150978.1|  LOC100284611                                       110   2e-22    
ref|XP_006577291.1|  PREDICTED: uncharacterized LOC100795305 isof...    110   2e-22    
gb|KHN43180.1|  hypothetical protein glysoja_001763                     109   2e-22    
ref|XP_010553756.1|  PREDICTED: protein WVD2-like 1                     110   2e-22    
ref|XP_010524945.1|  PREDICTED: protein WAVE-DAMPENED 2-like            108   2e-22    
ref|XP_006577289.1|  PREDICTED: uncharacterized LOC100795305 isof...    109   2e-22    
gb|KHN31471.1|  hypothetical protein glysoja_035578                     109   2e-22    
ref|XP_002459447.1|  hypothetical protein SORBIDRAFT_02g004800          109   3e-22    
ref|XP_009372166.1|  PREDICTED: protein WVD2-like 1                     109   4e-22    
ref|XP_006842677.1|  hypothetical protein AMTR_s00147p00050220          111   4e-22    
ref|XP_008370715.1|  PREDICTED: protein WVD2-like 1                     109   4e-22    
ref|XP_002882365.1|  hypothetical protein ARALYDRAFT_477724             106   1e-21    
gb|KHG04377.1|  50S ribosomal L3                                        107   2e-21    
ref|XP_008456211.1|  PREDICTED: protein WVD2-like 1                     107   2e-21    
ref|XP_006288696.1|  hypothetical protein CARUB_v10002005mg             103   2e-21    
ref|XP_001771001.1|  predicted protein                                  109   2e-21    
ref|XP_010485844.1|  PREDICTED: protein WVD2-like 1                     105   3e-21    
gb|KGN60789.1|  hypothetical protein Csa_2G010250                       107   3e-21    
ref|XP_004156475.1|  PREDICTED: uncharacterized LOC101205893            105   3e-21    
ref|XP_001769462.1|  predicted protein                                  100   4e-21    
ref|XP_006604849.1|  PREDICTED: protein WVD2-like 1-like isoform X4     105   4e-21    
ref|XP_004139247.1|  PREDICTED: uncharacterized protein LOC101205893    106   5e-21    
ref|XP_006604846.1|  PREDICTED: protein WVD2-like 1-like isoform X1     105   5e-21    
emb|CDY40665.1|  BnaC03g33810D                                          104   5e-21    



>ref|XP_004245024.1| PREDICTED: RNA polymerase II degradation factor 1 [Solanum lycopersicum]
Length=460

 Score =   338 bits (868),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 228/480 (48%), Positives = 300/480 (63%), Gaps = 48/480 (10%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM+ ++   ++ NG  C NG+    H + E +V  + D V NG F+++  E +FQ+AV +
Sbjct  1     MMEIDNNISVSVNGSSCGNGI----HQLPE-VVAAKLDDVPNGGFSVQGLERSFQSAVMV  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
             ND   + S+V EV HES   +E+N CA S+  E K S ESK+ K  KAPGK KN      
Sbjct  56    NDSETVGSTVHEVTHESTTTIENNPCASSEGHEAKESRESKNSKQSKAPGKGKNT-----  110

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
                 V+   K        S  +  +  S  R+KQ S+   KS SFN+RKT          
Sbjct  111   ----VSIGVKKTKDASTGSVVLNGSLASQQRSKQTSSLGVKSKSFNDRKTADNNLKPPVA  166

Query  885   -VKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTK  1061
              + V+H K  G+PD T+ S  A  +S +EK     LKK  P  ++   +S LSP AAD K
Sbjct  167   RINVSHAKQSGQPDATSPSPNA--DSLREKTNPISLKKAAPNNADGNAESPLSP-AADAK  223

Query  1062  SHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLR  1241
             S + G LP+Y+ SFKC+ERAEKR+EFY+KLEEKIHAKE+E+SN+QA+TKE+QEAEIKMLR
Sbjct  224   SRKVGALPTYNMSFKCDERAEKRREFYSKLEEKIHAKEVEKSNLQAKTKETQEAEIKMLR  283

Query  1242  KSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRL  1421
             KSLKFKATPMP+FYQEPPPP+VELKKIP TRAKSPKLGRRK SSP ++  +   + TSRL
Sbjct  284   KSLKFKATPMPSFYQEPPPPQVELKKIPTTRAKSPKLGRRK-SSPTKEA-DHTSMHTSRL  341

Query  1422  SLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITE--  1595
             SLD+  SQ N A+     +VKKP R+SLPKLPS+K  + S TKK SPIKTSIS+E  E  
Sbjct  342   SLDKNVSQ-NPAKGHPPENVKKPTRRSLPKLPSQKINLLSNTKKPSPIKTSISQETNEAA  400

Query  1596  ------VDSQPNIVAKVTDE----------AEDVHASETEPKENDEADMSLVQEPITVER  1727
                   V SQPN V++ T+E             V  S+++     +++ ++VQ PI VE+
Sbjct  401   SNNMSAVASQPNNVSEQTNEIVTFVQKHDATSVVETSQSKTFVEAQSETNVVQPPIAVEK  460



>ref|XP_009624289.1| PREDICTED: DNA ligase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=475

 Score =   333 bits (855),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 223/430 (52%), Positives = 290/430 (67%), Gaps = 25/430 (6%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MMD  +   ++ NGLG  NGV    H + E +V    +G+ N S + EE E +FQ+   L
Sbjct  1     MMDVVNNIAVSGNGLGFGNGV----HQLPE-VVAGIPNGMPNASSSTEELERSFQSTAVL  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
             ND   +DSSVQEV  E+M   ESN+   S+E E K S E+K+ K +KAPG+ +N K  +P
Sbjct  56    NDSETVDSSVQEVSREAMTTAESNAGVSSEEHEAKESDEAKNSKERKAPGRARNTKNPSP  115

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             K+     SK GKD  + + +S         R KQPS+   KS SF+++KT          
Sbjct  116   KNGAAKKSKDGKDASNGTLASKS-------RPKQPSSTDAKSKSFSDKKTTEYYSKPTLA  168

Query  885   -VKVNHDKHCGRPDTTTSSSVAQR-ESHkekpllkplkkgppkkSEATGQSSLSPT-AAD  1055
              + VN  K  G  +  ++S  A   E  KE   LKPLKK PP K++ + + S SPT A+D
Sbjct  169   HLNVNRAKQPGHAEVASASPSAAHSEGLKEATKLKPLKKVPPNKADGSAELSSSPTGASD  228

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K+ + G+LP+Y  +FKC+ERAEKRKEFY+KLEEKIHAKE+E+SN+QA+TKE+QEAEIKM
Sbjct  229   AKTRKVGSLPTYDINFKCDERAEKRKEFYSKLEEKIHAKEVEKSNLQAKTKETQEAEIKM  288

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTS  1415
             LRKSLKFKATPMP+FYQEP PPKVELKKIPPTRAKSPKLGRRK SSP ++G NE+ ++ S
Sbjct  289   LRKSLKFKATPMPSFYQEPAPPKVELKKIPPTRAKSPKLGRRK-SSPTKEGNNESVMRPS  347

Query  1416  RLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITE  1595
             RLSLDE  SQ++  +  S ++ KKPQRKSLPKLPSEKT + +ET+K S  K+S+SK+ TE
Sbjct  348   RLSLDENASQNDPVKGHSPLNFKKPQRKSLPKLPSEKTNLFNETRKPSIRKSSLSKKSTE  407

Query  1596  VDSQPNIVAK  1625
               S PN + K
Sbjct  408   AASLPNALPK  417



>ref|XP_009800881.1| PREDICTED: uncharacterized protein LOC104246702 isoform X2 [Nicotiana 
sylvestris]
Length=475

 Score =   331 bits (848),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 230/463 (50%), Positives = 301/463 (65%), Gaps = 25/463 (5%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MMD  +   ++ NGLG  NG     H + E +V    +G+ + S + EE E +FQ+   L
Sbjct  1     MMDVVNNIAVSGNGLGFGNGA----HQLPE-VVAGIPNGMPHASSSTEELERSFQSTAVL  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
             ND   +DSSVQEV  E+M   ESNS   S+E E K S E+K+ K +KAPG+ +N K S+P
Sbjct  56    NDSETVDSSVQEVSREAMTTAESNSGVSSEEHEAKESDEAKNSKERKAPGRARNTKNSSP  115

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             K+     SK GKD  + + +S         R KQPS+   KS SF+++KT          
Sbjct  116   KNGAAKKSKDGKDASNGTLASKS-------RPKQPSSTDAKSKSFSDKKTTEYYSKPTLA  168

Query  885   -VKVNHDKHCGRPDTTTSSSVAQR-ESHkekpllkplkkgppkkSEATGQSSLSPT-AAD  1055
              + VN  K  G  +  ++S  A   E  KE   LKPLKK PP K++ + + S SPT A+D
Sbjct  169   HLNVNRAKQPGHAEVASASPSAAHSEGLKETTKLKPLKKVPPNKADGSAELSSSPTGASD  228

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K+ + G+LP+Y  +FKC+ERAEKRKEFY+KLEEKIHAKE+E+SN+QA+TKE+QEAEIKM
Sbjct  229   AKTRKVGSLPTYDINFKCDERAEKRKEFYSKLEEKIHAKEVEKSNLQAKTKETQEAEIKM  288

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTS  1415
             LRKSLKFKATPMP+FYQEP PPKVELKKIPPTRAKSPKLGRRK SSP ++G NE+ ++ S
Sbjct  289   LRKSLKFKATPMPSFYQEPAPPKVELKKIPPTRAKSPKLGRRK-SSPTKEGNNESVMRPS  347

Query  1416  RLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITE  1595
             RLSLDE  SQ++  +  S ++ KKPQRKSLPKLPSEKT + +ET+K S  K+S+SK+ TE
Sbjct  348   RLSLDENASQNDPVKGHSPLNFKKPQRKSLPKLPSEKTNLSNETRKPSIRKSSLSKKSTE  407

Query  1596  VDSQPNIVAKVTDEAEDVHASETEPKENDEADMSLVQEPITVE  1724
               S  N + K   E      ++ E     EAD+   +   TVE
Sbjct  408   AKSLQNALPKEMGEVASQPNNQLEQITEREADVQECEVVSTVE  450



>ref|XP_009624287.1| PREDICTED: DNA ligase 1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624288.1| PREDICTED: DNA ligase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=476

 Score =   330 bits (845),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 222/431 (52%), Positives = 291/431 (68%), Gaps = 26/431 (6%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MMD  +   ++ NGLG  NGV    H + E +V    +G+ N S + EE E +FQ+   L
Sbjct  1     MMDVVNNIAVSGNGLGFGNGV----HQLPE-VVAGIPNGMPNASSSTEELERSFQSTAVL  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
             ND   +DSSVQEV  E+M   ESN+   S+E E K S E+K+ K +KAPG+ +N K  +P
Sbjct  56    NDSETVDSSVQEVSREAMTTAESNAGVSSEEHEAKESDEAKNSKERKAPGRARNTKNPSP  115

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKT--------VV  887
             K+     SK GKD  + + +S         R KQPS+   KS SF+++KT        + 
Sbjct  116   KNGAAKKSKDGKDASNGTLASKS-------RPKQPSSTDAKSKSFSDKKTTEYYSKPTLA  168

Query  888   KVNHDKHCGRPD----TTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPT-AA  1052
              +N ++   +P      + S S A  E  KE   LKPLKK PP K++ + + S SPT A+
Sbjct  169   HLNVNRAKQQPGHAEVASASPSAAHSEGLKEATKLKPLKKVPPNKADGSAELSSSPTGAS  228

Query  1053  DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIK  1232
             D K+ + G+LP+Y  +FKC+ERAEKRKEFY+KLEEKIHAKE+E+SN+QA+TKE+QEAEIK
Sbjct  229   DAKTRKVGSLPTYDINFKCDERAEKRKEFYSKLEEKIHAKEVEKSNLQAKTKETQEAEIK  288

Query  1233  MLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQT  1412
             MLRKSLKFKATPMP+FYQEP PPKVELKKIPPTRAKSPKLGRRK SSP ++G NE+ ++ 
Sbjct  289   MLRKSLKFKATPMPSFYQEPAPPKVELKKIPPTRAKSPKLGRRK-SSPTKEGNNESVMRP  347

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEIT  1592
             SRLSLDE  SQ++  +  S ++ KKPQRKSLPKLPSEKT + +ET+K S  K+S+SK+ T
Sbjct  348   SRLSLDENASQNDPVKGHSPLNFKKPQRKSLPKLPSEKTNLFNETRKPSIRKSSLSKKST  407

Query  1593  EVDSQPNIVAK  1625
             E  S PN + K
Sbjct  408   EAASLPNALPK  418



>ref|XP_009800879.1| PREDICTED: uncharacterized protein LOC104246702 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800880.1| PREDICTED: uncharacterized protein LOC104246702 isoform X1 [Nicotiana 
sylvestris]
Length=476

 Score =   327 bits (838),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 229/464 (49%), Positives = 302/464 (65%), Gaps = 26/464 (6%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MMD  +   ++ NGLG  NG     H + E +V    +G+ + S + EE E +FQ+   L
Sbjct  1     MMDVVNNIAVSGNGLGFGNGA----HQLPE-VVAGIPNGMPHASSSTEELERSFQSTAVL  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
             ND   +DSSVQEV  E+M   ESNS   S+E E K S E+K+ K +KAPG+ +N K S+P
Sbjct  56    NDSETVDSSVQEVSREAMTTAESNSGVSSEEHEAKESDEAKNSKERKAPGRARNTKNSSP  115

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKT--------VV  887
             K+     SK GKD  + + +S         R KQPS+   KS SF+++KT        + 
Sbjct  116   KNGAAKKSKDGKDASNGTLASKS-------RPKQPSSTDAKSKSFSDKKTTEYYSKPTLA  168

Query  888   KVNHDKHCGRPD----TTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPT-AA  1052
              +N ++   +P      + S S A  E  KE   LKPLKK PP K++ + + S SPT A+
Sbjct  169   HLNVNRAKQQPGHAEVASASPSAAHSEGLKETTKLKPLKKVPPNKADGSAELSSSPTGAS  228

Query  1053  DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIK  1232
             D K+ + G+LP+Y  +FKC+ERAEKRKEFY+KLEEKIHAKE+E+SN+QA+TKE+QEAEIK
Sbjct  229   DAKTRKVGSLPTYDINFKCDERAEKRKEFYSKLEEKIHAKEVEKSNLQAKTKETQEAEIK  288

Query  1233  MLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQT  1412
             MLRKSLKFKATPMP+FYQEP PPKVELKKIPPTRAKSPKLGRRK SSP ++G NE+ ++ 
Sbjct  289   MLRKSLKFKATPMPSFYQEPAPPKVELKKIPPTRAKSPKLGRRK-SSPTKEGNNESVMRP  347

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEIT  1592
             SRLSLDE  SQ++  +  S ++ KKPQRKSLPKLPSEKT + +ET+K S  K+S+SK+ T
Sbjct  348   SRLSLDENASQNDPVKGHSPLNFKKPQRKSLPKLPSEKTNLSNETRKPSIRKSSLSKKST  407

Query  1593  EVDSQPNIVAKVTDEAEDVHASETEPKENDEADMSLVQEPITVE  1724
             E  S  N + K   E      ++ E     EAD+   +   TVE
Sbjct  408   EAKSLQNALPKEMGEVASQPNNQLEQITEREADVQECEVVSTVE  451



>ref|XP_006364924.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006364925.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X2 [Solanum tuberosum]
Length=474

 Score =   324 bits (830),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 219/442 (50%), Positives = 277/442 (63%), Gaps = 35/442 (8%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM+ ++   ++ NG    NG+    H + E +V  + D V NGSF+++  E + Q+AV +
Sbjct  1     MMEVDNNISVSVNGSSFGNGI----HQLPE-VVTGKLDDVPNGSFSVQGLERSLQSAVMV  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
             ND   + S+  EV HES   +E+N CA S+  E K S ESK+ K  KAPGK KN      
Sbjct  56    NDSETVGSTAHEVAHESTTTIENNPCASSEGHEAKESRESKNSKQPKAPGKGKNTA----  111

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKT--------VV  887
               ++     K        S     +  S  R+KQ S+   KS SFN+RKT        V 
Sbjct  112   --SIGVKKTKDGKDASAGSVVSNGSLASQQRSKQASSLGVKSKSFNDRKTADNNLKPAVA  169

Query  888   KVN--HDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTK  1061
             ++N  H K  G+PD T+ S  A  +  KEK     LKK  P K++   +S LSP AAD K
Sbjct  170   RINASHAKQSGQPDATSPSPNA--DGLKEKTNPISLKKAAPNKADGNAESPLSP-AADAK  226

Query  1062  SHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLR  1241
             S + G LP+Y+ SFKCNERAEKR+EFY+KLEEKIHAKE+E+SN+QA+TKE+QEAEIKMLR
Sbjct  227   SRKVGALPTYNMSFKCNERAEKRREFYSKLEEKIHAKEVEQSNLQAKTKETQEAEIKMLR  286

Query  1242  KSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRL  1421
             KSLKFKATPMP+FYQEPPPP+VELKKIP TRAKSPKLGRRK SSP ++  N   + TSRL
Sbjct  287   KSLKFKATPMPSFYQEPPPPQVELKKIPTTRAKSPKLGRRK-SSPTKEA-NHTNMHTSRL  344

Query  1422  SLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITE--  1595
             SLD+  SQ N A+     +VKKP RKSLPKLPS+K  + S TKK S IKTS  +E  E  
Sbjct  345   SLDKSASQ-NPAKGHPPDNVKKPTRKSLPKLPSQKINLLSNTKKPSLIKTSKCQETNEAA  403

Query  1596  ------VDSQPNIVAKVTDEAE  1643
                   V SQPN   + T+E E
Sbjct  404   SNNMSAVASQPNNAPEQTNEIE  425



>ref|XP_009589926.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=438

 Score =   315 bits (806),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 234/472 (50%), Positives = 291/472 (62%), Gaps = 55/472 (12%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM+ ++   ++ENG   ENGV +   AV   +     DG+ NGS +              
Sbjct  1     MMEIDNNIVVSENGTSFENGVHEFPEAVAGKL-----DGIPNGSSS--------------  41

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
                    SS+ EV+HES   +ESN  A S+  E K SGE K+ K  KAPGK KN K S+P
Sbjct  42    -------SSIAEVVHESTTTIESNPSASSEGHETKESGELKNSKQPKAPGKAKNGKPSSP  94

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             K+A     KK KD       S  S  +   R KQ S+   KS SFN+RKT          
Sbjct  95    KNAASIRVKKSKDALAGPVVSNGSTASQP-RTKQTSSLGTKSKSFNDRKTADTNSKPIVA  153

Query  885   -VKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTK  1061
              V V+H K   +PD T+ S  A  +  KEK   KPLKK  P +++ + +S LSP AAD K
Sbjct  154   RVNVSHAKQSSQPDATSPSPNA--DGLKEKTKPKPLKKVAPTQADGSEESPLSP-AADAK  210

Query  1062  SHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLR  1241
               + G LP+Y+ SFKC+ERAEKRKEFY+KLEEKIHAKE+E++N+QA +KESQEAEIKMLR
Sbjct  211   LRKVGALPTYNMSFKCDERAEKRKEFYSKLEEKIHAKEVEKNNLQALSKESQEAEIKMLR  270

Query  1242  KSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRL  1421
             KSLKFKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGR+K SSP R+  N+  + TSRL
Sbjct  271   KSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRKK-SSPTREV-NDTAIHTSRL  328

Query  1422  SLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKE-----  1586
             SLDE  +Q N ++  S   VKKP RKSLPKLPS+K  +   TKK S IKTSISKE     
Sbjct  329   SLDENATQ-NPSKVHSPDIVKKPTRKSLPKLPSQKVNLSINTKKPS-IKTSISKETNEAA  386

Query  1587  ---ITEVDSQPNIVAKVTDEAEDVHASETEPKEN---DEADMSLVQEPITVE  1724
                ++EV SQPN V + T+E E   A ET   +     +A+  +VQ+ I VE
Sbjct  387   ANDMSEVASQPNNVLEHTNEIEATSAVETSQSKTVVEAQAETDVVQQLIAVE  438



>ref|XP_009589928.1| PREDICTED: neurofilament medium polypeptide-like isoform X4 [Nicotiana 
tomentosiformis]
Length=414

 Score =   309 bits (792),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 222/472 (47%), Positives = 273/472 (58%), Gaps = 79/472 (17%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM+ ++   ++ENG   ENGV +   AV   +     DG+ NGS +              
Sbjct  1     MMEIDNNIVVSENGTSFENGVHEFPEAVAGKL-----DGIPNGSSS--------------  41

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
                    SS+ EV+HES   +ESN  A S+  E K SGE K+ K  KAPGK KN K S+P
Sbjct  42    -------SSIAEVVHESTTTIESNPSASSEGHETKESGELKNSKQPKAPGKAKNGKPSSP  94

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             K+A     KK KD       S  S  +   R KQ S+   KS SFN+RKT          
Sbjct  95    KNAASIRVKKSKDALAGPVVSNGSTASQP-RTKQTSSLGTKSKSFNDRKTADTNSKPIVA  153

Query  885   -VKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTK  1061
              V V+H K   +PD T+ S  A                             L   AAD K
Sbjct  154   RVNVSHAKQSSQPDATSPSPNAD---------------------------GLKSPAADAK  186

Query  1062  SHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLR  1241
               + G LP+Y+ SFKC+ERAEKRKEFY+KLEEKIHAKE+E++N+QA +KESQEAEIKMLR
Sbjct  187   LRKVGALPTYNMSFKCDERAEKRKEFYSKLEEKIHAKEVEKNNLQALSKESQEAEIKMLR  246

Query  1242  KSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRL  1421
             KSLKFKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGR+K SSP R+  N+  + TSRL
Sbjct  247   KSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRKK-SSPTRE-VNDTAIHTSRL  304

Query  1422  SLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKE-----  1586
             SLDE  +Q N ++  S   VKKP RKSLPKLPS+K  +   TKK S IKTSISKE     
Sbjct  305   SLDENATQ-NPSKVHSPDIVKKPTRKSLPKLPSQKVNLSINTKKPS-IKTSISKETNEAA  362

Query  1587  ---ITEVDSQPNIVAKVTDEAEDVHASETEPKEN---DEADMSLVQEPITVE  1724
                ++EV SQPN V + T+E E   A ET   +     +A+  +VQ+ I VE
Sbjct  363   ANDMSEVASQPNNVLEHTNEIEATSAVETSQSKTVVEAQAETDVVQQLIAVE  414



>ref|XP_009589924.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009589925.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score =   310 bits (795),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 234/473 (49%), Positives = 291/473 (62%), Gaps = 56/473 (12%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM+ ++   ++ENG   ENGV +   AV   +     DG+ NGS +              
Sbjct  1     MMEIDNNIVVSENGTSFENGVHEFPEAVAGKL-----DGIPNGSSS--------------  41

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
                    SS+ EV+HES   +ESN  A S+  E K SGE K+ K  KAPGK KN K S+P
Sbjct  42    -------SSIAEVVHESTTTIESNPSASSEGHETKESGELKNSKQPKAPGKAKNGKPSSP  94

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             K+A     KK KD       S  S  +   R KQ S+   KS SFN+RKT          
Sbjct  95    KNAASIRVKKSKDALAGPVVSNGSTASQP-RTKQTSSLGTKSKSFNDRKTADTNSKPIVA  153

Query  885   -VKVNHDKH-CGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADT  1058
              V V+H K    +PD T+ S  A  +  KEK   KPLKK  P +++ + +S LSP AAD 
Sbjct  154   RVNVSHAKQQSSQPDATSPSPNA--DGLKEKTKPKPLKKVAPTQADGSEESPLSP-AADA  210

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             K  + G LP+Y+ SFKC+ERAEKRKEFY+KLEEKIHAKE+E++N+QA +KESQEAEIKML
Sbjct  211   KLRKVGALPTYNMSFKCDERAEKRKEFYSKLEEKIHAKEVEKNNLQALSKESQEAEIKML  270

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             RKSLKFKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGR+K SSP R+  N+  + TSR
Sbjct  271   RKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRKK-SSPTREV-NDTAIHTSR  328

Query  1419  LSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKE----  1586
             LSLDE  +Q N ++  S   VKKP RKSLPKLPS+K  +   TKK S IKTSISKE    
Sbjct  329   LSLDENATQ-NPSKVHSPDIVKKPTRKSLPKLPSQKVNLSINTKKPS-IKTSISKETNEA  386

Query  1587  ----ITEVDSQPNIVAKVTDEAEDVHASETEPKEN---DEADMSLVQEPITVE  1724
                 ++EV SQPN V + T+E E   A ET   +     +A+  +VQ+ I VE
Sbjct  387   AANDMSEVASQPNNVLEHTNEIEATSAVETSQSKTVVEAQAETDVVQQLIAVE  439



>ref|XP_009803431.1| PREDICTED: histone H1-I-like isoform X2 [Nicotiana sylvestris]
Length=449

 Score =   309 bits (791),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 222/484 (46%), Positives = 280/484 (58%), Gaps = 68/484 (14%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM+ ++   ++ENG   ENGV +   AV   +     DG+ NGS +              
Sbjct  1     MMEIDNNIVVSENGTSFENGVHEFPEAVAGKL-----DGIPNGSSS--------------  41

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
                    SS+ EV+HES   +ESN  A S+  + K SGESK+ K  KAPGK KN K S+P
Sbjct  42    -------SSIAEVVHESTTTIESNPSASSEGHDTKESGESKNSKQPKAPGKAKNGKPSSP  94

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             K+A  +   K        S     +  S  R KQ S+   KS SFN+RKT          
Sbjct  95    KNA-PSIRVKKSKDASAGSVVSNGSIASQPRTKQTSSLGTKSKSFNDRKTADTNSKPIVA  153

Query  885   -VKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPT-----  1046
              V V+H K  G+PD T+ S  A       K   K         ++A G   ++P      
Sbjct  154   RVNVSHAKQSGQPDATSPSPNAD----GLKEKTKTKPLKKVAPNQADGSEKVAPNQADGS  209

Query  1047  -------AADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQT  1205
                    AAD K  + G LP+Y+ SFKC+ERAEKRKEFY+KLEEKIHAKE+E++N+QA +
Sbjct  210   EESPSSPAADAKHRKVGALPTYNMSFKCDERAEKRKEFYSKLEEKIHAKEVEKNNLQALS  269

Query  1206  KESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRD  1385
             KESQEAEIKMLRKSLKFKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGR+K SSP R+
Sbjct  270   KESQEAEIKMLRKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRKK-SSPTRE  328

Query  1386  GKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPI  1565
               N+  + TSRLSLDE  +Q N  +  S   VKKP RKSLPKLPS+K  +   TKK S I
Sbjct  329   -VNDTAIHTSRLSLDENATQ-NPTKVHSPDIVKKPTRKSLPKLPSQKVNLSINTKKPS-I  385

Query  1566  KTSISKE--------ITEVDSQPNIVAKVTDEAE---DVHASETEPKENDEADMSLVQEP  1712
             KTSISKE        ++E  SQPN V + T+E E    V  S++      +A+ ++VQ+ 
Sbjct  386   KTSISKETNEAAANDMSEGASQPNNVLEHTNEIEATSTVETSQSMTIVEAQAETNVVQQS  445

Query  1713  ITVE  1724
             I VE
Sbjct  446   IAVE  449



>ref|XP_010322718.1| PREDICTED: RNA polymerase II degradation factor 1 isoform X2 
[Solanum lycopersicum]
Length=476

 Score =   309 bits (792),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 220/489 (45%), Positives = 297/489 (61%), Gaps = 50/489 (10%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MMD  +   ++ NGLG  NGV    H + E +V   S+G+ + S + EE E +FQ+ V L
Sbjct  1     MMDVVNNIAVSGNGLGFGNGV----HQLPE-VVAGISNGMPHASPSNEELERSFQSTVIL  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
              D   + SSVQEV +E+ + +ESN+   S+E E K S ++ + K QK P + +N K S P
Sbjct  56    TDSETVGSSVQEVSNETTITVESNAGVSSEEHEAKESDDATNSKEQKTPPRARNAKNSGP  115

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             ++ V   SK GK+  + + +S         R KQ S+   K  SF+++KTV         
Sbjct  116   QNGVAKKSKDGKEASNGTLASKP-------RPKQSSSLDAKGKSFSDKKTVEYYSKPALA  168

Query  885   -VKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATG--QSSLSPTAA-  1052
              + V+  K  G  +   S+S +  +S   K   K +       ++A G  +SS SPTAA 
Sbjct  169   HLNVDRAKQPGHAEVAASASPSAAQSEGLKEKTKLMPLKKVPPAKADGSAESSSSPTAAS  228

Query  1053  DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIK  1232
             D K  + GTLP+Y+ SFKC+ RAEKRKEFY+KLEEK  AKE+E+SNMQA+TKE+QEAEIK
Sbjct  229   DAKPRKVGTLPTYNISFKCDARAEKRKEFYSKLEEKTQAKEVEKSNMQAKTKETQEAEIK  288

Query  1233  MLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQT  1412
             MLRKSLKFKATPMP+FYQEP PPK+ELKKIPPTRAKSPKLGRRK SSP ++  NE+ ++ 
Sbjct  289   MLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGRRK-SSPTKERINESVMRP  347

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS-----------  1559
              RLSLDE  SQ+N  +  S + VKKPQRKSLPKLPSEKT + +ET+K S           
Sbjct  348   GRLSLDENASQNNPVKGHSPLIVKKPQRKSLPKLPSEKTNLSNETRKLSIRKSSSSKESA  407

Query  1560  ---PIKTSISKEITEVDSQPNIVAKVTDEAED----------VHASETEPKENDEADMSL  1700
                 +  ++ KE +EV SQPN   K   E +           V  S+TE     + + +L
Sbjct  408   EAASLPNALPKETSEVSSQPNNQHKQATEFDADGRECEVVSVVEPSQTETGVKAQIETNL  467

Query  1701  VQEPITVER  1727
             VQE +T+E+
Sbjct  468   VQEHVTIEQ  476



>ref|XP_010322717.1| PREDICTED: RNA polymerase II degradation factor 1 isoform X1 
[Solanum lycopersicum]
Length=477

 Score =   309 bits (791),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 229/490 (47%), Positives = 304/490 (62%), Gaps = 51/490 (10%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MMD  +   ++ NGLG  NGV    H + E +V   S+G+ + S + EE E +FQ+ V L
Sbjct  1     MMDVVNNIAVSGNGLGFGNGV----HQLPE-VVAGISNGMPHASPSNEELERSFQSTVIL  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
              D   + SSVQEV +E+ + +ESN+   S+E E K S ++ + K QK P + +N K S P
Sbjct  56    TDSETVGSSVQEVSNETTITVESNAGVSSEEHEAKESDDATNSKEQKTPPRARNAKNSGP  115

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV--------V  887
             ++ V   SK GK+  + + +S         R KQ S+   K  SF+++KTV         
Sbjct  116   QNGVAKKSKDGKEASNGTLASKP-------RPKQSSSLDAKGKSFSDKKTVEYYSKPALA  168

Query  888   KVNHDKHCGRPD-----TTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAA  1052
              +N D+   +P       + S S AQ E  KEK  L PLKK PP K++ + +SS SPTAA
Sbjct  169   HLNVDRAKQQPGHAEVAASASPSAAQSEGLKEKTKLMPLKKVPPAKADGSAESSSSPTAA  228

Query  1053  -DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEI  1229
              D K  + GTLP+Y+ SFKC+ RAEKRKEFY+KLEEK  AKE+E+SNMQA+TKE+QEAEI
Sbjct  229   SDAKPRKVGTLPTYNISFKCDARAEKRKEFYSKLEEKTQAKEVEKSNMQAKTKETQEAEI  288

Query  1230  KMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQ  1409
             KMLRKSLKFKATPMP+FYQEP PPK+ELKKIPPTRAKSPKLGRRK SSP ++  NE+ ++
Sbjct  289   KMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGRRK-SSPTKERINESVMR  347

Query  1410  TSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS----------  1559
               RLSLDE  SQ+N  +  S + VKKPQRKSLPKLPSEKT + +ET+K S          
Sbjct  348   PGRLSLDENASQNNPVKGHSPLIVKKPQRKSLPKLPSEKTNLSNETRKLSIRKSSSSKES  407

Query  1560  ----PIKTSISKEITEVDSQPNIVAKVTDEAED----------VHASETEPKENDEADMS  1697
                  +  ++ KE +EV SQPN   K   E +           V  S+TE     + + +
Sbjct  408   AEAASLPNALPKETSEVSSQPNNQHKQATEFDADGRECEVVSVVEPSQTETGVKAQIETN  467

Query  1698  LVQEPITVER  1727
             LVQE +T+E+
Sbjct  468   LVQEHVTIEQ  477



>ref|XP_010322719.1| PREDICTED: RNA polymerase II degradation factor 1 isoform X4 
[Solanum lycopersicum]
Length=475

 Score =   308 bits (788),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 219/488 (45%), Positives = 296/488 (61%), Gaps = 49/488 (10%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MMD  +   ++ NGLG  NGV    H + E +V   S+G+ + S + EE E +FQ+ V L
Sbjct  1     MMDVVNNIAVSGNGLGFGNGV----HQLPE-VVAGISNGMPHASPSNEELERSFQSTVIL  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
              D   + SSVQEV +E+ + +ESN+   S+E E K S ++ + K QK P + +N K S P
Sbjct  56    TDSETVGSSVQEVSNETTITVESNAGVSSEEHEAKESDDATNSKEQKTPPRARNAKNSGP  115

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             ++ V   SK GK+  + + +S         R KQ S+   K  SF+++KTV         
Sbjct  116   QNGVAKKSKDGKEASNGTLASKP-------RPKQSSSLDAKGKSFSDKKTVEYYSKPALA  168

Query  885   -VKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQS-SLSPTAA-D  1055
              + V+  K  G  +   S+S +  +S   K   K +       ++A G + S SPTAA D
Sbjct  169   HLNVDRAKQPGHAEVAASASPSAAQSEGLKEKTKLMPLKKVPPAKADGSAESSSPTAASD  228

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K  + GTLP+Y+ SFKC+ RAEKRKEFY+KLEEK  AKE+E+SNMQA+TKE+QEAEIKM
Sbjct  229   AKPRKVGTLPTYNISFKCDARAEKRKEFYSKLEEKTQAKEVEKSNMQAKTKETQEAEIKM  288

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTS  1415
             LRKSLKFKATPMP+FYQEP PPK+ELKKIPPTRAKSPKLGRRK SSP ++  NE+ ++  
Sbjct  289   LRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGRRK-SSPTKERINESVMRPG  347

Query  1416  RLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS------------  1559
             RLSLDE  SQ+N  +  S + VKKPQRKSLPKLPSEKT + +ET+K S            
Sbjct  348   RLSLDENASQNNPVKGHSPLIVKKPQRKSLPKLPSEKTNLSNETRKLSIRKSSSSKESAE  407

Query  1560  --PIKTSISKEITEVDSQPNIVAKVTDEAED----------VHASETEPKENDEADMSLV  1703
                +  ++ KE +EV SQPN   K   E +           V  S+TE     + + +LV
Sbjct  408   AASLPNALPKETSEVSSQPNNQHKQATEFDADGRECEVVSVVEPSQTETGVKAQIETNLV  467

Query  1704  QEPITVER  1727
             QE +T+E+
Sbjct  468   QEHVTIEQ  475



>ref|XP_009589927.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X3 [Nicotiana tomentosiformis]
Length=415

 Score =   305 bits (781),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 222/473 (47%), Positives = 273/473 (58%), Gaps = 80/473 (17%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM+ ++   ++ENG   ENGV +   AV   +     DG+ NGS +              
Sbjct  1     MMEIDNNIVVSENGTSFENGVHEFPEAVAGKL-----DGIPNGSSS--------------  41

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
                    SS+ EV+HES   +ESN  A S+  E K SGE K+ K  KAPGK KN K S+P
Sbjct  42    -------SSIAEVVHESTTTIESNPSASSEGHETKESGELKNSKQPKAPGKAKNGKPSSP  94

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             K+A     KK KD       S  S  +   R KQ S+   KS SFN+RKT          
Sbjct  95    KNAASIRVKKSKDALAGPVVSNGSTASQP-RTKQTSSLGTKSKSFNDRKTADTNSKPIVA  153

Query  885   -VKVNHDKH-CGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADT  1058
              V V+H K    +PD T+ S  A                             L   AAD 
Sbjct  154   RVNVSHAKQQSSQPDATSPSPNAD---------------------------GLKSPAADA  186

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             K  + G LP+Y+ SFKC+ERAEKRKEFY+KLEEKIHAKE+E++N+QA +KESQEAEIKML
Sbjct  187   KLRKVGALPTYNMSFKCDERAEKRKEFYSKLEEKIHAKEVEKNNLQALSKESQEAEIKML  246

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             RKSLKFKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGR+K SSP R+  N+  + TSR
Sbjct  247   RKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRKK-SSPTRE-VNDTAIHTSR  304

Query  1419  LSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKE----  1586
             LSLDE  +Q N ++  S   VKKP RKSLPKLPS+K  +   TKK S IKTSISKE    
Sbjct  305   LSLDENATQ-NPSKVHSPDIVKKPTRKSLPKLPSQKVNLSINTKKPS-IKTSISKETNEA  362

Query  1587  ----ITEVDSQPNIVAKVTDEAEDVHASETEPKEN---DEADMSLVQEPITVE  1724
                 ++EV SQPN V + T+E E   A ET   +     +A+  +VQ+ I VE
Sbjct  363   AANDMSEVASQPNNVLEHTNEIEATSAVETSQSKTVVEAQAETDVVQQLIAVE  415



>ref|XP_004241776.1| PREDICTED: RNA polymerase II degradation factor 1 isoform X3 
[Solanum lycopersicum]
Length=476

 Score =   305 bits (782),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 229/490 (47%), Positives = 304/490 (62%), Gaps = 52/490 (11%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MMD  +   ++ NGLG  NGV    H + E +V   S+G+ + S + EE E +FQ+ V L
Sbjct  1     MMDVVNNIAVSGNGLGFGNGV----HQLPE-VVAGISNGMPHASPSNEELERSFQSTVIL  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
              D   + SSVQEV +E+ + +ESN+   S+E E K S ++ + K QK P + +N K S P
Sbjct  56    TDSETVGSSVQEVSNETTITVESNAGVSSEEHEAKESDDATNSKEQKTPPRARNAKNSGP  115

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV--------V  887
             ++ V   SK GK+  + + +S         R KQ S+   K  SF+++KTV         
Sbjct  116   QNGVAKKSKDGKEASNGTLASKP-------RPKQSSSLDAKGKSFSDKKTVEYYSKPALA  168

Query  888   KVNHDKHCGRPD-----TTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAA  1052
              +N D+   +P       + S S AQ E  KEK  L PLKK PP K++ + +SS SPTAA
Sbjct  169   HLNVDRAKQQPGHAEVAASASPSAAQSEGLKEKTKLMPLKKVPPAKADGSAESS-SPTAA  227

Query  1053  -DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEI  1229
              D K  + GTLP+Y+ SFKC+ RAEKRKEFY+KLEEK  AKE+E+SNMQA+TKE+QEAEI
Sbjct  228   SDAKPRKVGTLPTYNISFKCDARAEKRKEFYSKLEEKTQAKEVEKSNMQAKTKETQEAEI  287

Query  1230  KMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQ  1409
             KMLRKSLKFKATPMP+FYQEP PPK+ELKKIPPTRAKSPKLGRRK SSP ++  NE+ ++
Sbjct  288   KMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGRRK-SSPTKERINESVMR  346

Query  1410  TSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS----------  1559
               RLSLDE  SQ+N  +  S + VKKPQRKSLPKLPSEKT + +ET+K S          
Sbjct  347   PGRLSLDENASQNNPVKGHSPLIVKKPQRKSLPKLPSEKTNLSNETRKLSIRKSSSSKES  406

Query  1560  ----PIKTSISKEITEVDSQPNIVAKVTDEAED----------VHASETEPKENDEADMS  1697
                  +  ++ KE +EV SQPN   K   E +           V  S+TE     + + +
Sbjct  407   AEAASLPNALPKETSEVSSQPNNQHKQATEFDADGRECEVVSVVEPSQTETGVKAQIETN  466

Query  1698  LVQEPITVER  1727
             LVQE +T+E+
Sbjct  467   LVQEHVTIEQ  476



>ref|XP_009803432.1| PREDICTED: histone H1-I-like isoform X3 [Nicotiana sylvestris]
Length=449

 Score =   304 bits (779),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 222/484 (46%), Positives = 280/484 (58%), Gaps = 68/484 (14%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM+ ++   ++ENG   ENGV +   AV   +     DG+ NGS +              
Sbjct  1     MMEIDNNIVVSENGTSFENGVHEFPEAVAGKL-----DGIPNGSSS--------------  41

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
                    SS+ EV+HES   +ESN  A S+  + K SGESK+ K  KAPGK KN K S+P
Sbjct  42    -------SSIAEVVHESTTTIESNPSASSEGHDTKESGESKNSKQPKAPGKAKNGKPSSP  94

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             K+A  +   K        S     +  S  R KQ S+   KS SFN+RKT          
Sbjct  95    KNA-PSIRVKKSKDASAGSVVSNGSIASQPRTKQTSSLGTKSKSFNDRKTADTNSKPIVA  153

Query  885   -VKVNHDK-HCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPT----  1046
              V V+H K   G+PD T+ S  A       K   K         ++A G   ++P     
Sbjct  154   RVNVSHAKRQSGQPDATSPSPNAD----GLKEKTKTKPLKKVAPNQADGSEKVAPNQADG  209

Query  1047  -------AADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQT  1205
                    AAD K  + G LP+Y+ SFKC+ERAEKRKEFY+KLEEKIHAKE+E++N+QA +
Sbjct  210   SEESPSPAADAKHRKVGALPTYNMSFKCDERAEKRKEFYSKLEEKIHAKEVEKNNLQALS  269

Query  1206  KESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRD  1385
             KESQEAEIKMLRKSLKFKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGR+K SSP R+
Sbjct  270   KESQEAEIKMLRKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRKK-SSPTRE  328

Query  1386  GKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPI  1565
               N+  + TSRLSLDE  +Q N  +  S   VKKP RKSLPKLPS+K  +   TKK S I
Sbjct  329   -VNDTAIHTSRLSLDENATQ-NPTKVHSPDIVKKPTRKSLPKLPSQKVNLSINTKKPS-I  385

Query  1566  KTSISKE--------ITEVDSQPNIVAKVTDEAE---DVHASETEPKENDEADMSLVQEP  1712
             KTSISKE        ++E  SQPN V + T+E E    V  S++      +A+ ++VQ+ 
Sbjct  386   KTSISKETNEAAANDMSEGASQPNNVLEHTNEIEATSTVETSQSMTIVEAQAETNVVQQS  445

Query  1713  ITVE  1724
             I VE
Sbjct  446   IAVE  449



>ref|XP_009803429.1| PREDICTED: histone H1-I-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009803430.1| PREDICTED: histone H1-I-like isoform X1 [Nicotiana sylvestris]
Length=450

 Score =   304 bits (778),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 222/485 (46%), Positives = 280/485 (58%), Gaps = 69/485 (14%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM+ ++   ++ENG   ENGV +   AV   +     DG+ NGS +              
Sbjct  1     MMEIDNNIVVSENGTSFENGVHEFPEAVAGKL-----DGIPNGSSS--------------  41

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
                    SS+ EV+HES   +ESN  A S+  + K SGESK+ K  KAPGK KN K S+P
Sbjct  42    -------SSIAEVVHESTTTIESNPSASSEGHDTKESGESKNSKQPKAPGKAKNGKPSSP  94

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             K+A  +   K        S     +  S  R KQ S+   KS SFN+RKT          
Sbjct  95    KNA-PSIRVKKSKDASAGSVVSNGSIASQPRTKQTSSLGTKSKSFNDRKTADTNSKPIVA  153

Query  885   -VKVNHDK-HCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPT----  1046
              V V+H K   G+PD T+ S  A       K   K         ++A G   ++P     
Sbjct  154   RVNVSHAKRQSGQPDATSPSPNAD----GLKEKTKTKPLKKVAPNQADGSEKVAPNQADG  209

Query  1047  --------AADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
                     AAD K  + G LP+Y+ SFKC+ERAEKRKEFY+KLEEKIHAKE+E++N+QA 
Sbjct  210   SEESPSSPAADAKHRKVGALPTYNMSFKCDERAEKRKEFYSKLEEKIHAKEVEKNNLQAL  269

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNR  1382
             +KESQEAEIKMLRKSLKFKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGR+K SSP R
Sbjct  270   SKESQEAEIKMLRKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRKK-SSPTR  328

Query  1383  DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASP  1562
             +  N+  + TSRLSLDE  +Q N  +  S   VKKP RKSLPKLPS+K  +   TKK S 
Sbjct  329   E-VNDTAIHTSRLSLDENATQ-NPTKVHSPDIVKKPTRKSLPKLPSQKVNLSINTKKPS-  385

Query  1563  IKTSISKE--------ITEVDSQPNIVAKVTDEAE---DVHASETEPKENDEADMSLVQE  1709
             IKTSISKE        ++E  SQPN V + T+E E    V  S++      +A+ ++VQ+
Sbjct  386   IKTSISKETNEAAANDMSEGASQPNNVLEHTNEIEATSTVETSQSMTIVEAQAETNVVQQ  445

Query  1710  PITVE  1724
              I VE
Sbjct  446   SIAVE  450



>ref|XP_011070147.1| PREDICTED: protein WVD2-like 1 isoform X3 [Sesamum indicum]
Length=458

 Score =   298 bits (763),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 211/440 (48%), Positives = 279/440 (63%), Gaps = 20/440 (5%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM A+    ++  G   ENG+ + L       + ++ +G  NG+  +EE   + +NA  L
Sbjct  1     MMAADSIITVSGYGPEFENGLHEPLP------ISEKVNGTSNGTLGVEELSADLENAAKL  54

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVK-LSN  728
             +D     +SV+E+  E  +PLES+S    +   V+ S +SK+ K QK  GK KN K LS 
Sbjct  55    SDHSV--ASVKEITEEPALPLESHSTTIPQALGVEESSDSKNLKPQKRTGKTKNEKPLSP  112

Query  729   PKHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKH  908
              + AV   SK     +   SS   +   S SR  +  A   KS S NE++     ++ K 
Sbjct  113   GQAAVTVLSKSKDGKEVKKSSVASNGIASDSRPGRTLALRTKSKSINEKQAA---DNSKQ  169

Query  909   CGRPDTTTS-SSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLP  1085
              G PD T+S +  A  E   E+  LK LKKGP  K+E T +SSLSPTA D K  R GTLP
Sbjct  170   LGNPDATSSLAGGAPSEELPEETKLKALKKGPVSKAEETSESSLSPTAGDAKPRRVGTLP  229

Query  1086  SYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKAT  1265
             +YSF+F+CNERAEKR+EFY+KLEEKIHAKE+E+SN+QA+TKE+QEAEIKMLRK+L FKAT
Sbjct  230   TYSFNFRCNERAEKRREFYSKLEEKIHAKEVEKSNLQAKTKETQEAEIKMLRKTLGFKAT  289

Query  1266  PMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQT--SRLSLDEKP  1439
             PMP+FYQEPPPPKVELKKIP TRAKSPKLGR+K +SP  D +  + L     RLSLDEK 
Sbjct  290   PMPSFYQEPPPPKVELKKIPTTRAKSPKLGRKKGTSP-ADSEENDALSARPGRLSLDEKV  348

Query  1440  SQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIV  1619
             SQD+LA+   +  VK P+RKSLPKLPS+ T +  E KKA+  K +  KE  E   QP+ +
Sbjct  349   SQDDLAKAPPVAHVKAPRRKSLPKLPSQNTSLTHEKKKAASRKITTPKETGESTIQPSDL  408

Query  1620  AKVTDEAEDVHASETEPKEN  1679
             +K + E     AS+T+ +E+
Sbjct  409   SKESSEV----ASDTQNQES  424



>ref|XP_011069988.1| PREDICTED: protein WVD2-like 1 isoform X1 [Sesamum indicum]
Length=470

 Score =   295 bits (756),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 213/449 (47%), Positives = 281/449 (63%), Gaps = 26/449 (6%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM A+    ++  G   ENG+ + L       + ++ +G  NG+  +EE   + +NA  L
Sbjct  1     MMAADSIITVSGYGPEFENGLHEPLP------ISEKVNGTSNGTLGVEELSADLENAAKL  54

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVK-LSN  728
             +D     +SV+E+  E  +PLES+S    +   V+ S +SK+ K QK  GK KN K LS 
Sbjct  55    SDHSV--ASVKEITEEPALPLESHSTTIPQALGVEESSDSKNLKPQKRTGKTKNEKPLSP  112

Query  729   PKHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKT-----VVKV  893
              + AV   SK     +   SS   +   S SR  +  A   KS S NE++      V+ V
Sbjct  113   GQAAVTVLSKSKDGKEVKKSSVASNGIASDSRPGRTLALRTKSKSINEKQAADNSKVMSV  172

Query  894   NHD----KHCGRPDTTTS-SSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADT  1058
               +    K  G PD T+S +  A  E   E+  LK LKKGP  K+E T +SSLSPTA D 
Sbjct  173   QSNQSISKQLGNPDATSSLAGGAPSEELPEETKLKALKKGPVSKAEETSESSLSPTAGDA  232

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             K  R GTLP+YSF+F+CNERAEKR+EFY+KLEEKIHAKE+E+SN+QA+TKE+QEAEIKML
Sbjct  233   KPRRVGTLPTYSFNFRCNERAEKRREFYSKLEEKIHAKEVEKSNLQAKTKETQEAEIKML  292

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQT--  1412
             RK+L FKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGR+K +SP  D +  + L    
Sbjct  293   RKTLGFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRKKGTSP-ADSEENDALSARP  351

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEIT  1592
              RLSLDEK SQD+LA+   +  VK P+RKSLPKLPS+ T +  E KKA+  K +  KE  
Sbjct  352   GRLSLDEKVSQDDLAKAPPVAHVKAPRRKSLPKLPSQNTSLTHEKKKAASRKITTPKETG  411

Query  1593  EVDSQPNIVAKVTDEAEDVHASETEPKEN  1679
             E   QP+ ++K + E     AS+T+ +E+
Sbjct  412   ESTIQPSDLSKESSEV----ASDTQNQES  436



>ref|XP_011070068.1| PREDICTED: protein WVD2-like 1 isoform X2 [Sesamum indicum]
Length=469

 Score =   294 bits (752),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 212/448 (47%), Positives = 281/448 (63%), Gaps = 25/448 (6%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MM A+    ++  G   ENG+ + L       + ++ +G  NG+  +EE   + +NA  L
Sbjct  1     MMAADSIITVSGYGPEFENGLHEPLP------ISEKVNGTSNGTLGVEELSADLENAAKL  54

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVK-LSN  728
             +D     +SV+E+  E  +PLES+S    +   V+ S +SK+ K QK  GK KN K LS 
Sbjct  55    SDHSV--ASVKEITEEPALPLESHSTTIPQALGVEESSDSKNLKPQKRTGKTKNEKPLSP  112

Query  729   PKHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKT-----VVKV  893
              + AV   SK     +   SS   +   S SR  +  A   KS S NE++      V+ V
Sbjct  113   GQAAVTVLSKSKDGKEVKKSSVASNGIASDSRPGRTLALRTKSKSINEKQAADNSKVMSV  172

Query  894   NHDKH---CGRPDTTTS-SSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTK  1061
               ++     G PD T+S +  A  E   E+  LK LKKGP  K+E T +SSLSPTA D K
Sbjct  173   QSNQSISKLGNPDATSSLAGGAPSEELPEETKLKALKKGPVSKAEETSESSLSPTAGDAK  232

Query  1062  SHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLR  1241
               R GTLP+YSF+F+CNERAEKR+EFY+KLEEKIHAKE+E+SN+QA+TKE+QEAEIKMLR
Sbjct  233   PRRVGTLPTYSFNFRCNERAEKRREFYSKLEEKIHAKEVEKSNLQAKTKETQEAEIKMLR  292

Query  1242  KSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQT--S  1415
             K+L FKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGR+K +SP  D +  + L     
Sbjct  293   KTLGFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRKKGTSP-ADSEENDALSARPG  351

Query  1416  RLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITE  1595
             RLSLDEK SQD+LA+   +  VK P+RKSLPKLPS+ T +  E KKA+  K +  KE  E
Sbjct  352   RLSLDEKVSQDDLAKAPPVAHVKAPRRKSLPKLPSQNTSLTHEKKKAASRKITTPKETGE  411

Query  1596  VDSQPNIVAKVTDEAEDVHASETEPKEN  1679
                QP+ ++K + E     AS+T+ +E+
Sbjct  412   STIQPSDLSKESSEV----ASDTQNQES  435



>emb|CDP13518.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   293 bits (751),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 198/437 (45%), Positives = 272/437 (62%), Gaps = 13/437 (3%)
 Frame = +3

Query  375   MDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLN  554
             MDA++  ++ ENG+G ENGV ++L +    + + +S+GV N S  I     +F++++ LN
Sbjct  1     MDADNLIQVTENGVGFENGVREELLSSELQVAIHESNGVPNCSPEIGGLNADFEDSLKLN  60

Query  555   DDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPK  734
             D   ID+S   V   S  P  SN+  +S+  +   + +      +   GKP N +  + +
Sbjct  61    DGEHIDASGLVVKEGSPTPANSNAADNSEGGKELLNSKPHEALAKSKSGKPLNTRTVS-E  119

Query  735   HAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---VKVNHDK  905
               V               S+      S S+    S    KS SFNER        V+  K
Sbjct  120   TGVKKSKDGKDALTASGVSNGTLASESNSKL---SFAKSKSKSFNERPAASASTNVSQSK  176

Query  906   HCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLP  1085
                +P+  +S+S AQ + ++EK   + LKK    K+E   +S +SP A D K  + GTLP
Sbjct  177   QIQQPELISSTSAAQSDCNREKTKPRVLKKSQSSKTEGVAES-VSP-AEDAKPRKVGTLP  234

Query  1086  SYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKAT  1265
             +Y FSF+CNERAEKR+EFY+KLEEKI AKE+E++N+QA++KE+QEAEIKMLRKSL FKAT
Sbjct  235   NYGFSFRCNERAEKRREFYSKLEEKIQAKEVEKTNLQAKSKETQEAEIKMLRKSLMFKAT  294

Query  1266  PMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNEN--GLQTSRLSLDEKP  1439
             PMP+FYQEPPPPK ELKKIP TRAKSPKLGR+K SSP+R  + E+  G  TSRLSLDEK 
Sbjct  295   PMPSFYQEPPPPKAELKKIPTTRAKSPKLGRKK-SSPSRVSEEESDEGTHTSRLSLDEKL  353

Query  1440  SQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIV  1619
             SQ++  +  S++++KKP RKSLPKLPS+KT +  ET+KAS  KTSISKE++   SQ +  
Sbjct  354   SQNDSVKGPSIVNLKKPLRKSLPKLPSQKTSLTGETRKASSRKTSISKEMSGSSSQADNS  413

Query  1620  AKVTDEAEDVHASETEP  1670
             +K +  A DV   E  P
Sbjct  414   SK-SGAAGDVQKQEETP  429



>ref|XP_010322721.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Solanum lycopersicum]
Length=458

 Score =   287 bits (735),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 214/489 (44%), Positives = 285/489 (58%), Gaps = 68/489 (14%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MMD  +   ++ NGLG  NGV    H + E +V   S+G+ + S + EE E +FQ+ V L
Sbjct  1     MMDVVNNIAVSGNGLGFGNGV----HQLPE-VVAGISNGMPHASPSNEELERSFQSTVIL  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
              D   + SSVQE                  E E K S ++ + K QK P + +N K S P
Sbjct  56    TDSETVGSSVQE------------------EHEAKESDDATNSKEQKTPPRARNAKNSGP  97

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV---------  884
             ++ V   SK GK+  + + +S         R KQ S+   K  SF+++KTV         
Sbjct  98    QNGVAKKSKDGKEASNGTLASKP-------RPKQSSSLDAKGKSFSDKKTVEYYSKPALA  150

Query  885   -VKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATG--QSSLSPTAA-  1052
              + V+  K  G  +   S+S +  +S   K   K +       ++A G  +SS SPTAA 
Sbjct  151   HLNVDRAKQPGHAEVAASASPSAAQSEGLKEKTKLMPLKKVPPAKADGSAESSSSPTAAS  210

Query  1053  DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIK  1232
             D K  + GTLP+Y+ SFKC+ RAEKRKEFY+KLEEK  AKE+E+SNMQA+TKE+QEAEIK
Sbjct  211   DAKPRKVGTLPTYNISFKCDARAEKRKEFYSKLEEKTQAKEVEKSNMQAKTKETQEAEIK  270

Query  1233  MLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQT  1412
             MLRKSLKFKATPMP+FYQEP PPK+ELKKIPPTRAKSPKLGRRK SSP ++  NE+ ++ 
Sbjct  271   MLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGRRK-SSPTKERINESVMRP  329

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS-----------  1559
              RLSLDE  SQ+N  +  S + VKKPQRKSLPKLPSEKT + +ET+K S           
Sbjct  330   GRLSLDENASQNNPVKGHSPLIVKKPQRKSLPKLPSEKTNLSNETRKLSIRKSSSSKESA  389

Query  1560  ---PIKTSISKEITEVDSQPNIVAKVTDEAED----------VHASETEPKENDEADMSL  1700
                 +  ++ KE +EV SQPN   K   E +           V  S+TE     + + +L
Sbjct  390   EAASLPNALPKETSEVSSQPNNQHKQATEFDADGRECEVVSVVEPSQTETGVKAQIETNL  449

Query  1701  VQEPITVER  1727
             VQE +T+E+
Sbjct  450   VQEHVTIEQ  458



>ref|XP_010322720.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Solanum lycopersicum]
Length=459

 Score =   287 bits (735),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 223/490 (46%), Positives = 292/490 (60%), Gaps = 69/490 (14%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNL  551
             MMD  +   ++ NGLG  NGV    H + E +V   S+G+ + S + EE E +FQ+ V L
Sbjct  1     MMDVVNNIAVSGNGLGFGNGV----HQLPE-VVAGISNGMPHASPSNEELERSFQSTVIL  55

Query  552   NDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNP  731
              D   + SSVQE                  E E K S ++ + K QK P + +N K S P
Sbjct  56    TDSETVGSSVQE------------------EHEAKESDDATNSKEQKTPPRARNAKNSGP  97

Query  732   KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV--------V  887
             ++ V   SK GK+  + + +S         R KQ S+   K  SF+++KTV         
Sbjct  98    QNGVAKKSKDGKEASNGTLASKP-------RPKQSSSLDAKGKSFSDKKTVEYYSKPALA  150

Query  888   KVNHDKHCGRPD-----TTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAA  1052
              +N D+   +P       + S S AQ E  KEK  L PLKK PP K++ + +SS SPTAA
Sbjct  151   HLNVDRAKQQPGHAEVAASASPSAAQSEGLKEKTKLMPLKKVPPAKADGSAESSSSPTAA  210

Query  1053  -DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEI  1229
              D K  + GTLP+Y+ SFKC+ RAEKRKEFY+KLEEK  AKE+E+SNMQA+TKE+QEAEI
Sbjct  211   SDAKPRKVGTLPTYNISFKCDARAEKRKEFYSKLEEKTQAKEVEKSNMQAKTKETQEAEI  270

Query  1230  KMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQ  1409
             KMLRKSLKFKATPMP+FYQEP PPK+ELKKIPPTRAKSPKLGRRK SSP ++  NE+ ++
Sbjct  271   KMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGRRK-SSPTKERINESVMR  329

Query  1410  TSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS----------  1559
               RLSLDE  SQ+N  +  S + VKKPQRKSLPKLPSEKT + +ET+K S          
Sbjct  330   PGRLSLDENASQNNPVKGHSPLIVKKPQRKSLPKLPSEKTNLSNETRKLSIRKSSSSKES  389

Query  1560  ----PIKTSISKEITEVDSQPNIVAKVTDEAED----------VHASETEPKENDEADMS  1697
                  +  ++ KE +EV SQPN   K   E +           V  S+TE     + + +
Sbjct  390   AEAASLPNALPKETSEVSSQPNNQHKQATEFDADGRECEVVSVVEPSQTETGVKAQIETN  449

Query  1698  LVQEPITVER  1727
             LVQE +T+E+
Sbjct  450   LVQEHVTIEQ  459



>ref|XP_007011861.1| TPX2 family protein, putative [Theobroma cacao]
 gb|EOY29480.1| TPX2 family protein, putative [Theobroma cacao]
Length=457

 Score =   272 bits (696),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 203/468 (43%), Positives = 268/468 (57%), Gaps = 64/468 (14%)
 Frame = +3

Query  426   NGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNF-QNAVNLNDDIAIDSSVQEVIHES  602
             NGV  QL   G+D  +  SD V NG+  +E+A  ++ QN ++ N       +  E    S
Sbjct  18    NGVYPQLRVSGDDSEI--SDNV-NGN--VEKAAKSYVQNGMDDN------GATGEAREGS  66

Query  603   MVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHA---Vvagskkgkdg  773
                +E+N   DSKE E+K +  +K  K QK  GK KN K S PK+    +V  SK GK  
Sbjct  67    NDFVENNGLIDSKEGELKDN--AKQSKPQKVQGKTKNEKPSGPKNVSSTLVKKSKDGKSA  124

Query  774   kdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQR  953
               + ++S   +  + SR KQP     KS SFNER+     N  K   +PD   S    ++
Sbjct  125   DVMLTTSNGGSVATNSRLKQPL----KSMSFNERQ----ANASKQSEKPDAAFSEGTMEK  176

Query  954   ESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRK  1133
                K               ++A G +   PTAAD K  R GTLP+Y FSFKC+ERAEKR+
Sbjct  177   PKLKPLKKGPV--------NKAEGDTESFPTAADAKPRRVGTLPNYGFSFKCDERAEKRR  228

Query  1134  EFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVEL  1313
             EFYTKL EKIHA+E+E+SN+QA++KE+QEAEIKMLRKSL FKATPMP+FYQEPPPPKVEL
Sbjct  229   EFYTKLGEKIHAREVEKSNLQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPPPPKVEL  288

Query  1314  KKIPPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKP  1490
             KKIPPTRAKSPKLGR+K S+P+  DG + +G Q+ RLSLDEK SQ    +  S +  +KP
Sbjct  289   KKIPPTRAKSPKLGRKKGSTPSESDGNSNSGHQSGRLSLDEKASQSISGKVISPVHARKP  348

Query  1491  QRKSLPKLPSEKTYIPSE------TKKASPIKTSISKEITE--------VDSQPNIVAKV  1628
             QRKSLPKLPS+KT + S       +K ++  K + SK  TE         + +   ++ V
Sbjct  349   QRKSLPKLPSQKTSLSSAANEEKTSKGSNQEKVTASKATTEGKIASSKATNEENTTLSDV  408

Query  1629  TDE----------------AEDVHASETEPKENDEADMSLVQEPITVE  1724
             T+E                 E     +  P   +E  + LVQEPI ++
Sbjct  409   TNEELSPVQQQEAVSTADSGESQLYMDQAPVIGEEGQLDLVQEPIALQ  456



>gb|KDP33592.1| hypothetical protein JCGZ_07163 [Jatropha curcas]
Length=464

 Score =   272 bits (696),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 203/459 (44%), Positives = 264/459 (58%), Gaps = 38/459 (8%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQS-DGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHE  599
             +NGV +Q  A GE+ V   S +G +       E +GN  +A  L D    +S   E    
Sbjct  18    QNGVREQSPASGEEGVFSNSANGNIEKITVSTEPDGNLDDASKLEDSGTGNSYAVEFREG  77

Query  600   SMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPK--HAVvagskkgkdg  773
             S V + SN    SKE E+K   +S+  K  K PGK KN K SN K   A      K +  
Sbjct  78    SNVHVGSNGFTGSKEGELKDGSQSEQVKSLKGPGKGKNEKPSNRKTVSATQEKKAKNEKF  137

Query  774   kdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQR  953
                  ++   + TS S+AKQ      KS SFNER+    V   K  G+ D  +S  +  R
Sbjct  138   AGTPPTASNGSVTSNSQAKQ----TFKSISFNERQ----VQASKQSGKSDVASSEGLMSR  189

Query  954   ESHkekpllkplkkgppkkSE----ATGQS-SLSPTAADTKSHRAGTLPSYSFSFKCNER  1118
                K       +K     +++    A G++ +LSPTA D+K  R G LP+Y FSFKC+ER
Sbjct  190   TKLKALKKGPGIKAEGDTENDSVIKAEGETQTLSPTAEDSKPRRVGALPNYGFSFKCDER  249

Query  1119  AEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPP  1298
             AEKR+EFY+KLEEKIHAKE+E++ +QA++KE+QEAEIKMLRKSL FKATPMP+FYQEPPP
Sbjct  250   AEKRREFYSKLEEKIHAKEVEKNTLQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPPP  309

Query  1299  PKVELKKIPPTRAKSPKLGRRKTSSP-NRDGKNENGLQTSRLSLDEKPSQDNLARRRSLI  1475
             PK+ELKKIPPTR KSPKLGRRK+SSP + +G N    +  RLSLDEK S +  A+  S I
Sbjct  310   PKLELKKIPPTRPKSPKLGRRKSSSPVDSEGNNGENSRPGRLSLDEKVSTNRSAKGPSPI  369

Query  1476  DVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVTDEAE----  1643
               KKPQRKSLPKLPSEKT + + T      KT +SK +  +   P    ++T++A     
Sbjct  370   HSKKPQRKSLPKLPSEKTSLSNATNDE---KTPLSKAL--IKENPPTSNQMTEDASAQKQ  424

Query  1644  -----DVHASETEPKENDE-------ADMSLVQEPITVE  1724
                     ASE    + DE       A+ +L+QEPI  E
Sbjct  425   EAIIPRALASEEIEAQIDEVVVVREQAEPTLLQEPIASE  463



>ref|XP_002515513.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46962.1| conserved hypothetical protein [Ricinus communis]
Length=426

 Score =   270 bits (691),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 179/369 (49%), Positives = 227/369 (62%), Gaps = 28/369 (8%)
 Frame = +3

Query  447   HAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAID-SSVQEVIHESMVPLESN  623
             + + E  +    DGV+        + GN +NA  L D I  + SS  EV   S V + SN
Sbjct  19    NGIHEQSLASMDDGVV--------SNGNLENASKLEDSITSNTSSAGEVCERSNVHVGSN  70

Query  624   SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKH--AVvagskkgkdgkdissssv  797
                  KE  VK  G S+  K  K PGK K+ K SNPK+  A     +K       + +  
Sbjct  71    GLTGCKEGNVKNEGHSEHAKSLKGPGKSKSEKSSNPKNTSATQLKKRKDGKVAGAAPTVS  130

Query  798   isngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpl  977
               + TS S++KQP     KS SF+ER     V   KH  + D T+S  + +         
Sbjct  131   NGSATSNSQSKQPL----KSKSFSERL----VQTAKHPAKCDVTSSEGLME--------T  174

Query  978   lkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEE  1157
             LK      P K+E   Q+SLSPTA D K  R   LP+Y FSFKC+ERAEKR+EFY+KLEE
Sbjct  175   LKLKTSKGPAKAEEIAQASLSPTAEDAKPRRVAALPNYGFSFKCDERAEKRREFYSKLEE  234

Query  1158  KIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRA  1337
             KIHAKE+E +N+QA++KE+QEAEIKMLRKSL FKATPMP+FYQEPPPPK+ELKKIP TR 
Sbjct  235   KIHAKELEMNNLQAKSKETQEAEIKMLRKSLAFKATPMPSFYQEPPPPKMELKKIPTTRP  294

Query  1338  KSPKLGRRKTSSPNRDGKNEN-GLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKL  1514
             KSPKLGR+K+SSP    +N++   + +RLSLD+K S +N A+  S I  KKPQRKSLPKL
Sbjct  295   KSPKLGRKKSSSPVDSEENDDQSRRLARLSLDQKVSHNNAAKGPSPIRSKKPQRKSLPKL  354

Query  1515  PSEKTYIPS  1541
             PS+KT + S
Sbjct  355   PSQKTSLSS  363



>ref|XP_007223133.1| hypothetical protein PRUPE_ppa005440mg [Prunus persica]
 gb|EMJ24332.1| hypothetical protein PRUPE_ppa005440mg [Prunus persica]
Length=461

 Score =   262 bits (669),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 242/404 (60%), Gaps = 41/404 (10%)
 Frame = +3

Query  375   MDANDKKRIAENGL--GCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAE------GN  530
             MD+++   +A  GL    +NGV  Q   V ++I         NG+ +           G 
Sbjct  1     MDSDN--LVATYGLEVAHQNGVHGQPGVVSDNI---------NGTVSETTTTETAAPNGK  49

Query  531   FQNAVNLNDDIAIDSSVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAP  698
              +N V L+D +  +SS  E   ES V  E N    +   +KE EVK S  SK  K+QK  
Sbjct  50    IENVVKLDDGVTNNSSTGEAKEESTVNPERNGLTIALTIAKEGEVKGSLHSKQTKVQKGQ  109

Query  699   GKPKNVKLSNPKHA--VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNE  872
             GK KN K S PK+   V     K  +  +++++    +  + SR KQP+    K+ SFN 
Sbjct  110   GKSKNEKPSGPKNVSPVWMKKSKDGNDGEVTAAVSNGSAATTSRPKQPN----KTRSFNG  165

Query  873   RKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAA  1052
             R+    V       + DT  S    ++        LKPLKK    K+E   QSSLSPT  
Sbjct  166   RQ----VQSSNQLEKSDTELSEGTVEK------TKLKPLKKDSLNKAEGESQSSLSPTEG  215

Query  1053  DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIK  1232
             D K  R  TLP+Y FSF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA++KE+ EAEI+
Sbjct  216   DMKPPRVSTLPNYGFSFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSKETLEAEIR  275

Query  1233  MLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN-RDGKNENGLQ  1409
             MLRK L FKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGRRK+  P   +G +    +
Sbjct  276   MLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRRKSLPPAVSEGNSNTNDR  335

Query  1410  TSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPS  1541
             +SRLSLDEK  Q N A+  S +  KKPQRKSLP+LPSEKT +P+
Sbjct  336   SSRLSLDEKVPQ-NSAKGPSPVHPKKPQRKSLPRLPSEKTTLPN  378



>emb|CBI21044.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   260 bits (664),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 190/402 (47%), Positives = 256/402 (64%), Gaps = 18/402 (4%)
 Frame = +3

Query  369   FMMDANDKKRIAENGL--GCENGVDKQLHAVG-EDIVVDQSDGVLNGSFTIEEAEGNFQN  539
             F+MD +D   +  NGL  G +NG+ +QL A G E ++ ++ +G L+ S       GN +N
Sbjct  7     FVMDVDD--LLPVNGLEEGHQNGIHEQLSAAGGEGVIPEKVNGNLDLSTESAGMNGNAEN  64

Query  540   AVNLNDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVK  719
                 +D+  I++S  EV   S +    N    S++ EV+ +  SK  K QK  GK    K
Sbjct  65    VGMWDDNGIINASTAEVGEGSHIRARVNGLTISEDLEVEDADPSKHSKPQKGQGKSSKEK  124

Query  720   LSNPKHA-VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKT-VVKV  893
             LS+PKHA      KK    + ++S+S   +  S SR KQ      KS SF++++  + K 
Sbjct  125   LSSPKHAGTTWVKKKDGKDEIVTSASTNGSLASISRPKQ----TLKSRSFSDKQDHLSKQ  180

Query  894   NHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRA  1073
             + +        +++S++ Q E   EK  LKP+K G P  S+   +S  SPT  DTK  R 
Sbjct  181   SKNSEAA----SSTSNMIQPEGRAEKTRLKPVKLGAPTVSDVNTKSP-SPTE-DTKPRRV  234

Query  1074  GTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLK  1253
               LPSY+FSF+C+ERAEKR+EFYTKLEEK HAKE+E +N+QA++KE+QEAEIKMLRKSL 
Sbjct  235   AALPSYNFSFRCDERAEKRREFYTKLEEKTHAKEIERTNLQAKSKETQEAEIKMLRKSLT  294

Query  1254  FKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDE  1433
             FKATPMP+FYQEPPPPKVELKKIPPTRAKSPKLGR+K SSP  + +  +  ++ RLSLDE
Sbjct  295   FKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGRKK-SSPAPESEGSSSHRSGRLSLDE  353

Query  1434  KPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
             K SQ+N A+  S    KKP RKSLPKLPSE+T +   T +A+
Sbjct  354   KVSQNNPAKGISPGHPKKPLRKSLPKLPSERTNLSKSTNEAA  395



>ref|XP_008219499.1| PREDICTED: neurofilament heavy polypeptide isoform X2 [Prunus 
mume]
Length=461

 Score =   260 bits (665),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 189/400 (47%), Positives = 245/400 (61%), Gaps = 33/400 (8%)
 Frame = +3

Query  375   MDANDKKRIAENGL--GCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEA--EGNFQNA  542
             MD+++   +A  GL    +NGV  Q   V ++I     +G ++ + T E A   G  +N 
Sbjct  1     MDSDN--LVATYGLEVAHQNGVHGQPGVVSDNI-----NGTVSKTTTTETAASNGKIENI  53

Query  543   VNLNDDIAIDSSVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPK  710
             V L+D +  +SS  E   ES V  E N    +   +KE EVK    SK  K+QK  GK K
Sbjct  54    VKLDDGVTNNSSTGEAKEESTVNPERNGLTIALTIAKEGEVKGFPHSKQTKVQKGQGKSK  113

Query  711   NVKLSNPKHA--VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV  884
             N K S PK+   V     K  +  +++++    +  + SR KQP+    K+ SFN R+  
Sbjct  114   NEKPSGPKNVSPVWVKKSKDGNDGEVTAAVSNGSAATTSRPKQPN----KTRSFNGRQ--  167

Query  885   VKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKS  1064
               V       + DT  S    ++        LKPLKK    K+E   QSSLSPT  D K 
Sbjct  168   --VQSSNQLEKSDTELSEGTMEK------TKLKPLKKDSLNKAEGESQSSLSPTEGDMKP  219

Query  1065  HRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRK  1244
              R  TLP+Y FSF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA++KE+ EAEI+MLRK
Sbjct  220   PRVSTLPNYGFSFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSKETLEAEIRMLRK  279

Query  1245  SLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN-RDGKNENGLQTSRL  1421
              L FKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGRRK+  P   +G +    ++SRL
Sbjct  280   KLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRRKSLPPAVSEGNSNTNDRSSRL  339

Query  1422  SLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPS  1541
             SLDEK  Q N A+  S +  KKPQRKSLP+LPSEKT +P+
Sbjct  340   SLDEKVPQ-NSAKGPSPVHPKKPQRKSLPRLPSEKTTLPN  378



>ref|XP_008219498.1| PREDICTED: neurofilament heavy polypeptide isoform X1 [Prunus 
mume]
Length=462

 Score =   259 bits (662),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 188/400 (47%), Positives = 247/400 (62%), Gaps = 32/400 (8%)
 Frame = +3

Query  375   MDANDKKRIAENGL--GCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEA--EGNFQNA  542
             MD+++   +A  GL    +NGV  Q   V ++I     +G ++ + T E A   G  +N 
Sbjct  1     MDSDN--LVATYGLEVAHQNGVHGQPGVVSDNI-----NGTVSKTTTTETAASNGKIENI  53

Query  543   VNLNDDIAIDSSVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPK  710
             V L+D +  +SS  E   ES V  E N    +   +KE EVK    SK  K+QK  GK K
Sbjct  54    VKLDDGVTNNSSTGEAKEESTVNPERNGLTIALTIAKEGEVKGFPHSKQTKVQKGQGKSK  113

Query  711   NVKLSNPKHA--VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV  884
             N K S PK+   V     K  +  +++++    +  + SR KQP+    K+ SFN R+  
Sbjct  114   NEKPSGPKNVSPVWVKKSKDGNDGEVTAAVSNGSAATTSRPKQPN----KTRSFNGRQVQ  169

Query  885   VKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKS  1064
                + ++   + DT  S    ++        LKPLKK    K+E   QSSLSPT  D K 
Sbjct  170   ---SSNQQLEKSDTELSEGTMEK------TKLKPLKKDSLNKAEGESQSSLSPTEGDMKP  220

Query  1065  HRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRK  1244
              R  TLP+Y FSF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA++KE+ EAEI+MLRK
Sbjct  221   PRVSTLPNYGFSFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSKETLEAEIRMLRK  280

Query  1245  SLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN-RDGKNENGLQTSRL  1421
              L FKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGRRK+  P   +G +    ++SRL
Sbjct  281   KLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRRKSLPPAVSEGNSNTNDRSSRL  340

Query  1422  SLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPS  1541
             SLDEK  Q N A+  S +  KKPQRKSLP+LPSEKT +P+
Sbjct  341   SLDEKVPQ-NSAKGPSPVHPKKPQRKSLPRLPSEKTTLPN  379



>ref|XP_008219500.1| PREDICTED: neurofilament heavy polypeptide isoform X3 [Prunus 
mume]
Length=456

 Score =   258 bits (659),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 189/400 (47%), Positives = 245/400 (61%), Gaps = 38/400 (10%)
 Frame = +3

Query  375   MDANDKKRIAENGL--GCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEA--EGNFQNA  542
             MD+++   +A  GL    +NGV  Q   V ++I     +G ++ + T E A   G  +N 
Sbjct  1     MDSDN--LVATYGLEVAHQNGVHGQPGVVSDNI-----NGTVSKTTTTETAASNGKIENI  53

Query  543   VNLNDDIAIDSSVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPK  710
             V L+D +  +SS  E   ES V  E N    +   +KE EVK    SK  K+QK  GK K
Sbjct  54    VKLDDGVTNNSSTGEAKEESTVNPERNGLTIALTIAKEGEVKGFPHSKQTKVQKGQGKSK  113

Query  711   NVKLSNPKHA--VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTV  884
             N K S PK+   V     K  +  +++++    +  + SR KQP+    K+ SFN R+ +
Sbjct  114   NEKPSGPKNVSPVWVKKSKDGNDGEVTAAVSNGSAATTSRPKQPN----KTRSFNGRQQL  169

Query  885   VKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKS  1064
              K          DT  S    ++        LKPLKK    K+E   QSSLSPT  D K 
Sbjct  170   EKS---------DTELSEGTMEK------TKLKPLKKDSLNKAEGESQSSLSPTEGDMKP  214

Query  1065  HRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRK  1244
              R  TLP+Y FSF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA++KE+ EAEI+MLRK
Sbjct  215   PRVSTLPNYGFSFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSKETLEAEIRMLRK  274

Query  1245  SLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN-RDGKNENGLQTSRL  1421
              L FKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGRRK+  P   +G +    ++SRL
Sbjct  275   KLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRRKSLPPAVSEGNSNTNDRSSRL  334

Query  1422  SLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPS  1541
             SLDEK  Q N A+  S +  KKPQRKSLP+LPSEKT +P+
Sbjct  335   SLDEKVPQ-NSAKGPSPVHPKKPQRKSLPRLPSEKTTLPN  373



>ref|XP_010648669.1| PREDICTED: nucleolar and coiled-body phosphoprotein 1 [Vitis 
vinifera]
Length=431

 Score =   256 bits (655),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 189/400 (47%), Positives = 254/400 (64%), Gaps = 18/400 (5%)
 Frame = +3

Query  375   MDANDKKRIAENGL--GCENGVDKQLHAVG-EDIVVDQSDGVLNGSFTIEEAEGNFQNAV  545
             MD +D   +  NGL  G +NG+ +QL A G E ++ ++ +G L+ S       GN +N  
Sbjct  1     MDVDD--LLPVNGLEEGHQNGIHEQLSAAGGEGVIPEKVNGNLDLSTESAGMNGNAENVG  58

Query  546   NLNDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLS  725
               +D+  I++S  EV   S +    N    S++ EV+ +  SK  K QK  GK    KLS
Sbjct  59    MWDDNGIINASTAEVGEGSHIRARVNGLTISEDLEVEDADPSKHSKPQKGQGKSSKEKLS  118

Query  726   NPKHA-VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKT-VVKVNH  899
             +PKHA      KK    + ++S+S   +  S SR KQ      KS SF++++  + K + 
Sbjct  119   SPKHAGTTWVKKKDGKDEIVTSASTNGSLASISRPKQ----TLKSRSFSDKQDHLSKQSK  174

Query  900   DKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGT  1079
             +        +++S++ Q E   EK  LKP+K G P  S+   +S  SPT  DTK  R   
Sbjct  175   NSEAA----SSTSNMIQPEGRAEKTRLKPVKLGAPTVSDVNTKSP-SPTE-DTKPRRVAA  228

Query  1080  LPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFK  1259
             LPSY+FSF+C+ERAEKR+EFYTKLEEK HAKE+E +N+QA++KE+QEAEIKMLRKSL FK
Sbjct  229   LPSYNFSFRCDERAEKRREFYTKLEEKTHAKEIERTNLQAKSKETQEAEIKMLRKSLTFK  288

Query  1260  ATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKP  1439
             ATPMP+FYQEPPPPKVELKKIPPTRAKSPKLGR+K SSP  + +  +  ++ RLSLDEK 
Sbjct  289   ATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGRKK-SSPAPESEGSSSHRSGRLSLDEKV  347

Query  1440  SQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
             SQ+N A+  S    KKP RKSLPKLPSE+T +   T +A+
Sbjct  348   SQNNPAKGISPGHPKKPLRKSLPKLPSERTNLSKSTNEAA  387



>ref|XP_006353688.1| PREDICTED: protein WVD2-like 1-like [Solanum tuberosum]
Length=273

 Score =   251 bits (640),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 146/263 (56%), Positives = 184/263 (70%), Gaps = 26/263 (10%)
 Frame = +3

Query  1011  SEATGQSSLSPTAA-DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEES  1187
             ++ + +SS SPTAA D K+ + GTLP+Y+ SFKC+ERAEKRKEFY+KLEEK  AKE+E+S
Sbjct  11    ADGSAESSSSPTAASDAKTRKVGTLPTYNISFKCDERAEKRKEFYSKLEEKTQAKEVEKS  70

Query  1188  NMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKT  1367
             NMQA+TKE+QEAEIKMLRKSLKFKATPMP+FYQEP PPK+ELKKIPPTRAKSPKLGRRK 
Sbjct  71    NMQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGRRK-  129

Query  1368  SSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSET  1547
             SSP ++  NE+ ++  RLSLDE  SQ N  +  S + VKKPQRKSLPKLPSEKT + +ET
Sbjct  130   SSPTKERINESVMRPGRLSLDENASQSNPVKGHSPLIVKKPQRKSLPKLPSEKTNLSNET  189

Query  1548  K--------------KASPIKTSISKEITEVDSQPNIVAKVTDEAED----------VHA  1655
             +              +A+ +  ++ KE +EV SQ N   K   E +           V  
Sbjct  190   RKLSIRKSSSSKESTEAASLLNALPKETSEVSSQSNNQHKQATEFDADGQECEIVSVVEP  249

Query  1656  SETEPKENDEADMSLVQEPITVE  1724
             S+TE       + +LVQE +T+E
Sbjct  250   SQTETGVKARIETNLVQEHVTIE  272



>ref|XP_009376921.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Pyrus x bretschneideri]
Length=454

 Score =   256 bits (653),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 195/432 (45%), Positives = 253/432 (59%), Gaps = 52/432 (12%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDS  575
             +  +NGV  Q   V +D         +NG+F+         + G   NA  ++D     S
Sbjct  14    VAHQNGVHGQAGVVSDD---------MNGTFSENAMTETAASSGKIGNADKVDDGGTNSS  64

Query  576   SVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHA-  740
             SV E I  ++ P ESN    +   +KE EVK S  SK  K+ K PGK KN K   PK   
Sbjct  65    SVWEAIEANVNP-ESNGLTVALTIAKEDEVKGSTHSKPAKVHKGPGKSKNEKAPGPKSVS  123

Query  741   -VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGR  917
               +    K  +G +  +S    +  S SR KQP+    K+ SFN R+   K++ +     
Sbjct  124   PTLTKKSKDGNGTEAKASVSNGSAASNSRLKQPN----KNRSFNGRQQPEKLDAE-----  174

Query  918   PDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSF  1097
                         E   EK  LKPLKKG   ++E   QSSLSPT  D K  R GTLP Y F
Sbjct  175   ----------LSEGSVEKAKLKPLKKGSQNQTEGESQSSLSPTEGD-KQPRVGTLPKYGF  223

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA+++E+ EAEI+MLRK L FKATPMP+
Sbjct  224   SFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSEETLEAEIRMLRKKLTFKATPMPS  283

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKPSQDN  1451
             FYQEPPPPKVELKKIP TRAKSPKLGRRK+  P  +    N NG ++SRLSLDEK  Q N
Sbjct  284   FYQEPPPPKVELKKIPTTRAKSPKLGRRKSLPPAVSEAHGNTNG-RSSRLSLDEKVPQ-N  341

Query  1452  LARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVT  1631
              A+  S +  KKPQRKSLP+LPSEKT +P+   +      ++++E T      N++A + 
Sbjct  342   SAKGPSPVHPKKPQRKSLPRLPSEKTTLPNVVNEPKTTSKAVNEEKT------NLIAAMI  395

Query  1632  DEAEDVHASETE  1667
             +E   V  +E E
Sbjct  396   EENATVPTAEGE  407



>ref|XP_009376920.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=459

 Score =   255 bits (652),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 194/432 (45%), Positives = 252/432 (58%), Gaps = 47/432 (11%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDS  575
             +  +NGV  Q   V +D         +NG+F+         + G   NA  ++D     S
Sbjct  14    VAHQNGVHGQAGVVSDD---------MNGTFSENAMTETAASSGKIGNADKVDDGGTNSS  64

Query  576   SVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHA-  740
             SV E I  ++ P ESN    +   +KE EVK S  SK  K+ K PGK KN K   PK   
Sbjct  65    SVWEAIEANVNP-ESNGLTVALTIAKEDEVKGSTHSKPAKVHKGPGKSKNEKAPGPKSVS  123

Query  741   -VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGR  917
               +    K  +G +  +S    +  S SR KQP+    K+ SFN R+    V       +
Sbjct  124   PTLTKKSKDGNGTEAKASVSNGSAASNSRLKQPN----KNRSFNGRQ----VQSSNQPEK  175

Query  918   PDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSF  1097
              D   S    ++        LKPLKKG   ++E   QSSLSPT  D K  R GTLP Y F
Sbjct  176   LDAELSEGSVEK------AKLKPLKKGSQNQTEGESQSSLSPTEGD-KQPRVGTLPKYGF  228

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA+++E+ EAEI+MLRK L FKATPMP+
Sbjct  229   SFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSEETLEAEIRMLRKKLTFKATPMPS  288

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKPSQDN  1451
             FYQEPPPPKVELKKIP TRAKSPKLGRRK+  P  +    N NG ++SRLSLDEK  Q N
Sbjct  289   FYQEPPPPKVELKKIPTTRAKSPKLGRRKSLPPAVSEAHGNTNG-RSSRLSLDEKVPQ-N  346

Query  1452  LARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVT  1631
              A+  S +  KKPQRKSLP+LPSEKT +P+   +      ++++E T      N++A + 
Sbjct  347   SAKGPSPVHPKKPQRKSLPRLPSEKTTLPNVVNEPKTTSKAVNEEKT------NLIAAMI  400

Query  1632  DEAEDVHASETE  1667
             +E   V  +E E
Sbjct  401   EENATVPTAEGE  412



>ref|XP_009355746.1| PREDICTED: titin-like isoform X2 [Pyrus x bretschneideri]
Length=458

 Score =   254 bits (650),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 190/423 (45%), Positives = 251/423 (59%), Gaps = 47/423 (11%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDS  575
             +  +NGV  Q   V +D         +NG+F+         + G  +N   L+D +  +S
Sbjct  14    VAHQNGVRGQAGVVSDD---------MNGTFSEKTMTDTAASNGKIENVDKLDDGVNNNS  64

Query  576   SVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHA-  740
             S+ +    ++ P ESN    +   +KE+EVK S   K  K+ K PGK KN K    K   
Sbjct  65    SIWKAKEANVNP-ESNGLTVALTIAKENEVKGSTHPKPAKVHKGPGKSKNEKAPGAKSVS  123

Query  741   -VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGR  917
              +     K  +G +  +S+   +    SR KQP+    KS SFN R+    V       +
Sbjct  124   PISMKKSKDGNGAEAKASASNGSAAPNSRPKQPN----KSGSFNGRQ----VQSSNQPEK  175

Query  918   PDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSF  1097
             PD   S      ES  EK  LKPLKKG   ++E   QSSLSPT  D K  R GTLP+Y F
Sbjct  176   PDAELS------ESSVEKAKLKPLKKGSQNQAEGESQSSLSPTEGD-KHPRVGTLPNYGF  228

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKR+EFYTK+EEKIHAKEME++N+QA++KE+ EAEI+MLRK L FKATPMP+
Sbjct  229   SFRCDERAEKRREFYTKMEEKIHAKEMEKNNLQAKSKETLEAEIRMLRKKLTFKATPMPS  288

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKPSQDN  1451
             FYQEPPPPKVELKKIP TRAKSPKLGRRK+  P  +    N NG Q+SRLSLD+K  Q N
Sbjct  289   FYQEPPPPKVELKKIPITRAKSPKLGRRKSLPPAVSEANGNTNG-QSSRLSLDQKVPQ-N  346

Query  1452  LARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVT  1631
              ++  S +  KKPQRKSLP+LPSEKT +P+   +      ++ +E T      N++A + 
Sbjct  347   TSKGPSPVHPKKPQRKSLPRLPSEKTTLPNAVNERKTTFKAVKEEKT------NLIAAMN  400

Query  1632  DEA  1640
             + A
Sbjct  401   ENA  403



>ref|XP_009376919.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=460

 Score =   254 bits (650),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 193/432 (45%), Positives = 254/432 (59%), Gaps = 46/432 (11%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDS  575
             +  +NGV  Q   V +D         +NG+F+         + G   NA  ++D     S
Sbjct  14    VAHQNGVHGQAGVVSDD---------MNGTFSENAMTETAASSGKIGNADKVDDGGTNSS  64

Query  576   SVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHA-  740
             SV E I  ++ P ESN    +   +KE EVK S  SK  K+ K PGK KN K   PK   
Sbjct  65    SVWEAIEANVNP-ESNGLTVALTIAKEDEVKGSTHSKPAKVHKGPGKSKNEKAPGPKSVS  123

Query  741   -VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGR  917
               +    K  +G +  +S    +  S SR KQP+    K+ SFN R+     + ++   +
Sbjct  124   PTLTKKSKDGNGTEAKASVSNGSAASNSRLKQPN----KNRSFNGRQVQ---SSNQQPEK  176

Query  918   PDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSF  1097
              D   S    ++        LKPLKKG   ++E   QSSLSPT  D K  R GTLP Y F
Sbjct  177   LDAELSEGSVEK------AKLKPLKKGSQNQTEGESQSSLSPTEGD-KQPRVGTLPKYGF  229

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA+++E+ EAEI+MLRK L FKATPMP+
Sbjct  230   SFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSEETLEAEIRMLRKKLTFKATPMPS  289

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKPSQDN  1451
             FYQEPPPPKVELKKIP TRAKSPKLGRRK+  P  +    N NG ++SRLSLDEK  Q N
Sbjct  290   FYQEPPPPKVELKKIPTTRAKSPKLGRRKSLPPAVSEAHGNTNG-RSSRLSLDEKVPQ-N  347

Query  1452  LARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVT  1631
              A+  S +  KKPQRKSLP+LPSEKT +P+   +      ++++E T      N++A + 
Sbjct  348   SAKGPSPVHPKKPQRKSLPRLPSEKTTLPNVVNEPKTTSKAVNEEKT------NLIAAMI  401

Query  1632  DEAEDVHASETE  1667
             +E   V  +E E
Sbjct  402   EENATVPTAEGE  413



>gb|EYU20263.1| hypothetical protein MIMGU_mgv1a007003mg [Erythranthe guttata]
Length=423

 Score =   253 bits (646),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 191/419 (46%), Positives = 249/419 (59%), Gaps = 26/419 (6%)
 Frame = +3

Query  495   NGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSG-ES  671
             NG   IE    N ++AV LND   + ++ +E+  E  +  ES+S +  K+   K SG +S
Sbjct  21    NGGLEIEGLNENLEDAVKLNDHKTL-ATGKEMAEEPSLKPESHSTSKFKKVGAKESGGDS  79

Query  672   KSGKLQKAPGKPKN------VKLSNPKHAVvagskkgkdgkdissssvisngtsasRAKQ  833
             K+ K  K  G+ KN        LS  K    A            +S        A R  +
Sbjct  80    KNLKPVKGIGRAKNPGNVGATVLSKSKDEREAIKPSVASNGTTGASKSQKIQIPAVRKNK  139

Query  834   PSAPIEKSTSFNERKTVVKVNHDKHCGR-PDTTTSSSVAQRESHkekpllkplkkgppkk  1010
             PS   EK    N R T ++ N  KH G  PD T+SS+  ++     +       +     
Sbjct  140   PSN--EKQGVDNLRSTSLQDN-SKHDGLLPDATSSSTSEEQSEEPSEKTKLKALRKSSHD  196

Query  1011  SE--ATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEE  1184
             SE      SSLSPTA D+K  ++GTLP+Y FSFKC ERAEKRKEFY+KLEEKI AKE E+
Sbjct  197   SENEEMSHSSLSPTAGDSKPRKSGTLPTYGFSFKCYERAEKRKEFYSKLEEKIQAKEEEK  256

Query  1185  SNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             SN+QA+TKESQ+AEI+M RKSL FKATPMP+FYQEPPPPK+ELKKIP TRAKSPKLGR+K
Sbjct  257   SNIQAKTKESQDAEIRMFRKSLAFKATPMPSFYQEPPPPKLELKKIPTTRAKSPKLGRKK  316

Query  1365  TSSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSE  1544
             T+    D K ENG + +RLSLDEK +Q N+A  ++   VKKP RKSLPKLPSE+  +  E
Sbjct  317   TA----DSK-ENGARPARLSLDEKLTQSNVA--KAPPHVKKPLRKSLPKLPSEEADLSFE  369

Query  1545  TKKASPIKTSISKEITEVDSQPNIVAKVTDEAEDVHASETEPKENDEADMSLVQEPITV  1721
              KK+   K + +KE  E      +V + +D +E+V+ SE EP    + + SLV+E I V
Sbjct  370   KKKSVSRKITATKETGES----VVVVQASDLSEEVNKSE-EPVLEVQENASLVREAIAV  423



>ref|XP_009355744.1| PREDICTED: titin-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009355745.1| PREDICTED: titin-like isoform X1 [Pyrus x bretschneideri]
Length=459

 Score =   253 bits (647),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 184/390 (47%), Positives = 240/390 (62%), Gaps = 40/390 (10%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDS  575
             +  +NGV  Q   V +D         +NG+F+         + G  +N   L+D +  +S
Sbjct  14    VAHQNGVRGQAGVVSDD---------MNGTFSEKTMTDTAASNGKIENVDKLDDGVNNNS  64

Query  576   SVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHA-  740
             S+ +    ++ P ESN    +   +KE+EVK S   K  K+ K PGK KN K    K   
Sbjct  65    SIWKAKEANVNP-ESNGLTVALTIAKENEVKGSTHPKPAKVHKGPGKSKNEKAPGAKSVS  123

Query  741   -VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGR  917
              +     K  +G +  +S+   +    SR KQP+    KS SFN R+     + ++   +
Sbjct  124   PISMKKSKDGNGAEAKASASNGSAAPNSRPKQPN----KSGSFNGRQVQ---SSNQQPEK  176

Query  918   PDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSF  1097
             PD   S      ES  EK  LKPLKKG   ++E   QSSLSPT  D K  R GTLP+Y F
Sbjct  177   PDAELS------ESSVEKAKLKPLKKGSQNQAEGESQSSLSPTEGD-KHPRVGTLPNYGF  229

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKR+EFYTK+EEKIHAKEME++N+QA++KE+ EAEI+MLRK L FKATPMP+
Sbjct  230   SFRCDERAEKRREFYTKMEEKIHAKEMEKNNLQAKSKETLEAEIRMLRKKLTFKATPMPS  289

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKPSQDN  1451
             FYQEPPPPKVELKKIP TRAKSPKLGRRK+  P  +    N NG Q+SRLSLD+K  Q N
Sbjct  290   FYQEPPPPKVELKKIPITRAKSPKLGRRKSLPPAVSEANGNTNG-QSSRLSLDQKVPQ-N  347

Query  1452  LARRRSLIDVKKPQRKSLPKLPSEKTYIPS  1541
              ++  S +  KKPQRKSLP+LPSEKT +P+
Sbjct  348   TSKGPSPVHPKKPQRKSLPRLPSEKTTLPN  377



>gb|EYU32347.1| hypothetical protein MIMGU_mgv1a007026mg [Erythranthe guttata]
Length=422

 Score =   251 bits (640),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 202/414 (49%), Positives = 250/414 (60%), Gaps = 37/414 (9%)
 Frame = +3

Query  462   DIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHESMVPLESNSCADSK  641
             +  V+  +G  NGS  IEE   N ++AV   D        Q V  +  +P ES+S     
Sbjct  13    ECAVEYENGASNGSLGIEELSANLEDAVKPTD--------QSVKEDLSLPPESHSNTTPM  64

Query  642   ESEVKTSGESKSGKLQKA-PGKPKNVKLSNPKHAVvagskkgkdgkdissssvisngtsa  818
             E  VK S +SK+ K QK    K KN K   PK     G  K KDGK++S SSV SNG + 
Sbjct  65    EIVVKESSDSKNLKPQKGITAKVKNGKSPTPKQGASTGLTKVKDGKEVSKSSVASNGKT-  123

Query  819   sRAKQPSAPIEKSTSFNERK-------TVVKVNHDKHCGRPDTTTSSSVAQRESHkekpl  977
                   SA   +S SFNE++       T V+ NH     + D T S       +  E+  
Sbjct  124   ------SALKTRSKSFNEKQAADSPKVTSVQNNHSIPKAKQDETPSPKSG---ASPEELP  174

Query  978   lkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEE  1157
              +   K   K S  T +SSLSPT+AD+K  + G LP+Y FSFKCNERAEKR+EFY+KLEE
Sbjct  175   EESKLKALKKGSSVTSESSLSPTSADSKQRKLGNLPTYGFSFKCNERAEKRREFYSKLEE  234

Query  1158  KIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRA  1337
             KIHAKE E+++MQA++KE+QEAEIKM RKSL FKATPMPTFYQEPPPPKVELKKIP TRA
Sbjct  235   KIHAKEAEKNDMQAKSKETQEAEIKMFRKSLAFKATPMPTFYQEPPPPKVELKKIPTTRA  294

Query  1338  KSPKLGRRKTSSPNRDGKNENGL--QTSRLSLDEKPSQDNLARRR--SLIDVKKPQRKSL  1505
             KSPKLGR+KT SPN D +  + +  + SRLSLDEK S +N   +    +  VKKP RKSL
Sbjct  295   KSPKLGRKKT-SPNADSEESDAIIARPSRLSLDEKISHNNHLDKAPPPVAHVKKPMRKSL  353

Query  1506  PKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVTDEAEDVHASETE  1667
             PKLPSE T + +E KKA P K +  KEI +   Q N      DEA +  A+ TE
Sbjct  354   PKLPSENTTLSNEKKKAPPRKITTPKEIKDSLIQTN------DEATESAAAGTE  401



>ref|XP_010048967.1| PREDICTED: uncharacterized protein LOC104437670 [Eucalyptus grandis]
 gb|KCW81394.1| hypothetical protein EUGRSUZ_C02774 [Eucalyptus grandis]
Length=429

 Score =   250 bits (638),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 179/386 (46%), Positives = 221/386 (57%), Gaps = 35/386 (9%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHES  602
             +NG+  Q    GED +   +  ++  +  +   E N         +  +D S  +    +
Sbjct  17    QNGMHGQFLNNGEDAIAVSNADIVAETADLVAVEANLH-------EFKLDGSGNDNSFST  69

Query  603   MVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgkdi  782
                 E  +    K+ E  T  + K    QK  GK  N KLSN K A           +  
Sbjct  70    GCASEIGASETHKDGETVTGDKLKVSGPQKIEGKKSNGKLSNIKVA------STIGARKS  123

Query  783   ssssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESH  962
                  +     +S+ KQP+     S SFNER+T       KH G+ D   S S A++   
Sbjct  124   KDGKNVEAVGVSSQTKQPAV----SRSFNERET-----QSKHGGKSDAAMSESFAEK---  171

Query  963   kekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFY  1142
                  LKPLKKG   K EA  QSS SPTA D+K  + G LP+Y FSF+C++RAEKRKE+Y
Sbjct  172   ---TKLKPLKKGSLDKPEADAQSSPSPTAGDSKPRKVGALPNYGFSFRCDQRAEKRKEYY  228

Query  1143  TKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKI  1322
             TKLEEKIHAKEME + +Q ++KE+ EAEIKMLRKSL FKATPMP+FYQEPPPPK ELKKI
Sbjct  229   TKLEEKIHAKEMERTTLQEKSKETLEAEIKMLRKSLTFKATPMPSFYQEPPPPKAELKKI  288

Query  1323  PPTRAKSPKLGRRKTSSPNRDGKNENGL---QTSRLSLDEKPSQDNLARRRSLIDVKKPQ  1493
             P TRAKSPKLGRRKTSS   D   ENG    Q  RLSLDEK S+DN A+  S  + KKP 
Sbjct  289   PTTRAKSPKLGRRKTSS--MDESKENGRATQQLGRLSLDEKVSRDNSAKGPSPANSKKPL  346

Query  1494  RKSLPKLPSEKTYIPSETKKASPIKT  1571
             RKSLPKLPSEKT +   T  A  +KT
Sbjct  347   RKSLPKLPSEKTTLSGGT--ARTVKT  370



>ref|XP_011036553.1| PREDICTED: uncharacterized protein LOC105134022 isoform X1 [Populus 
euphratica]
Length=435

 Score =   249 bits (636),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 179/375 (48%), Positives = 225/375 (60%), Gaps = 31/375 (8%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHES  602
             +NGV +Q  A GED VV         S  + E+ GN     +  +DI    S +EV  E 
Sbjct  18    QNGVHEQSAAAGEDGVV---------SNNLSESMGNAFKVDDCTNDIL---STREVEGEL  65

Query  603   MVPLESNSCADSKESE--VKTSGESKSGKLQKAPGKPKNVKLSNPKH-AVvagskkgkdg  773
              V +  N  + SKE E  VK +  S+  + QK  GK  N K SNPK+ +      K    
Sbjct  66    KVYVGINGFSVSKEGEAKVKDADNSEKARSQKGSGKSGNAKPSNPKNVSATQVKGKDGRD  125

Query  774   kdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQR  953
                 ++    +    S+ KQP     KS SFNER+        K  G+ D   S+ + ++
Sbjct  126   AVARTAVSNGSVAVNSQLKQPL----KSNSFNERQG----QASKQSGKSDAVLSAGLVEK  177

Query  954   ESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRK  1133
                     LKPLK G   K+E   +S+LSPTA D K  + GTLP+Y FSFKC+ERAEKRK
Sbjct  178   ------AKLKPLKNGTVVKAEGETESTLSPTAEDAKPRKFGTLPNYGFSFKCDERAEKRK  231

Query  1134  EFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVEL  1313
             EFYTKLEEKIHAKE+E+S +QA++KE+QEAEIK+ RKSL FKATPMP+FYQEP P KVEL
Sbjct  232   EFYTKLEEKIHAKEVEKSTLQAKSKETQEAEIKLFRKSLAFKATPMPSFYQEPAPLKVEL  291

Query  1314  KKIPPTRAKSPKLGRRKTSSP-NRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKP  1490
             KKIP TRAKSPKLGR+K+ SP + +GKN    ++ RLSLDEK S   +  R S    KKP
Sbjct  292   KKIPTTRAKSPKLGRKKSPSPADSEGKNSQSSRSGRLSLDEKIS-SKIPIRLSPAHPKKP  350

Query  1491  QRKSLPKLPSEKTYI  1535
              RKSLPKLPSEK  +
Sbjct  351   LRKSLPKLPSEKINL  365



>ref|XP_009376914.1| PREDICTED: titin-like isoform X2 [Pyrus x bretschneideri]
Length=459

 Score =   249 bits (636),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 195/432 (45%), Positives = 252/432 (58%), Gaps = 47/432 (11%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDS  575
             +  +NGV  Q   V +D         +NG+F+         + G   NA  ++D     S
Sbjct  14    VAHQNGVHGQAGVVSDD---------MNGTFSENAMTETAASSGKIGNADKVDDGGTNSS  64

Query  576   SVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAV  743
             SV E I  ++ P ESN    +   +KE EVK S  SK  K+ K PGK KN K   PK   
Sbjct  65    SVWEAIEANVNP-ESNGLTVALTIAKEDEVKGSTHSKPAKVHKGPGKSKNEKAPGPKSVS  123

Query  744   va--gskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGR  917
              +     K  +G +  +S    +  S SR KQP+    K+ SF  R+    V       +
Sbjct  124   PSLMKKSKDGNGTEAKASVSNGSAASNSRPKQPN----KNRSFIGRQ----VQSSNQPEK  175

Query  918   PDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSF  1097
              D   S      E   EK  LKPLKKG   ++E   QSSLSPT  D K  R GTLP Y F
Sbjct  176   LDAELS------EGSVEKAKLKPLKKGSQNQAEGESQSSLSPTEGD-KQPRVGTLPKYGF  228

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA+++E+ EAEI+MLRK L FKATPMP+
Sbjct  229   SFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSEETLEAEIRMLRKKLTFKATPMPS  288

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKPSQDN  1451
             FYQEPPPPKVELKKIP TRAKSPKL RRK+  P  +    N NG ++SRLSLDEK  Q N
Sbjct  289   FYQEPPPPKVELKKIPTTRAKSPKLSRRKSLPPAVSEAHGNTNG-RSSRLSLDEKVPQ-N  346

Query  1452  LARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVT  1631
              A+  S +  KKPQRKSLP+LPSEKT +P+   +      ++++E T      N++A + 
Sbjct  347   TAKGPSPVHPKKPQRKSLPRLPSEKTTLPNVVNEPKTTSKAVNEEKT------NLIAAMI  400

Query  1632  DEAEDVHASETE  1667
             +E   V  +E+E
Sbjct  401   EENATVPTAESE  412



>ref|XP_008394082.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Malus 
domestica]
Length=458

 Score =   248 bits (634),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 186/423 (44%), Positives = 246/423 (58%), Gaps = 47/423 (11%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDS  575
             +  +NGV  Q   V +D         +NG+F+         + G  +N   L+D +   S
Sbjct  14    VAHQNGVHGQAGVVSDD---------MNGTFSENTMTDTAASNGKIENVDKLDDGVTNSS  64

Query  576   SVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHA-  740
             S+ +    ++ P ESN    +   +KE EVK S   K  K+ K  GK KN K    K   
Sbjct  65    SIWKAKEANVNP-ESNGLTVALTIAKEDEVKGSTHPKPAKVHKGXGKSKNEKAPGAKSIS  123

Query  741   -VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGR  917
              +     K  +G +  +S    +    SR KQP+    KS SFN R+    V       +
Sbjct  124   PISMKKSKDGNGAEAKASVSNGSAAPNSRPKQPN----KSRSFNGRQ----VQSSNQPEK  175

Query  918   PDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSF  1097
             PD   S S  ++        LKPLKKG   ++E   QSSLSPT  D K  R GTLP+Y F
Sbjct  176   PDAELSESSVEK------AKLKPLKKGSQNQAEGESQSSLSPTEGD-KHPRVGTLPNYGF  228

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA++KE+ EAEI+MLRK L FKATPMP+
Sbjct  229   SFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSKETLEAEIRMLRKKLTFKATPMPS  288

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKPSQDN  1451
             FYQEPPPPKVELKKIP TRAKSPKLGRR +  P  +    N NG Q+SRLSLD+K  Q N
Sbjct  289   FYQEPPPPKVELKKIPTTRAKSPKLGRRNSLPPAVSEAKGNTNG-QSSRLSLDQKVPQ-N  346

Query  1452  LARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVT  1631
              ++  S +  KKPQRKSLP+LPSEKT +P+   +      ++++E T      N++A + 
Sbjct  347   TSKGPSPVHPKKPQRKSLPRLPSEKTTLPNAVNERKMTLKAVNEEKT------NLIAAMN  400

Query  1632  DEA  1640
             + A
Sbjct  401   ENA  403



>ref|XP_008352059.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Malus 
domestica]
Length=458

 Score =   248 bits (634),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 189/423 (45%), Positives = 247/423 (58%), Gaps = 47/423 (11%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDS  575
             +  +NGV  Q   V +D         +NG+F+         + G  +N   L+D +   S
Sbjct  14    VAHQNGVHGQAGVVSDD---------MNGTFSENTMTDTAASNGKIENVDKLDDGVTNSS  64

Query  576   SVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHA-  740
             S+ +    ++ P ESN    +   +KE EVK S   K  K+ K  GK KN K    K   
Sbjct  65    SIWKAKEANVNP-ESNGLTVALTIAKEDEVKGSTHPKPAKVHKGQGKSKNEKAPGAKSIS  123

Query  741   -VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGR  917
              +     K  +G +  +S    +    SR KQP+    KS SFN R+    V       +
Sbjct  124   PISMKKSKDGNGAEAKASVSNGSAAPNSRPKQPN----KSRSFNGRQ----VQSSNQPEK  175

Query  918   PDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSF  1097
             PD   S      ES  EK  LKPLKKG   ++E   QSSLSPT  D K  R GTLP+Y F
Sbjct  176   PDAELS------ESSVEKAKLKPLKKGSQNQAEGESQSSLSPTEGD-KHPRVGTLPNYGF  228

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA++KE+ EAEI+MLRK L FKATPMP+
Sbjct  229   SFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSKETLEAEIRMLRKKLTFKATPMPS  288

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKPSQDN  1451
             FYQEPPPPKVELKKIP TRAKSPKLGRR +  P  +    N NG Q+SRLSLD+K  Q N
Sbjct  289   FYQEPPPPKVELKKIPTTRAKSPKLGRRNSLPPAVSEAKGNTNG-QSSRLSLDQKVPQ-N  346

Query  1452  LARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVT  1631
              ++  S +  KKPQRKSLP+LPSEKT +P+   +      ++++E T      N++A + 
Sbjct  347   TSKGPSPVHPKKPQRKSLPRLPSEKTTLPNAVNERKMTLKAVNEEKT------NLIAAMN  400

Query  1632  DEA  1640
             + A
Sbjct  401   ENA  403



>ref|XP_008378378.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Malus 
domestica]
Length=453

 Score =   248 bits (632),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 191/436 (44%), Positives = 250/436 (57%), Gaps = 66/436 (15%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDSSVQ  584
             +NGV  Q   V +D         +NG+F+         + G   NA  ++D     SSV 
Sbjct  17    QNGVHGQAGVVSDD---------MNGTFSENAMTETAASSGKIGNADKVDDGGTNSSSVW  67

Query  585   EVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvag  752
             E I  ++ P ESN    +   +KE EVK S  SK  K+ K PGK KN K   PK      
Sbjct  68    EAIEANVNP-ESNGLTVALTIAKEDEVKGSTXSKPAKVHKGPGKSKNEKAPGPKSVSPTL  126

Query  753   skkgkdgkdissssvisngtsasRA--KQPSAPIEKSTSFNERKTVVKVNHDKHCG----  914
              KK KDG    + + +SNG++A  +  KQP+    K+  FN R+   K++ +   G    
Sbjct  127   MKKSKDGNGTEAKASVSNGSAAPNSCPKQPN----KNRLFNGRQQPEKLDAELSEGSVEK  182

Query  915   ---RPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLP  1085
                +P    S + A+ ES                      QSSLSPT  D K  R GTLP
Sbjct  183   AKLKPLKKGSQNQAEGES----------------------QSSLSPTEGD-KQPRVGTLP  219

Query  1086  SYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKAT  1265
              Y FSF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA+++E+ EAEI+MLRK L FKAT
Sbjct  220   KYGFSFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSEETLEAEIRMLRKKLTFKAT  279

Query  1266  PMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKP  1439
             PMP+FYQEPPPPKVELKKIP TRAKSPKLGRRK+  P  +    N NG ++SRLSLDEK 
Sbjct  280   PMPSFYQEPPPPKVELKKIPTTRAKSPKLGRRKSLPPAVSEAHGNTNG-RSSRLSLDEKV  338

Query  1440  SQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIV  1619
              Q N A+  S +  KKPQRKSLP+LPSEKT +P+   +      ++++E T      N++
Sbjct  339   PQ-NTAKGPSPVHPKKPQRKSLPRLPSEKTTLPNVVNEPKMTSKAVNEEKT------NLI  391

Query  1620  AKVTDEAEDVHASETE  1667
             A   +E      +E+E
Sbjct  392   AATIEENATXPTAESE  407



>ref|XP_008394080.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Malus 
domestica]
 ref|XP_008394081.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Malus 
domestica]
Length=459

 Score =   248 bits (632),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 188/423 (44%), Positives = 249/423 (59%), Gaps = 46/423 (11%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDS  575
             +  +NGV  Q   V +D         +NG+F+         + G  +N   L+D +   S
Sbjct  14    VAHQNGVHGQAGVVSDD---------MNGTFSENTMTDTAASNGKIENVDKLDDGVTNSS  64

Query  576   SVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHA-  740
             S+ +    ++ P ESN    +   +KE EVK S   K  K+ K  GK KN K    K   
Sbjct  65    SIWKAKEANVNP-ESNGLTVALTIAKEDEVKGSTHPKPAKVHKGXGKSKNEKAPGAKSIS  123

Query  741   -VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGR  917
              +     K  +G +  +S    +    SR KQP+    KS SFN R+     + ++   +
Sbjct  124   PISMKKSKDGNGAEAKASVSNGSAAPNSRPKQPN----KSRSFNGRQVQ---SSNQQPEK  176

Query  918   PDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSF  1097
             PD   S      ES  EK  LKPLKKG   ++E   QSSLSPT  D K  R GTLP+Y F
Sbjct  177   PDAELS------ESSVEKAKLKPLKKGSQNQAEGESQSSLSPTEGD-KHPRVGTLPNYGF  229

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA++KE+ EAEI+MLRK L FKATPMP+
Sbjct  230   SFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSKETLEAEIRMLRKKLTFKATPMPS  289

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKPSQDN  1451
             FYQEPPPPKVELKKIP TRAKSPKLGRR +  P  +    N NG Q+SRLSLD+K  Q N
Sbjct  290   FYQEPPPPKVELKKIPTTRAKSPKLGRRNSLPPAVSEAKGNTNG-QSSRLSLDQKVPQ-N  347

Query  1452  LARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVT  1631
              ++  S +  KKPQRKSLP+LPSEKT +P+   +      ++++E T      N++A + 
Sbjct  348   TSKGPSPVHPKKPQRKSLPRLPSEKTTLPNAVNERKMTLKAVNEEKT------NLIAAMN  401

Query  1632  DEA  1640
             + A
Sbjct  402   ENA  404



>ref|XP_008352057.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Malus 
domestica]
 ref|XP_008352058.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Malus 
domestica]
Length=459

 Score =   247 bits (631),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 188/423 (44%), Positives = 249/423 (59%), Gaps = 46/423 (11%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFT------IEEAEGNFQNAVNLNDDIAIDS  575
             +  +NGV  Q   V +D         +NG+F+         + G  +N   L+D +   S
Sbjct  14    VAHQNGVHGQAGVVSDD---------MNGTFSENTMTDTAASNGKIENVDKLDDGVTNSS  64

Query  576   SVQEVIHESMVPLESN----SCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHA-  740
             S+ +    ++ P ESN    +   +KE EVK S   K  K+ K  GK KN K    K   
Sbjct  65    SIWKAKEANVNP-ESNGLTVALTIAKEDEVKGSTHPKPAKVHKGQGKSKNEKAPGAKSIS  123

Query  741   -VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGR  917
              +     K  +G +  +S    +    SR KQP+    KS SFN R+     + ++   +
Sbjct  124   PISMKKSKDGNGAEAKASVSNGSAAPNSRPKQPN----KSRSFNGRQVQ---SSNQQPEK  176

Query  918   PDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSF  1097
             PD   S      ES  EK  LKPLKKG   ++E   QSSLSPT  D K  R GTLP+Y F
Sbjct  177   PDAELS------ESSVEKAKLKPLKKGSQNQAEGESQSSLSPTEGD-KHPRVGTLPNYGF  229

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKR+EFYTKLEEKIHAKEME++N+QA++KE+ EAEI+MLRK L FKATPMP+
Sbjct  230   SFRCDERAEKRREFYTKLEEKIHAKEMEKNNLQAKSKETLEAEIRMLRKKLTFKATPMPS  289

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP--NRDGKNENGLQTSRLSLDEKPSQDN  1451
             FYQEPPPPKVELKKIP TRAKSPKLGRR +  P  +    N NG Q+SRLSLD+K  Q N
Sbjct  290   FYQEPPPPKVELKKIPTTRAKSPKLGRRNSLPPAVSEAKGNTNG-QSSRLSLDQKVPQ-N  347

Query  1452  LARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVT  1631
              ++  S +  KKPQRKSLP+LPSEKT +P+   +      ++++E T      N++A + 
Sbjct  348   TSKGPSPVHPKKPQRKSLPRLPSEKTTLPNAVNERKMTLKAVNEEKT------NLIAAMN  401

Query  1632  DEA  1640
             + A
Sbjct  402   ENA  404



>ref|XP_002309627.2| hypothetical protein POPTR_0006s27050g [Populus trichocarpa]
 gb|EEE93150.2| hypothetical protein POPTR_0006s27050g [Populus trichocarpa]
Length=436

 Score =   246 bits (627),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 200/463 (43%), Positives = 261/463 (56%), Gaps = 43/463 (9%)
 Frame = +3

Query  375   MDANDKKRIAENGL--GCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVN  548
             MD+ D   + + GL    +NG  +Q  A GED VV  +   LNGS           N   
Sbjct  1     MDS-DNHLLPDGGLEAAHQNGGHQQSPAAGEDGVVSNN---LNGSVG---------NTFK  47

Query  549   LNDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKT--SGESKSGKLQKAPGKPKNVKL  722
             L+D    + S  EV  E    + SN     KE EVK   +  S++ K QK PGK    K 
Sbjct  48    LDDGTTDNLSTGEVEDELKAYVGSNGLPVFKEGEVKVKDADNSENAKSQKGPGKRGTAKP  107

Query  723   SNPKHA--VvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVN  896
             S+ K+A        K     ++  +    +    S+ KQ      KS SFNER+      
Sbjct  108   SHLKNASATQVKKGKDGRDAEVQLTVSNGSVAVNSQLKQ----HLKSKSFNERQGQA---  160

Query  897   HDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAG  1076
               K  G  D      + ++        LKPLKKGP  K+EA   S+ SPT  D K  + G
Sbjct  161   -SKQSGTSDAGPPEGIVEK------TKLKPLKKGPVDKAEADTDSTSSPTVEDAKPRKVG  213

Query  1077  TLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKF  1256
              LP+Y FSFKC+ERAEKRKEFY+KLEEKIHAKE+E++ +QA++KE+ EAEIKMLRKSL F
Sbjct  214   ALPNYGFSFKCDERAEKRKEFYSKLEEKIHAKEVEKTTLQAKSKETHEAEIKMLRKSLGF  273

Query  1257  KATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP-NRDGKNENGLQTSRLSLDE  1433
             KATPMP+FYQEP PPKVELKKIP TRAKSPKLGRRK+SSP + +G N    +  RLSLDE
Sbjct  274   KATPMPSFYQEPAPPKVELKKIPTTRAKSPKLGRRKSSSPADTEGNNSQSYRPGRLSLDE  333

Query  1434  KPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPN  1613
             K S +   +  S    KKPQRKSLPKLPSEKT + S+ K   P   + ++E   + +Q N
Sbjct  334   KVSSNIPIKGLSPAHPKKPQRKSLPKLPSEKTKLSSDEKTKLP--KASNEENPTLSNQSN  391

Query  1614  IVAKVTDEAEDVHASETE--PKEN-----DEADMSLVQEPITV  1721
               +  T E E V  +E+E  P ++     +EA  +L ++P+ +
Sbjct  392   EGSSPTQEQEAVSKNESEFLPGKDETAVKEEAQATLAKDPVAL  434



>gb|KCW81395.1| hypothetical protein EUGRSUZ_C02774 [Eucalyptus grandis]
Length=428

 Score =   244 bits (624),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 178/386 (46%), Positives = 220/386 (57%), Gaps = 36/386 (9%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHES  602
             +NG+  Q    GED +   +  ++  +  +   E N         +  +D S  +    +
Sbjct  17    QNGMHGQFLNNGEDAIAVSNADIVAETADLVAVEANLH-------EFKLDGSGNDNSFST  69

Query  603   MVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgkdi  782
                 E  +    K+ E  T  + K    QK  GK  N KLSN K A           +  
Sbjct  70    GCASEIGASETHKDGETVTGDKLKVSGPQKIEGKKSNGKLSNIKVA------STIGARKS  123

Query  783   ssssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESH  962
                  +     +S+ KQP+     S SFNER+T       KH G+ D   S S A++   
Sbjct  124   KDGKNVEAVGVSSQTKQPAV----SRSFNERET-----QSKHGGKSDAAMSESFAEK---  171

Query  963   kekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFY  1142
                  LKPLKKG   K EA  QSS  PTA D+K  + G LP+Y FSF+C++RAEKRKE+Y
Sbjct  172   ---TKLKPLKKGSLDKPEADAQSS-PPTAGDSKPRKVGALPNYGFSFRCDQRAEKRKEYY  227

Query  1143  TKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKI  1322
             TKLEEKIHAKEME + +Q ++KE+ EAEIKMLRKSL FKATPMP+FYQEPPPPK ELKKI
Sbjct  228   TKLEEKIHAKEMERTTLQEKSKETLEAEIKMLRKSLTFKATPMPSFYQEPPPPKAELKKI  287

Query  1323  PPTRAKSPKLGRRKTSSPNRDGKNENGL---QTSRLSLDEKPSQDNLARRRSLIDVKKPQ  1493
             P TRAKSPKLGRRKTSS   D   ENG    Q  RLSLDEK S+DN A+  S  + KKP 
Sbjct  288   PTTRAKSPKLGRRKTSS--MDESKENGRATQQLGRLSLDEKVSRDNSAKGPSPANSKKPL  345

Query  1494  RKSLPKLPSEKTYIPSETKKASPIKT  1571
             RKSLPKLPSEKT +   T  A  +KT
Sbjct  346   RKSLPKLPSEKTTLSGGT--ARTVKT  369



>gb|KHG18348.1| Abnormal spindle-like microcephaly-associated protein [Gossypium 
arboreum]
Length=451

 Score =   244 bits (624),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 193/396 (49%), Positives = 241/396 (61%), Gaps = 31/396 (8%)
 Frame = +3

Query  372   MMDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVL-NGSFTIEEA-EGNFQNAV  545
             MMD+ D   +    +  +NGV+++L  V ED      DG   N +  +E+  E   QN +
Sbjct  1     MMDSEDVLPVEGLEVALQNGVNRKLQ-VSED-----DDGFSDNVTGNVEKTLETCLQNEM  54

Query  546   NLNDDIAIDSSVQEVIHESMVPL-ESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKL  722
             +       D+ + +   E M    +SN   DSKE EVK +   K  K QK  GK KN   
Sbjct  55    D-------DNGITKEDREGMSGFVDSNGLIDSKEGEVKDN--VKQSKSQKVQGKTKNENP  105

Query  723   SNPKHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHD  902
             S P++   A  KK KDGK   ++   S G S +   +P  P++ S SFNE+      N  
Sbjct  106   SGPRNVSSALVKKSKDGKSAEATLTASKGGSLATNSRPKQPLQSSRSFNEKHG----NAS  161

Query  903   KHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTL  1082
             KH  +      S  A  +   EKP LKPLKKGP  K+E    + LSP AAD K  R GTL
Sbjct  162   KHSEK------SGAAFTKGTMEKPKLKPLKKGPIHKTEV--DTELSPMAADAKPLRVGTL  213

Query  1083  PSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKA  1262
             P+Y FSFKC+ERAEKR+EFYTKLEEKIHAKE+E+SN+QA++KE+QEAEIK  RKSL FKA
Sbjct  214   PNYGFSFKCDERAEKRREFYTKLEEKIHAKEVEKSNLQAKSKETQEAEIKKFRKSLNFKA  273

Query  1263  TPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP-NRDGKNENGLQTSRLSLDEKP  1439
             TPMP+FYQEP PPKVELKKIP TRAKSPKLGR+K S P   D  + +  Q+ R SLDEK 
Sbjct  274   TPMPSFYQEPAPPKVELKKIPTTRAKSPKLGRKKGSVPFEFDAASNSSHQSGRRSLDEKA  333

Query  1440  SQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSET  1547
             SQ   A+  S +  KKPQRKSLPKLPS+KT +   T
Sbjct  334   SQSISAKLISPVHAKKPQRKSLPKLPSQKTSLAGAT  369



>ref|XP_006483365.1| PREDICTED: enolase-phosphatase E1-like isoform X1 [Citrus sinensis]
Length=439

 Score =   244 bits (622),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 187/462 (40%), Positives = 251/462 (54%), Gaps = 36/462 (8%)
 Frame = +3

Query  375   MDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLN  554
             MD++D K    + +  +NG  KQL A GED V+  +D V           G+ +    L+
Sbjct  1     MDSDDLKVAEGDEVALQNGAHKQLVASGEDGVI--ADDVNQTITETARPNGDSETVDKLD  58

Query  555   DDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPK  734
             +      +  EV+      +ESN    +K  + K +  SK     K  GK K+ K  NPK
Sbjct  59    ES----GTTGEVMEGESDNVESNGLVVAKTGKGKAADTSKQSIPLKGHGKSKSEKPLNPK  114

Query  735   H--AVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKH  908
             +  +      K     D +S+    +    S +KQ      KS +FNER+        K 
Sbjct  115   NVSSTGVKKSKDGKNDDGTSTISNGSVGLNSHSKQSF----KSMTFNERQ----AQFSKQ  166

Query  909   CGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPS  1088
              G+ DT +S  +A++            K       E  G+  L   + D K  R G LP+
Sbjct  167   SGKSDTPSSEGLAEK---------TKSKPLKKGPPEKAGKD-LDYKSDDAKPRRVGALPN  216

Query  1089  YSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATP  1268
             Y FSF+C+ERAEKR+EFY+KLEEKIHAKE+E+S +QA++KE+QEAEIKMLRKSL FKATP
Sbjct  217   YGFSFRCDERAEKRREFYSKLEEKIHAKEVEKSTLQAKSKETQEAEIKMLRKSLNFKATP  276

Query  1269  MPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQD  1448
             MPTFYQEPPPPKVELKKIP TRAKSPKLGRRK+S+P    ++    +  RLSLD K    
Sbjct  277   MPTFYQEPPPPKVELKKIPTTRAKSPKLGRRKSSTPADSVEDSTSCRPGRLSLDAKGPPS  336

Query  1449  NLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSI-SKEITEVDSQPNIVAK  1625
             N AR  S +  KKPQRKSLPKLPSEK  I +  K+ +   +   ++E T   +    VA 
Sbjct  337   NSARGISPVHPKKPQRKSLPKLPSEKATILNSMKEENTTSSKAPNEENTTSSNATKEVAS  396

Query  1626  VTDEAEDVHASETEPKE---------NDEADMSLVQEPITVE  1724
              T+E E +  +E E  +          ++A   LVQEPI +E
Sbjct  397   PTEEQEQIPTAEPEETQFHKDEGLVAEEQAQPILVQEPIALE  438



>ref|XP_011036554.1| PREDICTED: uncharacterized protein LOC105134022 isoform X2 [Populus 
euphratica]
Length=423

 Score =   242 bits (617),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 172/373 (46%), Positives = 219/373 (59%), Gaps = 39/373 (10%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHES  602
             +NGV +Q  A GED VV         S  + E+ GN     +  +DI     V+  + E 
Sbjct  18    QNGVHEQSAAAGEDGVV---------SNNLSESMGNAFKVDDCTNDILSTREVEGELKEG  68

Query  603   MVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKH-AVvagskkgkdgkd  779
                          E++VK +  S+  + QK  GK  N K SNPK+ +      K      
Sbjct  69    -------------EAKVKDADNSEKARSQKGSGKSGNAKPSNPKNVSATQVKGKDGRDAV  115

Query  780   issssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRES  959
               ++    +    S+ KQP     KS SFNER+        K  G+ D   S+ + ++  
Sbjct  116   ARTAVSNGSVAVNSQLKQPL----KSNSFNERQG----QASKQSGKSDAVLSAGLVEK--  165

Query  960   HkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEF  1139
                   LKPLK G   K+E   +S+LSPTA D K  + GTLP+Y FSFKC+ERAEKRKEF
Sbjct  166   ----AKLKPLKNGTVVKAEGETESTLSPTAEDAKPRKFGTLPNYGFSFKCDERAEKRKEF  221

Query  1140  YTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKK  1319
             YTKLEEKIHAKE+E+S +QA++KE+QEAEIK+ RKSL FKATPMP+FYQEP P KVELKK
Sbjct  222   YTKLEEKIHAKEVEKSTLQAKSKETQEAEIKLFRKSLAFKATPMPSFYQEPAPLKVELKK  281

Query  1320  IPPTRAKSPKLGRRKTSSP-NRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQR  1496
             IP TRAKSPKLGR+K+ SP + +GKN    ++ RLSLDEK S   +  R S    KKP R
Sbjct  282   IPTTRAKSPKLGRKKSPSPADSEGKNSQSSRSGRLSLDEKISS-KIPIRLSPAHPKKPLR  340

Query  1497  KSLPKLPSEKTYI  1535
             KSLPKLPSEK  +
Sbjct  341   KSLPKLPSEKINL  353



>ref|XP_002324860.2| hypothetical protein POPTR_0018s01730g [Populus trichocarpa]
 gb|EEF03425.2| hypothetical protein POPTR_0018s01730g [Populus trichocarpa]
Length=422

 Score =   241 bits (615),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 190/443 (43%), Positives = 249/443 (56%), Gaps = 50/443 (11%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQS-DGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHE  599
             +NGV +Q  A  ED VV  +  G +  +F +++           ND++    S +EV  E
Sbjct  18    QNGVHEQSAAAREDGVVSNNLSGSMGNTFEVDDC---------TNDNL----STREVEGE  64

Query  600   SMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKH-AVvagskkgkdgk  776
                           E++VK +  S+  + QK  GK  N K SNPK+ +      K     
Sbjct  65    ----------LKEGEAKVKDADNSEKARSQKGSGKGGNAKPSNPKNVSATQVKGKDGRDA  114

Query  777   dissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRE  956
                ++    +    S+ KQP     KS SFNER+        K  G+ D   S+ + ++ 
Sbjct  115   VARTAVSNGSVAVNSQLKQPL----KSNSFNERQGQA----SKQSGKSDAVLSAGLVEK-  165

Query  957   SHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKE  1136
                     KPLKKGP  K+E   +S+ SPTA D KS + GTLP+Y FSFKC+ERAEKRKE
Sbjct  166   -------AKPLKKGPVVKAEGETESTSSPTAEDAKSRKFGTLPNYGFSFKCDERAEKRKE  218

Query  1137  FYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELK  1316
             FYTKLEEKIHAKE+E+S +QA++KE+QEAEIK+ RKSL FKATPMP+FYQEP P KVELK
Sbjct  219   FYTKLEEKIHAKEVEKSTLQAKSKETQEAEIKLFRKSLAFKATPMPSFYQEPAPLKVELK  278

Query  1317  KIPPTRAKSPKLGRRKTSSP-NRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQ  1493
             KIP TRAKSPKLGR+K+ SP + +G N    ++ RLSLDEK S     R  S    KKPQ
Sbjct  279   KIPTTRAKSPKLGRKKSPSPADSEGNNSQSNRSGRLSLDEKISSKIPIRGLSPAHPKKPQ  338

Query  1494  RKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVTDEAEDVHASETE--  1667
             RKSLPKLPSEK  + +  +K    K S ++E T +  Q N       E E V  +E    
Sbjct  339   RKSLPKLPSEKINLYANDEKGKLPKAS-NEENTTLSDQTNEGVSANQEQEAVSKNEASEF  397

Query  1668  --PKEN---DEADMSLVQEPITV  1721
               PKE     E   +L++ PI +
Sbjct  398   LPPKEEVVVQEEAATLMKGPIAL  420



>ref|XP_006450433.1| hypothetical protein CICLE_v10008326mg [Citrus clementina]
 gb|ESR63673.1| hypothetical protein CICLE_v10008326mg [Citrus clementina]
Length=439

 Score =   241 bits (616),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 186/462 (40%), Positives = 251/462 (54%), Gaps = 36/462 (8%)
 Frame = +3

Query  375   MDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLN  554
             MD++D K    + +  +NG  KQL A GED V+  +D V           G+ +    L+
Sbjct  1     MDSDDLKVAEGDEVALQNGAHKQLVASGEDGVI--ADDVNQTITETARPNGDSETVDKLD  58

Query  555   DDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPK  734
             +      +  EV+      +ESN    +   + K +  SK     K  GK K+ K  NPK
Sbjct  59    ES----GTTGEVMEGESDNVESNGLVVATTGKGKAADTSKQSIPLKGHGKSKSEKPLNPK  114

Query  735   H--AVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKH  908
             +  +      K     D +S+    +    S +KQ      KS +FNER++       K 
Sbjct  115   NVSSTGVKKSKDGKNDDGTSTISNGSVGLNSHSKQSF----KSMTFNERQS----QFSKQ  166

Query  909   CGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPS  1088
              G+ DT +S  +A++            K       E  G+  L   + D K  R G LP+
Sbjct  167   SGKSDTPSSEGLAEK---------TKSKPLKKGPPEKAGKD-LDYKSDDAKPRRVGALPN  216

Query  1089  YSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATP  1268
             Y FSF+C+ERAEKR+EFY+KLEEKIHAKE+E+S +QA++KE+QEAEIKMLRKSL FKATP
Sbjct  217   YGFSFRCDERAEKRREFYSKLEEKIHAKEVEKSTLQAKSKETQEAEIKMLRKSLNFKATP  276

Query  1269  MPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQD  1448
             MPTFYQEPPPPKVELKKIP TRAKSPKLGRRK+S+P    ++    +  RLSLD K    
Sbjct  277   MPTFYQEPPPPKVELKKIPTTRAKSPKLGRRKSSTPADSVEDSTSCRPGRLSLDAKGPPS  336

Query  1449  NLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSI-SKEITEVDSQPNIVAK  1625
             N AR  S +  KKPQRKSLPKLPSEK  I +  K+ +   +   ++E T   +    VA 
Sbjct  337   NSARGISPVHPKKPQRKSLPKLPSEKATILNSMKEENTTSSKAPNEENTTSSNATKEVAS  396

Query  1626  VTDEAEDVHASETEPKE---------NDEADMSLVQEPITVE  1724
              T+E E +  +E E  +          ++A   LVQEPI +E
Sbjct  397   PTEEQEQIPTAEPEETQFHKDEGLVAEEQAQPILVQEPIALE  438



>gb|KDO61734.1| hypothetical protein CISIN_1g013648mg [Citrus sinensis]
 gb|KDO61735.1| hypothetical protein CISIN_1g013648mg [Citrus sinensis]
Length=439

 Score =   241 bits (616),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 186/462 (40%), Positives = 250/462 (54%), Gaps = 36/462 (8%)
 Frame = +3

Query  375   MDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLN  554
             MD++D K    + +  +NG  KQL A GED V+  +D V           G+ +    L+
Sbjct  1     MDSDDLKVAEGDEVALQNGAHKQLVASGEDGVI--ADDVNQTITETARPNGDSETVDKLD  58

Query  555   DDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPK  734
             +      +  EV+      +ESN    +   + K +  SK     K  GK K+ K  NPK
Sbjct  59    ES----GTTGEVMEGESDNVESNGLVVATTGKGKAADTSKQSIPLKGHGKSKSEKPLNPK  114

Query  735   H--AVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKH  908
             +  +      K     D +S+    +    S +KQ      KS +FNER+        K 
Sbjct  115   NVSSTGVKKSKDGKNDDGTSTISNGSVGLNSHSKQSF----KSMTFNERQ----AQFSKQ  166

Query  909   CGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPS  1088
              G+ DT +S  +A++            K       E  G+  L   + D K  R G LP+
Sbjct  167   SGKSDTPSSEGLAEK---------TKSKPLKKGPPEKAGKD-LDYKSDDAKPRRVGALPN  216

Query  1089  YSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATP  1268
             Y FSF+C+ERAEKR+EFY+KLEEKIHAKE+E+S +QA++KE+QEAEIKMLRKSL FKATP
Sbjct  217   YGFSFRCDERAEKRREFYSKLEEKIHAKEVEKSTLQAKSKETQEAEIKMLRKSLNFKATP  276

Query  1269  MPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQD  1448
             MPTFYQEPPPPKVELKKIP TRAKSPKLGRRK+S+P    ++    +  RLSLD K    
Sbjct  277   MPTFYQEPPPPKVELKKIPTTRAKSPKLGRRKSSTPADSVEDSTSCRPGRLSLDAKGPPS  336

Query  1449  NLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSI-SKEITEVDSQPNIVAK  1625
             N AR  S +  KKPQRKSLPKLPSEK  I +  K+ +   +   ++E T   +    VA 
Sbjct  337   NSARGISPVHPKKPQRKSLPKLPSEKATILNSMKEENTTSSKAPNEENTTSSNATKEVAS  396

Query  1626  VTDEAEDVHASETEPKE---------NDEADMSLVQEPITVE  1724
              T+E E +  +E E  +          ++A   LVQEPI +E
Sbjct  397   PTEEQEQIPTAEPEETQFHKDEGLVAEEQAQPILVQEPIALE  438



>gb|ABK95344.1| unknown [Populus trichocarpa]
Length=422

 Score =   239 bits (610),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 189/443 (43%), Positives = 249/443 (56%), Gaps = 50/443 (11%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQS-DGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHE  599
             +NGV +Q  A  ED VV  +  G +  +F +++           ND++    S +EV  E
Sbjct  18    QNGVHEQSAAAREDGVVSNNLSGSMGNTFEVDDC---------TNDNL----STREVEGE  64

Query  600   SMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKH-AVvagskkgkdgk  776
                           E++VK +  S+  + QK  GK  N K SNPK+ +      K     
Sbjct  65    ----------LKEGEAKVKDADNSEKARSQKGSGKGGNAKPSNPKNVSATQVKGKDGRDA  114

Query  777   dissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRE  956
                ++    +    S+ KQP     KS SFNER+        K  G+ D   S+ + ++ 
Sbjct  115   VARTAVSNGSVAVNSQLKQPL----KSNSFNERQGQA----SKQSGKSDAVLSAGLVEK-  165

Query  957   SHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKE  1136
                     KPLKKGP  K+E   +S+ SPTA D KS + GTLP+Y FSFKC+ERAEKRKE
Sbjct  166   -------AKPLKKGPVVKAEGETESTSSPTAEDAKSRKFGTLPNYGFSFKCDERAEKRKE  218

Query  1137  FYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELK  1316
             FYTKLEEKIHAKE+E+S +QA++KE+QEAEIK+ RKSL FKATPMP+FYQEP P KVELK
Sbjct  219   FYTKLEEKIHAKEVEKSTLQAKSKETQEAEIKLFRKSLAFKATPMPSFYQEPAPLKVELK  278

Query  1317  KIPPTRAKSPKLGRRKTSSP-NRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQ  1493
             KIP TRAKSPKLGR+K+ SP + +G N    ++ RLSLDEK S     R  S    KKPQ
Sbjct  279   KIPTTRAKSPKLGRKKSPSPADSEGNNSQSNRSGRLSLDEKISSKIPIRGLSPAHPKKPQ  338

Query  1494  RKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIVAKVTDEAEDVHASETE--  1667
             RKSLP+LPSEK  + +  +K    K S ++E T +  Q N       E E V  +E    
Sbjct  339   RKSLPELPSEKINLYANDEKGKLPKAS-NEENTTLSDQTNEGVSANQEQEAVSKNEASEF  397

Query  1668  --PKEN---DEADMSLVQEPITV  1721
               PKE     E   +L++ PI +
Sbjct  398   LPPKEEVVVQEEAATLMKGPIAL  420



>ref|XP_011039686.1| PREDICTED: ankyrin repeat domain-containing protein 12 [Populus 
euphratica]
 ref|XP_011039687.1| PREDICTED: ankyrin repeat domain-containing protein 12 [Populus 
euphratica]
Length=439

 Score =   238 bits (608),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 201/462 (44%), Positives = 263/462 (57%), Gaps = 38/462 (8%)
 Frame = +3

Query  375   MDANDKKRIAENGL--GCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVN  548
             MD+ D   + + GL    +NG  +Q  A GED VV  +   LNGS           N   
Sbjct  1     MDS-DNHLLPDGGLEAAHQNGGHQQSPAAGEDGVVSNN---LNGSVG---------NTFK  47

Query  549   LNDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKT--SGESKSGKLQKAPGKPKNVKL  722
             L D    + S  EV  E    + SN     KE EVK   +  S++ K QK PGK    K 
Sbjct  48    LEDGTTDNLSTGEVEDELKAYVGSNGLPVFKEGEVKVKDADNSENSKSQKGPGKRGTAKP  107

Query  723   SNPKHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHD  902
             S+ K+A     KKGKDG+D      +SNG+ A  ++       KS +FNER+        
Sbjct  108   SHLKNASATQVKKGKDGRDAEVKLAVSNGSVAVNSQLKQH--LKSKAFNERQG----QSS  161

Query  903   KHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTL  1082
             K  G+ D      + ++        LKPLKKGP  K+EA   S+ SPT  D K  + G L
Sbjct  162   KQSGKSDAAPPEGIVEK------TKLKPLKKGPVDKAEADTDSTSSPTVEDAKPRKVGAL  215

Query  1083  PSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKA  1262
             P+Y FSFKC+ERAEKRKEFY+KLEEKIHAKE+E++ +QA++KE+QEAEIK+LRKSL FKA
Sbjct  216   PNYGFSFKCDERAEKRKEFYSKLEEKIHAKEVEKTTLQAKSKETQEAEIKLLRKSLGFKA  275

Query  1263  TPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSP-NRDGKNENGLQTSRLSLDEKP  1439
             TPMP+FYQEP PPKVELKKIP TRAKSPKLGRRK+SSP + +G N    +  RLSLDEK 
Sbjct  276   TPMPSFYQEPAPPKVELKKIPTTRAKSPKLGRRKSSSPADTEGNNSQSYRPGRLSLDEKV  335

Query  1440  SQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPNIV  1619
             S +   +  S    KKP RKSLPKLPSEKT +     + + +  + ++E   + +Q N  
Sbjct  336   SSNIPIKGLSPAHPKKPLRKSLPKLPSEKTKLSIANDEKTRLPKASNEENPTLSNQSNEG  395

Query  1620  AKVTDEAEDVHASE--------TEPKENDEADMSLVQEPITV  1721
             +  T E E V  +E         E    +EA  +L ++P+ +
Sbjct  396   SSPTQEQEAVSKNEESEFLPGKDETAVKEEAQATLAKDPVAL  437



>ref|XP_010102672.1| hypothetical protein L484_000806 [Morus notabilis]
 gb|EXC46039.1| hypothetical protein L484_000806 [Morus notabilis]
Length=462

 Score =   237 bits (605),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 184/380 (48%), Positives = 235/380 (62%), Gaps = 24/380 (6%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEA---EGNFQNAVNLNDDIAIDSSVQEVI  593
             +NG  +Q  A  ED V+  SD V   S    E     GN +   +L+D IA +SS +EV 
Sbjct  17    QNGAYEQTPATVEDFVI--SDNVNVPSIKSNETAVPNGNAKVVAHLDDGIAKNSSSEEVK  74

Query  594   HESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdg  773
              ES+  + SN    +KE E K S +SK  K QK  G  KN K S+ K+ + +  KK KDG
Sbjct  75    EESINSIASNGLTVAKEGEAKVSDQSKQPKSQKGLGTSKNGKPSSTKNDLGSSLKKNKDG  134

Query  774   kdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQR  953
             K + + S I NG+ AS + QP   I KS SFN+RK  VK       G  D      + + 
Sbjct  135   KAVEAISTIPNGSVASNS-QPRKTI-KSKSFNDRKQPVKPEAAATEGNTDKLKLKPLKKE  192

Query  954   ESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRK  1133
               +K +              EA  +SS SPTA + K  R   LP+Y FSFKC+ERAEKR+
Sbjct  193   PVNKAEV-------------EADTKSS-SPTAGEAKPPRVAMLPNYGFSFKCDERAEKRR  238

Query  1134  EFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVEL  1313
             EFYTKL EKIHAKEME++N+QA++KE+QEAEIK+LRKSL FKATPMP+FYQEPPPPKVEL
Sbjct  239   EFYTKLGEKIHAKEMEQTNLQAKSKETQEAEIKLLRKSLAFKATPMPSFYQEPPPPKVEL  298

Query  1314  KKIPPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKP  1490
             KKIP TRAKSPKLGRRK+  P   +G +    Q+ RLSLDEK S++  + +   +  +KP
Sbjct  299   KKIPTTRAKSPKLGRRKSLPPTESEGSSNPTNQSGRLSLDEKVSKN--SAKGPAVQPRKP  356

Query  1491  QRKSLPKLPSEKTYIPSETK  1550
             +RKSLP LPSEK  + + TK
Sbjct  357   ERKSLPTLPSEKASLANATK  376



>ref|XP_004291456.1| PREDICTED: uncharacterized protein LOC101310775 [Fragaria vesca 
subsp. vesca]
Length=470

 Score =   236 bits (602),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 226/377 (60%), Gaps = 23/377 (6%)
 Frame = +3

Query  414   LGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVI  593
             +  ENG   QL+   + I    S+  L  S  +    G  +N VN +D ++ +SS  EV 
Sbjct  14    VALENGDHGQLNVGPDAINGSASETALTESAALN---GKMENVVNSDDGVSNNSSAGEVK  70

Query  594   HESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdg  773
              ES V   SN    +KE   K S +SK  K+QK  GK K  K  +PK A+    KK KDG
Sbjct  71    EESRV-NSSNGLKIAKERGPKVSVQSKQFKVQKGQGKSKIEKPPSPKIALPTSMKKSKDG  129

Query  774   kdissssvisngtsa--sRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVA  947
              D  +++ +SN  +A  SRAKQP+    KS S N  +  +     K    P T       
Sbjct  130   NDAEATATVSNDLAAPISRAKQPN----KSRSSNGPQVQLSDQQPKQSEAPST-------  178

Query  948   QRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEK  1127
                    +            K++   QSSLSPT  D K  R GTLP+Y FSF+C+ERAEK
Sbjct  179   ---EGLVEKTDLKPLIKGSYKADGDSQSSLSPTEGD-KPPRVGTLPNYGFSFRCDERAEK  234

Query  1128  RKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKV  1307
             R+EFYTKLEEKIHAKEME++N+QA++KE+ EAEIKMLRK L FKATPMP+FYQEPPPPKV
Sbjct  235   RREFYTKLEEKIHAKEMEKNNLQAKSKETLEAEIKMLRKKLTFKATPMPSFYQEPPPPKV  294

Query  1308  ELKKIPPTRAKSPKLGRRKT-SSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVK  1484
             ELKK+P TRAKSPKLGR+K+  + + +G +    Q+ RLSL EK  Q N A+  S +  K
Sbjct  295   ELKKLPTTRAKSPKLGRKKSLPAADSEGNSTTKSQSGRLSLGEKVPQ-NSAKGPSPVLPK  353

Query  1485  KPQRKSLPKLPSEKTYI  1535
             KPQRKSLP+LPSE T +
Sbjct  354   KPQRKSLPRLPSETTTL  370



>emb|CAN82789.1| hypothetical protein VITISV_030600 [Vitis vinifera]
Length=440

 Score =   233 bits (594),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 176/438 (40%), Positives = 232/438 (53%), Gaps = 85/438 (19%)
 Frame = +3

Query  375   MDANDKKRIAENGL--GCENGVDKQLHAVG-EDIVVDQSDGVLNGSFTIEEAEGNFQNAV  545
             MD +D   +  NGL  G +NG+ +QL A G E ++ ++ +G L+ S       GN +N  
Sbjct  1     MDVDD--LLPVNGLEEGHQNGIHEQLSAAGGEGVIPEKVNGNLDLSTESAGMNGNAENVG  58

Query  546   NLNDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLS  725
               +D+  I++S  EV   S +    N    S++ EV+ +  SK  K QK  GK    KLS
Sbjct  59    MWDDNGIINASTAEVGEGSHIRARVNGLTISEDLEVEDADPSKHSKPQKGQGKSSKEKLS  118

Query  726   NPKHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDK  905
             +PKHA                          +  K+     E  TS +   ++  ++  K
Sbjct  119   SPKHA------------------------GTTWVKKKDGKDEIVTSASTNGSLASISRPK  154

Query  906   HCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSS--------LSPTAADTK  1061
                   T  S S + ++ H  K             SEA   +S         SPT  DTK
Sbjct  155   Q-----TLKSRSFSDKQDHLSKQSKN---------SEAASSTSNMIQPEGRASPTE-DTK  199

Query  1062  SHRAGTLPSYSFSFKCNERAEKRKE-----------------FYTKLEEKIHAKEMEESN  1190
               R   LPSY+FSF+C+ERAEKR+E                 FYTKLEEK HAKE+E +N
Sbjct  200   PRRVAALPSYNFSFRCDERAEKRREQHFCFSTEDNVYHFVGQFYTKLEEKTHAKEIERTN  259

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELK---------------KIP  1325
             +QA++KE+QEAEIKMLRKSL FKATPMP+FYQEPPPPKVELK               KIP
Sbjct  260   LQAKSKETQEAEIKMLRKSLTFKATPMPSFYQEPPPPKVELKKLCHVFGNENGNLMQKIP  319

Query  1326  PTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSL  1505
             PTRAKSPKLGR+K SSP  + +  +  ++ RLSLDEK SQ+N A+  S    KKP RKSL
Sbjct  320   PTRAKSPKLGRKK-SSPAPESEGSSSHRSGRLSLDEKVSQNNPAKGISPGHPKKPLRKSL  378

Query  1506  PKLPSEKTYIPSETKKAS  1559
             PKLPSE+T +   T +A+
Sbjct  379   PKLPSERTNLSKSTNEAA  396



>ref|XP_003522613.1| PREDICTED: neurofilament heavy polypeptide isoform X1 [Glycine 
max]
 ref|XP_006578146.1| PREDICTED: neurofilament heavy polypeptide isoform X4 [Glycine 
max]
 ref|XP_006578147.1| PREDICTED: neurofilament heavy polypeptide isoform X5 [Glycine 
max]
 gb|KHN08133.1| hypothetical protein glysoja_032317 [Glycine soja]
Length=468

 Score =   233 bits (593),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 169/405 (42%), Positives = 229/405 (57%), Gaps = 31/405 (8%)
 Frame = +3

Query  432   VDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHESMVP  611
             V  +L   G+D +    D  +          GNF+N +   D  A D S +E  +++   
Sbjct  21    VHDELSNSGKDDIASNVDPGVTKIIETAATNGNFENFIQY-DSTATDYSSKEGSNDN---  76

Query  612   LESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPK--HAVvagskkgkdgkdis  785
             ++ N+   SKE E K    +   K+ K P K KN K  +P+  H       K    ++++
Sbjct  77    IDVNNVTISKEEEAKIIDRTGQLKVGKGPAKNKNAKPPSPRGSHVSSVKKNKDGKDEEVA  136

Query  786   sssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHk  965
             S+         S  +QP     K+ S ++++  +     KH G+ +  TS    ++    
Sbjct  137   SAVSNGTFALDSHPRQPI----KNRSLSDKQARL----SKHPGKSNAATSEESMEK----  184

Query  966   ekpllkplkkgppkkSEATGQS-SLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFY  1142
                  +P            G++ S SPTA D K  R G LP Y FSFKC+ERAE+RKEFY
Sbjct  185   ----SRPRLLKKEPLDNLQGETESSSPTAEDAKPRRVGALPKYGFSFKCDERAERRKEFY  240

Query  1143  TKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKI  1322
             TKLEEKIHAKE+EESN+QA+TKE+QEAEIKMLRKSL FKATPMP+FYQEPPPP+VELKK+
Sbjct  241   TKLEEKIHAKEVEESNLQAKTKETQEAEIKMLRKSLGFKATPMPSFYQEPPPPRVELKKM  300

Query  1323  PPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRK  1499
             P TRAKSPKLGR+K+S+ +  +G   N  +  RLSLDEK SQ N  +  S +  KKPQRK
Sbjct  301   PTTRAKSPKLGRKKSSTNSEPEGNLSNNARQGRLSLDEKVSQTNPTKGISPVHQKKPQRK  360

Query  1500  SL-PKLPSEKTY------IPSETKKASPIKTSISKEITEVDSQPN  1613
             SL P+L SEKT       + + +K  +  K S+S   TEV +  N
Sbjct  361   SLPPQLTSEKTRSSNSASVRTSSKAVNGGKNSLSSVTTEVTTLSN  405



>ref|XP_006578145.1| PREDICTED: neurofilament heavy polypeptide isoform X3 [Glycine 
max]
Length=471

 Score =   233 bits (594),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 169/405 (42%), Positives = 229/405 (57%), Gaps = 31/405 (8%)
 Frame = +3

Query  432   VDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHESMVP  611
             V  +L   G+D +    D  +          GNF+N +   D  A D S +E  +++   
Sbjct  24    VHDELSNSGKDDIASNVDPGVTKIIETAATNGNFENFIQY-DSTATDYSSKEGSNDN---  79

Query  612   LESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPK--HAVvagskkgkdgkdis  785
             ++ N+   SKE E K    +   K+ K P K KN K  +P+  H       K    ++++
Sbjct  80    IDVNNVTISKEEEAKIIDRTGQLKVGKGPAKNKNAKPPSPRGSHVSSVKKNKDGKDEEVA  139

Query  786   sssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHk  965
             S+         S  +QP     K+ S ++++  +     KH G+ +  TS    ++    
Sbjct  140   SAVSNGTFALDSHPRQPI----KNRSLSDKQARL----SKHPGKSNAATSEESMEK----  187

Query  966   ekpllkplkkgppkkSEATGQS-SLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFY  1142
                  +P            G++ S SPTA D K  R G LP Y FSFKC+ERAE+RKEFY
Sbjct  188   ----SRPRLLKKEPLDNLQGETESSSPTAEDAKPRRVGALPKYGFSFKCDERAERRKEFY  243

Query  1143  TKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKI  1322
             TKLEEKIHAKE+EESN+QA+TKE+QEAEIKMLRKSL FKATPMP+FYQEPPPP+VELKK+
Sbjct  244   TKLEEKIHAKEVEESNLQAKTKETQEAEIKMLRKSLGFKATPMPSFYQEPPPPRVELKKM  303

Query  1323  PPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRK  1499
             P TRAKSPKLGR+K+S+ +  +G   N  +  RLSLDEK SQ N  +  S +  KKPQRK
Sbjct  304   PTTRAKSPKLGRKKSSTNSEPEGNLSNNARQGRLSLDEKVSQTNPTKGISPVHQKKPQRK  363

Query  1500  SL-PKLPSEKTY------IPSETKKASPIKTSISKEITEVDSQPN  1613
             SL P+L SEKT       + + +K  +  K S+S   TEV +  N
Sbjct  364   SLPPQLTSEKTRSSNSASVRTSSKAVNGGKNSLSSVTTEVTTLSN  408



>ref|XP_009376913.1| PREDICTED: titin-like isoform X1 [Pyrus x bretschneideri]
Length=460

 Score =   232 bits (591),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 162/221 (73%), Gaps = 11/221 (5%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             +E   QSSLSPT  D K  R GTLP Y FSF+C+ERAEKR+EFYTKLEEKIHAKEME++N
Sbjct  202   AEGESQSSLSPTEGD-KQPRVGTLPKYGFSFRCDERAEKRREFYTKLEEKIHAKEMEKNN  260

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             +QA+++E+ EAEI+MLRK L FKATPMP+FYQEPPPPKVELKKIP TRAKSPKL RRK+ 
Sbjct  261   LQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLSRRKSL  320

Query  1371  SP--NRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSE  1544
              P  +    N NG ++SRLSLDEK  Q N A+  S +  KKPQRKSLP+LPSEKT +P+ 
Sbjct  321   PPAVSEAHGNTNG-RSSRLSLDEKVPQ-NTAKGPSPVHPKKPQRKSLPRLPSEKTTLPNV  378

Query  1545  TKKASPIKTSISKEITEVDSQPNIVAKVTDEAEDVHASETE  1667
               +      ++++E T      N++A + +E   V  +E+E
Sbjct  379   VNEPKTTSKAVNEEKT------NLIAAMIEENATVPTAESE  413



>ref|XP_006578144.1| PREDICTED: neurofilament heavy polypeptide isoform X2 [Glycine 
max]
Length=492

 Score =   233 bits (593),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 169/405 (42%), Positives = 229/405 (57%), Gaps = 31/405 (8%)
 Frame = +3

Query  432   VDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHESMVP  611
             V  +L   G+D +    D  +          GNF+N +   D  A D S +E  +++   
Sbjct  45    VHDELSNSGKDDIASNVDPGVTKIIETAATNGNFENFIQY-DSTATDYSSKEGSNDN---  100

Query  612   LESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPK--HAVvagskkgkdgkdis  785
             ++ N+   SKE E K    +   K+ K P K KN K  +P+  H       K    ++++
Sbjct  101   IDVNNVTISKEEEAKIIDRTGQLKVGKGPAKNKNAKPPSPRGSHVSSVKKNKDGKDEEVA  160

Query  786   sssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHk  965
             S+         S  +QP     K+ S ++++  +     KH G+ +  TS    ++    
Sbjct  161   SAVSNGTFALDSHPRQPI----KNRSLSDKQARL----SKHPGKSNAATSEESMEK----  208

Query  966   ekpllkplkkgppkkSEATGQS-SLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFY  1142
                  +P            G++ S SPTA D K  R G LP Y FSFKC+ERAE+RKEFY
Sbjct  209   ----SRPRLLKKEPLDNLQGETESSSPTAEDAKPRRVGALPKYGFSFKCDERAERRKEFY  264

Query  1143  TKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKI  1322
             TKLEEKIHAKE+EESN+QA+TKE+QEAEIKMLRKSL FKATPMP+FYQEPPPP+VELKK+
Sbjct  265   TKLEEKIHAKEVEESNLQAKTKETQEAEIKMLRKSLGFKATPMPSFYQEPPPPRVELKKM  324

Query  1323  PPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRK  1499
             P TRAKSPKLGR+K+S+ +  +G   N  +  RLSLDEK SQ N  +  S +  KKPQRK
Sbjct  325   PTTRAKSPKLGRKKSSTNSEPEGNLSNNARQGRLSLDEKVSQTNPTKGISPVHQKKPQRK  384

Query  1500  SL-PKLPSEKTY------IPSETKKASPIKTSISKEITEVDSQPN  1613
             SL P+L SEKT       + + +K  +  K S+S   TEV +  N
Sbjct  385   SLPPQLTSEKTRSSNSASVRTSSKAVNGGKNSLSSVTTEVTTLSN  429



>ref|XP_008378379.1| PREDICTED: neurofilament heavy polypeptide-like isoform X3 [Malus 
domestica]
Length=429

 Score =   231 bits (588),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 161/221 (73%), Gaps = 11/221 (5%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             +E   QSSLSPT  D K  R GTLP Y FSF+C+ERAEKR+EFYTKLEEKIHAKEME++N
Sbjct  172   AEGESQSSLSPTEGD-KQPRVGTLPKYGFSFRCDERAEKRREFYTKLEEKIHAKEMEKNN  230

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             +QA+++E+ EAEI+MLRK L FKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGRRK+ 
Sbjct  231   LQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRRKSL  290

Query  1371  SP--NRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSE  1544
              P  +    N NG ++SRLSLDEK  Q N A+  S +  KKPQRKSLP+LPSEKT +P+ 
Sbjct  291   PPAVSEAHGNTNG-RSSRLSLDEKVPQ-NTAKGPSPVHPKKPQRKSLPRLPSEKTTLPNV  348

Query  1545  TKKASPIKTSISKEITEVDSQPNIVAKVTDEAEDVHASETE  1667
               +      ++++E T      N++A   +E      +E+E
Sbjct  349   VNEPKMTSKAVNEEKT------NLIAATIEENATXPTAESE  383



>ref|XP_008378377.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Malus 
domestica]
Length=459

 Score =   231 bits (590),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 161/221 (73%), Gaps = 11/221 (5%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             +E   QSSLSPT  D K  R GTLP Y FSF+C+ERAEKR+EFYTKLEEKIHAKEME++N
Sbjct  202   AEGESQSSLSPTEGD-KQPRVGTLPKYGFSFRCDERAEKRREFYTKLEEKIHAKEMEKNN  260

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             +QA+++E+ EAEI+MLRK L FKATPMP+FYQEPPPPKVELKKIP TRAKSPKLGRRK+ 
Sbjct  261   LQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGRRKSL  320

Query  1371  SP--NRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSE  1544
              P  +    N NG ++SRLSLDEK  Q N A+  S +  KKPQRKSLP+LPSEKT +P+ 
Sbjct  321   PPAVSEAHGNTNG-RSSRLSLDEKVPQ-NTAKGPSPVHPKKPQRKSLPRLPSEKTTLPNV  378

Query  1545  TKKASPIKTSISKEITEVDSQPNIVAKVTDEAEDVHASETE  1667
               +      ++++E T      N++A   +E      +E+E
Sbjct  379   VNEPKMTSKAVNEEKT------NLIAATIEENATXPTAESE  413



>ref|XP_003526407.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Glycine 
max]
 ref|XP_006581356.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Glycine 
max]
Length=461

 Score =   228 bits (582),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 174/400 (44%), Positives = 227/400 (57%), Gaps = 27/400 (7%)
 Frame = +3

Query  432   VDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHE-SMV  608
             V  +L   G+D +    D  +          GN +N +   D  A D S +E I E S  
Sbjct  21    VHDELSIFGKDGIASNVDPGVTKIIETAATNGNLENFIQY-DSTATDYSSKEEIKEGSND  79

Query  609   PLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPK--HAVvagskkgkdgkdi  782
              +  N+   SKE E +    ++  K+ K P K KN K  +P+  HA      K    +++
Sbjct  80    NIYMNNVTISKEEEAEIIDRTEQLKVGKGPAKNKNAKPPSPRGSHASSVKKNKDGKDEEV  139

Query  783   ssssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESH  962
             +SS       S S  +QP     K+ S ++++  +     KH G+      S+ A  E  
Sbjct  140   ASSVSNGTFASDSHPRQPI----KNRSLSDKQARL----SKHPGK------SNAAHSEES  185

Query  963   kekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFY  1142
              EK   +  KK P    +   +SS SPTA D K  R G LP Y FSFKC+ERAE+RKEFY
Sbjct  186   MEKTRPQLSKKDPHDNLQGEAESS-SPTAEDAKPRRVGALPKYGFSFKCDERAERRKEFY  244

Query  1143  TKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKI  1322
             TKLEEKIHAKE+EESN+QA+TKE+QEAEIKMLRKSL FKATPMP+FYQEPPPP+ EL+K+
Sbjct  245   TKLEEKIHAKEVEESNLQAKTKENQEAEIKMLRKSLGFKATPMPSFYQEPPPPRAELRKM  304

Query  1323  PPTRAKSPKLGRRKTS-SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRK  1499
             P TRAKSPKLGR+K+S +   +G   N  +  RLSLDEK SQ N     S +  KKPQRK
Sbjct  305   PTTRAKSPKLGRKKSSINSEPEGNTSNSARQGRLSLDEKMSQTNPTNGISPVHPKKPQRK  364

Query  1500  SL-PKLPSEK------TYIPSETKKASPIKTSISKEITEV  1598
             SL P+L SEK        + + +K  +  KTS+S    EV
Sbjct  365   SLPPRLASEKISSSNSASVRTSSKAVNGGKTSLSSVTAEV  404



>ref|XP_010525961.1| PREDICTED: protein WVD2-like 1 isoform X2 [Tarenaya hassleriana]
Length=400

 Score =   225 bits (573),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 150/191 (79%), Gaps = 4/191 (2%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   +SS +PTA D KS RAG LP+Y FSF+C++RAEKR+EFY+KLEEKIHAKE+E+SN
Sbjct  174   SEGESESS-NPTAEDGKSRRAGALPNYGFSFRCDQRAEKRREFYSKLEEKIHAKELEKSN  232

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKT-  1367
             MQA++KE+QEAEIKMLRKSL FKATPMPTFYQEP PPKVELKKIPPT+ KSPKLGR+KT 
Sbjct  233   MQAKSKETQEAEIKMLRKSLNFKATPMPTFYQEPQPPKVELKKIPPTKPKSPKLGRKKTV  292

Query  1368  SSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSET  1547
             S+ + +   ++  +  RLSLDEK S+ N   + +L  VK P RKSLPKLPS+KT + S  
Sbjct  293   SATDSEETTDHTPRIGRLSLDEKGSKHNQVEKDALP-VKPPLRKSLPKLPSQKTSL-SNG  350

Query  1548  KKASPIKTSIS  1580
              K +P K + +
Sbjct  351   GKPAPAKATTN  361



>ref|XP_010525960.1| PREDICTED: protein WVD2-like 1 isoform X1 [Tarenaya hassleriana]
Length=401

 Score =   224 bits (570),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 3/181 (2%)
 Frame = +3

Query  1041  PTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQE  1220
             PTA D KS RAG LP+Y FSF+C++RAEKR+EFY+KLEEKIHAKE+E+SNMQA++KE+QE
Sbjct  184   PTAEDGKSRRAGALPNYGFSFRCDQRAEKRREFYSKLEEKIHAKELEKSNMQAKSKETQE  243

Query  1221  AEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKT-SSPNRDGKNE  1397
             AEIKMLRKSL FKATPMPTFYQEP PPKVELKKIPPT+ KSPKLGR+KT S+ + +   +
Sbjct  244   AEIKMLRKSLNFKATPMPTFYQEPQPPKVELKKIPPTKPKSPKLGRKKTVSATDSEETTD  303

Query  1398  NGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSI  1577
             +  +  RLSLDEK S+ N   + +L  VK P RKSLPKLPS+KT + S   K +P K + 
Sbjct  304   HTPRIGRLSLDEKGSKHNQVEKDALP-VKPPLRKSLPKLPSQKTSL-SNGGKPAPAKATT  361

Query  1578  S  1580
             +
Sbjct  362   N  362



>ref|XP_010526215.1| PREDICTED: peptidyl-prolyl isomerase cwc-27-like isoform X1 [Tarenaya 
hassleriana]
Length=437

 Score =   224 bits (572),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/310 (45%), Positives = 186/310 (60%), Gaps = 37/310 (12%)
 Frame = +3

Query  852   KSTSFNERKTVVKVNHDKHCGRPDTTTSSSV----AQRESHkekpllkplkkgppkkSEA  1019
             KS SFN+R+  V + H +H   P             +++SH                SE 
Sbjct  141   KSKSFNDRQARV-MKHGQHDTEPTEAAGEKTELKPLKKQSHDT--------------SEG  185

Query  1020  TGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQA  1199
               +SS SP A D KS R G LP+Y FSFKC++RAEKR+EFYTKLEEKIHAKE+E+++MQA
Sbjct  186   DSESSKSPKAEDGKSRRVGALPNYGFSFKCDQRAEKRREFYTKLEEKIHAKELEKNDMQA  245

Query  1200  QTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSP  1376
             ++KE+QEAEIKMLRKSL FKATPMP+FYQEP PPKVELKKIPPTR KSPKLGR+K  S  
Sbjct  246   KSKETQEAEIKMLRKSLNFKATPMPSFYQEPQPPKVELKKIPPTRPKSPKLGRKKIVSVA  305

Query  1377  NRDGKNENGLQTSRLSLDEKPSQDNLARRRSL-IDVKKPQ-RKSLPKLPSEKTYIP----  1538
             + +   E   +  RLSLDEK S+ +L  + +L +D KKP  R+SLP+LPS+K  +     
Sbjct  306   DSEESTEQTPRIGRLSLDEKGSKISLGAKETLPVDSKKPHLRRSLPRLPSQKAGLSNGKN  365

Query  1539  -----------SETKKASPIKTSISKEITEVDSQPNIVAKVTDEAEDVHASETEPKENDE  1685
                        +++ KA P KT   K+    +      A+ ++  +D     T  ++  E
Sbjct  366   EGKALPLAKAGADSMKAKPEKTKPEKDEDSTNQDQAPTAETSNAHQDARDQSTREEDKAE  425

Query  1686  ADMSLVQEPI  1715
             + M+L   P+
Sbjct  426   SPMALEHVPV  435



>ref|XP_010250125.1| PREDICTED: uncharacterized protein LOC104592447 [Nelumbo nucifera]
Length=514

 Score =   226 bits (577),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 156/368 (42%), Positives = 222/368 (60%), Gaps = 32/368 (9%)
 Frame = +3

Query  549   LNDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSN  728
             L + +++ S+ ++V   S++ ++SN     KE   +   ++   K QK   K KN K S+
Sbjct  104   LEESLSLSSTTEDVQDRSVIHVDSNGLVIDKELSGEDKEQTDHHKPQKGQRKSKNEKPSS  163

Query  729   PKHAVvagskkgkdgk--dissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHD  902
              K  V    +K KDGK  + +SS++  + TS  R+KQ  AP     S N+R++V + N  
Sbjct  164   TKVGVATSVQKTKDGKHVEATSSALNGSVTSTVRSKQSVAPATNWKSINDRQSV-EGNAS  222

Query  903   KHCGRPDTTTSSSVAQR-ESHkekpllkplkkgppkkSEATGQ-----------------  1028
                 RP  ++++S AQ+ + H +      +     +  +  G+                 
Sbjct  223   SESSRPTKSSATSTAQKSQQHGKSVSAPNMNVSQSEGPKEQGKHLKTLKEGVSTKVEENA  282

Query  1029  --SSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
               +SLSP A   K+ R G+LPSY FSF+C+ERAEKRKEF++KLEEKIHAKE+E S +QA+
Sbjct  283   ISTSLSPKAGGPKTRRVGSLPSYGFSFRCDERAEKRKEFFSKLEEKIHAKEVERSTLQAK  342

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKT-----  1367
             +KE+QEAEIK+LRKSL FKATPMP+FY+EP PPKVELKKIPPTR KSPKLGR K+     
Sbjct  343   SKETQEAEIKLLRKSLTFKATPMPSFYEEPAPPKVELKKIPPTRPKSPKLGRHKSLPVEK  402

Query  1368  --SSP--NRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYI  1535
               S P    +G + +  +T RLSLD K SQ+   + +S +  KKP RKSLPKLPS+++ +
Sbjct  403   NKSLPVEGSEGNSSHSSRTGRLSLDSKSSQNGFVKGKSPVQTKKPLRKSLPKLPSQESTL  462

Query  1536  PSETKKAS  1559
              S T  A+
Sbjct  463   TSVTDDAT  470



>ref|XP_010696225.1| PREDICTED: uncharacterized protein LOC104908761 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=471

 Score =   225 bits (574),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 225/374 (60%), Gaps = 17/374 (5%)
 Frame = +3

Query  447   HAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHESMVPLESNS  626
             H +GE+ +  + +  L+ + T    + + ++    N DI ++    EV   S V +E+N 
Sbjct  12    HGLGENDIASEVNETLDSTMTSVGPDVSQESVGEFNSDIMVNPLTDEVEQLSDVHVENNG  71

Query  627   CADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgkdissssvisn  806
                 +E +   +  +K  K QK  G+ KN K SN K+AVV  +K   +    ++S+    
Sbjct  72    SLTPEEVKTTEATAAKEPKPQKNQGRGKNEKPSNAKNAVVTSNKNNSNKAVKTTSNGTLP  131

Query  807   gtsasRAKQPSAPIEKSTSFNERKTV----------VKVNHDKHCGRPDTTTSSSVAQRE  956
               +     +P   + K  SFN+R             V +  +    +P  + S +V Q E
Sbjct  132   TNT-----RPKQLVAKVKSFNDRHATSSNSSKSTIPVSMASNAQKAKPLKSGSDNVVQCE  186

Query  957   SHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKE  1136
             +  EKP LKPL++ PP  +E   +S  SP+AAD K +R G LPSY FSF+C+ERAEKR+E
Sbjct  187   NAMEKPKLKPLRQEPPSTAEGDEESVESPSAADGKPNREGKLPSYGFSFRCHERAEKRRE  246

Query  1137  FYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELK  1316
             FYTKLEEKIHA+E+E++N+QA++KESQEAEIK LRK L FKA+PMP+FYQE P PKVELK
Sbjct  247   FYTKLEEKIHAQELEKNNLQAKSKESQEAEIKRLRKKLTFKASPMPSFYQE-PTPKVELK  305

Query  1317  KIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPS-QDNLARRRSLIDVKKPQ  1493
             KIP TR +SPKLGR+K SS       +   +  RLSLDEK   Q N ++  S +  K+PQ
Sbjct  306   KIPTTRPRSPKLGRKKNSSSVEAEDGDQSYRLGRLSLDEKAVLQTNPSKEPSPVQSKRPQ  365

Query  1494  RKSLPKLPSEKTYI  1535
             RKSLP+LPSEKT +
Sbjct  366   RKSLPRLPSEKTRL  379



>ref|XP_007137018.1| hypothetical protein PHAVU_009G093100g [Phaseolus vulgaris]
 ref|XP_007137019.1| hypothetical protein PHAVU_009G093100g [Phaseolus vulgaris]
 gb|ESW09012.1| hypothetical protein PHAVU_009G093100g [Phaseolus vulgaris]
 gb|ESW09013.1| hypothetical protein PHAVU_009G093100g [Phaseolus vulgaris]
Length=478

 Score =   225 bits (573),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 149/197 (76%), Gaps = 8/197 (4%)
 Frame = +3

Query  1032  SLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKE  1211
             S SPTA D ++ + G LP+Y FSFKC+ERAE+R+EFYTKLEEKIHAKE+EESN+QA+TKE
Sbjct  212   SSSPTAEDAQTRKVGMLPNYGFSFKCDERAERRREFYTKLEEKIHAKEVEESNLQAKTKE  271

Query  1212  SQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNR-DG  1388
             +QEAEIK LRKSL FKATPMP+FYQEPPP +VE KK+P TRAKSPKLGR+K+S+ +  +G
Sbjct  272   TQEAEIKRLRKSLGFKATPMPSFYQEPPPARVEFKKMPTTRAKSPKLGRKKSSTVSESEG  331

Query  1389  KNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSL-PKLPSEKT------YIPSET  1547
                N  +  RLSLD K SQ NL +  +L+  KKPQRKSL P+L SEKT       + + +
Sbjct  332   NTSNSARQGRLSLDVKVSQTNLTKGVTLVHQKKPQRKSLPPRLTSEKTSSSNSASVRTPS  391

Query  1548  KKASPIKTSISKEITEV  1598
             K  +  KTS+S   TEV
Sbjct  392   KAVNDDKTSLSSVTTEV  408



>ref|XP_008466404.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Cucumis 
melo]
Length=506

 Score =   225 bits (573),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 174/337 (52%), Positives = 218/337 (65%), Gaps = 23/337 (7%)
 Frame = +3

Query  546   NLNDDIAI----DSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKN  713
             N+ DDI+     +S+ +E+      P ES+     KE E K+    K  K +KA  K KN
Sbjct  53    NIEDDISGSTTNESTTRELTEGLNFPEESDISILPKEGEEKSVDPPKKVKPEKAQIKSKN  112

Query  714   VKLSNPKHAVvagskkgkdgkdisss-svisngtsasRAKQPSAPIEKSTSFNERKTVVK  890
              K S+ KH    G+KK KDGK+     +    G S S  KQPS    KS SFNER+  V 
Sbjct  113   EKSSSLKHVSSTGAKKNKDGKEAEHLLNGSGTGVSHSHPKQPS----KSRSFNERQAQVP  168

Query  891   VNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHR  1070
                +K  G             E  KE   LKPLKKG P KSE   +SS+SP A D K +R
Sbjct  169   KQTEKSDG-------------EGSKENTSLKPLKKGQPSKSEGESESSISPRAGDEKPNR  215

Query  1071  AGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSL  1250
              G LP+Y FSF+CNERAEKRKEFY+KLEEKI AKE+E++ +QA++KE+QEAEIKMLRKSL
Sbjct  216   VGRLPNYGFSFRCNERAEKRKEFYSKLEEKIQAKEVEKNTLQAKSKETQEAEIKMLRKSL  275

Query  1251  KFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG-LQTSRLSL  1427
              FKATPMP+FYQEPPPPKVELKKIPPTRAKSPKLGR+K+S+P     N+ G ++++RLSL
Sbjct  276   NFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGRKKSSTPADSSSNDGGDVRSARLSL  335

Query  1428  DEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIP  1538
             DE  + +N ++    +   KP+R+SLP LPSEK  IP
Sbjct  336   DENVALNNNSKGVYPVRSDKPKRRSLPNLPSEKITIP  372



>ref|XP_010696215.1| PREDICTED: uncharacterized protein LOC104908761 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696219.1| PREDICTED: uncharacterized protein LOC104908761 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=472

 Score =   224 bits (571),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 162/375 (43%), Positives = 229/375 (61%), Gaps = 18/375 (5%)
 Frame = +3

Query  447   HAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHESMVPLESNS  626
             H +GE+ +  + +  L+ + T    + + ++    N DI ++    EV   S V +E+N 
Sbjct  12    HGLGENDIASEVNETLDSTMTSVGPDVSQESVGEFNSDIMVNPLTDEVEQLSDVHVENNG  71

Query  627   CADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgkdissssvisn  806
                 +E +   +  +K  K QK  G+ KN K SN K+AVV  +K   +    ++S+    
Sbjct  72    SLTPEEVKTTEATAAKEPKPQKNQGRGKNEKPSNAKNAVVTSNKNNSNKAVKTTSNGTLP  131

Query  807   gtsasRAKQPSAPIEKSTSFNER--------KTVVKVN---HDKHCGRPDTTTSSSVAQR  953
               +     +P   + K  SFN+R        K+ + V+   + +   +P  + S +V Q 
Sbjct  132   TNT-----RPKQLVAKVKSFNDRHATSSNSSKSTIPVSMASNAQKAKQPLKSGSDNVVQC  186

Query  954   ESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRK  1133
             E+  EKP LKPL++ PP  +E   +S  SP+AAD K +R G LPSY FSF+C+ERAEKR+
Sbjct  187   ENAMEKPKLKPLRQEPPSTAEGDEESVESPSAADGKPNREGKLPSYGFSFRCHERAEKRR  246

Query  1134  EFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVEL  1313
             EFYTKLEEKIHA+E+E++N+QA++KESQEAEIK LRK L FKA+PMP+FYQE P PKVEL
Sbjct  247   EFYTKLEEKIHAQELEKNNLQAKSKESQEAEIKRLRKKLTFKASPMPSFYQE-PTPKVEL  305

Query  1314  KKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPS-QDNLARRRSLIDVKKP  1490
             KKIP TR +SPKLGR+K SS       +   +  RLSLDEK   Q N ++  S +  K+P
Sbjct  306   KKIPTTRPRSPKLGRKKNSSSVEAEDGDQSYRLGRLSLDEKAVLQTNPSKEPSPVQSKRP  365

Query  1491  QRKSLPKLPSEKTYI  1535
             QRKSLP+LPSEKT +
Sbjct  366   QRKSLPRLPSEKTRL  380



>ref|XP_010437921.1| PREDICTED: uncharacterized protein LOC104721599 isoform X1 [Camelina 
sativa]
Length=439

 Score =   222 bits (565),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 165/383 (43%), Positives = 223/383 (58%), Gaps = 38/383 (10%)
 Frame = +3

Query  645   SEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgkdissssvisngtsasR  824
             ++V+   +SK  K  KA  KPK+ KLS  K+ V +   K       +   V ++  S + 
Sbjct  71    TQVENVDDSKCMKSDKAQRKPKHDKLSGAKN-VSSVHIKKNKEGKTAGVKVAASNGSVAP  129

Query  825   AKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgpp  1004
               +P+ P+ KS SFN R+  V        G+ D+T + + A+     +K   KP KK   
Sbjct  130   IARPTEPL-KSKSFNGREAQVSKQ-----GKHDSTPAETAAR-----DKVKPKPQKKQAH  178

Query  1005  kkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEE  1184
             + SE   QSS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E 
Sbjct  179   ETSEDDTQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEI  238

Query  1185  SNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             +NMQA++KE+QEAE++MLRKSL FKATPMP+FYQEP PPK ELKKIPPTRAKSPKLGR+K
Sbjct  239   NNMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRAKSPKLGRKK  298

Query  1365  TSSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYI  1535
             T+S   D +     +  RLSLDE+ S+DN A +  +  V   K+P RKSLP+LPS+KT +
Sbjct  299   TAS-GADCEETQTPRIGRLSLDERASKDNSAAKGIMPTVELKKQPVRKSLPRLPSQKTAL  357

Query  1536  PSETKKASPIKT-------------------SISKEITEVDSQPNIVAKVTDEAEDVHAS  1658
             P    K +P K                    ++++    V+ +  +      +AED H  
Sbjct  358   PD--GKPAPAKAATTSAKVKPEKKKVEKDAETVNQSSHPVEEEAQVTVSSNADAEDSHEI  415

Query  1659  ETEPKENDEADMSL-VQEPITVE  1724
              +     D AD S+ V E +TVE
Sbjct  416   VSPRMNEDRADKSIEVSEAVTVE  438



>ref|XP_010546566.1| PREDICTED: protein WVD2-like 1 isoform X1 [Tarenaya hassleriana]
Length=439

 Score =   221 bits (563),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 157/233 (67%), Gaps = 27/233 (12%)
 Frame = +3

Query  852   KSTSFNERKTVVKVNHDKHCGRPDTTTSSSV----AQRESHkekpllkplkkgppkkSEA  1019
             KS SFN+R+ +    H KH   P   T         +++SH+               SE 
Sbjct  140   KSKSFNDRQALA-TKHGKHDAVPTEVTRDKTKLKPLKKQSHET--------------SEG  184

Query  1020  TGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQA  1199
               +SS SP A D KS R G LP+Y F+F+C++RAEKR+EFY+KLEEKIHAKE+E ++MQA
Sbjct  185   DSESSKSPKAEDGKSRRVGALPNYGFNFRCDQRAEKRREFYSKLEEKIHAKELENNDMQA  244

Query  1200  QTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN  1379
             ++KE+QEAEIKMLRKSL FKATPMP+FYQEP PPKVELKKIPPTR KSPKLGR+KT    
Sbjct  245   KSKETQEAEIKMLRKSLNFKATPMPSFYQEPQPPKVELKKIPPTRPKSPKLGRKKT----  300

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKT  1529
              +  N+   +  RLSLDE+ S+DN A  + ++ V   K   RKSLP+LPS+KT
Sbjct  301   -EETNDQTPRIGRLSLDERVSKDNSAGVKEILAVDPKKLSFRKSLPRLPSQKT  352



>ref|XP_007161209.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
 ref|XP_007161210.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
 gb|ESW33203.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
 gb|ESW33204.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
Length=477

 Score =   221 bits (564),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 169/374 (45%), Positives = 225/374 (60%), Gaps = 21/374 (6%)
 Frame = +3

Query  423   ENGVDKQLHAVGED--IVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIH  596
             +NGV  +    GED     D    V   + T+  + GNF N V+ +D  AID+     I 
Sbjct  17    QNGVHDEPSNSGEDGGASYDLDPSVTETAETVA-SNGNFDN-VHQSDSAAIDNLFVAQIK  74

Query  597   ESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKL--SNPKHAVvagskkgkd  770
             ES   ++ NS   +KE ++K S ++K  +  K   K KN K   S+  HA +    K + 
Sbjct  75    ESNDIIDGNSMIITKEEDMKISDQTKQSRAPKGFVKNKNAKAPSSSGVHAGLVNKSKIRK  134

Query  771   gkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQ  950
              K+ISSS         SR KQ    I+ S SFN+R+T  ++++ KH  + D   SS V+ 
Sbjct  135   DKEISSSVSNGTLALDSRPKQS---IKSSRSFNDRQT--ELSNPKHPLKSDEA-SSEVSM  188

Query  951   RESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKR  1130
              ++  +     P+K            SSLS    D K  R GTLP+Y FSFKC ERAE+R
Sbjct  189   EKTKTKSLRKGPVKDQEI-------DSSLSTNNEDAKPQRVGTLPNYGFSFKCGERAERR  241

Query  1131  KEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVE  1310
             KEFY KLEE+I AKE E++NMQA+TKE+Q+AEIK LRKSL FKATPMP+FYQEP PPKVE
Sbjct  242   KEFYDKLEERIQAKEEEKNNMQAKTKETQDAEIKKLRKSLNFKATPMPSFYQEPAPPKVE  301

Query  1311  LKKIPPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKK  1487
             LKKIP TR KSPK GR+KTS+ +  DG N +G + +RLSLDEK S+ N ++  + +  KK
Sbjct  302   LKKIPTTRPKSPKFGRKKTSANSESDGNNSSGSRLARLSLDEKVSESNPSKGPNPVLQKK  361

Query  1488  PQRKSLP-KLPSEK  1526
             P R+SLP +L SE+
Sbjct  362   PHRRSLPSRLASER  375



>ref|XP_004501334.1| PREDICTED: uncharacterized protein DDB_G0284459-like [Cicer arietinum]
Length=473

 Score =   221 bits (562),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 166/265 (63%), Gaps = 34/265 (13%)
 Frame = +3

Query  1032  SLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKE  1211
             S SPTA D K+ R GT+P+Y FSFKCNERAE+RKEFY+KLEE+IHAKE+EESNMQA+TKE
Sbjct  208   SSSPTAEDAKARRVGTMPNYGFSFKCNERAERRKEFYSKLEERIHAKEVEESNMQAKTKE  267

Query  1212  SQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS-SPNRDG  1388
             +QEAEIK LRK L FKATPMP+FYQEPPP +VELKKIP TRAKSPKLGRRK S S  ++G
Sbjct  268   TQEAEIKKLRKKLAFKATPMPSFYQEPPPSRVELKKIPTTRAKSPKLGRRKDSISSEQEG  327

Query  1389  KNENGLQTSRLSLDEKPSQDNLARRRS-LIDVKKPQRKSLP-KLPSEK------TYIPSE  1544
                   Q  RLSLDEK SQ N  +  S  +  KKPQR+SLP +L  E+          + 
Sbjct  328   STNISAQQCRLSLDEKVSQSNPTKGISPPVHQKKPQRRSLPTRLTPERISSSNSATARTS  387

Query  1545  TKKASPIKTSISKEITEVDSQPNIV--------------AKVTDEAEDVHASETEPKE--  1676
             +K  +  KTS+S   TEV    N                + ++DE  +  +   EP E  
Sbjct  388   SKAVNDEKTSLSSVTTEVTILSNATREEKDEAAAAIEGNSALSDETSETLSLNIEPDEAE  447

Query  1677  ---------NDEADMSLVQEPITVE  1724
                       D+  ++LVQ+PI  E
Sbjct  448   SHMNGVIVIEDKPQLTLVQQPIAAE  472



>ref|XP_010526217.1| PREDICTED: peptidyl-prolyl isomerase cwc-27-like isoform X2 [Tarenaya 
hassleriana]
Length=436

 Score =   219 bits (558),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 186/310 (60%), Gaps = 38/310 (12%)
 Frame = +3

Query  852   KSTSFNERKTVVKVNHDKHCGRPDTTTSSSV----AQRESHkekpllkplkkgppkkSEA  1019
             KS SFN+R+  V + H +H   P             +++SH                SE 
Sbjct  141   KSKSFNDRQARV-MKHGQHDTEPTEAAGEKTELKPLKKQSHDT--------------SEG  185

Query  1020  TGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQA  1199
               +SS +P A D KS R G LP+Y FSFKC++RAEKR+EFYTKLEEKIHAKE+E+++MQA
Sbjct  186   DSESS-NPKAEDGKSRRVGALPNYGFSFKCDQRAEKRREFYTKLEEKIHAKELEKNDMQA  244

Query  1200  QTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSP  1376
             ++KE+QEAEIKMLRKSL FKATPMP+FYQEP PPKVELKKIPPTR KSPKLGR+K  S  
Sbjct  245   KSKETQEAEIKMLRKSLNFKATPMPSFYQEPQPPKVELKKIPPTRPKSPKLGRKKIVSVA  304

Query  1377  NRDGKNENGLQTSRLSLDEKPSQDNLARRRSL-IDVKKPQ-RKSLPKLPSEKTYIP----  1538
             + +   E   +  RLSLDEK S+ +L  + +L +D KKP  R+SLP+LPS+K  +     
Sbjct  305   DSEESTEQTPRIGRLSLDEKGSKISLGAKETLPVDSKKPHLRRSLPRLPSQKAGLSNGKN  364

Query  1539  -----------SETKKASPIKTSISKEITEVDSQPNIVAKVTDEAEDVHASETEPKENDE  1685
                        +++ KA P KT   K+    +      A+ ++  +D     T  ++  E
Sbjct  365   EGKALPLAKAGADSMKAKPEKTKPEKDEDSTNQDQAPTAETSNAHQDARDQSTREEDKAE  424

Query  1686  ADMSLVQEPI  1715
             + M+L   P+
Sbjct  425   SPMALEHVPV  434



>ref|XP_004136350.1| PREDICTED: uncharacterized protein LOC101207396 [Cucumis sativus]
 gb|KGN60099.1| hypothetical protein Csa_3G878190 [Cucumis sativus]
Length=509

 Score =   221 bits (562),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +3

Query  1041  PTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQE  1220
             P A D K +R G LP+Y FSF+CNERAEKRKEFY+KLEEKI AKE+E++ +QA++KE+QE
Sbjct  209   PRAGDEKPNRVGRLPNYGFSFRCNERAEKRKEFYSKLEEKIQAKEVEKNTLQAKSKETQE  268

Query  1221  AEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNEN  1400
             AEIKMLRKSL FKATPMP+FYQEPPPPKVELKKIPPTRAKSPKLGR+K+S+      N+ 
Sbjct  269   AEIKMLRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGRKKSSTLADSSSNDG  328

Query  1401  G-LQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIP  1538
             G ++++RLSLDE  + +N ++    +   KP+R+SLP LPSEK  IP
Sbjct  329   GDVRSARLSLDENVALNNNSKGVYPVRSDKPKRRSLPNLPSEKIVIP  375



>ref|XP_010437923.1| PREDICTED: uncharacterized protein LOC104721599 isoform X3 [Camelina 
sativa]
Length=438

 Score =   217 bits (553),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 164/383 (43%), Positives = 223/383 (58%), Gaps = 39/383 (10%)
 Frame = +3

Query  645   SEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgkdissssvisngtsasR  824
             ++V+   +SK  K  KA  KPK+ KLS  K+ V +   K       +   V ++  S + 
Sbjct  71    TQVENVDDSKCMKSDKAQRKPKHDKLSGAKN-VSSVHIKKNKEGKTAGVKVAASNGSVAP  129

Query  825   AKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgpp  1004
               +P+ P+ KS SFN R+  V        G+ D+T + + A+     +K   KP KK   
Sbjct  130   IARPTEPL-KSKSFNGREAQVSKQ-----GKHDSTPAETAAR-----DKVKPKPQKKQAH  178

Query  1005  kkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEE  1184
             + SE   QSS +P A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E 
Sbjct  179   ETSEDDTQSS-NPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEI  237

Query  1185  SNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             +NMQA++KE+QEAE++MLRKSL FKATPMP+FYQEP PPK ELKKIPPTRAKSPKLGR+K
Sbjct  238   NNMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRAKSPKLGRKK  297

Query  1365  TSSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYI  1535
             T+S   D +     +  RLSLDE+ S+DN A +  +  V   K+P RKSLP+LPS+KT +
Sbjct  298   TAS-GADCEETQTPRIGRLSLDERASKDNSAAKGIMPTVELKKQPVRKSLPRLPSQKTAL  356

Query  1536  PSETKKASPIKT-------------------SISKEITEVDSQPNIVAKVTDEAEDVHAS  1658
             P    K +P K                    ++++    V+ +  +      +AED H  
Sbjct  357   PD--GKPAPAKAATTSAKVKPEKKKVEKDAETVNQSSHPVEEEAQVTVSSNADAEDSHEI  414

Query  1659  ETEPKENDEADMSL-VQEPITVE  1724
              +     D AD S+ V E +TVE
Sbjct  415   VSPRMNEDRADKSIEVSEAVTVE  437



>ref|XP_004173325.1| PREDICTED: uncharacterized protein LOC101231649 [Cucumis sativus]
Length=509

 Score =   218 bits (556),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +3

Query  1041  PTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQE  1220
             P A D K +R G LP+Y FSF+CNERAEKRKEFY+KLEEKI AKE+E++ +QA++KE+QE
Sbjct  209   PRAGDEKPNRVGRLPNYGFSFRCNERAEKRKEFYSKLEEKIQAKEVEKNTLQAKSKETQE  268

Query  1221  AEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNEN  1400
             AEIKMLRKSL FKATPMP+FYQEPPPPKVELKKIPPTRAKSPKLGR+K+S+      N+ 
Sbjct  269   AEIKMLRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGRKKSSTLADSSSNDG  328

Query  1401  G-LQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYI  1535
             G ++++RLSLDE  + +N ++    +   KP+R+SLP LPSEK  I
Sbjct  329   GDVRSARLSLDENVALNNNSKGVYPVRSDKPKRRSLPNLPSEKIVI  374



>ref|XP_010546567.1| PREDICTED: protein WVD2-like 1 isoform X2 [Tarenaya hassleriana]
Length=438

 Score =   216 bits (549),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 157/233 (67%), Gaps = 28/233 (12%)
 Frame = +3

Query  852   KSTSFNERKTVVKVNHDKHCGRPDTTTSSSV----AQRESHkekpllkplkkgppkkSEA  1019
             KS SFN+R+ +    H KH   P   T         +++SH+               SE 
Sbjct  140   KSKSFNDRQALA-TKHGKHDAVPTEVTRDKTKLKPLKKQSHET--------------SEG  184

Query  1020  TGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQA  1199
               +SS +P A D KS R G LP+Y F+F+C++RAEKR+EFY+KLEEKIHAKE+E ++MQA
Sbjct  185   DSESS-NPKAEDGKSRRVGALPNYGFNFRCDQRAEKRREFYSKLEEKIHAKELENNDMQA  243

Query  1200  QTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN  1379
             ++KE+QEAEIKMLRKSL FKATPMP+FYQEP PPKVELKKIPPTR KSPKLGR+KT    
Sbjct  244   KSKETQEAEIKMLRKSLNFKATPMPSFYQEPQPPKVELKKIPPTRPKSPKLGRKKT----  299

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKT  1529
              +  N+   +  RLSLDE+ S+DN A  + ++ V   K   RKSLP+LPS+KT
Sbjct  300   -EETNDQTPRIGRLSLDERVSKDNSAGVKEILAVDPKKLSFRKSLPRLPSQKT  351



>gb|ACL52672.1| unknown [Zea mays]
Length=385

 Score =   213 bits (543),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +3

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K  R G+ PSY FSFKC+ERAEKR+EFY+KLEEKIHA+E+E+SN+QA++KE++EAE+KM
Sbjct  185   VKPQRVGSTPSYGFSFKCDERAEKRREFYSKLEEKIHAQELEKSNLQAKSKETEEAELKM  244

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSPNRDGKNENGLQT  1412
             LRKSL FKATPMP+FY+EPPPPKVELKKIP TRA+SPKLGR K TSS   +G      ++
Sbjct  245   LRKSLNFKATPMPSFYKEPPPPKVELKKIPTTRARSPKLGRSKNTSSGGTEGNPNPPARS  304

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
              RLSLDE+ SQ+ + +  +   VKKPQRKSLPKLPSE+T
Sbjct  305   GRLSLDERVSQNGVKKAPAANAVKKPQRKSLPKLPSEQT  343



>ref|NP_001130992.1| uncharacterized protein LOC100192097 [Zea mays]
 ref|XP_008658037.1| PREDICTED: uncharacterized protein LOC100192097 isoform X1 [Zea 
mays]
 gb|ACF79409.1| unknown [Zea mays]
 gb|AFW87216.1| WDL1 isoform 1 [Zea mays]
 gb|AFW87217.1| WDL1 isoform 2 [Zea mays]
 gb|AFW87218.1| WDL1 isoform 3 [Zea mays]
 gb|AFW87219.1| WDL1 isoform 4 [Zea mays]
 gb|AFW87220.1| WDL1 isoform 5 [Zea mays]
Length=385

 Score =   213 bits (543),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +3

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K  R G+ PSY FSFKC+ERAEKR+EFY+KLEEKIHA+E+E+SN+QA++KE++EAE+KM
Sbjct  185   VKPQRVGSTPSYGFSFKCDERAEKRREFYSKLEEKIHAQELEKSNLQAKSKETEEAELKM  244

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSPNRDGKNENGLQT  1412
             LRKSL FKATPMP+FY+EPPPPKVELKKIP TRA+SPKLGR K TSS   +G      ++
Sbjct  245   LRKSLNFKATPMPSFYKEPPPPKVELKKIPTTRARSPKLGRSKNTSSGGTEGNPNPPARS  304

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
              RLSLDE+ SQ+ + +  +   VKKPQRKSLPKLPSE+T
Sbjct  305   GRLSLDERVSQNGVKKAPAANAVKKPQRKSLPKLPSEQT  343



>ref|NP_567893.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
 ref|NP_001119094.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
 gb|AAK59686.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44942.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86040.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
 gb|AEE86042.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
Length=437

 Score =   214 bits (545),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 137/179 (77%), Gaps = 4/179 (2%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS SP A D K  + G LP+Y FSFKC++RAEKRKEFY KLEEK HAKE E ++
Sbjct  179   SEDDTQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRKEFYVKLEEKTHAKEEEINS  238

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE+QEAE++MLRKSL FKATPMP+FYQEP PPK ELKKIPPTR KSPKLGR+KT+
Sbjct  239   MQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKTA  298

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSL--IDVKK-PQRKSLPKLPSEKTYIP  1538
             S   D +     +  RLSLDE+ S+DN   +  +  +D+KK P RKSLP+LPS+KT +P
Sbjct  299   S-GADSEETQTPRLGRLSLDERASKDNPTAKGIMPTVDLKKQPVRKSLPRLPSQKTVLP  356



>gb|KDO80221.1| hypothetical protein CISIN_1g012146mg [Citrus sinensis]
 gb|KDO80222.1| hypothetical protein CISIN_1g012146mg [Citrus sinensis]
 gb|KDO80223.1| hypothetical protein CISIN_1g012146mg [Citrus sinensis]
Length=451

 Score =   214 bits (545),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = +3

Query  1023  GQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
             G  S S    DTK  R G LP+Y FSFKC+ERA+KRKEFY KLEEKIHA+E+E++ +QA+
Sbjct  216   GTHSSSSPEGDTKPQRTGVLPAYGFSFKCDERAQKRKEFYAKLEEKIHAREVEKTTIQAK  275

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS-PN  1379
             T+E+QEAEIKM RKSL FKATPMP+FY EP PPKVELKK PPTRAKSPKL R ++S   +
Sbjct  276   TQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELKKTPPTRAKSPKLSRSRSSRIKD  335

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
              DG + +  Q+ R SLD K +Q+ +A+  S  D KKP RKSLPKLPSEKT + + T    
Sbjct  336   SDGNSSHSSQSGRFSLDVKLTQNRVAKGSSPQDYKKPLRKSLPKLPSEKTTLANTTVD--  393

Query  1560  PIKTSISKEITEVDSQPNI  1616
                   S  I+++  QP++
Sbjct  394   ------SASISQLSEQPDL  406



>ref|XP_002869282.1| hypothetical protein ARALYDRAFT_491495 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45541.1| hypothetical protein ARALYDRAFT_491495 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   214 bits (544),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 167/259 (64%), Gaps = 22/259 (8%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E ++
Sbjct  179   SEDDTQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINS  238

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE+QEAE++MLRKSL FKATPMP+FYQEP PPK ELKKIPPTR KSPKLGR+KT+
Sbjct  239   MQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKTA  298

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSL--IDVKK-PQRKSLPKLPSEKTYIP-  1538
             S   D +     +  RLSLDE+ S+DN   +  +  +D+KK P RKSLP+LPS+KT +P 
Sbjct  299   S-GGDCEETQTPRLGRLSLDERASKDNPTAKGIMPTVDLKKQPVRKSLPRLPSQKTALPD  357

Query  1539  ---------SETKKASPIKTSISKEITEVD--SQP-----NIVAKVTDEAEDVHASETEP  1670
                      + + K  P K  + K+   V+  S P      +    + +AED H   +  
Sbjct  358   GKPAPAKAATISAKVKPEKKKLEKDTETVNQSSHPIEEEAQVTVSSSADAEDSHEIVSPR  417

Query  1671  KENDEADMSL-VQEPITVE  1724
                D AD S+ V E + VE
Sbjct  418   MNEDRADKSIEVSEAVAVE  436



>ref|XP_006475866.1| PREDICTED: uncharacterized protein LOC102610166 isoform X3 [Citrus 
sinensis]
 gb|KDO80217.1| hypothetical protein CISIN_1g012146mg [Citrus sinensis]
Length=460

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = +3

Query  1023  GQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
             G  S S    DTK  R G LP+Y FSFKC+ERA+KRKEFY KLEEKIHA+E+E++ +QA+
Sbjct  225   GTHSSSSPEGDTKPQRTGVLPAYGFSFKCDERAQKRKEFYAKLEEKIHAREVEKTTIQAK  284

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS-PN  1379
             T+E+QEAEIKM RKSL FKATPMP+FY EP PPKVELKK PPTRAKSPKL R ++S   +
Sbjct  285   TQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELKKTPPTRAKSPKLSRSRSSRIKD  344

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
              DG + +  Q+ R SLD K +Q+ +A+  S  D KKP RKSLPKLPSEKT + + T    
Sbjct  345   SDGNSSHSSQSGRFSLDVKLTQNRVAKGSSPQDYKKPLRKSLPKLPSEKTTLANTTVD--  402

Query  1560  PIKTSISKEITEVDSQPNI  1616
                   S  I+++  QP++
Sbjct  403   ------SASISQLSEQPDL  415



>ref|XP_006450903.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
 ref|XP_006450905.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
 gb|ESR64143.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
 gb|ESR64145.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
Length=451

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = +3

Query  1023  GQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
             G  S S    DTK  R G LP+Y FSFKC+ERA+KRKEFY KLEEKIHA+E+E++ +QA+
Sbjct  216   GTHSSSSPEGDTKPQRTGVLPAYGFSFKCDERAQKRKEFYAKLEEKIHAREVEKTTIQAK  275

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS-PN  1379
             T+E+QEAEIKM RKSL FKATPMP+FY EP PPKVELKK PPTRAKSPKL R ++S   +
Sbjct  276   TQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELKKTPPTRAKSPKLSRSRSSRIKD  335

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
              DG + +  Q+ R SLD K +Q+ +A+  S  D KKP RKSLPKLPSEKT + + T    
Sbjct  336   SDGTSSHSSQSGRFSLDVKLTQNRVAKGSSPQDYKKPLRKSLPKLPSEKTTLANTTVD--  393

Query  1560  PIKTSISKEITEVDSQPNI  1616
                   S  I+++  QP++
Sbjct  394   ------SASISQLSEQPDL  406



>ref|XP_010447404.1| PREDICTED: uncharacterized protein LOC104730041 isoform X2 [Camelina 
sativa]
Length=440

 Score =   214 bits (544),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 187/321 (58%), Gaps = 38/321 (12%)
 Frame = +3

Query  831   QPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkk  1010
             +P+ P+ KS SFN R+  V     KH   P  T S    + +           KK   + 
Sbjct  134   RPTEPL-KSKSFNGREAQV-TKLGKHDSAPAETASGDKVKPKP---------QKKQAHET  182

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS SP   D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +N
Sbjct  183   SEDDTQSSNSPKE-DGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINN  241

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE+QEAE++MLRKSL FKATPMP+FYQEP PPK ELKKIPPTRAKSPKLGR+KT+
Sbjct  242   MQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRAKSPKLGRKKTA  301

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIPS  1541
             S   D +     +  RLSLDE+ S+DN A +  +  V   K+P RKSLP+LPS+KT +P 
Sbjct  302   S-GADCEETQTPRIGRLSLDERASKDNSAAKGIMPTVELKKQPVRKSLPRLPSQKTALPD  360

Query  1542  ETKKASPIKTSISKEITE-------------------VDSQPNIVAKVTDEAEDVHASET  1664
                K +P K + +    +                   V+ +  +      +AED H   +
Sbjct  361   --GKPAPAKAATTSAKVKPEKKKVEKDAETLNQSSHPVEEEAQVTVSSNADAEDSHEIVS  418

Query  1665  EPKENDEADMSL-VQEPITVE  1724
                  D AD S+ V E +TVE
Sbjct  419   PMMNEDRADKSIEVSEAVTVE  439



>gb|KDO80219.1| hypothetical protein CISIN_1g012146mg [Citrus sinensis]
Length=461

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = +3

Query  1023  GQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
             G  S S    DTK  R G LP+Y FSFKC+ERA+KRKEFY KLEEKIHA+E+E++ +QA+
Sbjct  226   GTHSSSSPEGDTKPQRTGVLPAYGFSFKCDERAQKRKEFYAKLEEKIHAREVEKTTIQAK  285

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS-PN  1379
             T+E+QEAEIKM RKSL FKATPMP+FY EP PPKVELKK PPTRAKSPKL R ++S   +
Sbjct  286   TQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELKKTPPTRAKSPKLSRSRSSRIKD  345

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
              DG + +  Q+ R SLD K +Q+ +A+  S  D KKP RKSLPKLPSEKT + + T    
Sbjct  346   SDGNSSHSSQSGRFSLDVKLTQNRVAKGSSPQDYKKPLRKSLPKLPSEKTTLANTTVD--  403

Query  1560  PIKTSISKEITEVDSQPNI  1616
                   S  I+++  QP++
Sbjct  404   ------SASISQLSEQPDL  416



>ref|XP_006450904.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
 ref|XP_006450906.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
 gb|ESR64144.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
 gb|ESR64146.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
Length=460

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = +3

Query  1023  GQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
             G  S S    DTK  R G LP+Y FSFKC+ERA+KRKEFY KLEEKIHA+E+E++ +QA+
Sbjct  225   GTHSSSSPEGDTKPQRTGVLPAYGFSFKCDERAQKRKEFYAKLEEKIHAREVEKTTIQAK  284

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS-PN  1379
             T+E+QEAEIKM RKSL FKATPMP+FY EP PPKVELKK PPTRAKSPKL R ++S   +
Sbjct  285   TQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELKKTPPTRAKSPKLSRSRSSRIKD  344

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
              DG + +  Q+ R SLD K +Q+ +A+  S  D KKP RKSLPKLPSEKT + + T    
Sbjct  345   SDGTSSHSSQSGRFSLDVKLTQNRVAKGSSPQDYKKPLRKSLPKLPSEKTTLANTTVD--  402

Query  1560  PIKTSISKEITEVDSQPNI  1616
                   S  I+++  QP++
Sbjct  403   ------SASISQLSEQPDL  415



>ref|XP_006450901.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
 gb|ESR64141.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
Length=460

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = +3

Query  1023  GQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
             G  S S    DTK  R G LP+Y FSFKC+ERA+KRKEFY KLEEKIHA+E+E++ +QA+
Sbjct  225   GTHSSSSPEGDTKPQRTGVLPAYGFSFKCDERAQKRKEFYAKLEEKIHAREVEKTTIQAK  284

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS-PN  1379
             T+E+QEAEIKM RKSL FKATPMP+FY EP PPKVELKK PPTRAKSPKL R ++S   +
Sbjct  285   TQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELKKTPPTRAKSPKLSRSRSSRIKD  344

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
              DG + +  Q+ R SLD K +Q+ +A+  S  D KKP RKSLPKLPSEKT + + T    
Sbjct  345   SDGTSSHSSQSGRFSLDVKLTQNRVAKGSSPQDYKKPLRKSLPKLPSEKTTLANTTVD--  402

Query  1560  PIKTSISKEITEVDSQPNI  1616
                   S  I+++  QP++
Sbjct  403   ------SASISQLSEQPDL  415



>ref|XP_006283755.1| hypothetical protein CARUB_v10004833mg [Capsella rubella]
 gb|EOA16653.1| hypothetical protein CARUB_v10004833mg [Capsella rubella]
Length=438

 Score =   213 bits (543),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 136/179 (76%), Gaps = 4/179 (2%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E ++
Sbjct  180   SEDDTQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINS  239

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE+QEAE++MLRKSL FKATPMP+FYQEP PPK ELKKIPPTR KSPKLGR+KT+
Sbjct  240   MQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKTA  299

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIP  1538
             S   D +     +  RLSLDE+ S+DN A +  +  V   K+P RKSLP+LPS+KT +P
Sbjct  300   S-GVDCEETQTPRLGRLSLDERASKDNSAAKGIMPTVELKKQPVRKSLPRLPSQKTALP  357



>ref|XP_006475864.1| PREDICTED: uncharacterized protein LOC102610166 isoform X1 [Citrus 
sinensis]
 gb|KDO80220.1| hypothetical protein CISIN_1g012146mg [Citrus sinensis]
Length=470

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = +3

Query  1023  GQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
             G  S S    DTK  R G LP+Y FSFKC+ERA+KRKEFY KLEEKIHA+E+E++ +QA+
Sbjct  235   GTHSSSSPEGDTKPQRTGVLPAYGFSFKCDERAQKRKEFYAKLEEKIHAREVEKTTIQAK  294

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS-PN  1379
             T+E+QEAEIKM RKSL FKATPMP+FY EP PPKVELKK PPTRAKSPKL R ++S   +
Sbjct  295   TQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELKKTPPTRAKSPKLSRSRSSRIKD  354

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
              DG + +  Q+ R SLD K +Q+ +A+  S  D KKP RKSLPKLPSEKT + + T    
Sbjct  355   SDGNSSHSSQSGRFSLDVKLTQNRVAKGSSPQDYKKPLRKSLPKLPSEKTTLANTTVD--  412

Query  1560  PIKTSISKEITEVDSQPNI  1616
                   S  I+++  QP++
Sbjct  413   ------SASISQLSEQPDL  425



>ref|XP_006475865.1| PREDICTED: uncharacterized protein LOC102610166 isoform X2 [Citrus 
sinensis]
 gb|KDO80218.1| hypothetical protein CISIN_1g012146mg [Citrus sinensis]
Length=469

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = +3

Query  1023  GQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
             G  S S    DTK  R G LP+Y FSFKC+ERA+KRKEFY KLEEKIHA+E+E++ +QA+
Sbjct  234   GTHSSSSPEGDTKPQRTGVLPAYGFSFKCDERAQKRKEFYAKLEEKIHAREVEKTTIQAK  293

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS-PN  1379
             T+E+QEAEIKM RKSL FKATPMP+FY EP PPKVELKK PPTRAKSPKL R ++S   +
Sbjct  294   TQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELKKTPPTRAKSPKLSRSRSSRIKD  353

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
              DG + +  Q+ R SLD K +Q+ +A+  S  D KKP RKSLPKLPSEKT + + T    
Sbjct  354   SDGNSSHSSQSGRFSLDVKLTQNRVAKGSSPQDYKKPLRKSLPKLPSEKTTLANTTVD--  411

Query  1560  PIKTSISKEITEVDSQPNI  1616
                   S  I+++  QP++
Sbjct  412   ------SASISQLSEQPDL  424



>ref|XP_002438655.1| hypothetical protein SORBIDRAFT_10g023700 [Sorghum bicolor]
 gb|EER90022.1| hypothetical protein SORBIDRAFT_10g023700 [Sorghum bicolor]
Length=384

 Score =   211 bits (538),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 128/158 (81%), Gaps = 1/158 (1%)
 Frame = +3

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K  R G+ PSY FSFKC+ERAEKR+EFYTKLEEKIHA+E+E+SN+Q   +E++EAE+KM
Sbjct  184   VKPQRVGSTPSYGFSFKCDERAEKRREFYTKLEEKIHAQELEKSNLQTAVQETEEAELKM  243

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSPNRDGKNENGLQT  1412
             LRKSL FKATPMP+FY+EPPPPKVELKKIP TRA+SPKLGR K TSS   +G +     +
Sbjct  244   LRKSLNFKATPMPSFYKEPPPPKVELKKIPTTRARSPKLGRSKNTSSGGTEGNSNPPAHS  303

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEK  1526
             +RLSLDE+ SQ+ + +  +   VKKPQRKSLPKLPSE+
Sbjct  304   ARLSLDERVSQNGVKKAPAANAVKKPQRKSLPKLPSEQ  341



>ref|XP_006450902.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
 gb|ESR64142.1| hypothetical protein CICLE_v10008193mg [Citrus clementina]
Length=469

 Score =   214 bits (544),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 9/199 (5%)
 Frame = +3

Query  1023  GQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
             G  S S    DTK  R G LP+Y FSFKC+ERA+KRKEFY KLEEKIHA+E+E++ +QA+
Sbjct  234   GTHSSSSPEGDTKPQRTGVLPAYGFSFKCDERAQKRKEFYAKLEEKIHAREVEKTTIQAK  293

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS-PN  1379
             T+E+QEAEIKM RKSL FKATPMP+FY EP PPKVELKK PPTRAKSPKL R ++S   +
Sbjct  294   TQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELKKTPPTRAKSPKLSRSRSSRIKD  353

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKAS  1559
              DG + +  Q+ R SLD K +Q+ +A+  S  D KKP RKSLPKLPSEKT + + T    
Sbjct  354   SDGTSSHSSQSGRFSLDVKLTQNRVAKGSSPQDYKKPLRKSLPKLPSEKTTLANTTVD--  411

Query  1560  PIKTSISKEITEVDSQPNI  1616
                   S  I+++  QP++
Sbjct  412   ------SASISQLSEQPDL  424



>ref|XP_010437922.1| PREDICTED: general transcriptional corepressor trfA-like isoform 
X2 [Camelina sativa]
Length=439

 Score =   212 bits (540),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 164/384 (43%), Positives = 223/384 (58%), Gaps = 40/384 (10%)
 Frame = +3

Query  645   SEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgkdissssvisngtsasR  824
             ++V+   +SK  K  KA  KPK+ KLS  K+ V +   K       +   V ++  S + 
Sbjct  71    TQVENVDDSKCMKSDKAQRKPKHDKLSGAKN-VSSVHIKKNKEGKTAGVKVAASNGSVAP  129

Query  825   AKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgpp  1004
               +P+ P+ KS SFN R+  V        G+ D+T + + A+     +K   KP KK   
Sbjct  130   IARPTEPL-KSKSFNGREAQVSKQ-----GKHDSTPAETAAR-----DKVKPKPQKKQAH  178

Query  1005  kkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEE  1184
             + SE   QSS +P A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E 
Sbjct  179   ETSEDDTQSS-NPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEI  237

Query  1185  SNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVEL-KKIPPTRAKSPKLGRR  1361
             +NMQA++KE+QEAE++MLRKSL FKATPMP+FYQEP PPK EL KKIPPTRAKSPKLGR+
Sbjct  238   NNMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKKIPPTRAKSPKLGRK  297

Query  1362  KTSSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTY  1532
             KT+S   D +     +  RLSLDE+ S+DN A +  +  V   K+P RKSLP+LPS+KT 
Sbjct  298   KTAS-GADCEETQTPRIGRLSLDERASKDNSAAKGIMPTVELKKQPVRKSLPRLPSQKTA  356

Query  1533  IPSETKKASPIKT-------------------SISKEITEVDSQPNIVAKVTDEAEDVHA  1655
             +P    K +P K                    ++++    V+ +  +      +AED H 
Sbjct  357   LPD--GKPAPAKAATTSAKVKPEKKKVEKDAETVNQSSHPVEEEAQVTVSSNADAEDSHE  414

Query  1656  SETEPKENDEADMSL-VQEPITVE  1724
               +     D AD S+ V E +TVE
Sbjct  415   IVSPRMNEDRADKSIEVSEAVTVE  438



>ref|XP_003545471.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X1 [Glycine max]
 ref|XP_006596103.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X2 [Glycine max]
 gb|KHN13751.1| hypothetical protein glysoja_044340 [Glycine soja]
Length=481

 Score =   213 bits (543),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 179/435 (41%), Positives = 242/435 (56%), Gaps = 19/435 (4%)
 Frame = +3

Query  423   ENGVDKQLHAVGED--IVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIH  596
             +NGV  +    GED  +  D    V   + T+    GNF N  + +D  A D+S+   I 
Sbjct  17    QNGVHDEPSNSGEDGGVSYDLDPSVPETAATVA-PNGNFDN-FHQSDSAASDNSLVAEIK  74

Query  597   ESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgk  776
             ES V ++  +    KE EVK S ++K  +  K   K KN K  +    V A         
Sbjct  75    ESNVNIDGTNMTIPKEEEVKISDQTKQSRAPKGLVKNKNAKAPS-SSGVHASLVNKSQIG  133

Query  777   dissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRE  956
                 +S   +  S++    P   I+ S SFN+R+T           +P   + S  A  E
Sbjct  134   KDKEASSSVSNGSSALDSLPRQSIKGSRSFNDRQT--------QLSKPKHPSKSDAASSE  185

Query  957   SHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKE  1136
                EK   K L+KGP  K +  G+SSLS    D+K  R GTLP+Y FSFKC ERAE+RKE
Sbjct  186   VSVEKTKPKSLRKGPIDKVQGEGESSLSTNTDDSKPQRVGTLPNYGFSFKCGERAERRKE  245

Query  1137  FYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELK  1316
             FY KLEE+I AKE+E+SN+QA+TKE+QEAEIKMLRKSL FKATPMP+FYQEP P K ELK
Sbjct  246   FYNKLEERIQAKEVEKSNLQAKTKETQEAEIKMLRKSLNFKATPMPSFYQEPAPAKAELK  305

Query  1317  KIPPTRAKSPKLGRRK-TSSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRS-LIDVKKP  1490
             KIP TRAKSPKLGR+K T++   DG N +  + +RLSLDEK S+ N  +  +  +  KKP
Sbjct  306   KIPTTRAKSPKLGRKKSTANSESDGNNSSSSRLARLSLDEKVSESNPTKGPTPPVHQKKP  365

Query  1491  QRKSLP-KLPSEKTYIPSETKKASPIKTSISKEITEVDS---QPNIVAKVTDEAEDVHAS  1658
             QR+SLP +L SE   + +     +  K +I  E + + S   + N +   T EA+ +  +
Sbjct  366   QRRSLPARLASEGNSVSNSRTALTSSKAAIKDEKSSLSSAAKKDNNLTNATGEAKTMTIA  425

Query  1659  ETEPKENDEADMSLV  1703
               E K    ++ S V
Sbjct  426   ANEEKSTLSSETSAV  440



>gb|AFK45470.1| unknown [Medicago truncatula]
Length=452

 Score =   212 bits (540),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 126/158 (80%), Gaps = 2/158 (1%)
 Frame = +3

Query  1041  PTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQE  1220
             PT+ D K  R GT+P+Y FSFKCNERAE+RKEFY+KLEE+IHAKE+EESN+QA+TKESQE
Sbjct  192   PTSEDAKPRRVGTMPTYGFSFKCNERAERRKEFYSKLEERIHAKEVEESNIQAKTKESQE  251

Query  1221  AEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS--SPNRDGKN  1394
             AEIK LRK L FKATPMP+FYQEP P +VELKKIP TRAKSPKLGR+K+S  S   D  +
Sbjct  252   AEIKRLRKKLAFKATPMPSFYQEPTPSRVELKKIPTTRAKSPKLGRKKSSTMSSELDVNS  311

Query  1395  ENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLP  1508
              +  Q  RLSLDEK SQ+N  +  S +  KKPQR+SLP
Sbjct  312   NSSAQQCRLSLDEKVSQNNPTKGISHVQPKKPQRRSLP  349



>gb|AES73638.2| TPX2 (targeting protein for Xklp2) family protein [Medicago truncatula]
Length=453

 Score =   212 bits (540),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 126/158 (80%), Gaps = 2/158 (1%)
 Frame = +3

Query  1041  PTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQE  1220
             PT+ D K  R GT+P+Y FSFKCNERAE+RKEFY+KLEE+IHAKE+EESN+QA+TKESQE
Sbjct  193   PTSEDAKPRRVGTMPTYGFSFKCNERAERRKEFYSKLEERIHAKEVEESNIQAKTKESQE  252

Query  1221  AEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS--SPNRDGKN  1394
             AEIK LRK L FKATPMP+FYQEP P +VELKKIP TRAKSPKLGR+K+S  S   D  +
Sbjct  253   AEIKRLRKKLAFKATPMPSFYQEPTPSRVELKKIPTTRAKSPKLGRKKSSTMSSELDVNS  312

Query  1395  ENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLP  1508
              +  Q  RLSLDEK SQ+N  +  S +  KKPQR+SLP
Sbjct  313   NSSAQQCRLSLDEKVSQNNPTKGISHVQPKKPQRRSLP  350



>ref|XP_010447406.1| PREDICTED: uncharacterized protein LOC104730041 isoform X4 [Camelina 
sativa]
Length=439

 Score =   211 bits (537),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 158/247 (64%), Gaps = 26/247 (11%)
 Frame = +3

Query  1053  DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIK  1232
             D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +NMQA++KE+QEAE++
Sbjct  195   DGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINNMQAKSKETQEAELR  254

Query  1233  MLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQT  1412
             MLRKSL FKATPMP+FYQEP PPK ELKKIPPTRAKSPKLGR+KT+S   D +     + 
Sbjct  255   MLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRAKSPKLGRKKTAS-GADCEETQTPRI  313

Query  1413  SRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIPSETKKASPIKT----  1571
              RLSLDE+ S+DN A +  +  V   K+P RKSLP+LPS+KT +P    K +P K     
Sbjct  314   GRLSLDERASKDNSAAKGIMPTVELKKQPVRKSLPRLPSQKTALPD--GKPAPAKAATTS  371

Query  1572  ---------------SISKEITEVDSQPNIVAKVTDEAEDVHASETEPKENDEADMSL-V  1703
                            ++++    V+ +  +      +AED H   +     D AD S+ V
Sbjct  372   AKVKPEKKKVEKDAETLNQSSHPVEEEAQVTVSSNADAEDSHEIVSPMMNEDRADKSIEV  431

Query  1704  QEPITVE  1724
              E +TVE
Sbjct  432   SEAVTVE  438



>ref|XP_006842059.1| hypothetical protein AMTR_s00078p00037340 [Amborella trichopoda]
 gb|ERN03734.1| hypothetical protein AMTR_s00078p00037340 [Amborella trichopoda]
Length=459

 Score =   211 bits (537),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 162/240 (68%), Gaps = 20/240 (8%)
 Frame = +3

Query  1029  SSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTK  1208
             +S SP+ A+TK  R GT PSY FSF+C+ERAEKRKEFY+KLEEKIHAKE+E+SN+QA++K
Sbjct  221   TSSSPSLAETKPGRVGTTPSYGFSFRCDERAEKRKEFYSKLEEKIHAKEVEKSNLQAKSK  280

Query  1209  ESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDG  1388
             E+ EAEIK+LRKSL FKA PMPTFYQEP PPKVELKKIPPTRAKSPKLGR K+SS + DG
Sbjct  281   ETLEAEIKLLRKSLTFKANPMPTFYQEPAPPKVELKKIPPTRAKSPKLGRHKSSSGDSDG  340

Query  1389  KNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEK--TYIPSETKKASP  1562
                   +++RLSLDE  + +N        + KK QRKSLPKLPSEK  T + SE +    
Sbjct  341   STGRSCRSARLSLDETKTNNNSTPPSQ--NPKKSQRKSLPKLPSEKSNTLLESEER----  394

Query  1563  IKTSISKEITEVDSQPNIVAKVTDEAEDVHASETEPK------ENDEADMSL-VQEPITV  1721
                 +  +I   D  P  VAK  DE E +   E E K      EN E +    V EP+ V
Sbjct  395   ---PLDNQIPNSDETPEFVAK-PDEIESM-VEEREGKAVIQFSENKEGESETEVSEPVVV  449



>ref|XP_004498741.1| PREDICTED: serine-rich adhesin for platelets-like isoform X1 
[Cicer arietinum]
 ref|XP_004498742.1| PREDICTED: serine-rich adhesin for platelets-like isoform X2 
[Cicer arietinum]
 ref|XP_004498743.1| PREDICTED: serine-rich adhesin for platelets-like isoform X3 
[Cicer arietinum]
Length=475

 Score =   211 bits (537),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 182/416 (44%), Positives = 230/416 (55%), Gaps = 33/416 (8%)
 Frame = +3

Query  372   MMDANDKKRIAENGLG--CENGVDKQLHAVGEDI-VVDQSDGVLNGSFTIEEAEGNFQNA  542
             MMD  +   I  +GL    +NGV  +    GED  V +  D  +  +       G  +N 
Sbjct  1     MMDLVNP--ILADGLDEVHQNGVHDEPSNSGEDGGVSNDLDSRVTETIETVAPNGYLEN-  57

Query  543   VNLNDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKL  722
              N ++  A   S    I  S V ++ N+   SKE EVK + +++  + QK   K KN K+
Sbjct  58    FNQSESTATGDSSIGGIEGSNVNVDGNNTTISKEKEVKKTVQTEQSRAQKGSVKNKNAKV  117

Query  723   --SNPKHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVN  896
               S+  HA +  + K    K  SS+         SR KQ      KS SFN+R++    N
Sbjct  118   ASSSGVHANLVKNSKNAKDKPASSAVSNGTSALESRPKQSI----KSRSFNDRQSQASKN  173

Query  897   HDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAG  1076
               K          S  A  E  KEK   K LK       EA  +SSL+  A D K  R G
Sbjct  174   PSK----------SDAASSEVAKEKKKPKSLKPVDKVPDEA--ESSLT-NAEDAKPRRVG  220

Query  1077  TLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKF  1256
             TLP+Y FSFKC+ERAEKR+EF TK+EEKI AKE E+SN+QA+T ESQE EIK LRKSL F
Sbjct  221   TLPNYGFSFKCDERAEKRREFLTKVEEKIQAKEEEKSNLQAKTMESQEKEIKKLRKSLTF  280

Query  1257  KATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDE  1433
             KATPMPTFYQEP PPKVELKKIP TRAKSPKLGR+KTS+ +  DG   +  Q  RLSLDE
Sbjct  281   KATPMPTFYQEPAPPKVELKKIPTTRAKSPKLGRKKTSTNSESDGNGNSSSQLGRLSLDE  340

Query  1434  KPSQDNLARRRSLIDVKKPQRKSL-PKLPSEKTYI------PSETKKASPIKTSIS  1580
             K S  N  +  + +  KKP RKSL P+L S++T        P+ +K     KTS+S
Sbjct  341   KVSHSNSTKGVAPVHQKKPLRKSLPPRLASDRTSSSNSVAGPTSSKAVHDEKTSLS  396



>ref|XP_010048196.1| PREDICTED: cylicin-1-like [Eucalyptus grandis]
 ref|XP_010048198.1| PREDICTED: cylicin-1-like [Eucalyptus grandis]
 ref|XP_010048199.1| PREDICTED: cylicin-1-like [Eucalyptus grandis]
 ref|XP_010048200.1| PREDICTED: cylicin-1-like [Eucalyptus grandis]
 gb|KCW80380.1| hypothetical protein EUGRSUZ_C01741 [Eucalyptus grandis]
Length=428

 Score =   210 bits (534),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +3

Query  1026  QSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQT  1205
             QSS   TAAD   HR G  P+Y FSF+C+ERAEKRKEFYTKLEEKIHAKE+E++ +QA++
Sbjct  194   QSSPDLTAADAGPHRVGARPNYGFSFRCDERAEKRKEFYTKLEEKIHAKEVEQTTLQAKS  253

Query  1206  KESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRD  1385
             KE+QEAE+KMLRKSL FKATPMP FYQEP PPKVELKKIPPTRA+SPKLGRRK+SS    
Sbjct  254   KETQEAELKMLRKSLNFKATPMPNFYQEPSPPKVELKKIPPTRARSPKLGRRKSSSSEGS  313

Query  1386  GKNENGLQTS-RLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEK  1526
              +N +G + S RLSL E+ S+ N   R   I  KKP RKSLP LPSE+
Sbjct  314   EENGDGNRPSGRLSLGEEVSR-NQQSRVPPIKAKKPIRKSLPVLPSER  360



>ref|XP_004965929.1| PREDICTED: neurofilament heavy polypeptide-like [Setaria italica]
Length=383

 Score =   208 bits (530),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             K  R G+ P+Y FSFKC+ERAEKR+EFY+KLEEKIHA+E+E+SN+QA++KE++EAE+KML
Sbjct  185   KPQRVGSTPAYGFSFKCDERAEKRREFYSKLEEKIHAQELEKSNLQAKSKEAEEAELKML  244

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSPNRDGKNENGLQTS  1415
             RKSL FKA PMP+FY+EPPPPKVELKKIP TR +SPKLGR K T+S   +G     ++++
Sbjct  245   RKSLNFKAAPMPSFYKEPPPPKVELKKIPTTRPRSPKLGRSKNTTSTGTEGNTNPTVRSA  304

Query  1416  RLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEK  1526
             RLSLDE+ SQ+ + +  +   VKKPQRKSLPKLPSE+
Sbjct  305   RLSLDERVSQNGIKKAPATNAVKKPQRKSLPKLPSEQ  341



>ref|XP_006412486.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 gb|ESQ53939.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
Length=432

 Score =   209 bits (533),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 158/232 (68%), Gaps = 18/232 (8%)
 Frame = +3

Query  852   KSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQS  1031
             KSTSFN R+  V   H    G+PD+  + S A      +K   KP KK   + SE   QS
Sbjct  134   KSTSFNGREAQV-TEH----GKPDSAPAESAA-----GDKVKPKPQKKQVHETSEDDTQS  183

Query  1032  SLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKE  1211
             S SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E ++MQA++KE
Sbjct  184   SNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINSMQAKSKE  243

Query  1212  SQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGK  1391
             +QEAE++ LRKSL FKATPMP+FYQEP PPK ELKKIPPTR KSPKLGR+KT     D +
Sbjct  244   TQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKT-----DSE  298

Query  1392  NENGLQTSRLSLDEKPSQDNLARRRSL--IDVKK-PQRKSLPKLPSEKTYIP  1538
                  +  RLSLDEK  +DN   +  +  +D+KK P RKSLP+LPS+KT +P
Sbjct  299   ETQTPRVGRLSLDEKALKDNPTAKGIVPTVDLKKQPVRKSLPRLPSQKTALP  350



>ref|XP_006412488.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 ref|XP_006412489.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 ref|XP_006412490.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 gb|ESQ53941.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 gb|ESQ53942.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 gb|ESQ53943.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
Length=435

 Score =   209 bits (533),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 158/232 (68%), Gaps = 18/232 (8%)
 Frame = +3

Query  852   KSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQS  1031
             KSTSFN R+  V   H    G+PD+  + S A      +K   KP KK   + SE   QS
Sbjct  137   KSTSFNGREAQV-TEH----GKPDSAPAESAA-----GDKVKPKPQKKQVHETSEDDTQS  186

Query  1032  SLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKE  1211
             S SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E ++MQA++KE
Sbjct  187   SNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINSMQAKSKE  246

Query  1212  SQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGK  1391
             +QEAE++ LRKSL FKATPMP+FYQEP PPK ELKKIPPTR KSPKLGR+KT     D +
Sbjct  247   TQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKT-----DSE  301

Query  1392  NENGLQTSRLSLDEKPSQDNLARRRSL--IDVKK-PQRKSLPKLPSEKTYIP  1538
                  +  RLSLDEK  +DN   +  +  +D+KK P RKSLP+LPS+KT +P
Sbjct  302   ETQTPRVGRLSLDEKALKDNPTAKGIVPTVDLKKQPVRKSLPRLPSQKTALP  353



>ref|XP_003549281.1| PREDICTED: protein gar2-like isoform X1 [Glycine max]
 ref|XP_006601153.1| PREDICTED: protein gar2-like isoform X2 [Glycine max]
 gb|KHN33910.1| hypothetical protein glysoja_031772 [Glycine soja]
Length=481

 Score =   211 bits (536),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 165/368 (45%), Positives = 219/368 (60%), Gaps = 19/368 (5%)
 Frame = +3

Query  423   ENGVDKQLHAVGED--IVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIH  596
             +NGV  +    G+D  +  D    V   + T+    GNF N  + +D  A D+S    I 
Sbjct  17    QNGVHDEPSNSGDDDGVSYDLDPSVTETAATVA-LNGNFDN-FHQSDSAASDNSFVAEIK  74

Query  597   ESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKL--SNPKHAVvagskkgkd  770
             ES   ++  +    KE EVK S ++K  +  K   K KN K   S+  HA +    K   
Sbjct  75    ESNDNIDGTNMTIPKEEEVKISDQTKQSRAPKGLVKNKNAKAPSSSGVHASLVNKSKIGK  134

Query  771   gkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQ  950
              K+ SSS         SR +Q +   + S SFN+R+T  +++  KH  + D T+S     
Sbjct  135   DKEASSSVSNGTSALDSRPRQST---KSSRSFNDRQT--QLSKPKHPSKSDATSS-----  184

Query  951   RESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKR  1130
              E   EK   K  +K P  K +   +SSLS    D K  R GTLP+Y FSFKC ERAE+R
Sbjct  185   -EVSVEKTKPKSSRKEPIDKVQGEAESSLSSNTEDAKPQRVGTLPNYGFSFKCGERAERR  243

Query  1131  KEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVE  1310
             +EFY KLEE+I AKE+E+SN+QA++KE+QEAEIKMLRKSL FKATPMP+FYQEP P K E
Sbjct  244   REFYNKLEERIQAKEVEKSNLQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPAPAKAE  303

Query  1311  LKKIPPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRS-LIDVK  1484
             LKKIP TRAKSPKLGR+K+S+ +  DG N +  + +RLSLDEK S+ NL +  +  +  K
Sbjct  304   LKKIPTTRAKSPKLGRKKSSANSESDGNNSSSSRLARLSLDEKVSESNLTKGPTPPVHQK  363

Query  1485  KPQRKSLP  1508
             KPQR+SLP
Sbjct  364   KPQRRSLP  371



>ref|NP_974659.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
 gb|AEE86041.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
Length=436

 Score =   209 bits (532),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 137/179 (77%), Gaps = 5/179 (3%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS +P A D K  + G LP+Y FSFKC++RAEKRKEFY KLEEK HAKE E ++
Sbjct  179   SEDDTQSS-NPKADDGKPRKVGALPNYGFSFKCDQRAEKRKEFYVKLEEKTHAKEEEINS  237

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE+QEAE++MLRKSL FKATPMP+FYQEP PPK ELKKIPPTR KSPKLGR+KT+
Sbjct  238   MQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKTA  297

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSL--IDVKK-PQRKSLPKLPSEKTYIP  1538
             S   D +     +  RLSLDE+ S+DN   +  +  +D+KK P RKSLP+LPS+KT +P
Sbjct  298   S-GADSEETQTPRLGRLSLDERASKDNPTAKGIMPTVDLKKQPVRKSLPRLPSQKTVLP  355



>ref|XP_010447403.1| PREDICTED: uncharacterized protein LOC104730041 isoform X1 [Camelina 
sativa]
Length=441

 Score =   209 bits (532),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 187/322 (58%), Gaps = 39/322 (12%)
 Frame = +3

Query  831   QPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkk  1010
             +P+ P+ KS SFN R+  V     KH   P  T S    + +           KK   + 
Sbjct  134   RPTEPL-KSKSFNGREAQV-TKLGKHDSAPAETASGDKVKPKP---------QKKQAHET  182

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS SP   D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +N
Sbjct  183   SEDDTQSSNSPKE-DGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINN  241

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVEL-KKIPPTRAKSPKLGRRKT  1367
             MQA++KE+QEAE++MLRKSL FKATPMP+FYQEP PPK EL KKIPPTRAKSPKLGR+KT
Sbjct  242   MQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKKIPPTRAKSPKLGRKKT  301

Query  1368  SSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIP  1538
             +S   D +     +  RLSLDE+ S+DN A +  +  V   K+P RKSLP+LPS+KT +P
Sbjct  302   AS-GADCEETQTPRIGRLSLDERASKDNSAAKGIMPTVELKKQPVRKSLPRLPSQKTALP  360

Query  1539  SETKKASPIKTSISKEITE-------------------VDSQPNIVAKVTDEAEDVHASE  1661
                 K +P K + +    +                   V+ +  +      +AED H   
Sbjct  361   D--GKPAPAKAATTSAKVKPEKKKVEKDAETLNQSSHPVEEEAQVTVSSNADAEDSHEIV  418

Query  1662  TEPKENDEADMSL-VQEPITVE  1724
             +     D AD S+ V E +TVE
Sbjct  419   SPMMNEDRADKSIEVSEAVTVE  440



>ref|XP_006656223.1| PREDICTED: neurofilament heavy polypeptide-like [Oryza brachyantha]
Length=372

 Score =   207 bits (526),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 144/193 (75%), Gaps = 11/193 (6%)
 Frame = +3

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K  R G+ PSY F+FKC+ERAEKR+EFY+KLEEKIHA+E+E+SNMQA++KE++EAE+K 
Sbjct  183   VKPQRVGSTPSYGFAFKCDERAEKRREFYSKLEEKIHAQELEKSNMQAKSKETEEAELKR  242

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSPNRDGKNENGLQT  1412
             LRKSL FKA PMP+FY+EPPPPKVELKKIP TRA+SPKLGR K TSS + +  N    + 
Sbjct  243   LRKSLNFKANPMPSFYKEPPPPKVELKKIPTTRARSPKLGRSKNTSSASTEESNVPSSRP  302

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEIT  1592
             +RLSLDE+ SQ+ + +  ++   KKPQRKSLPKLPSE+T          P +   SK  T
Sbjct  303   ARLSLDERASQNGVKKLPAVNTAKKPQRKSLPKLPSEQTV---------PEQVENSKTST  353

Query  1593  EVDSQPNIVAKVT  1631
             ++  +P I A+VT
Sbjct  354   DLTREP-IRAQVT  365



>ref|NP_001058026.1| Os06g0606800 [Oryza sativa Japonica Group]
 dbj|BAD36111.1| putative BRI1-KD interacting protein 118 [Oryza sativa Japonica 
Group]
 dbj|BAF19940.1| Os06g0606800 [Oryza sativa Japonica Group]
 dbj|BAG89931.1| unnamed protein product [Oryza sativa Japonica Group]
Length=372

 Score =   206 bits (524),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = +3

Query  1041  PTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQE  1220
             P     K  R G+ P+Y F+FKC+ERAEKR+EFY+KLEEKIHA+E+E+SNMQA++KE++E
Sbjct  178   PNCEKVKPQRVGSTPAYGFAFKCDERAEKRREFYSKLEEKIHAQELEKSNMQAKSKETEE  237

Query  1221  AEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSPNRDGKNE  1397
             AE+K LRKSL F+A PMP+FY+EPPPPKVELKKIP TRA+SPKLGR K TSS + +    
Sbjct  238   AELKKLRKSLNFRANPMPSFYKEPPPPKVELKKIPTTRARSPKLGRSKNTSSVSTEESTV  297

Query  1398  NGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTY---IPSETKKASPIK  1568
                + +RLSLDE+ SQ+ + +  +   V+KPQRKSLPKLPSE+T    + + T    P++
Sbjct  298   PSSRPARLSLDERASQNGVKKVPAANTVRKPQRKSLPKLPSEQTVTEQVENNTSATDPVR  357

Query  1569  TSISKEITEVD  1601
               I  ++T  D
Sbjct  358   ELIRAQVTPDD  368



>ref|XP_003588767.1| Seed specific protein Bn15D14A [Medicago truncatula]
Length=458

 Score =   208 bits (530),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 227/394 (58%), Gaps = 17/394 (4%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHES  602
             +NGV  +    GED V +  D  +  +      +GN +N +N  +  A  +S  + I  S
Sbjct  17    QNGVHDEPSNSGEDAVSNDLDPHVTVNTETFVPDGNSEN-INQLESTATGNSAMKEIEGS  75

Query  603   MVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgkdi  782
                ++ ++   SKE EVK    ++  + QK P K KN K+ +    V A   K       
Sbjct  76    NDNVDGSNLTVSKEKEVKIKVSTEQSRAQKGPVKNKNAKVGS-SSGVNASLVKNSKIGKD  134

Query  783   ssssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESH  962
               +S   +  +++   +P  PI K+ S N+R++ +     K          S  A  +  
Sbjct  135   KQASPAVSNGTSALDSRPRQPI-KNRSSNDRQSQLSKQPSK----------SEAASSDVA  183

Query  963   kekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFY  1142
              EK   K LKKGP  K +  G+SSL+    DTK  R GTLP+Y FSF+C ERAEKR+EF 
Sbjct  184   VEKKKPKSLKKGPLDKVQGEGESSLT-NREDTKPRRVGTLPNYGFSFRCGERAEKRREFL  242

Query  1143  TKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKI  1322
             TK+EEKI AKE E+S++QA++KESQEAEIK LRKSL FKATP+PTFYQEP PPKVELKKI
Sbjct  243   TKVEEKIQAKEEEKSSLQAKSKESQEAEIKKLRKSLTFKATPLPTFYQEPAPPKVELKKI  302

Query  1323  PPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRK  1499
             P TRAKSPKLGR+KTS+ +  DG      +  RLSL+EK SQ N     +L   KKP RK
Sbjct  303   PTTRAKSPKLGRKKTSTNSESDGNGSCSSRQGRLSLNEKVSQSNSPTGVTLAHQKKPLRK  362

Query  1500  SLP-KLPSEKT-YIPSETKKASPIKTSISKEITE  1595
             SLP +L SE+T    + T KA+   TS+SK   E
Sbjct  363   SLPTRLASERTNSAAAPTSKATKKDTSLSKGTGE  396



>gb|AES59018.2| TPX2 (targeting protein for Xklp2) family protein [Medicago truncatula]
Length=459

 Score =   208 bits (530),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 227/394 (58%), Gaps = 17/394 (4%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHES  602
             +NGV  +    GED V +  D  +  +      +GN +N +N  +  A  +S  + I  S
Sbjct  18    QNGVHDEPSNSGEDAVSNDLDPHVTVNTETFVPDGNSEN-INQLESTATGNSAMKEIEGS  76

Query  603   MVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgkdi  782
                ++ ++   SKE EVK    ++  + QK P K KN K+ +    V A   K       
Sbjct  77    NDNVDGSNLTVSKEKEVKIKVSTEQSRAQKGPVKNKNAKVGS-SSGVNASLVKNSKIGKD  135

Query  783   ssssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESH  962
               +S   +  +++   +P  PI K+ S N+R++ +     K          S  A  +  
Sbjct  136   KQASPAVSNGTSALDSRPRQPI-KNRSSNDRQSQLSKQPSK----------SEAASSDVA  184

Query  963   kekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFY  1142
              EK   K LKKGP  K +  G+SSL+    DTK  R GTLP+Y FSF+C ERAEKR+EF 
Sbjct  185   VEKKKPKSLKKGPLDKVQGEGESSLT-NREDTKPRRVGTLPNYGFSFRCGERAEKRREFL  243

Query  1143  TKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKI  1322
             TK+EEKI AKE E+S++QA++KESQEAEIK LRKSL FKATP+PTFYQEP PPKVELKKI
Sbjct  244   TKVEEKIQAKEEEKSSLQAKSKESQEAEIKKLRKSLTFKATPLPTFYQEPAPPKVELKKI  303

Query  1323  PPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRK  1499
             P TRAKSPKLGR+KTS+ +  DG      +  RLSL+EK SQ N     +L   KKP RK
Sbjct  304   PTTRAKSPKLGRKKTSTNSESDGNGSCSSRQGRLSLNEKVSQSNSPTGVTLAHQKKPLRK  363

Query  1500  SLP-KLPSEKT-YIPSETKKASPIKTSISKEITE  1595
             SLP +L SE+T    + T KA+   TS+SK   E
Sbjct  364   SLPTRLASERTNSAAAPTSKATKKDTSLSKGTGE  397



>ref|XP_006596104.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X3 [Glycine max]
Length=480

 Score =   208 bits (529),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 178/435 (41%), Positives = 242/435 (56%), Gaps = 20/435 (5%)
 Frame = +3

Query  423   ENGVDKQLHAVGED--IVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIH  596
             +NGV  +    GED  +  D    V   + T+    GNF N  + +D  A D+S+   I 
Sbjct  17    QNGVHDEPSNSGEDGGVSYDLDPSVPETAATVA-PNGNFDN-FHQSDSAASDNSLVAEIK  74

Query  597   ESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgk  776
             ES V ++  +    KE EVK S ++K  +  K   K KN K  +    V A         
Sbjct  75    ESNVNIDGTNMTIPKEEEVKISDQTKQSRAPKGLVKNKNAKAPS-SSGVHASLVNKSQIG  133

Query  777   dissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRE  956
                 +S   +  S++    P   I+ S SFN+R+T           +P   + S  A  E
Sbjct  134   KDKEASSSVSNGSSALDSLPRQSIKGSRSFNDRQT--------QLSKPKHPSKSDAASSE  185

Query  957   SHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKE  1136
                EK   K L+KGP  K +  G+SS + T  D+K  R GTLP+Y FSFKC ERAE+RKE
Sbjct  186   VSVEKTKPKSLRKGPIDKVQGEGESSFTNTD-DSKPQRVGTLPNYGFSFKCGERAERRKE  244

Query  1137  FYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELK  1316
             FY KLEE+I AKE+E+SN+QA+TKE+QEAEIKMLRKSL FKATPMP+FYQEP P K ELK
Sbjct  245   FYNKLEERIQAKEVEKSNLQAKTKETQEAEIKMLRKSLNFKATPMPSFYQEPAPAKAELK  304

Query  1317  KIPPTRAKSPKLGRRK-TSSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRS-LIDVKKP  1490
             KIP TRAKSPKLGR+K T++   DG N +  + +RLSLDEK S+ N  +  +  +  KKP
Sbjct  305   KIPTTRAKSPKLGRKKSTANSESDGNNSSSSRLARLSLDEKVSESNPTKGPTPPVHQKKP  364

Query  1491  QRKSLP-KLPSEKTYIPSETKKASPIKTSISKEITEVDS---QPNIVAKVTDEAEDVHAS  1658
             QR+SLP +L SE   + +     +  K +I  E + + S   + N +   T EA+ +  +
Sbjct  365   QRRSLPARLASEGNSVSNSRTALTSSKAAIKDEKSSLSSAAKKDNNLTNATGEAKTMTIA  424

Query  1659  ETEPKENDEADMSLV  1703
               E K    ++ S V
Sbjct  425   ANEEKSTLSSETSAV  439



>ref|XP_010447405.1| PREDICTED: uncharacterized protein LOC104730041 isoform X3 [Camelina 
sativa]
Length=440

 Score =   206 bits (525),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 158/248 (64%), Gaps = 27/248 (11%)
 Frame = +3

Query  1053  DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIK  1232
             D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +NMQA++KE+QEAE++
Sbjct  195   DGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINNMQAKSKETQEAELR  254

Query  1233  MLRKSLKFKATPMPTFYQEPPPPKVEL-KKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQ  1409
             MLRKSL FKATPMP+FYQEP PPK EL KKIPPTRAKSPKLGR+KT+S   D +     +
Sbjct  255   MLRKSLNFKATPMPSFYQEPQPPKTELKKKIPPTRAKSPKLGRKKTAS-GADCEETQTPR  313

Query  1410  TSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIPSETKKASPIKT---  1571
               RLSLDE+ S+DN A +  +  V   K+P RKSLP+LPS+KT +P    K +P K    
Sbjct  314   IGRLSLDERASKDNSAAKGIMPTVELKKQPVRKSLPRLPSQKTALPD--GKPAPAKAATT  371

Query  1572  ----------------SISKEITEVDSQPNIVAKVTDEAEDVHASETEPKENDEADMSL-  1700
                             ++++    V+ +  +      +AED H   +     D AD S+ 
Sbjct  372   SAKVKPEKKKVEKDAETLNQSSHPVEEEAQVTVSSNADAEDSHEIVSPMMNEDRADKSIE  431

Query  1701  VQEPITVE  1724
             V E +TVE
Sbjct  432   VSEAVTVE  439



>ref|NP_001046221.1| Os02g0200800 [Oryza sativa Japonica Group]
 dbj|BAD11346.1| BRI1-KD interacting protein 118 [Oryza sativa Japonica Group]
 dbj|BAF08135.1| Os02g0200800, partial [Oryza sativa Japonica Group]
Length=334

 Score =   203 bits (517),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 127/163 (78%), Gaps = 10/163 (6%)
 Frame = +3

Query  1062  SHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLR  1241
             S +AG  P+Y FSFKC+ERAEKRKEFY+KLEEKIHA+EME SN+QA++KE++EAE+KMLR
Sbjct  117   SRKAGGTPAYGFSFKCDERAEKRKEFYSKLEEKIHAREMEISNLQAKSKETEEAELKMLR  176

Query  1242  KSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG------  1403
             KSL FKATPMP+FYQEP PPKVELKKIPPTRA+SPKLGR K  S    G+ E        
Sbjct  177   KSLNFKATPMPSFYQEPTPPKVELKKIPPTRARSPKLGRSKNKS---AGETEETVTPPGR  233

Query  1404  -LQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
              ++ S  SLDEK SQ+ + +      VKKPQRKSLPKLPSE+T
Sbjct  234   PVRLSLDSLDEKVSQNGVKKANPSNAVKKPQRKSLPKLPSEET  276



>gb|ACG45595.1| WDL1 [Zea mays]
Length=386

 Score =   204 bits (520),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +3

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K  R G+ PSY FSFKC+ERAEKR+EFY+KLEEKIHA+E+E+SN+QA++KE++EAE+KM
Sbjct  185   VKPQRVGSTPSYGFSFKCDERAEKRREFYSKLEEKIHAQELEKSNLQAKSKETEEAELKM  244

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSPNRDGKNENGLQT  1412
             LRKSL FKATPMP+FY+EPPPPKVELKKIP TRA+SPKLGR K TSS   +G      ++
Sbjct  245   LRKSLNFKATPMPSFYKEPPPPKVELKKIPTTRARSPKLGRSKNTSSGGTEGNPNPPARS  304

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
             +RLSLDE+ SQ+ + +  +    KKPQRKSLPKLPSE+T
Sbjct  305   ARLSLDERVSQNGVKKAPAANAAKKPQRKSLPKLPSEQT  343



>dbj|BAD15848.1| putative BRI1-KD interacting protein [Oryza sativa Japonica Group]
 gb|EEE56515.1| hypothetical protein OsJ_05791 [Oryza sativa Japonica Group]
Length=395

 Score =   204 bits (520),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 127/163 (78%), Gaps = 10/163 (6%)
 Frame = +3

Query  1062  SHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLR  1241
             S +AG  P+Y FSFKC+ERAEKRKEFY+KLEEKIHA+EME SN+QA++KE++EAE+KMLR
Sbjct  178   SRKAGGTPAYGFSFKCDERAEKRKEFYSKLEEKIHAREMEISNLQAKSKETEEAELKMLR  237

Query  1242  KSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG------  1403
             KSL FKATPMP+FYQEP PPKVELKKIPPTRA+SPKLGR K  S    G+ E        
Sbjct  238   KSLNFKATPMPSFYQEPTPPKVELKKIPPTRARSPKLGRSKNKSA---GETEETVTPPGR  294

Query  1404  -LQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
              ++ S  SLDEK SQ+ + +      VKKPQRKSLPKLPSE+T
Sbjct  295   PVRLSLDSLDEKVSQNGVKKANPSNAVKKPQRKSLPKLPSEET  337



>gb|EAY84904.1| hypothetical protein OsI_06272 [Oryza sativa Indica Group]
Length=395

 Score =   204 bits (519),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 126/166 (76%), Gaps = 16/166 (10%)
 Frame = +3

Query  1062  SHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLR  1241
             S +AG +P+Y FSFKC+ERAEKRKEFY+KLEEKIHA+EME SN+QA++KE++EAE+KMLR
Sbjct  178   SRKAGGIPAYGFSFKCDERAEKRKEFYSKLEEKIHAREMEISNLQAKSKETEEAELKMLR  237

Query  1242  KSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS----------PNRDGK  1391
             KSL FKATPMP+FYQEP PPKVELKKIPPTRA+SPKLGR K  S          P R   
Sbjct  238   KSLNFKATPMPSFYQEPTPPKVELKKIPPTRARSPKLGRSKNKSAGETDETVTPPGRP--  295

Query  1392  NENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
                 ++ S  SLDEK SQ+ + +      VKKPQRKS PKLPSE+T
Sbjct  296   ----VRLSLDSLDEKVSQNGVKKANPSNAVKKPQRKSFPKLPSEET  337



>ref|XP_007161211.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
 gb|ESW33205.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
Length=472

 Score =   206 bits (525),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 164/374 (44%), Positives = 220/374 (59%), Gaps = 26/374 (7%)
 Frame = +3

Query  423   ENGVDKQLHAVGED--IVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIH  596
             +NGV  +    GED     D    V   + T+  + GNF N V+ +D  AID+     I 
Sbjct  17    QNGVHDEPSNSGEDGGASYDLDPSVTETAETVA-SNGNFDN-VHQSDSAAIDNLFVAQIK  74

Query  597   ESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKL--SNPKHAVvagskkgkd  770
             ES   ++ NS   +KE ++K S ++K  +  K   K KN K   S+  HA +    K + 
Sbjct  75    ESNDIIDGNSMIITKEEDMKISDQTKQSRAPKGFVKNKNAKAPSSSGVHAGLVNKSKIRK  134

Query  771   gkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQ  950
              K+ISSS         SR KQ    I+ S SFN+R+T  ++++ KH  + D   SS V+ 
Sbjct  135   DKEISSSVSNGTLALDSRPKQS---IKSSRSFNDRQT--ELSNPKHPLKSDEA-SSEVSM  188

Query  951   RESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKR  1130
              ++  +     P+K            SSLS    D K  R GTLP+Y FSFKC ERAE+R
Sbjct  189   EKTKTKSLRKGPVKDQEI-------DSSLSTNNEDAKPQRVGTLPNYGFSFKCGERAERR  241

Query  1131  KEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVE  1310
             KEFY KLEE+I AKE E++NMQA+TKE+Q+AEIK LRKSL FKATPMP+FYQEP PP   
Sbjct  242   KEFYDKLEERIQAKEEEKNNMQAKTKETQDAEIKKLRKSLNFKATPMPSFYQEPAPP---  298

Query  1311  LKKIPPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKK  1487
               KIP TR KSPK GR+KTS+ +  DG N +G + +RLSLDEK S+ N ++  + +  KK
Sbjct  299   --KIPTTRPKSPKFGRKKTSANSESDGNNSSGSRLARLSLDEKVSESNPSKGPNPVLQKK  356

Query  1488  PQRKSLP-KLPSEK  1526
             P R+SLP +L SE+
Sbjct  357   PHRRSLPSRLASER  370



>ref|NP_001159176.1| hypothetical protein [Zea mays]
 ref|XP_008643899.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN25320.1| unknown [Zea mays]
 gb|AFW70698.1| hypothetical protein ZEAMMB73_271181 [Zea mays]
 gb|AFW70699.1| hypothetical protein ZEAMMB73_271181 [Zea mays]
Length=388

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             K  + G+ PSY F+FKC+ER+EKR+EFY+KLEEKIHA+E+E SN+QA++KE++EAE+KML
Sbjct  175   KPRKVGSTPSYGFTFKCDERSEKRREFYSKLEEKIHARELEISNLQAKSKETEEAELKML  234

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             RKSL FKATPMP+FY+EP P KVELKKIPPTRAKSPKLGR K  S +   +N    Q +R
Sbjct  235   RKSLNFKATPMPSFYKEPTPAKVELKKIPPTRAKSPKLGRSKNKSISETEENTTTDQPAR  294

Query  1419  LSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
             LSLDEK SQ+ + +       KKPQRKSLP+LPSE+T
Sbjct  295   LSLDEKVSQNGVKKPTPSSSAKKPQRKSLPRLPSEET  331



>emb|CDY23322.1| BnaA08g12240D [Brassica napus]
Length=410

 Score =   204 bits (519),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 130/176 (74%), Gaps = 8/176 (5%)
 Frame = +3

Query  1020  TGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQA  1199
             T  SS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E ++MQA
Sbjct  168   TQSSSNSPQAEDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINSMQA  227

Query  1200  QTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN  1379
             ++KE+QEAE++ LRKSL FKATPMP+FYQEP PPK ELKKIPPTR KSPKLGR+KT    
Sbjct  228   KSKETQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKT----  283

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIP  1538
              D +     +  RLSLDEK S+DN   +  +  V   K+P RKSLP+LPS+KT +P
Sbjct  284   -DSEETQTPRLGRLSLDEKASKDNSTSKGIVPTVDHKKQPLRKSLPRLPSQKTALP  338



>ref|XP_006412487.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 gb|ESQ53940.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
Length=434

 Score =   205 bits (521),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 158/232 (68%), Gaps = 19/232 (8%)
 Frame = +3

Query  852   KSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQS  1031
             KSTSFN R+  V   H    G+PD+  + S A      +K   KP KK   + SE   QS
Sbjct  137   KSTSFNGREAQV-TEH----GKPDSAPAESAA-----GDKVKPKPQKKQVHETSEDDTQS  186

Query  1032  SLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKE  1211
             S +P A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E ++MQA++KE
Sbjct  187   S-NPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINSMQAKSKE  245

Query  1212  SQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGK  1391
             +QEAE++ LRKSL FKATPMP+FYQEP PPK ELKKIPPTR KSPKLGR+KT     D +
Sbjct  246   TQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKT-----DSE  300

Query  1392  NENGLQTSRLSLDEKPSQDNLARRRSL--IDVKK-PQRKSLPKLPSEKTYIP  1538
                  +  RLSLDEK  +DN   +  +  +D+KK P RKSLP+LPS+KT +P
Sbjct  301   ETQTPRVGRLSLDEKALKDNPTAKGIVPTVDLKKQPVRKSLPRLPSQKTALP  352



>ref|XP_006601154.1| PREDICTED: protein gar2-like isoform X3 [Glycine max]
Length=480

 Score =   206 bits (524),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 165/368 (45%), Positives = 219/368 (60%), Gaps = 20/368 (5%)
 Frame = +3

Query  423   ENGVDKQLHAVGED--IVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIH  596
             +NGV  +    G+D  +  D    V   + T+    GNF N  + +D  A D+S    I 
Sbjct  17    QNGVHDEPSNSGDDDGVSYDLDPSVTETAATVA-LNGNFDN-FHQSDSAASDNSFVAEIK  74

Query  597   ESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKL--SNPKHAVvagskkgkd  770
             ES   ++  +    KE EVK S ++K  +  K   K KN K   S+  HA +    K   
Sbjct  75    ESNDNIDGTNMTIPKEEEVKISDQTKQSRAPKGLVKNKNAKAPSSSGVHASLVNKSKIGK  134

Query  771   gkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQ  950
              K+ SSS         SR +Q +   + S SFN+R+T  +++  KH  + D T+S     
Sbjct  135   DKEASSSVSNGTSALDSRPRQST---KSSRSFNDRQT--QLSKPKHPSKSDATSS-----  184

Query  951   RESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKR  1130
              E   EK   K  +K P  K +   +SS S T  D K  R GTLP+Y FSFKC ERAE+R
Sbjct  185   -EVSVEKTKPKSSRKEPIDKVQGEAESSFSNTE-DAKPQRVGTLPNYGFSFKCGERAERR  242

Query  1131  KEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVE  1310
             +EFY KLEE+I AKE+E+SN+QA++KE+QEAEIKMLRKSL FKATPMP+FYQEP P K E
Sbjct  243   REFYNKLEERIQAKEVEKSNLQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPAPAKAE  302

Query  1311  LKKIPPTRAKSPKLGRRKTSSPNR-DGKNENGLQTSRLSLDEKPSQDNLARRRS-LIDVK  1484
             LKKIP TRAKSPKLGR+K+S+ +  DG N +  + +RLSLDEK S+ NL +  +  +  K
Sbjct  303   LKKIPTTRAKSPKLGRKKSSANSESDGNNSSSSRLARLSLDEKVSESNLTKGPTPPVHQK  362

Query  1485  KPQRKSLP  1508
             KPQR+SLP
Sbjct  363   KPQRRSLP  370



>ref|XP_009108881.1| PREDICTED: protein WVD2-like 1 isoform X2 [Brassica rapa]
Length=418

 Score =   204 bits (518),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 132/179 (74%), Gaps = 8/179 (4%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS +P A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E ++
Sbjct  182   SEDDTQSSSNPQAEDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINS  241

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE+QEAE++ LRKSL FKATPMP+FYQEP PPK ELKKIPPTR KSPKLGR+KT 
Sbjct  242   MQAKSKETQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKT-  300

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIP  1538
                 D +     +  RLSLDEK S+D+   +  +  V   K+P RKSLP+LPS+KT +P
Sbjct  301   ----DSEETQTPRLGRLSLDEKASKDDSTSKGIVPTVDHKKQPLRKSLPRLPSQKTALP  355



>ref|XP_006647040.1| PREDICTED: microtubule-associated protein 1B-like [Oryza brachyantha]
Length=394

 Score =   203 bits (516),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 131/166 (79%), Gaps = 7/166 (4%)
 Frame = +3

Query  1053  DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIK  1232
             +++S +A   P+Y FSFKC+ERAEKRKEFY+KLEEKIHA+E+E +N+QA++KE++EAE++
Sbjct  177   NSESRKAAGTPAYGFSFKCDERAEKRKEFYSKLEEKIHARELEINNLQAKSKEAEEAELR  236

Query  1233  MLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGL--  1406
             MLRKSL FKATPMP+FYQEP PPK+ELKKIPPTR +SPKLGR K  S    G+ E  +  
Sbjct  237   MLRKSLNFKATPMPSFYQEPTPPKIELKKIPPTRPRSPKLGRSKNKSA---GETEETVTP  293

Query  1407  --QTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIP  1538
               +T+RLSLDEK SQ+ + +       KKPQRKSLPKLPSE++  P
Sbjct  294   PGRTARLSLDEKVSQNGVKKANPSNAAKKPQRKSLPKLPSEESGSP  339



>emb|CBI28213.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   203 bits (517),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 136/187 (73%), Gaps = 6/187 (3%)
 Frame = +3

Query  1014  EATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNM  1193
             E    +SLSP   D K  R G LP+Y FSFKC+ERAEKRKEFY KLEEK HAKE+E +N 
Sbjct  184   ETAHSASLSPEEGDAKPQRTGHLPAYGFSFKCDERAEKRKEFYLKLEEKTHAKEVERTNR  243

Query  1194  QAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             QA++KE+QEAEIKMLRKSL FKATPMP+FY E P PKVELKK+PPT+AKSPKL  +K  +
Sbjct  244   QAKSKETQEAEIKMLRKSLNFKATPMPSFYHE-PTPKVELKKMPPTKAKSPKLSCQK--N  300

Query  1374  PNRDGKNENGLQTS---RLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSE  1544
             P      EN  Q++   RLSLDEK +Q+   +R S   +KKP RKSLPKLPS+KT + S 
Sbjct  301   PPMAVTEENSSQSTRLGRLSLDEKTTQNGPTKRSSPQQLKKPLRKSLPKLPSQKTTLASG  360

Query  1545  TKKASPI  1565
             T+  + +
Sbjct  361   TENTTSL  367



>ref|NP_001168424.1| hypothetical protein [Zea mays]
 ref|XP_008648078.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28167.1| unknown [Zea mays]
 gb|AFW76396.1| hypothetical protein ZEAMMB73_162127 [Zea mays]
 gb|AFW76397.1| hypothetical protein ZEAMMB73_162127 [Zea mays]
 gb|AFW76398.1| hypothetical protein ZEAMMB73_162127 [Zea mays]
Length=385

 Score =   201 bits (512),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = +3

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K  R G+ PSY FSFKC+ERAEKR+EFY+KLEEKIHA+E+E+SN+QA++KE++EAE+KM
Sbjct  184   VKPQRVGSTPSYGFSFKCDERAEKRREFYSKLEEKIHAQELEKSNLQAKSKETEEAELKM  243

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSPNRDGKNENGLQT  1412
             LRKSLKFKATPMP+FY+EPPPPKVELKKIP TRA+SPKLGR K T S   +G +    ++
Sbjct  244   LRKSLKFKATPMPSFYKEPPPPKVELKKIPTTRARSPKLGRSKNTPSGGTEGNSNPPARS  303

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
             +RLSLD++  Q+   +  +    KKPQRKSLPKLPSE+T
Sbjct  304   ARLSLDQRVPQNGAKKAPAANAAKKPQRKSLPKLPSEQT  342



>ref|XP_009108879.1| PREDICTED: protein WVD2-like 1 isoform X1 [Brassica rapa]
 ref|XP_009108880.1| PREDICTED: protein WVD2-like 1 isoform X1 [Brassica rapa]
Length=419

 Score =   202 bits (515),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 130/176 (74%), Gaps = 8/176 (5%)
 Frame = +3

Query  1020  TGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQA  1199
             T  SS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E ++MQA
Sbjct  186   TQSSSNSPQAEDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINSMQA  245

Query  1200  QTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN  1379
             ++KE+QEAE++ LRKSL FKATPMP+FYQEP PPK ELKKIPPTR KSPKLGR+KT    
Sbjct  246   KSKETQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKT----  301

Query  1380  RDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIP  1538
              D +     +  RLSLDEK S+D+   +  +  V   K+P RKSLP+LPS+KT +P
Sbjct  302   -DSEETQTPRLGRLSLDEKASKDDSTSKGIVPTVDHKKQPLRKSLPRLPSQKTALP  356



>gb|AFW70700.1| hypothetical protein ZEAMMB73_271181, partial [Zea mays]
Length=363

 Score =   201 bits (510),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             K  + G+ PSY F+FKC+ER+EKR+EFY+KLEEKIHA+E+E SN+QA++KE++EAE+KML
Sbjct  150   KPRKVGSTPSYGFTFKCDERSEKRREFYSKLEEKIHARELEISNLQAKSKETEEAELKML  209

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             RKSL FKATPMP+FY+EP P KVELKKIPPTRAKSPKLGR K  S +   +N    Q +R
Sbjct  210   RKSLNFKATPMPSFYKEPTPAKVELKKIPPTRAKSPKLGRSKNKSISETEENTTTDQPAR  269

Query  1419  LSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
             LSLDEK SQ+ + +       KKPQRKSLP+LPSE+T
Sbjct  270   LSLDEKVSQNGVKKPTPSSSAKKPQRKSLPRLPSEET  306



>ref|XP_002282218.1| PREDICTED: troponin T, skeletal muscle-like [Vitis vinifera]
Length=456

 Score =   203 bits (517),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 136/187 (73%), Gaps = 6/187 (3%)
 Frame = +3

Query  1014  EATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNM  1193
             E    +SLSP   D K  R G LP+Y FSFKC+ERAEKRKEFY KLEEK HAKE+E +N 
Sbjct  216   ETAHSASLSPEEGDAKPQRTGHLPAYGFSFKCDERAEKRKEFYLKLEEKTHAKEVERTNR  275

Query  1194  QAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             QA++KE+QEAEIKMLRKSL FKATPMP+FY E P PKVELKK+PPT+AKSPKL  +K  +
Sbjct  276   QAKSKETQEAEIKMLRKSLNFKATPMPSFYHE-PTPKVELKKMPPTKAKSPKLSCQK--N  332

Query  1374  PNRDGKNENGLQTS---RLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSE  1544
             P      EN  Q++   RLSLDEK +Q+   +R S   +KKP RKSLPKLPS+KT + S 
Sbjct  333   PPMAVTEENSSQSTRLGRLSLDEKTTQNGPTKRSSPQQLKKPLRKSLPKLPSQKTTLASG  392

Query  1545  TKKASPI  1565
             T+  + +
Sbjct  393   TENTTSL  399



>ref|XP_003603388.1| BRI1-KD interacting protein 118-like protein [Medicago truncatula]
Length=394

 Score =   199 bits (507),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = +3

Query  1074  GTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLK  1253
              T+P+Y FSFKCNERAE+RKEFY+KLEE+IHAKE+EESN+QA+TKESQEAEIK LRK L 
Sbjct  145   WTMPTYGFSFKCNERAERRKEFYSKLEERIHAKEVEESNIQAKTKESQEAEIKRLRKKLA  204

Query  1254  FKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS--SPNRDGKNENGLQTSRLSL  1427
             FKATPMP+FYQEP P +VELKKIP TRAKSPKLGR+K+S  S   D  + +  Q  RLSL
Sbjct  205   FKATPMPSFYQEPTPSRVELKKIPTTRAKSPKLGRKKSSTMSSELDVNSNSSAQQCRLSL  264

Query  1428  DEKPSQDNLARRRSLIDVKKPQRKSLP  1508
             DEK SQ+N  +  S +  KKPQR+SLP
Sbjct  265   DEKVSQNNPTKGISHVQPKKPQRRSLP  291



>gb|EMS64350.1| hypothetical protein TRIUR3_26680 [Triticum urartu]
Length=411

 Score =   200 bits (508),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 126/165 (76%), Gaps = 21/165 (13%)
 Frame = +3

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
             +K+ RAG+ P+Y FSFKC+ERAEKR+EFY+KLEEKIHA+EME SNMQA++KE++EAE+KM
Sbjct  197   SKARRAGSTPAYGFSFKCDERAEKRREFYSKLEEKIHAREMEISNMQAKSKETEEAELKM  256

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTS  1415
             LRKSLKFKATPMP+F    PPPKVELKKIPPTRAKSPKLGR          KN++GL+  
Sbjct  257   LRKSLKFKATPMPSFS---PPPKVELKKIPPTRAKSPKLGR---------SKNKSGLEAE  304

Query  1416  ---------RLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSE  1523
                      R+SLDEK +Q+   +      VKKPQRKSLPKLPSE
Sbjct  305   ESTTPSHPIRVSLDEKATQNGAKKVTPSNSVKKPQRKSLPKLPSE  349



>emb|CDX72356.1| BnaC07g43780D [Brassica napus]
Length=430

 Score =   200 bits (508),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 151/232 (65%), Gaps = 21/232 (9%)
 Frame = +3

Query  852   KSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQS  1031
             KSTSFN R + V     +     +T T   V  +            KK   + SE   QS
Sbjct  137   KSTSFNGRASKVTEQGKQDRAPAETATGDKVKPK----------LQKKQVQETSEDDAQS  186

Query  1032  SLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKE  1211
             S SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +NMQA++KE
Sbjct  187   SNSPKAEDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINNMQAKSKE  246

Query  1212  SQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGK  1391
             +QEAE++ LRKSL FKATPMP+F Q   PPK ELKKIPPTR KSPKLGR+KT     D +
Sbjct  247   TQEAELRKLRKSLNFKATPMPSFSQ---PPKTELKKIPPTRPKSPKLGRKKT-----DSE  298

Query  1392  NENGLQTSRLSLDEKPSQDNLARRRSL--IDVKK-PQRKSLPKLPSEKTYIP  1538
                  + SRLSLDEK S+D+   + ++  +D+KK P RKSLP+LPS+KT +P
Sbjct  299   ETQTPRVSRLSLDEKASKDSPTAKGTVPTVDLKKQPLRKSLPRLPSQKTALP  350



>ref|XP_003603387.1| BRI1-KD interacting protein 118-like protein [Medicago truncatula]
Length=442

 Score =   200 bits (508),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = +3

Query  1074  GTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLK  1253
              T+P+Y FSFKCNERAE+RKEFY+KLEE+IHAKE+EESN+QA+TKESQEAEIK LRK L 
Sbjct  193   WTMPTYGFSFKCNERAERRKEFYSKLEERIHAKEVEESNIQAKTKESQEAEIKRLRKKLA  252

Query  1254  FKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS--SPNRDGKNENGLQTSRLSL  1427
             FKATPMP+FYQEP P +VELKKIP TRAKSPKLGR+K+S  S   D  + +  Q  RLSL
Sbjct  253   FKATPMPSFYQEPTPSRVELKKIPTTRAKSPKLGRKKSSTMSSELDVNSNSSAQQCRLSL  312

Query  1428  DEKPSQDNLARRRSLIDVKKPQRKSLP  1508
             DEK SQ+N  +  S +  KKPQR+SLP
Sbjct  313   DEKVSQNNPTKGISHVQPKKPQRRSLP  339



>ref|NP_001148491.1| LOC100282106 [Zea mays]
 ref|XP_008677233.1| PREDICTED: LOC100282106 isoform X1 [Zea mays]
 gb|ACG31713.1| seed specific protein Bn15D14A [Zea mays]
 gb|ACN28182.1| unknown [Zea mays]
 gb|AFW66153.1| Seed specific protein Bn15D14A isoform 1 [Zea mays]
 gb|AFW66154.1| Seed specific protein Bn15D14A isoform 2 [Zea mays]
Length=397

 Score =   198 bits (504),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             K  + G++PSY F+FKC+ER+EKR+EFY+KLEEKIHA+E+E SN+QA++KE++EAE+KML
Sbjct  177   KPRKVGSIPSYGFTFKCDERSEKRREFYSKLEEKIHARELEISNLQAKSKETEEAELKML  236

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             RKSL FKATPMP+FY+EP P KVELKKIPPTRAKSPK GR K  S     +N    Q + 
Sbjct  237   RKSLNFKATPMPSFYKEPTPVKVELKKIPPTRAKSPKFGRSKNKSTPETEENATADQPAH  296

Query  1419  LSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
             LSL+E  SQ  + +   L   KKPQRKSLP+LPSE+T
Sbjct  297   LSLEENVSQTGVKKPTPLNPAKKPQRKSLPRLPSEET  333



>ref|XP_002451734.1| hypothetical protein SORBIDRAFT_04g006860 [Sorghum bicolor]
 gb|EES04710.1| hypothetical protein SORBIDRAFT_04g006860 [Sorghum bicolor]
Length=369

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             K  + G+ PSY F+FKC+ER+EKR+EFY+KLEEKI A+E+E SN+Q ++KE++EAE+KML
Sbjct  151   KPRKVGSTPSYGFTFKCDERSEKRREFYSKLEEKIQARELEISNLQEKSKETEEAELKML  210

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             RKSL FKATPMP+FY+EP P KVELKK PPTRAKSPKLGR K  S     +N    Q++R
Sbjct  211   RKSLNFKATPMPSFYKEPTPAKVELKKTPPTRAKSPKLGRSKNKSTPETEENTTMDQSAR  270

Query  1419  LSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
             LSL+EK SQ+ + +   L   KKPQRKSLP+LPSE+T
Sbjct  271   LSLEEKVSQNGVKKSTPLNSAKKPQRKSLPRLPSEET  307



>emb|CDX68836.1| BnaC01g06170D [Brassica napus]
Length=425

 Score =   198 bits (503),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 133/185 (72%), Gaps = 11/185 (6%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +N
Sbjct  175   SEDDTQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINN  234

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE++EAE++ LRKSL FKATPMP+F Q   PPK ELKKIPPTR KSPKLGR+KT 
Sbjct  235   MQAKSKETEEAELRKLRKSLNFKATPMPSFSQ---PPKTELKKIPPTRPKSPKLGRKKT-  290

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIPS  1541
                 D +     +  RLSLDEK S+D+ A + ++  V   K+P RKSLP+LPS+KT +P 
Sbjct  291   ----DSEETQTPRIGRLSLDEKTSRDHPAAKGTVATVDPKKQPLRKSLPRLPSQKTALPV  346

Query  1542  ETKKA  1556
              T  A
Sbjct  347   ATTSA  351



>emb|CDY13483.1| BnaA03g52010D [Brassica napus]
Length=415

 Score =   197 bits (502),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 132/179 (74%), Gaps = 11/179 (6%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +N
Sbjct  164   SEDDAQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINN  223

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE+QEAE++ LRKSL FKATPMP+F Q   PPK ELKKIPPTR KSPKLGR+KT 
Sbjct  224   MQAKSKETQEAELRKLRKSLNFKATPMPSFSQ---PPKTELKKIPPTRPKSPKLGRKKT-  279

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSL--IDVKK-PQRKSLPKLPSEKTYIP  1538
                 D +     + +RLSLDEK S+D+   +  +  +D+KK P RKSLP+LPS+KT +P
Sbjct  280   ----DSEEAQTPRVARLSLDEKASRDSTTAKGVVPTVDLKKQPLRKSLPRLPSQKTALP  334



>ref|XP_009138078.1| PREDICTED: uncharacterized protein LOC103862120 isoform X1 [Brassica 
rapa]
 ref|XP_009138079.1| PREDICTED: uncharacterized protein LOC103862120 isoform X1 [Brassica 
rapa]
Length=431

 Score =   197 bits (502),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 132/179 (74%), Gaps = 11/179 (6%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +N
Sbjct  180   SEDDAQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINN  239

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE+QEAE++ LRKSL FKATPMP+F Q   PPK ELKKIPPTR KSPKLGR+KT 
Sbjct  240   MQAKSKETQEAELRKLRKSLNFKATPMPSFSQ---PPKTELKKIPPTRPKSPKLGRKKT-  295

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSL--IDVKK-PQRKSLPKLPSEKTYIP  1538
                 D +     + +RLSLDEK S+D+   +  +  +D+KK P RKSLP+LPS+KT +P
Sbjct  296   ----DSEEAQTPRVARLSLDEKASRDSTTAKGVVPTVDLKKQPLRKSLPRLPSQKTALP  350



>ref|XP_009126143.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Brassica rapa]
 ref|XP_009126149.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Brassica rapa]
 ref|XP_009126156.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Brassica rapa]
Length=430

 Score =   197 bits (502),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 131/179 (73%), Gaps = 11/179 (6%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +N
Sbjct  177   SEDDTQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINN  236

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE++EAE++ LRKSL FKATPMP+F Q   PPK ELKKIPPTR KSPKLGR+KT 
Sbjct  237   MQAKSKETEEAELRKLRKSLNFKATPMPSFSQ---PPKTELKKIPPTRPKSPKLGRKKT-  292

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIP  1538
                 D +     + SRLSLDEK S+D+ A + +   V   K+P RKSLP+LPS+KT +P
Sbjct  293   ----DAEETQTPRVSRLSLDEKASRDHPAAKGTAATVDPKKQPLRKSLPRLPSQKTTLP  347



>emb|CDX75236.1| BnaA01g04660D [Brassica napus]
Length=431

 Score =   197 bits (500),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 130/179 (73%), Gaps = 11/179 (6%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +N
Sbjct  178   SEDDTQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINN  237

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE++EAE++ LRKSL FKATPMP+F Q   PPK ELKKIPPTR KSPKLGR+KT 
Sbjct  238   MQAKSKETEEAELRKLRKSLNFKATPMPSFSQ---PPKTELKKIPPTRPKSPKLGRKKT-  293

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIP  1538
                 D +     +  RLSLDEK S+D+ A + +   V   K+P RKSLP+LPS+KT +P
Sbjct  294   ----DAEETQTPRVGRLSLDEKASRDHPAAKGTAATVDPKKQPLRKSLPRLPSQKTTLP  348



>ref|XP_002878856.1| hypothetical protein ARALYDRAFT_481399 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55115.1| hypothetical protein ARALYDRAFT_481399 [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   195 bits (496),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 163/243 (67%), Gaps = 21/243 (9%)
 Frame = +3

Query  1038  SPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQ  1217
             SP   D KS RA +LP+Y FSF+C++RAEKR+EFY+KLEEKIHAKE E++ +QA++KE+Q
Sbjct  159   SPKEEDGKSRRASSLPNYGFSFRCDQRAEKRREFYSKLEEKIHAKEEEKNTVQAKSKETQ  218

Query  1218  EAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNE  1397
             EAE+KMLRKSL FKATPMPTFYQEP  PK ELKKIP TR KSPKLGR+KT S   D +  
Sbjct  219   EAELKMLRKSLNFKATPMPTFYQEPQLPKTELKKIPTTRPKSPKLGRKKTDS-GADSEEA  277

Query  1398  NGLQT---SRLSLDEKPSQDNLARRRSLIDVKK-PQRKSLPKLPSEKTYIPSETKKASPI  1565
               +QT    RLSLDEK     + +    ++ KK P RKSLP+LPSEKT +     K +P 
Sbjct  278   ITIQTPRIGRLSLDEKAP---VVKGSVPVETKKLPMRKSLPRLPSEKTNL--SNGKVAPA  332

Query  1566  K--TSISKEITE-------VDSQPNIVAKVTDEAEDVHASETEPKENDEADMS-LVQEPI  1715
             K  T+ +K  +E       VD+Q +  + V D A+   + E  P+ N++ + S +V E +
Sbjct  333   KAVTASTKAKSERKKPDKDVDAQ-SQSSPVGDNADPEDSQEQAPRVNEDRNESHMVVEVV  391

Query  1716  TVE  1724
              VE
Sbjct  392   AVE  394



>ref|XP_010436296.1| PREDICTED: transcriptional regulator ATRX homolog [Camelina sativa]
Length=301

 Score =   190 bits (483),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 162/266 (61%), Gaps = 32/266 (12%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEK-----IHAKE  1175
             SE   QSS SP A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK     +H++ 
Sbjct  39    SEDDTQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTXTECLHSRP  98

Query  1176  MEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLG  1355
             +   ++   ++E+QEAE++MLRKSL FKATPMP+FYQEP PPK ELKKIPPTRAKSPKLG
Sbjct  99    LLIKSLLF-SQETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRAKSPKLG  157

Query  1356  RRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEK  1526
             R+KT+S   D +     +  RLSLDE+ S+DN A +  +  V   K+P RKSLP+LPS+K
Sbjct  158   RKKTAS-GADCEETQTPRIGRLSLDERASKDNSAAKGIMPTVELKKQPVRKSLPRLPSQK  216

Query  1527  TYIPSETKKASPIKT-------------------SISKEITEVDSQPNIVAKVTDEAEDV  1649
             T +P    K +P K                    ++++    V+ +  +      +AED 
Sbjct  217   TALPD--GKPAPAKAATTSAKVKPEKKKVEKDAETVNQSSHPVEEEAQVTVSSNADAEDS  274

Query  1650  HASETEPKENDEADMSL-VQEPITVE  1724
             H   +     D AD S+ V E +TVE
Sbjct  275   HEIVSPRMNEDRADKSIEVSEAVTVE  300



>ref|XP_009138080.1| PREDICTED: uncharacterized protein LOC103862120 isoform X2 [Brassica 
rapa]
Length=430

 Score =   193 bits (490),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 132/179 (74%), Gaps = 12/179 (7%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS +P A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +N
Sbjct  180   SEDDAQSS-NPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINN  238

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE+QEAE++ LRKSL FKATPMP+F Q   PPK ELKKIPPTR KSPKLGR+KT 
Sbjct  239   MQAKSKETQEAELRKLRKSLNFKATPMPSFSQ---PPKTELKKIPPTRPKSPKLGRKKT-  294

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSL--IDVKK-PQRKSLPKLPSEKTYIP  1538
                 D +     + +RLSLDEK S+D+   +  +  +D+KK P RKSLP+LPS+KT +P
Sbjct  295   ----DSEEAQTPRVARLSLDEKASRDSTTAKGVVPTVDLKKQPLRKSLPRLPSQKTALP  349



>ref|XP_003563653.1| PREDICTED: protein WVD2-like 1 [Brachypodium distachyon]
 ref|XP_010227540.1| PREDICTED: protein WVD2-like 1 [Brachypodium distachyon]
Length=381

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  1044  TAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEA  1223
             T    K  R G+ PSY F+FKCNERAEKR+EFY+KLEEKIHA+EME++N++A++KE++EA
Sbjct  178   TCERIKPQRVGSTPSYGFAFKCNERAEKRREFYSKLEEKIHAQEMEKTNLEAKSKETEEA  237

Query  1224  EIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG  1403
             E++ LRKSL FKA PMP+FY+EPPPPKV+LKKIP TRA+SPKLGR K +       +   
Sbjct  238   ELRQLRKSLNFKAAPMPSFYKEPPPPKVDLKKIPTTRARSPKLGRSKNTISAGTEVSTTS  297

Query  1404  LQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
              + +RLSLD+K SQ++     +    KKPQRKSLPKLPSE+T
Sbjct  298   SRPARLSLDQKTSQNSARTAPAANAAKKPQRKSLPKLPSEQT  339



>ref|XP_009126164.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Brassica rapa]
Length=429

 Score =   193 bits (490),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 131/179 (73%), Gaps = 12/179 (7%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             SE   QSS +P A D K  + G LP+Y FSFKC++RAEKR+EFY KLEEK HAKE E +N
Sbjct  177   SEDDTQSS-NPKADDGKPRKVGALPNYGFSFKCDQRAEKRREFYVKLEEKTHAKEEEINN  235

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             MQA++KE++EAE++ LRKSL FKATPMP+F Q   PPK ELKKIPPTR KSPKLGR+KT 
Sbjct  236   MQAKSKETEEAELRKLRKSLNFKATPMPSFSQ---PPKTELKKIPPTRPKSPKLGRKKT-  291

Query  1371  SPNRDGKNENGLQTSRLSLDEKPSQDNLARRRSLIDV---KKPQRKSLPKLPSEKTYIP  1538
                 D +     + SRLSLDEK S+D+ A + +   V   K+P RKSLP+LPS+KT +P
Sbjct  292   ----DAEETQTPRVSRLSLDEKASRDHPAAKGTAATVDPKKQPLRKSLPRLPSQKTTLP  346



>gb|AAD20707.1| unknown protein [Arabidopsis thaliana]
Length=404

 Score =   189 bits (480),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 127/174 (73%), Gaps = 6/174 (3%)
 Frame = +3

Query  1029  SSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTK  1208
             +  SP   D K  RA  LP+Y FSF+C++RAEKR+EFY+KLEEKIHAKE E++ +QA++K
Sbjct  161   TQYSPKEDDGKPRRASALPNYGFSFRCDQRAEKRREFYSKLEEKIHAKEEEKNTVQAKSK  220

Query  1209  ESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDG  1388
             E+QEAE+KMLRKSL FKATPMPTFYQEP  PK ELKKI  TR KSPKLGR+KT+S   D 
Sbjct  221   ETQEAELKMLRKSLNFKATPMPTFYQEPQLPKTELKKIAITRPKSPKLGRKKTNS-RADS  279

Query  1389  KNENGLQT---SRLSLDEKPSQDNLARRRSLIDVKK--PQRKSLPKLPSEKTYI  1535
             +    +QT    RLSLDEK  +DN     S+    K  P RKSLP+LPSEKT +
Sbjct  280   EEAITIQTPRFGRLSLDEKTPKDNPVVEGSVPGETKKPPVRKSLPRLPSEKTNL  333



>ref|NP_180118.2| TPX2 (targeting protein for Xklp2) family protein [Arabidopsis 
thaliana]
 dbj|BAE99750.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07706.1| TPX2 (targeting protein for Xklp2) family protein [Arabidopsis 
thaliana]
Length=403

 Score =   187 bits (476),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 125/170 (74%), Gaps = 6/170 (4%)
 Frame = +3

Query  1041  PTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQE  1220
             P   D K  RA  LP+Y FSF+C++RAEKR+EFY+KLEEKIHAKE E++ +QA++KE+QE
Sbjct  164   PKEDDGKPRRASALPNYGFSFRCDQRAEKRREFYSKLEEKIHAKEEEKNTVQAKSKETQE  223

Query  1221  AEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNEN  1400
             AE+KMLRKSL FKATPMPTFYQEP  PK ELKKI  TR KSPKLGR+KT+S   D +   
Sbjct  224   AELKMLRKSLNFKATPMPTFYQEPQLPKTELKKIAITRPKSPKLGRKKTNS-RADSEEAI  282

Query  1401  GLQT---SRLSLDEKPSQDNLARRRSLIDVKK--PQRKSLPKLPSEKTYI  1535
              +QT    RLSLDEK  +DN     S+    K  P RKSLP+LPSEKT +
Sbjct  283   TIQTPRFGRLSLDEKTPKDNPVVEGSVPGETKKPPVRKSLPRLPSEKTNL  332



>gb|EMS54637.1| hypothetical protein TRIUR3_19981 [Triticum urartu]
Length=383

 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 134/198 (68%), Gaps = 19/198 (10%)
 Frame = +3

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K  + G+ PSY F+FKCNERAEKR+EFY+KLEEKIHA+E+E++NMQA++KE +EAE++ 
Sbjct  184   VKPQKVGSTPSYGFAFKCNERAEKRREFYSKLEEKIHAQELEKNNMQAKSKEMEEAELRQ  243

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNEN-GLQT  1412
             LRKSL FKA PMP+FY+EPP PK+ELKK+P TR +SPKLGR K ++      + N   + 
Sbjct  244   LRKSLNFKAAPMPSFYKEPPAPKIELKKVPTTRPRSPKLGRSKNTTSAGTAVSTNPSSRP  303

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTY---------------IPSET  1547
              RLSLD++ SQ++    ++    KK QRKSLPKLPSE+T                I   T
Sbjct  304   VRLSLDQRASQNSP---KAAPAPKKSQRKSLPKLPSEQTGSVDIATSISSAEQLEISKST  360

Query  1548  KKASPIKTSISKEITEVD  1601
               A PI+T I  ++T  D
Sbjct  361   ATADPIRTPIRAQVTPDD  378



>gb|EMT24340.1| hypothetical protein F775_04460 [Aegilops tauschii]
Length=381

 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 122/159 (77%), Gaps = 4/159 (3%)
 Frame = +3

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
              K  + G+ PSY F+FKCNERAEKR+EFY+KLEEKIHA+E+E++NMQA++KE +EAE++ 
Sbjct  184   VKPQKVGSTPSYGFAFKCNERAEKRREFYSKLEEKIHAQELEKNNMQAKSKEMEEAELRQ  243

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNEN-GLQT  1412
             LRKSL FKA PMP+FY+EPP PKVELKK+P TR +SPKLGR K ++      + N   + 
Sbjct  244   LRKSLNFKAAPMPSFYKEPPAPKVELKKVPTTRPRSPKLGRSKNTTSAGTAVSTNPSSRP  303

Query  1413  SRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
              RLSLD++ SQ++    ++    KK QRKSLPKLPSE+T
Sbjct  304   VRLSLDQRASQNSP---KAAPAPKKSQRKSLPKLPSEQT  339



>gb|EMT11734.1| hypothetical protein F775_32274 [Aegilops tauschii]
Length=580

 Score =   182 bits (462),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 126/194 (65%), Gaps = 50/194 (26%)
 Frame = +3

Query  1056  TKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKM  1235
             +K+ R+G+ P+Y FSFKC+ERAEKR+EFY+KLEEKIHA+EME SNMQA++KE++EAE+KM
Sbjct  322   SKARRSGSTPAYGFSFKCDERAEKRREFYSKLEEKIHAREMEISNMQAKSKETEEAELKM  381

Query  1236  LRKSLKFKATPMPTFYQEPPPPKVELK-----------------------------KIPP  1328
             LRKSLKFKATPMP+F    PPPKVELK                             KIPP
Sbjct  382   LRKSLKFKATPMPSFS---PPPKVELKKKIVYAMCCIWMGCCCRAFILIEKSVLAVKIPP  438

Query  1329  TRAKSPKLGRRKTSSPNRDGKNENGLQTS---------RLSLDEKPSQDNLARRRSLIDV  1481
             TRAKSPKLGR          KN++GL+           R+SLDEK +Q+   +      V
Sbjct  439   TRAKSPKLGR---------SKNKSGLEAEESTTPSHPIRMSLDEKATQNGAKKVTPSNSV  489

Query  1482  KKPQRKSLPKLPSE  1523
             KKPQRKSLPKLPSE
Sbjct  490   KKPQRKSLPKLPSE  503



>gb|KHG28502.1| putative basic-leucine zipper transcription factor M [Gossypium 
arboreum]
Length=292

 Score =   173 bits (438),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 169/300 (56%), Gaps = 42/300 (14%)
 Frame = +3

Query  549   LNDDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSN  728
             +ND++       E   +S   +ESN+  DS+E E++ +   K  K QK  GK KN KLS+
Sbjct  1     MNDNVG----TGEAGEDSDDFIESNALIDSEEGEIEDN--MKQSKPQKVQGKTKNEKLSS  54

Query  729   P---KHAVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNH  899
             P     A+V  +K GK       +S   +  ++S   QP      +  F+ER+     N 
Sbjct  55    PGSVSSALVKKNKDGKSADVPLIASSAGSVATSSALNQPHT----NRPFSERQG----NA  106

Query  900   DKHCGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGT  1079
              K   + D   S    ++                   +++ G S  SPTA D K  R  T
Sbjct  107   SKQSEKSDAALSEGTTEK------------PVKKGPLTKSEGDSESSPTATDAKPCRVST  154

Query  1080  LPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFK  1259
             LP Y FSFKC+ERAEKRKEFY+KLEEKIHA+E+E+S +QA++            KSL FK
Sbjct  155   LPKYGFSFKCDERAEKRKEFYSKLEEKIHAREIEKSKLQAKS------------KSLNFK  202

Query  1260  ATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK-TSSPNRDGKNENGLQTSRLSLDEK  1436
             ATPMP+FYQEP PPKVE+KK+P TRAKSPKLGRRK T++ + DG + +G Q  RLSLDEK
Sbjct  203   ATPMPSFYQEPSPPKVEIKKVPTTRAKSPKLGRRKSTTTLDSDGNSNSGHQLVRLSLDEK  262



>ref|XP_009392362.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392363.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Musa 
acuminata subsp. malaccensis]
Length=424

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 119/163 (73%), Gaps = 7/163 (4%)
 Frame = +3

Query  1062  SHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLR  1241
             S RA       FSF+ +ERAEKRKEF+ KLEEK HAKE+E++N+QA++KE+QEAEI+ LR
Sbjct  211   SPRARKSAGCGFSFRLDERAEKRKEFFMKLEEKNHAKELEKTNLQAKSKENQEAEIRRLR  270

Query  1242  KSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRL  1421
             K+L FKATPMP+FYQEP PPKVELKKIPPTRA+SPKLGRRK S    DG +E G  +S  
Sbjct  271   KTLTFKATPMPSFYQEPGPPKVELKKIPPTRARSPKLGRRKQSVSAADGSSEVGTSSST-  329

Query  1422  SLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETK  1550
                 KPS    + + +    KKP++K L KLPS+K+  P+ TK
Sbjct  330   ----KPSDGAASSKGNAAFPKKPKQKLLSKLPSQKS--PTATK  366



>ref|XP_006483366.1| PREDICTED: enolase-phosphatase E1-like isoform X2 [Citrus sinensis]
Length=296

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 127/318 (40%), Positives = 172/318 (54%), Gaps = 26/318 (8%)
 Frame = +3

Query  375   MDANDKKRIAENGLGCENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLN  554
             MD++D K    + +  +NG  KQL A GED V+  +D V           G+ +    L+
Sbjct  1     MDSDDLKVAEGDEVALQNGAHKQLVASGEDGVI--ADDVNQTITETARPNGDSETVDKLD  58

Query  555   DDIAIDSSVQEVIHESMVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPK  734
             +      +  EV+      +ESN    +K  + K +  SK     K  GK K+ K  NPK
Sbjct  59    ES----GTTGEVMEGESDNVESNGLVVAKTGKGKAADTSKQSIPLKGHGKSKSEKPLNPK  114

Query  735   H--AVvagskkgkdgkdissssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKH  908
             +  +      K     D +S+    +    S +KQ      KS +FNER+        K 
Sbjct  115   NVSSTGVKKSKDGKNDDGTSTISNGSVGLNSHSKQSF----KSMTFNERQ----AQFSKQ  166

Query  909   CGRPDTTTSSSVAQRESHkekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPS  1088
              G+ DT +S  +A++            K       E  G+  L   + D K  R G LP+
Sbjct  167   SGKSDTPSSEGLAEK---------TKSKPLKKGPPEKAGKD-LDYKSDDAKPRRVGALPN  216

Query  1089  YSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATP  1268
             Y FSF+C+ERAEKR+EFY+KLEEKIHAKE+E+S +QA++KE+QEAEIKMLRKSL FKATP
Sbjct  217   YGFSFRCDERAEKRREFYSKLEEKIHAKEVEKSTLQAKSKETQEAEIKMLRKSLNFKATP  276

Query  1269  MPTFYQEPPPPKVELKKI  1322
             MPTFYQEPPPPKVELKK+
Sbjct  277   MPTFYQEPPPPKVELKKL  294



>ref|XP_010917924.1| PREDICTED: uncharacterized protein LOC105042421 [Elaeis guineensis]
 ref|XP_010917925.1| PREDICTED: uncharacterized protein LOC105042421 [Elaeis guineensis]
Length=479

 Score =   175 bits (444),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 137/210 (65%), Gaps = 10/210 (5%)
 Frame = +3

Query  1086  SYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKAT  1265
             S  F+F+ +ERAEKRKEF+ KLEEKI  KE+E++N+QA+TKESQEAEI+ LRKSL FKAT
Sbjct  230   SSGFNFRLDERAEKRKEFFLKLEEKIQQKELEKTNLQAKTKESQEAEIRQLRKSLTFKAT  289

Query  1266  PMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLD-EKPS  1442
             PMP+FYQEP PPKVELKKIPPTRAKSPKLGR K S    D  +E   Q+S  + D  KP 
Sbjct  290   PMPSFYQEPGPPKVELKKIPPTRAKSPKLGRHKPSVAATDNPSEGSSQSSHPASDTSKPK  349

Query  1443  QDNLARRRSLIDVKKPQRKSLPKLPSEK-TYIPSETKKASPIKTSISKEITEVDSQPNIV  1619
             +     + +   +KKP +KSL KLPS+K T +  ETK   P+ T       +V +Q   V
Sbjct  350   EGAANNKGASTALKKPTQKSLSKLPSQKSTAVKPETK---PLGTK-----PKVSNQKPKV  401

Query  1620  AKVTDEAEDVHASETEPKENDEADMSLVQE  1709
              K   E  D  ++E  P E D A  S+  E
Sbjct  402   EKPKVEENDGKSTEVPPPEADIAVESVFLE  431



>ref|XP_009412316.1| PREDICTED: uncharacterized protein LOC103993842 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412317.1| PREDICTED: uncharacterized protein LOC103993842 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412318.1| PREDICTED: uncharacterized protein LOC103993842 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412319.1| PREDICTED: uncharacterized protein LOC103993842 [Musa acuminata 
subsp. malaccensis]
Length=445

 Score =   173 bits (438),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 141/208 (68%), Gaps = 24/208 (12%)
 Frame = +3

Query  1092  SFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPM  1271
             +F+F+ +ERAEKRKEF+TKLEEK HAKE+E++N+QA++KESQEAEI+ LRKSL FKATPM
Sbjct  227   AFNFRLDERAEKRKEFFTKLEEKNHAKELEKTNLQAKSKESQEAEIRQLRKSLTFKATPM  286

Query  1272  PTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR-----LSLDEK  1436
             PTFYQEP PPKVEL K+PPTRA+SPKLGRRK S    DG +E G   +R     +S   K
Sbjct  287   PTFYQEPCPPKVELTKVPPTRARSPKLGRRKPSVTAADGPSEAG--NTRDGPHPISSLTK  344

Query  1437  PSQDNLARRRSLIDVKKPQRKSLPKLPSEK---TYIPSETKKASPIKTSISKEI------  1589
             P++ + + + + I  K  ++KSL KLPS+K   T + SE+     + T  ++EI      
Sbjct  345   PNEGSESSKGNAIASKNSKKKSLAKLPSQKLKTTKLDSES-----VMTPKTEEIDAGNSD  399

Query  1590  ---TEVDSQPNIVAKVTDEAEDVHASET  1664
                TEV ++ N  AK+    + V  ++T
Sbjct  400   NRPTEVSAETNTEAKLASANDRVEENKT  427



>gb|EPS64572.1| hypothetical protein M569_10209, partial [Genlisea aurea]
Length=170

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 127/176 (72%), Gaps = 11/176 (6%)
 Frame = +3

Query  1026  QSSLSPTAADTKSH-RAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQ  1202
             Q+S S  + + KS  R+ TLP+Y FSF+C++RAEKRKEFY++LEEKI AKE E++N+QA+
Sbjct  5     QNSFSTCSENLKSEKRSSTLPAYDFSFRCDQRAEKRKEFYSRLEEKIQAKEAEKNNLQAK  64

Query  1203  TKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNR  1382
             TKE+Q+AEIK LRK++ FKATPMP+FYQEP P K+E KKIP TR KSPKLGRRK SSP  
Sbjct  65    TKETQDAEIKNLRKTMAFKATPMPSFYQEPAPAKLESKKIPTTRPKSPKLGRRK-SSPAA  123

Query  1383  DGKNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETK  1550
             + + ENG  ++       P   +  +  ++   K+  R+SLPKLPS+K  +  E K
Sbjct  124   ECE-ENGHHSA------APGSSSSLKASAV--KKQSSRQSLPKLPSQKINLGEEDK  170



>ref|XP_009415304.1| PREDICTED: uncharacterized protein LOC103996173 [Musa acuminata 
subsp. malaccensis]
Length=442

 Score =   168 bits (425),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 118/169 (70%), Gaps = 11/169 (7%)
 Frame = +3

Query  1044  TAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEA  1223
             +AA + + RA       F+FK +ERAEKRKEF+ KLEEK HAKE+E++N+QA++KE+QEA
Sbjct  208   SAASSSTPRARKNTGIGFNFKLDERAEKRKEFFMKLEEKNHAKELEKTNLQAKSKENQEA  267

Query  1224  EIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG  1403
             EI+ LRKSL FKATPMP FYQEP PPK ELKKIPPTRA+SPKLGRRK S       +E G
Sbjct  268   EIRRLRKSLTFKATPMPNFYQEPGPPKAELKKIPPTRARSPKLGRRKQSVAAASNPSEAG  327

Query  1404  -------LQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
                    +  S   ++E  +    + +R+ I  K P++KSL KLPS+K+
Sbjct  328   DSCQSPCVTASSTKMNEGAA----SSKRNAIASKNPKQKSLSKLPSQKS  372



>ref|XP_009415983.1| PREDICTED: uncharacterized protein LOC103996729 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009415992.1| PREDICTED: uncharacterized protein LOC103996729 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 116/166 (70%), Gaps = 6/166 (4%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+ +ERAEKRKEF+TKLEEK HAKEME++N+QA++KE+QEAEI+ LRKSL FKATPMP
Sbjct  201   FSFRLDERAEKRKEFFTKLEEKNHAKEMEKTNLQARSKENQEAEIRRLRKSLTFKATPMP  260

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNL  1454
              FYQEP PPKVELKKIPPTRA+SPKLGR K S    D  +E  +      L    ++ N 
Sbjct  261   NFYQEPGPPKVELKKIPPTRARSPKLGRHKASVAASDIPSEASMSCGSPCLTPSSTKLNE  320

Query  1455  A----RRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSIS  1580
             A    R  S  ++  P +KSLPKLPS+K  + +   K+   KT  S
Sbjct  321   AAATNRGNSTSNI--PTQKSLPKLPSQKPKVVATELKSVATKTKFS  364



>ref|XP_006826420.1| hypothetical protein AMTR_s00004p00160730 [Amborella trichopoda]
 gb|ERM93657.1| hypothetical protein AMTR_s00004p00160730 [Amborella trichopoda]
Length=518

 Score =   166 bits (419),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 120/189 (63%), Gaps = 29/189 (15%)
 Frame = +3

Query  1086  SYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKAT  1265
             S  FSF+C+ERAEKRKEF+TKLEEKI AKE+E++N+QAQ+KESQEAEIK LRKSL FKAT
Sbjct  280   SAGFSFRCDERAEKRKEFFTKLEEKIQAKEVEKTNLQAQSKESQEAEIKQLRKSLTFKAT  339

Query  1266  PMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS------------SPNRDGKNENGLQ  1409
             PMP+FYQEP PPKV+LKKIP TR +SPKLGR K+S            +PN     +   Q
Sbjct  340   PMPSFYQEPAPPKVDLKKIPTTRPRSPKLGRHKSSIAPLALAAATDTTPNNTKSCKGSRQ  399

Query  1410  TSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEI  1589
              S    +  P   N          KKP R+SL K PS+K+  P             +KE+
Sbjct  400   GSMDQANPNPPSQNTENTS-----KKPVRRSLTKAPSQKSSNPK------------TKEV  442

Query  1590  TEVDSQPNI  1616
             ++  ++PNI
Sbjct  443   SKDPAKPNI  451



>ref|XP_008790219.1| PREDICTED: uncharacterized protein LOC103707486 [Phoenix dactylifera]
Length=481

 Score =   161 bits (408),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 108/146 (74%), Gaps = 1/146 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+F+ +ERAEKRKEF+ KLEEKIH KE+E++N+QA++KESQEAEI+ LRKSL FKATPMP
Sbjct  235   FNFRLDERAEKRKEFFLKLEEKIHQKELEKTNLQAKSKESQEAEIRQLRKSLTFKATPMP  294

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNL  1454
             +FYQEP PPK ELKKIPPTR +SPKLGR K S    D  +E    +   + D   S++  
Sbjct  295   SFYQEPGPPKAELKKIPPTRPRSPKLGRNKPSVAATDNPSEGSSVSPHPASDTSKSKEGA  354

Query  1455  ARRRSL-IDVKKPQRKSLPKLPSEKT  1529
             A  +     +KKP +KSL ++PS+K+
Sbjct  355   ANNKGASTALKKPTQKSLSRMPSQKS  380



>ref|XP_009405789.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=398

 Score =   159 bits (403),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 130/199 (65%), Gaps = 11/199 (6%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+F  +ERAEKRKEF+ KLEEK HAKE+E++N+Q ++KESQEAEI+ LRKSL FKATPMP
Sbjct  175   FNFSLDERAEKRKEFFMKLEEKNHAKEVEKTNLQVKSKESQEAEIRKLRKSLTFKATPMP  234

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGL--QTSRLSLDEKPSQD  1448
             +FYQEP PPKVELKKIPPTRAKSPKLGRRK  S   D  +E  +  ++ R +       +
Sbjct  235   SFYQEPGPPKVELKKIPPTRAKSPKLGRRKVPSAVTDNPSEGSISCESPRPAPSSSKPNE  294

Query  1449  NLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISK-----EITEVDSQPN  1613
              +   +     K P +KSL KLPS+++   +   K++  K  +S      E  +V++  N
Sbjct  295   AVTSIKGSSTSKNPTKKSLSKLPSQESKTSTPDVKSAATKRKVSNMKAKLEKAKVEASDN  354

Query  1614  IVAKVTDEAEDVHASETEP  1670
              + +V  EA    ++E EP
Sbjct  355   KLIEVAPEA----STEVEP  369



>ref|XP_006662975.1| PREDICTED: protein WAVE-DAMPENED 2-like, partial [Oryza brachyantha]
Length=323

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 113/163 (69%), Gaps = 21/163 (13%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEFY KLEEKIHAKE+E++N+QA++KESQEAEIK+LRKSL FKATPMP
Sbjct  102   FSFRLQERAEKRKEFYQKLEEKIHAKELEQTNLQAKSKESQEAEIKLLRKSLTFKATPMP  161

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS----PNRDGKNENGLQTSRLSLDEKPS  1442
             +FY+E  PPKVELKKIPPTRA+SPKLGR K ++     + DG          +S +   S
Sbjct  162   SFYKE-QPPKVELKKIPPTRARSPKLGRHKPTNSVAVASADGS---------VSCESPRS  211

Query  1443  QDNLAR-------RRSLIDVKKPQRKSLPKLPSEKTYIPSETK  1550
               NLA+        +S +  +KP ++S+ + P E     +ETK
Sbjct  212   ITNLAKLTESAENNKSRVTARKPAQRSVTRTPQESATAKTETK  254



>ref|XP_009405787.1| PREDICTED: uncharacterized protein LOC103988852 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405788.1| PREDICTED: uncharacterized protein LOC103988852 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=399

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 130/200 (65%), Gaps = 12/200 (6%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+F  +ERAEKRKEF+ KLEEK HAKE+E++N+Q ++KESQEAEI+ LRKSL FKATPMP
Sbjct  175   FNFSLDERAEKRKEFFMKLEEKNHAKEVEKTNLQVKSKESQEAEIRKLRKSLTFKATPMP  234

Query  1275  TFYQEPPPPKVELKK-IPPTRAKSPKLGRRKTSSPNRDGKNENGL--QTSRLSLDEKPSQ  1445
             +FYQEP PPKVELKK IPPTRAKSPKLGRRK  S   D  +E  +  ++ R +       
Sbjct  235   SFYQEPGPPKVELKKQIPPTRAKSPKLGRRKVPSAVTDNPSEGSISCESPRPAPSSSKPN  294

Query  1446  DNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISK-----EITEVDSQP  1610
             + +   +     K P +KSL KLPS+++   +   K++  K  +S      E  +V++  
Sbjct  295   EAVTSIKGSSTSKNPTKKSLSKLPSQESKTSTPDVKSAATKRKVSNMKAKLEKAKVEASD  354

Query  1611  NIVAKVTDEAEDVHASETEP  1670
             N + +V  EA    ++E EP
Sbjct  355   NKLIEVAPEA----STEVEP  370



>ref|XP_006481634.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Citrus 
sinensis]
 gb|KDO70674.1| hypothetical protein CISIN_1g011063mg [Citrus sinensis]
Length=493

 Score =   155 bits (391),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 113/170 (66%), Gaps = 16/170 (9%)
 Frame = +3

Query  1038  SPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQ  1217
             S T+A ++  R+G      F+F+  ERAE+RKEF++KLEEKIHAKE+E+SN+Q ++KESQ
Sbjct  251   STTSATSRGRRSGV---SGFNFRLEERAERRKEFFSKLEEKIHAKEVEKSNLQEKSKESQ  307

Query  1218  EAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNE  1397
             EAEIK LRKSL FKATPMP+FY+E PPPKVELKKIP TRA SPK GR K+S   +D   E
Sbjct  308   EAEIKQLRKSLTFKATPMPSFYKE-PPPKVELKKIPTTRAVSPKFGRNKSSVAAKDSSFE  366

Query  1398  NGLQTSRLSLDEKP--------SQDNLARRRSLIDVKKPQRKSLPKLPSE  1523
             NG       L++ P        +  N     S   +KKPQ    PKL S+
Sbjct  367   NGGSCHSPRLNQGPNNSMKGTQANGNKESATSKTPIKKPQ----PKLQSQ  412



>gb|EEC68390.1| hypothetical protein OsI_36542 [Oryza sativa Indica Group]
Length=430

 Score =   152 bits (384),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 83/90 (92%), Gaps = 1/90 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEFY KLEEKIHAKE+E++N+QA++KESQEAEIK+LRKSL FKATPMP
Sbjct  208   FSFRLQERAEKRKEFYQKLEEKIHAKELEQTNLQAKSKESQEAEIKLLRKSLTFKATPMP  267

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             +FY+E  PPKVELKKIPPTRA+SPKLGR K
Sbjct  268   SFYKE-QPPKVELKKIPPTRARSPKLGRHK  296



>ref|NP_001068122.1| Os11g0571900 [Oryza sativa Japonica Group]
 gb|ABA94344.1| Targeting protein for Xklp2 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28485.1| Os11g0571900 [Oryza sativa Japonica Group]
 dbj|BAG93722.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67254.1| hypothetical protein OsJ_24413 [Oryza sativa Japonica Group]
Length=430

 Score =   152 bits (384),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 83/90 (92%), Gaps = 1/90 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEFY KLEEKIHAKE+E++N+QA++KESQEAEIK+LRKSL FKATPMP
Sbjct  208   FSFRLQERAEKRKEFYQKLEEKIHAKELEQTNLQAKSKESQEAEIKLLRKSLTFKATPMP  267

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             +FY+E  PPKVELKKIPPTRA+SPKLGR K
Sbjct  268   SFYKE-QPPKVELKKIPPTRARSPKLGRHK  296



>gb|EPS68122.1| hypothetical protein M569_06652, partial [Genlisea aurea]
Length=104

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 3/98 (3%)
 Frame = +3

Query  1092  SFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPM  1271
             +FSF+  ERAEKRK+F+TK+EEKI AKE E+SN+QA++KE+QEAEIK LRKSL FKATPM
Sbjct  8     TFSFRLEERAEKRKQFFTKVEEKIQAKEAEKSNLQAKSKENQEAEIKQLRKSLTFKATPM  67

Query  1272  PTFYQEPPPPKVELKKIPPTRAKSPKLGRRK--TSSPN  1379
             PTFY+E PPPKVELKKIP TR KSPKLGRRK   SSPN
Sbjct  68    PTFYKE-PPPKVELKKIPITRPKSPKLGRRKAGASSPN  104



>gb|KEH39832.1| TPX2 (targeting protein for Xklp2) family protein [Medicago truncatula]
Length=347

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 170/300 (57%), Gaps = 14/300 (5%)
 Frame = +3

Query  423   ENGVDKQLHAVGEDIVVDQSDGVLNGSFTIEEAEGNFQNAVNLNDDIAIDSSVQEVIHES  602
             +NGV  +    GED V +  D  +  +      +GN +N +N  +  A  +S  + I  S
Sbjct  18    QNGVHDEPSNSGEDAVSNDLDPHVTVNTETFVPDGNSEN-INQLESTATGNSAMKEIEGS  76

Query  603   MVPLESNSCADSKESEVKTSGESKSGKLQKAPGKPKNVKLSNPKHAVvagskkgkdgkdi  782
                ++ ++   SKE EVK    ++  + QK P K KN K+ +    V A   K       
Sbjct  77    NDNVDGSNLTVSKEKEVKIKVSTEQSRAQKGPVKNKNAKVGS-SSGVNASLVKNSKIGKD  135

Query  783   ssssvisngtsasRAKQPSAPIEKSTSFNERKTVVKVNHDKHCGRPDTTTSSSVAQRESH  962
               +S   +  +++   +P  PI K+ S N+R++ +     K          S  A  +  
Sbjct  136   KQASPAVSNGTSALDSRPRQPI-KNRSSNDRQSQLSKQPSK----------SEAASSDVA  184

Query  963   kekpllkplkkgppkkSEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFY  1142
              EK   K LKKGP  K +  G+SSL+    DTK  R GTLP+Y FSF+C ERAEKR+EF 
Sbjct  185   VEKKKPKSLKKGPLDKVQGEGESSLT-NREDTKPRRVGTLPNYGFSFRCGERAEKRREFL  243

Query  1143  TKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKI  1322
             TK+EEKI AKE E+S++QA++KESQEAEIK LRKSL FKATP+PTFYQEP PPKVELKK+
Sbjct  244   TKVEEKIQAKEEEKSSLQAKSKESQEAEIKKLRKSLTFKATPLPTFYQEPAPPKVELKKV  303



>ref|XP_010263081.1| PREDICTED: uncharacterized protein LOC104601451 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010263083.1| PREDICTED: uncharacterized protein LOC104601451 isoform X3 [Nelumbo 
nucifera]
Length=467

 Score =   152 bits (384),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+ +  ERAEKRKEF++KLEEKIHAKE+E +N+QA+TKESQEAEI+ LRKSL FKATPMP
Sbjct  244   FASRLIERAEKRKEFFSKLEEKIHAKELERTNLQAKTKESQEAEIRELRKSLMFKATPMP  303

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNL  1454
             +FY+E PPPKVELKKIP TRA SPK GR K S    D  +E   Q++  SLD K S    
Sbjct  304   SFYKE-PPPKVELKKIPTTRAISPKFGRHKNSIAAVDNSSEGSCQSTYPSLDSKKSTKVA  362

Query  1455  ARRRSLIDV-KKPQRKSLPKLPS  1520
             A         KKP RK + KL S
Sbjct  363   ATSTGDSSASKKPVRKLISKLSS  385



>ref|XP_010263082.1| PREDICTED: uncharacterized protein LOC104601451 isoform X2 [Nelumbo 
nucifera]
Length=467

 Score =   152 bits (384),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+ +  ERAEKRKEF++KLEEKIHAKE+E +N+QA+TKESQEAEI+ LRKSL FKATPMP
Sbjct  244   FASRLIERAEKRKEFFSKLEEKIHAKELERTNLQAKTKESQEAEIRELRKSLMFKATPMP  303

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNL  1454
             +FY+E PPPKVELKKIP TRA SPK GR K S    D  +E   Q++  SLD K S    
Sbjct  304   SFYKE-PPPKVELKKIPTTRAISPKFGRHKNSIAAVDNSSEGSCQSTYPSLDSKKSTKVA  362

Query  1455  ARRRSLIDV-KKPQRKSLPKLPS  1520
             A         KKP RK + KL S
Sbjct  363   ATSTGDSSASKKPVRKLISKLSS  385



>ref|XP_002308335.2| hypothetical protein POPTR_0006s21470g [Populus trichocarpa]
 gb|EEE91858.2| hypothetical protein POPTR_0006s21470g [Populus trichocarpa]
Length=503

 Score =   152 bits (384),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 106/153 (69%), Gaps = 19/153 (12%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF++KLEEKIHAKE+E++N+QA++KESQEAEIK LRKSL FKA PMP
Sbjct  270   FSFRLEERAEKRKEFFSKLEEKIHAKEIEQTNLQAKSKESQEAEIKKLRKSLTFKAAPMP  329

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNL  1454
              FY+E PPPKVELKKIP TRAKSPKLGRRK+S+ + +    N L+    S   + S   L
Sbjct  330   CFYKE-PPPKVELKKIPTTRAKSPKLGRRKSSTTSMN----NSLEDVGSSFSPRASHSPL  384

Query  1455  -----------ARRRSLID---VKKPQRKSLPK  1511
                        A+R   +D    K P RKS PK
Sbjct  385   LNQESSNPTKGAQRNGNVDNGASKTPIRKSQPK  417



>ref|XP_011047144.1| PREDICTED: uncharacterized protein LOC105141583 [Populus euphratica]
Length=503

 Score =   152 bits (384),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 85/93 (91%), Gaps = 1/93 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF++KLEEKIHAKE+E++N+QA++KESQEAEIK LRKSL FKA PMP
Sbjct  270   FSFRLEERAEKRKEFFSKLEEKIHAKEIEQTNLQAKSKESQEAEIKKLRKSLTFKAAPMP  329

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
              FY+E PPPKVELKKIP TRAKSPKLGRRK+S+
Sbjct  330   CFYKE-PPPKVELKKIPTTRAKSPKLGRRKSST  361



>ref|XP_010247903.1| PREDICTED: uncharacterized protein LOC104590846 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010247908.1| PREDICTED: uncharacterized protein LOC104590846 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010247914.1| PREDICTED: uncharacterized protein LOC104590846 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010247921.1| PREDICTED: uncharacterized protein LOC104590846 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010247925.1| PREDICTED: uncharacterized protein LOC104590846 isoform X1 [Nelumbo 
nucifera]
Length=504

 Score =   152 bits (384),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+F+ +ERAEKRKEF++KLEEKIHAKE+E++N+Q +TKESQEAEIK LRKSL FKATPMP
Sbjct  284   FAFRLDERAEKRKEFFSKLEEKIHAKELEKNNLQEKTKESQEAEIKQLRKSLTFKATPMP  343

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPS  1442
              FY+E PPPKVELKKIP TRA SPKLGR K+S+   D  +E   Q+ R  L+ K S
Sbjct  344   CFYKE-PPPKVELKKIPTTRAVSPKLGRHKSSA---DNHSEGSCQSPRPDLEAKKS  395



>ref|XP_010247933.1| PREDICTED: uncharacterized protein LOC104590846 isoform X2 [Nelumbo 
nucifera]
Length=474

 Score =   152 bits (383),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 94/117 (80%), Gaps = 4/117 (3%)
 Frame = +3

Query  1092  SFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPM  1271
              F+F+ +ERAEKRKEF++KLEEKIHAKE+E++N+Q +TKESQEAEIK LRKSL FKATPM
Sbjct  253   GFAFRLDERAEKRKEFFSKLEEKIHAKELEKNNLQEKTKESQEAEIKQLRKSLTFKATPM  312

Query  1272  PTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPS  1442
             P FY+E PPPKVELKKIP TRA SPKLGR K+S+   D  +E   Q+ R  L+ K S
Sbjct  313   PCFYKE-PPPKVELKKIPTTRAVSPKLGRHKSSA---DNHSEGSCQSPRPDLEAKKS  365



>ref|XP_010541818.1| PREDICTED: general transcriptional corepressor trfA-like [Tarenaya 
hassleriana]
 ref|XP_010541819.1| PREDICTED: general transcriptional corepressor trfA-like [Tarenaya 
hassleriana]
 ref|XP_010541820.1| PREDICTED: general transcriptional corepressor trfA-like [Tarenaya 
hassleriana]
Length=462

 Score =   151 bits (382),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 104/142 (73%), Gaps = 6/142 (4%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEFYTKLEEKIHAKE+E+SN+QA++KE+QEAEIK LRK L FKA+PMP
Sbjct  234   FSFRLEERAEKRKEFYTKLEEKIHAKEIEKSNLQAKSKENQEAEIKKLRKRLTFKASPMP  293

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRD--GKNENGLQTSRLSLDEKPSQD  1448
             +FY+E PPPKVELKKIP TR  SPKLGR+K    N D  G       + R+SL+   S  
Sbjct  294   SFYKE-PPPKVELKKIPTTRPVSPKLGRKKG---NVDTVGGEAGSCASPRVSLENISSGK  349

Query  1449  NLARRRSLIDVKKPQRKSLPKL  1514
              + +++    ++KP  KS PKL
Sbjct  350   GMLKQKDSSILEKPVTKSQPKL  371



>ref|NP_565829.1| TPX2 (targeting protein for Xklp2)-like protein [Arabidopsis 
thaliana]
 gb|AAL14415.1| At2g35880/F11F19.21 [Arabidopsis thaliana]
 gb|AAD21469.2| expressed protein [Arabidopsis thaliana]
 gb|AAM98231.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09173.1| TPX2 (targeting protein for Xklp2)-like protein [Arabidopsis 
thaliana]
Length=432

 Score =   150 bits (379),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 1/110 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKIHAKE+E++N+QA++KESQE EIK L
Sbjct  234   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIHAKEVEKTNLQAKSKESQEEEIKRL  293

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDG  1388
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS    G
Sbjct  294   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSSDATGG  342



>ref|XP_002881415.1| hypothetical protein ARALYDRAFT_482558 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57674.1| hypothetical protein ARALYDRAFT_482558 [Arabidopsis lyrata subsp. 
lyrata]
Length=433

 Score =   150 bits (378),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 1/110 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKIHAKE+E++N+QA++KESQE EIK L
Sbjct  234   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIHAKEVEKTNLQAKSKESQEEEIKRL  293

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDG  1388
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS    G
Sbjct  294   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSSDATGG  342



>ref|XP_006410758.1| hypothetical protein EUTSA_v10016634mg [Eutrema salsugineum]
 gb|ESQ52211.1| hypothetical protein EUTSA_v10016634mg [Eutrema salsugineum]
Length=457

 Score =   150 bits (379),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 104/152 (68%), Gaps = 15/152 (10%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKIHAKE+E++ +QA++KESQE EIK L
Sbjct  235   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIHAKEVEKTTLQAKSKESQEEEIKRL  294

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS    G  E G + ++
Sbjct  295   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSSDATGG--EAGPRVTK  351

Query  1419  LSLDEKPSQDNLARRRSLIDVKKPQRKSLPKL  1514
                          +  SL  +KKP  KS PKL
Sbjct  352   ------------PKDSSLSTLKKPITKSQPKL  371



>ref|XP_007028041.1| TPX2 family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY08543.1| TPX2 family protein, putative isoform 2 [Theobroma cacao]
Length=486

 Score =   150 bits (380),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 108/149 (72%), Gaps = 11/149 (7%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+F+  ERAEKRKEF++KLEEKIHAKE+E +N+QA++KE+QEAEIK LRKSL FKATPMP
Sbjct  261   FTFRLEERAEKRKEFFSKLEEKIHAKEVERNNLQAKSKENQEAEIKQLRKSLAFKATPMP  320

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNL  1454
             +FY+E PPPKVELKKIP TRAKSPKLGR K+S    +  +E    +   SL++   + N 
Sbjct  321   SFYKE-PPPKVELKKIPTTRAKSPKLGRHKSSVSATNNPSEGDGSSVSPSLNQ---EQNF  376

Query  1455  ARRRSL-------IDVKKPQRKSLPKLPS  1520
             + RR+        +  KK  +KS PKL S
Sbjct  377   STRRTQTNGNEDNVASKKAVKKSQPKLQS  405



>ref|XP_006481633.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Citrus 
sinensis]
 gb|KDO70670.1| hypothetical protein CISIN_1g011063mg [Citrus sinensis]
 gb|KDO70671.1| hypothetical protein CISIN_1g011063mg [Citrus sinensis]
 gb|KDO70672.1| hypothetical protein CISIN_1g011063mg [Citrus sinensis]
 gb|KDO70673.1| hypothetical protein CISIN_1g011063mg [Citrus sinensis]
Length=494

 Score =   150 bits (380),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 104/151 (69%), Gaps = 13/151 (9%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+F+  ERAE+RKEF++KLEEKIHAKE+E+SN+Q ++KESQEAEIK LRKSL FKATPMP
Sbjct  268   FNFRLEERAERRKEFFSKLEEKIHAKEVEKSNLQEKSKESQEAEIKQLRKSLTFKATPMP  327

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKP-----  1439
             +FY+E PPPKVELKKIP TRA SPK GR K+S   +D   ENG       L++ P     
Sbjct  328   SFYKE-PPPKVELKKIPTTRAVSPKFGRNKSSVAAKDSSFENGGSCHSPRLNQGPNNSMK  386

Query  1440  ---SQDNLARRRSLIDVKKPQRKSLPKLPSE  1523
                +  N     S   +KKPQ    PKL S+
Sbjct  387   GTQANGNKESATSKTPIKKPQ----PKLQSQ  413



>ref|XP_006430022.1| hypothetical protein CICLE_v10012108mg [Citrus clementina]
 ref|XP_006430024.1| hypothetical protein CICLE_v10012108mg [Citrus clementina]
 gb|ESR43262.1| hypothetical protein CICLE_v10012108mg [Citrus clementina]
 gb|ESR43264.1| hypothetical protein CICLE_v10012108mg [Citrus clementina]
Length=494

 Score =   150 bits (380),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 133/222 (60%), Gaps = 19/222 (9%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+F+  ERAE+RKEF++KLEEKIHAKE+E+SN+Q ++KESQEAEIK LRKSL FKATPMP
Sbjct  268   FNFRLEERAERRKEFFSKLEEKIHAKEVEKSNLQEKSKESQEAEIKQLRKSLTFKATPMP  327

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKP-----  1439
             +FY+E PPPKVELKKIP TRA SPK GR K+S   +D   ENG       L++ P     
Sbjct  328   SFYKE-PPPKVELKKIPTTRAVSPKFGRNKSSVVAKDSSFENGGSCHSPRLNQGPNNSMK  386

Query  1440  -SQDNLARRRSLIDVKKPQRKSLPKLPSEKTYIPSETK----KASPIKTSISKEITEVDS  1604
              +Q N  +  +    K P +KS PKL S+ + I  +T+    K+ P       +  E D 
Sbjct  387   GTQANGNKESAT--SKTPIKKSQPKLQSQDS-IRRKTEGKPLKSKPKNAGAGNQNLEADG  443

Query  1605  QPNIV---AKVTDEAEDV--HASETEPKENDEADMSLVQEPI  1715
             +P      +    E +D    ASE  P E D   M++    I
Sbjct  444   KPEETQNQSSALPECKDAVDLASEIHPAETDGPIMTMANPEI  485



>ref|XP_007028040.1| TPX2 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY08542.1| TPX2 family protein, putative isoform 1 [Theobroma cacao]
Length=491

 Score =   150 bits (380),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 108/149 (72%), Gaps = 11/149 (7%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+F+  ERAEKRKEF++KLEEKIHAKE+E +N+QA++KE+QEAEIK LRKSL FKATPMP
Sbjct  266   FTFRLEERAEKRKEFFSKLEEKIHAKEVERNNLQAKSKENQEAEIKQLRKSLAFKATPMP  325

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNL  1454
             +FY+E PPPKVELKKIP TRAKSPKLGR K+S    +  +E    +   SL++   + N 
Sbjct  326   SFYKE-PPPKVELKKIPTTRAKSPKLGRHKSSVSATNNPSEGDGSSVSPSLNQ---EQNF  381

Query  1455  ARRRSL-------IDVKKPQRKSLPKLPS  1520
             + RR+        +  KK  +KS PKL S
Sbjct  382   STRRTQTNGNEDNVASKKAVKKSQPKLQS  410



>ref|XP_007028042.1| TPX2 family protein, putative isoform 3 [Theobroma cacao]
 gb|EOY08544.1| TPX2 family protein, putative isoform 3 [Theobroma cacao]
Length=414

 Score =   149 bits (376),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 108/149 (72%), Gaps = 11/149 (7%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+F+  ERAEKRKEF++KLEEKIHAKE+E +N+QA++KE+QEAEIK LRKSL FKATPMP
Sbjct  189   FTFRLEERAEKRKEFFSKLEEKIHAKEVERNNLQAKSKENQEAEIKQLRKSLAFKATPMP  248

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNL  1454
             +FY+E PPPKVELKKIP TRAKSPKLGR K+S    +  +E    +   SL++   + N 
Sbjct  249   SFYKE-PPPKVELKKIPTTRAKSPKLGRHKSSVSATNNPSEGDGSSVSPSLNQ---EQNF  304

Query  1455  ARRRSL-------IDVKKPQRKSLPKLPS  1520
             + RR+        +  KK  +KS PKL S
Sbjct  305   STRRTQTNGNEDNVASKKAVKKSQPKLQS  333



>tpg|DAA42159.1| TPA: hypothetical protein ZEAMMB73_567014 [Zea mays]
Length=256

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF+ KLEEKIHAKE+E++N+Q ++KESQEAEIK+LRKSL FKATPMP
Sbjct  34    FSFRLEERAEKRKEFFQKLEEKIHAKELEKTNLQEKSKESQEAEIKLLRKSLTFKATPMP  93

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             +FY+E  PPKVELKKIPPTRA+SPKLGR K
Sbjct  94    SFYKE-QPPKVELKKIPPTRARSPKLGRHK  122



>ref|XP_008387137.1| PREDICTED: neurofilament heavy polypeptide-like [Malus domestica]
 ref|XP_008387138.1| PREDICTED: neurofilament heavy polypeptide-like [Malus domestica]
Length=483

 Score =   150 bits (379),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 145/238 (61%), Gaps = 17/238 (7%)
 Frame = +3

Query  1041  PTAADTKSHR-AGTLPS------YSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQA  1199
             P   D  +H  A T PS        FSF+  ERAEKRKEF+TKLEEKI AKE E++N QA
Sbjct  233   PIKEDDDAHSVASTTPSGRRISASGFSFRLEERAEKRKEFFTKLEEKIQAKEEEKNNSQA  292

Query  1200  QTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN  1379
             ++KESQEAEIK LRKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGR K+S  +
Sbjct  293   KSKESQEAEIKRLRKSLTFKAAPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRNKSSISS  351

Query  1380  RDGKNEN-GLQTS-RLSLDEKPSQDNLARR--RSLIDVKKPQRKSLPKLPSEKTYIPSET  1547
              +  +E  G   S RL+ +   S+  L  +  + +ID KKP RKS  +LPS++    +  
Sbjct  352   LNSSSEGAGASLSPRLNQELNISKKGLKTKSEKDVIDPKKPIRKSQTRLPSQENA--ATK  409

Query  1548  KKASPIKTSISKEITEVDSQPNIVAKVTDEAED--VHASETEPKENDEADMSLVQEPI  1715
              +A P K+       E   Q     K T+EA+D   H SE + +   E  +  ++EP+
Sbjct  410   TEAKPAKSPPKGTKEETQDQKAHTGK-TEEAQDQSGHLSEFQDEIEPEVSVGQIKEPV  466



>gb|KDP36079.1| hypothetical protein JCGZ_08723 [Jatropha curcas]
Length=492

 Score =   150 bits (378),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 4/122 (3%)
 Frame = +3

Query  1038  SPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQ  1217
             S T++ T S RA       FSF+  ERAEKRKEF++KLEEKIHAKE+E+SN+QA++KE+Q
Sbjct  241   STTSSATHSRRAS---GSGFSFRLEERAEKRKEFFSKLEEKIHAKEIEKSNLQAKSKENQ  297

Query  1218  EAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNE  1397
             EAEI+ LRKSLKFKATPMP FY+E PPPKVELKKIP TR  SPKLGR K+S+ + +   E
Sbjct  298   EAEIRQLRKSLKFKATPMPNFYKE-PPPKVELKKIPTTRPISPKLGRNKSSNTSINSPAE  356

Query  1398  NG  1403
              G
Sbjct  357   GG  358



>ref|XP_002449726.1| hypothetical protein SORBIDRAFT_05g022180 [Sorghum bicolor]
 gb|EES08714.1| hypothetical protein SORBIDRAFT_05g022180 [Sorghum bicolor]
Length=429

 Score =   149 bits (375),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = +3

Query  1092  SFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPM  1271
              FSF+  ERAEKRKEF+ KLEEKIHAKE+E++N+Q ++KESQEAEIK+LRKSL FKATPM
Sbjct  208   GFSFRLEERAEKRKEFFQKLEEKIHAKELEKTNLQEKSKESQEAEIKLLRKSLTFKATPM  267

Query  1272  PTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDN  1451
             P+FY+E  PPKVELKKIPPTRA+SPKLGR K +S       +   ++ R + +     + 
Sbjct  268   PSFYKE-QPPKVELKKIPPTRARSPKLGRHKPASSATAASADGSCESPRSTANSGKVNEV  326

Query  1452  LARRRSLIDVKKPQRKSLPKLPSE  1523
             +   +  +  +KP ++ + K PS+
Sbjct  327   MENNKPRVPARKPVQRPVTKAPSQ  350



>ref|XP_008241097.1| PREDICTED: nucleolar and coiled-body phosphoprotein 1 [Prunus 
mume]
Length=483

 Score =   149 bits (377),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 141/221 (64%), Gaps = 10/221 (5%)
 Frame = +3

Query  1071  AGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSL  1250
             +G   S SF+F+ +ERAEKRKEF+ KLEEKI AKE E++N QA++KESQEAEIK LRKSL
Sbjct  250   SGRRSSGSFAFRLDERAEKRKEFFEKLEEKIQAKEAEKNNSQAKSKESQEAEIKKLRKSL  309

Query  1251  KFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG--LQTSRLS  1424
              FKA PMP+FY+E PPPKVELKKIP TRAKSPKLGR K+S  + +  +E G    + RL+
Sbjct  310   TFKAAPMPSFYKE-PPPKVELKKIPTTRAKSPKLGRNKSSISSLNNSSEGGGACLSPRLN  368

Query  1425  LDEKPSQDNLARR--RSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEV  1598
              +   S+  L  +  + ++D KKP RKS  +L S++      TK  +    S  K I E 
Sbjct  369   QELNNSKKALKTKSEKDVLDSKKPIRKSHSRLHSQENVA---TKDEAKSVKSPPKAIGEE  425

Query  1599  DSQPNIVAKVTDEAEDVHASETEPKENDEADMSL--VQEPI  1715
                       T+E +D     +E KE  E+++++  ++EPI
Sbjct  426   RKYQKTCTTETEEGQDKSGLLSECKEKIESEVNVAEIEEPI  466



>ref|XP_010505111.1| PREDICTED: protein WAVE-DAMPENED 2-like [Camelina sativa]
Length=219

 Score =   143 bits (360),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKI AKE+E++N+QA+++ESQE EIK L
Sbjct  20    RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIQAKEVEKTNLQAKSQESQEEEIKRL  79

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS
Sbjct  80    RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSS  123



>emb|CDX79632.1| BnaC03g19680D [Brassica napus]
Length=413

 Score =   147 bits (372),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKIHAKE+E++ +QA++KESQE EIK L
Sbjct  218   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIHAKEVEKTTLQAKSKESQEEEIKRL  277

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDG  1388
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS    G
Sbjct  278   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSSDATGG  326



>ref|XP_004979518.1| PREDICTED: protein WVD2-like 1-like [Setaria italica]
Length=459

 Score =   148 bits (373),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  +RAEKRKEF+ KLEEKIHAKE+E++N+Q ++KESQEAEIK+LRKSL FKATPMP
Sbjct  237   FSFRLEQRAEKRKEFFQKLEEKIHAKELEQTNLQEKSKESQEAEIKLLRKSLTFKATPMP  296

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             +FY+E  PPKVELKKIPPTRA+SPKLGR K
Sbjct  297   SFYKE-QPPKVELKKIPPTRARSPKLGRHK  325



>ref|XP_009133052.1| PREDICTED: general transcriptional corepressor trfA [Brassica 
rapa]
Length=404

 Score =   147 bits (371),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKIHAKE+E++ +QA++KESQE EIK L
Sbjct  210   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIHAKEVEKTTLQAKSKESQEEEIKRL  269

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDG  1388
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS    G
Sbjct  270   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSSDATGG  318



>ref|XP_010106961.1| hypothetical protein L484_016889 [Morus notabilis]
 gb|EXC12959.1| hypothetical protein L484_016889 [Morus notabilis]
Length=469

 Score =   148 bits (373),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 106/148 (72%), Gaps = 7/148 (5%)
 Frame = +3

Query  1086  SYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKAT  1265
             +  F+F+ +ERA KRKEF++KLEEKI AKE E++N QA++KE+QEAEIK+LRKS+ FKAT
Sbjct  261   ALGFAFRLDERAAKRKEFFSKLEEKIQAKEEEKTNQQAKSKENQEAEIKLLRKSMTFKAT  320

Query  1266  PMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQ  1445
             PMP FY+E PPPK+ELKKIP TRA SPKLGR K S+    G       T R++ ++  S 
Sbjct  321   PMPNFYRE-PPPKIELKKIPTTRAISPKLGRHKNSNSLEGG----ATLTPRVNQNQNNS-  374

Query  1446  DNLARRRSLIDVKKPQRKSLPKLPSEKT  1529
              N    + + D KKP RKS P L S++T
Sbjct  375   -NKGSEKEVTDSKKPIRKSQPMLHSQET  401



>ref|XP_006604667.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X1 [Glycine max]
 ref|XP_006604668.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X2 [Glycine max]
 gb|KHN43597.1| hypothetical protein glysoja_002180 [Glycine soja]
Length=442

 Score =   147 bits (372),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 108/150 (72%), Gaps = 7/150 (5%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF++KLEEKI AKE E++N+QA++KE+QEAEI++LRKS+ FKATPMP
Sbjct  246   FSFRLEERAEKRKEFFSKLEEKILAKEAEKTNLQAKSKENQEAEIRLLRKSMAFKATPMP  305

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNL  1454
             +FY+E PPPKVELKKIP TRAKSPKLGR K S+ N +   +      R     K  Q++ 
Sbjct  306   SFYKE-PPPKVELKKIPTTRAKSPKLGRHKESAMNNNSGEDKTCSIPR----GKQQQNDS  360

Query  1455  ARRRSLIDV--KKPQRKSLPKLPSEKTYIP  1538
              + +   D+  KKP RK+  K+ S++   P
Sbjct  361   NKVKGHKDMVSKKPIRKTQAKVKSQENVTP  390



>ref|XP_006604669.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X3 [Glycine max]
Length=441

 Score =   147 bits (372),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 108/150 (72%), Gaps = 7/150 (5%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF++KLEEKI AKE E++N+QA++KE+QEAEI++LRKS+ FKATPMP
Sbjct  245   FSFRLEERAEKRKEFFSKLEEKILAKEAEKTNLQAKSKENQEAEIRLLRKSMAFKATPMP  304

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQDNL  1454
             +FY+E PPPKVELKKIP TRAKSPKLGR K S+ N +   +      R     K  Q++ 
Sbjct  305   SFYKE-PPPKVELKKIPTTRAKSPKLGRHKESAMNNNSGEDKTCSIPR----GKQQQNDS  359

Query  1455  ARRRSLIDV--KKPQRKSLPKLPSEKTYIP  1538
              + +   D+  KKP RK+  K+ S++   P
Sbjct  360   NKVKGHKDMVSKKPIRKTQAKVKSQENVTP  389



>ref|XP_011094204.1| PREDICTED: uncharacterized protein LOC105173962 [Sesamum indicum]
Length=483

 Score =   148 bits (373),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +3

Query  1080  LPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFK  1259
             + ++SF      RAEKRKEF++K+EEKIHAKE+E+SNMQA++KE+QEAEIK LRKSL FK
Sbjct  259   VSAFSFRLXXXXRAEKRKEFFSKIEEKIHAKEVEKSNMQAKSKENQEAEIKQLRKSLTFK  318

Query  1260  ATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG  1403
             ATPMP+FY+E PPPKVE+KKIP TRA SPKLGR KT+ P      ENG
Sbjct  319   ATPMPSFYKE-PPPKVEIKKIPTTRAISPKLGRNKTTVPTAVNSIENG  365



>tpg|DAA42158.1| TPA: lymphoid organ expressed yellow head virus receptor protein 
[Zea mays]
Length=454

 Score =   147 bits (372),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF+ KLEEKIHAKE+E++N+Q ++KESQEAEIK+LRKSL FKATPMP
Sbjct  232   FSFRLEERAEKRKEFFQKLEEKIHAKELEKTNLQEKSKESQEAEIKLLRKSLTFKATPMP  291

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             +FY+E  PPKVELKKIPPTRA+SPKLGR K
Sbjct  292   SFYKE-QPPKVELKKIPPTRARSPKLGRHK  320



>emb|CDX84593.1| BnaA03g16370D [Brassica napus]
Length=409

 Score =   147 bits (370),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKIHAKE+E++ +QA++KESQE EIK L
Sbjct  215   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIHAKEVEKTTLQAKSKESQEEEIKRL  274

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDG  1388
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS    G
Sbjct  275   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSSDATGG  323



>ref|NP_001149997.1| LOC100283624 [Zea mays]
 gb|ACG37439.1| lymphoid organ expressed yellow head virus receptor protein [Zea 
mays]
Length=455

 Score =   147 bits (371),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF+ KLEEKIHAKE+E++N+Q ++KESQEAEIK+LRKSL FKATPMP
Sbjct  233   FSFRLEERAEKRKEFFQKLEEKIHAKELEKTNLQEKSKESQEAEIKLLRKSLTFKATPMP  292

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             +FY+E  PPKVELKKIPPTRA+SPKLGR K
Sbjct  293   SFYKE-QPPKVELKKIPPTRARSPKLGRHK  321



>ref|XP_006295617.1| hypothetical protein CARUB_v10024730mg [Capsella rubella]
 gb|EOA28515.1| hypothetical protein CARUB_v10024730mg [Capsella rubella]
Length=433

 Score =   147 bits (370),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKI AKE+E++N+QA++KESQE EIK L
Sbjct  234   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIQAKEVEKTNLQAKSKESQEEEIKRL  293

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS
Sbjct  294   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSS  337



>ref|NP_001140809.1| uncharacterized protein LOC100272884 [Zea mays]
 gb|ACF84680.1| unknown [Zea mays]
 gb|AFW65259.1| hypothetical protein ZEAMMB73_329657 [Zea mays]
Length=459

 Score =   147 bits (370),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 82/91 (90%), Gaps = 1/91 (1%)
 Frame = +3

Query  1092  SFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPM  1271
              FSF+  ERAEKRKEF+ KLEEKIHAKE+E++N+Q ++KESQEAEIK+LRKSL FKATPM
Sbjct  235   GFSFRLEERAEKRKEFFQKLEEKIHAKELEKTNLQEKSKESQEAEIKLLRKSLTFKATPM  294

Query  1272  PTFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             P+FY+E  PPKVELKKIPPTRA+SP+LGR K
Sbjct  295   PSFYKE-QPPKVELKKIPPTRARSPRLGRHK  324



>ref|XP_008676785.1| PREDICTED: uncharacterized protein LOC100272884 isoform X1 [Zea 
mays]
 gb|ACR36755.1| unknown [Zea mays]
Length=456

 Score =   147 bits (370),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 82/91 (90%), Gaps = 1/91 (1%)
 Frame = +3

Query  1092  SFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPM  1271
              FSF+  ERAEKRKEF+ KLEEKIHAKE+E++N+Q ++KESQEAEIK+LRKSL FKATPM
Sbjct  232   GFSFRLEERAEKRKEFFQKLEEKIHAKELEKTNLQEKSKESQEAEIKLLRKSLTFKATPM  291

Query  1272  PTFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             P+FY+E  PPKVELKKIPPTRA+SP+LGR K
Sbjct  292   PSFYKE-QPPKVELKKIPPTRARSPRLGRHK  321



>gb|EEE65987.1| hypothetical protein OsJ_21919 [Oryza sativa Japonica Group]
Length=448

 Score =   146 bits (368),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  1041  PTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQE  1220
             P     K  R G+ P+Y F+FKC+ERAEKR+EFY+KLEEKIHA+E+E+SNMQA++KE++E
Sbjct  178   PNCEKVKPQRVGSTPAYGFAFKCDERAEKRREFYSKLEEKIHAQELEKSNMQAKSKETEE  237

Query  1221  AEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKI  1322
             AE+K LRKSL F+A PMP+FY+EPPPPKVELKK+
Sbjct  238   AELKKLRKSLNFRANPMPSFYKEPPPPKVELKKL  271


 Score = 65.9 bits (159),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 73/134 (54%), Gaps = 16/134 (12%)
 Frame = +3

Query  1248  LKFKATPMPTFYQ-EPPPPKVELK-----------KIPPTRAKSPKLGRRK-TSSPNRDG  1388
             +  + TP+P   Q +P P   EL             IP TRA+SPKLGR K TSS + + 
Sbjct  311   IALQPTPLPFGVQLKPAPAPRELHTSRAPGYASQGHIPTTRARSPKLGRSKNTSSVSTEE  370

Query  1389  KNENGLQTSRLSLDEKPSQDNLARRRSLIDVKKPQRKSLPKLPSEKTY---IPSETKKAS  1559
                   + +RLSLDE+ SQ+ + +  +   V+KPQRKSLPKLPSE+T    + + T    
Sbjct  371   STVPSSRPARLSLDERASQNGVKKVPAANTVRKPQRKSLPKLPSEQTVTEQVENNTSATD  430

Query  1560  PIKTSISKEITEVD  1601
             P++  I  ++T  D
Sbjct  431   PVRELIRAQVTPDD  444



>ref|XP_002323363.2| hypothetical protein POPTR_0016s06690g [Populus trichocarpa]
 gb|EEF05124.2| hypothetical protein POPTR_0016s06690g [Populus trichocarpa]
Length=500

 Score =   146 bits (369),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF++K+EEKIHAKE+E++N+Q ++KE+QEAEIK LRKSL FKATPMP
Sbjct  267   FSFRLEERAEKRKEFFSKIEEKIHAKEIEQTNLQEKSKENQEAEIKQLRKSLTFKATPMP  326

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             +FY+E PPPK ELKKIP TRA SPKLGRRK+S+
Sbjct  327   SFYKE-PPPKAELKKIPTTRAISPKLGRRKSST  358



>ref|XP_010516794.1| PREDICTED: general transcriptional corepressor trfA-like [Camelina 
sativa]
 ref|XP_010516795.1| PREDICTED: general transcriptional corepressor trfA-like [Camelina 
sativa]
 ref|XP_010516796.1| PREDICTED: general transcriptional corepressor trfA-like [Camelina 
sativa]
Length=434

 Score =   145 bits (367),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKI AKE+E++N+QA+++ESQE EIK L
Sbjct  234   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIQAKEVEKTNLQAKSQESQEEEIKRL  293

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS
Sbjct  294   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSS  337



>ref|XP_011042551.1| PREDICTED: uncharacterized protein LOC105138210 [Populus euphratica]
 ref|XP_011042552.1| PREDICTED: uncharacterized protein LOC105138210 [Populus euphratica]
 ref|XP_011042553.1| PREDICTED: uncharacterized protein LOC105138210 [Populus euphratica]
 ref|XP_011042554.1| PREDICTED: uncharacterized protein LOC105138210 [Populus euphratica]
Length=504

 Score =   146 bits (369),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF++K+EEKIHAKE+E++N+Q ++KE+QEAEIK LRKSL FKATPMP
Sbjct  271   FSFRLEERAEKRKEFFSKIEEKIHAKEIEQTNLQEKSKENQEAEIKQLRKSLTFKATPMP  330

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             +FY+E PPPK ELKKIP TRA SPKLGRRK+S+
Sbjct  331   SFYKE-PPPKAELKKIPTTRAISPKLGRRKSST  362



>ref|XP_002524093.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38303.1| conserved hypothetical protein [Ricinus communis]
Length=484

 Score =   146 bits (368),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+ +ERAE+R+EF++KLEEKIHAKEME++N+QA+++E+QEAEIK LRKSL FKATPMP
Sbjct  255   FSFRLDERAERRREFFSKLEEKIHAKEMEKNNLQAKSQENQEAEIKQLRKSLTFKATPMP  314

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG  1403
             +FY+E PPPKVELKKIP TR  SPKLGR K  + + +G  E G
Sbjct  315   SFYKE-PPPKVELKKIPTTRPISPKLGRNKGLTASMNGSIEGG  356



>emb|CDX75079.1| BnaA05g08250D [Brassica napus]
Length=433

 Score =   145 bits (365),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKI AKE+E++ +QA++KESQE EIK L
Sbjct  229   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIQAKEVEKTTLQAKSKESQEEEIKRL  288

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG  1403
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS    G  E G
Sbjct  289   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSSDATTG-GETG  341



>ref|XP_009143624.1| PREDICTED: neurofilament heavy polypeptide-like [Brassica rapa]
Length=447

 Score =   144 bits (364),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKI AKE+E++ +QA++KESQE EIK L
Sbjct  229   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIQAKEVEKTTLQAKSKESQEEEIKRL  288

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG  1403
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS    G  E G
Sbjct  289   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSSDATTG-GETG  341



>gb|KHG09829.1| 30S ribosomal S8 [Gossypium arboreum]
Length=469

 Score =   144 bits (364),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 108/150 (72%), Gaps = 15/150 (10%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             F+F+  ERAEKRKEF +KLEEKIHAKE+E++N+QA++KE+QEAEIK LRKSL FKATPMP
Sbjct  244   FTFRLEERAEKRKEFLSKLEEKIHAKEVEKNNLQAKSKENQEAEIKQLRKSLTFKATPMP  303

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEK------  1436
              FY+E PPPKVELKKIP TRA SPKLGR K++    +  +E      R SL+++      
Sbjct  304   NFYKE-PPPKVELKKIPTTRAISPKLGRNKSNVAATNNPSEVDGSGVRPSLNQERNGSTK  362

Query  1437  -----PSQDNLARRRSLIDVKKPQRKSLPK  1511
                   +++N+A +++   VKKPQ K  PK
Sbjct  363   RTQTNGNEENVASKKT---VKKPQPKVQPK  389



>ref|XP_009362663.1| PREDICTED: uncharacterized protein LOC103952721 [Pyrus x bretschneideri]
Length=482

 Score =   145 bits (365),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 146/238 (61%), Gaps = 18/238 (8%)
 Frame = +3

Query  1041  PTAADTKSHR-AGTLPS------YSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQA  1199
             P   D  +H  A T PS        FSF+  ERAEKRKEF+TKLEEKI AKE E++N QA
Sbjct  233   PIKEDDDAHSIASTTPSGRRISASGFSFRLEERAEKRKEFFTKLEEKIQAKEEEKNNSQA  292

Query  1200  QTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN  1379
             ++KESQEAEIK LRKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGR K+S  +
Sbjct  293   KSKESQEAEIKRLRKSLTFKAAPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRNKSSISS  351

Query  1380  RDGKNEN-GLQTS-RLSLDEKPSQDNLARR--RSLIDVKKPQRKSLPKLPSEKTYIPSET  1547
              +  +E  G   S RL+ +   S+  L  +  + +ID  KP +KS  +L S++    + T
Sbjct  352   LNSSSEGAGASLSPRLNRELNNSKKGLQSKSEKDVIDPNKPIKKSQTRLHSQEN---AAT  408

Query  1548  KKASPIKTSISKEITEVDSQPNIVAKVTDEAEDVHASETEPKENDEADMSL--VQEPI  1715
             K  +    S  K I E   Q     K T+EA+D     +E K+  E ++S+  ++EP+
Sbjct  409   KTEAKPAKSPPKGIKETKDQKAHTGK-TEEAQDQSGHLSEFKDEIEPEVSVGQIKEPV  465



>emb|CDX84165.1| BnaC04g09270D [Brassica napus]
Length=445

 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKI AKE+E++ +QA++KESQE EIK L
Sbjct  225   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIQAKEVEKTTLQAKSKESQEEEIKRL  284

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDG  1388
             RKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGRRK+SS    G
Sbjct  285   RKSLTFKAGPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRRKSSSDATGG  333



>ref|XP_010509545.1| PREDICTED: general transcriptional corepressor trfA-like [Camelina 
sativa]
Length=432

 Score =   144 bits (362),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKI AKE+E++N+QA+++ESQE EIK L
Sbjct  234   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIQAKEVEKTNLQAKSQESQEEEIKRL  293

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             RKSL FKA PMP+FY+E PPPKVE KKIP TR KSPKLGRRK+SS
Sbjct  294   RKSLTFKAGPMPSFYKE-PPPKVEWKKIPTTRPKSPKLGRRKSSS  337



>gb|EPS60828.1| hypothetical protein M569_13974, partial [Genlisea aurea]
Length=194

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  1053  DTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIK  1232
             D KS R G++P+Y F+ +C+ERAEKRKEF+TKLEEKI AKE E++N+QA+TKE+ +AE+K
Sbjct  106   DVKSQRRGSIPAYEFNSRCDERAEKRKEFFTKLEEKIQAKEAEKNNLQAKTKETHDAEMK  165

Query  1233  MLRKSLKFKATPMPTFYQEPPPPKVELKK  1319
             +LRKSL FKATPMP+FYQEP PPKVEL+K
Sbjct  166   ILRKSLGFKATPMPSFYQEPIPPKVELRK  194



>ref|XP_004497628.1| PREDICTED: biorientation of chromosomes in cell division protein 
1-like 1-like [Cicer arietinum]
Length=461

 Score =   143 bits (360),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 125/198 (63%), Gaps = 16/198 (8%)
 Frame = +3

Query  1089  YSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATP  1268
             + FSF+  ERAEKR+EF++KLEEKI  KE E+SNMQ ++KE+QEAEIK LRK + FKA P
Sbjct  236   FGFSFRLEERAEKRREFFSKLEEKIQEKEAEKSNMQEKSKENQEAEIKKLRKRMTFKAAP  295

Query  1269  MPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQD  1448
             MP+FY+E PPPKVELKKIP TR KSPKLGR K S  N + +++     S  S  EK  Q+
Sbjct  296   MPSFYKE-PPPKVELKKIPTTRPKSPKLGRNKGSVVNNNSEDK-----SSSSPHEKQQQN  349

Query  1449  N-----LARRRSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQPN  1613
             +     +   + +I  KKP +K+  KL S++  +   TK       S + E++ ++    
Sbjct  350   DSFKAKVKGYKDIITSKKPIKKTQAKLQSQEIEV---TKTEISSIRSTTNEVSVINQDAK  406

Query  1614  IVAKVTDEAED--VHASE  1661
              V +  +E +D  VH SE
Sbjct  407   AVIESNEECKDTTVHISE  424



>ref|XP_004303390.1| PREDICTED: uncharacterized protein LOC101300076 [Fragaria vesca 
subsp. vesca]
Length=501

 Score =   144 bits (362),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 142/217 (65%), Gaps = 18/217 (8%)
 Frame = +3

Query  1092  SFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPM  1271
              FSF+ +ERAEKRKEF+TKLEEKI AKE E++N QA++KE+QEAEIK LRKSL F+A PM
Sbjct  262   GFSFRLDERAEKRKEFFTKLEEKIQAKEAEKNNSQAKSKENQEAEIKQLRKSLTFRAAPM  321

Query  1272  PTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENG--LQTSRLSLDEKPSQ  1445
             P+FY+E PPPK+E+KKIP TR  SPKLGR K S P+ +  +E+G    + RL+ +   S 
Sbjct  322   PSFYKE-PPPKIEIKKIPTTRPISPKLGRHKNSIPSPNSPSEDGGMCLSPRLARERNKSI  380

Query  1446  DNLARR-----RSLIDVKKPQRKSLPKLPSEKTYIPSETKKASPIKTSISKEITEVDSQP  1610
               L  +       + + KKP RKS  +L S++    +   +  P K+ I KE+++ + Q 
Sbjct  381   KGLKEKGEKDVSHVTEPKKPIRKSQHRLNSQENG--AAKAEGKPSKSQI-KEVSKEEKQ-  436

Query  1611  NIVAKVTDEAEDVHASETEPKENDEADMSLVQ--EPI  1715
             ++ A   D++ D+    +E K+  EA++S+ Q  EP+
Sbjct  437   SLKACTGDQSGDL----SECKDRIEAEVSVDQTKEPV  469



>emb|CDP10567.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   142 bits (358),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF++K+EEKIHAKE E+SN+QA++KESQEAEIK  R+SL FKATPMP
Sbjct  254   FSFRLEERAEKRKEFFSKMEEKIHAKEAEKSNLQAKSKESQEAEIKQFRRSLTFKATPMP  313

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             +FY+E PP KVELKKIP TR  SPKLGR K+S
Sbjct  314   SFYKE-PPQKVELKKIPTTRPVSPKLGRAKSS  344



>ref|XP_010677582.1| PREDICTED: protein WVD2-like 1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010677584.1| PREDICTED: protein WVD2-like 1 [Beta vulgaris subsp. vulgaris]
Length=489

 Score =   142 bits (358),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 110/173 (64%), Gaps = 20/173 (12%)
 Frame = +3

Query  1047  AADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAE  1226
             +A  KS  AG      FSF+ +ERAEKRKEF  K+EEKIHAKE E++N+Q ++KESQEAE
Sbjct  256   SASKKSSIAG------FSFRLDERAEKRKEFNMKIEEKIHAKEAEKNNLQEKSKESQEAE  309

Query  1227  IKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGL  1406
             IK LRKSL FKA PMP FY+E PPP+VE+KKIP TR KSPKLGR K+S    +G N  GL
Sbjct  310   IKQLRKSLNFKAMPMPNFYKE-PPPRVEIKKIPTTRPKSPKLGRNKSSV---EGAN-TGL  364

Query  1407  QTSRLSLDEKPSQDNLARR------RSLIDVKKPQRKSLPKL-PSEKTYIPSE  1544
             +     +   P   N+ +R      RS    K+  +KS  KL P E     SE
Sbjct  365   EGGATCVS--PRVSNMVKRVHTNGERSADSTKRSAKKSHSKLQPRESVSTRSE  415



>ref|XP_006431338.1| hypothetical protein CICLE_v10003186mg, partial [Citrus clementina]
 gb|ESR44578.1| hypothetical protein CICLE_v10003186mg, partial [Citrus clementina]
Length=363

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  1029  SSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTK  1208
             S  S TAA  ++ ++  + + + +F+C ERAEKRKEFY+KLEEK  A E E+S  +A+TK
Sbjct  183   SVASSTAASVRTVKSRIIVAAAPTFRCTERAEKRKEFYSKLEEKHQALEAEKSQSEARTK  242

Query  1209  ESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             E  EA IK LRKSL FKA+PMP+FY + PPPKVELKK+PPTRAKSPKLGRRK+ S
Sbjct  243   EETEAAIKQLRKSLTFKASPMPSFYHDGPPPKVELKKMPPTRAKSPKLGRRKSCS  297



>ref|XP_011077774.1| PREDICTED: micronuclear linker histone polyprotein-like [Sesamum 
indicum]
 ref|XP_011077775.1| PREDICTED: micronuclear linker histone polyprotein-like [Sesamum 
indicum]
Length=457

 Score =   141 bits (356),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 95/126 (75%), Gaps = 7/126 (6%)
 Frame = +3

Query  1011  SEATGQSSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESN  1190
             + +T  S+L+P A   K +  G      FS +  ERAEKRKEF++K+EEK+HAKE+E++N
Sbjct  226   THSTTSSNLTPRAQQRKMNVLG------FSSRLQERAEKRKEFFSKIEEKVHAKEVEKNN  279

Query  1191  MQAQTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTS  1370
             +QA++KE+QEAEIK LRKSL FKATPMPTFY+E PPPKVELKKIP TR  SPKLGR K +
Sbjct  280   LQAKSKENQEAEIKQLRKSLTFKATPMPTFYKE-PPPKVELKKIPTTRPISPKLGRNKGT  338

Query  1371  SPNRDG  1388
             +    G
Sbjct  339   TVENSG  344



>ref|XP_007163000.1| hypothetical protein PHAVU_001G197800g [Phaseolus vulgaris]
 gb|ESW34994.1| hypothetical protein PHAVU_001G197800g [Phaseolus vulgaris]
Length=430

 Score =   140 bits (354),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 104/147 (71%), Gaps = 8/147 (5%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF++KLEEK  AKE E++N+QA++KE+QEAEIK+LRKSL FKATPMP
Sbjct  241   FSFRLEERAEKRKEFFSKLEEKTIAKEAEKTNLQAKSKENQEAEIKLLRKSLTFKATPMP  300

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSRLSLDEKPSQ-DN  1451
              FY+E PPPKVELKKIP TR KSPKLGR K  + N    N +G   S  S   K  Q D+
Sbjct  301   NFYKE-PPPKVELKKIPTTRPKSPKLGRHKEPAVN----NNSGEDKSCSSPGGKQQQNDS  355

Query  1452  LARRRSLIDV--KKPQRKSLPKLPSEK  1526
                 +   DV  KKP +K+  KL SEK
Sbjct  356   NKGNKGHKDVISKKPIQKNQAKLKSEK  382



>gb|KDO45898.1| hypothetical protein CISIN_1g0150552mg [Citrus sinensis]
Length=398

 Score =   140 bits (353),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  1029  SSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTK  1208
             S  S TAA  ++ ++  + + + +F+C ERAEKRKEFY+KLEEK  A E E+S  +A+TK
Sbjct  203   SVASSTAASVRTVKSRIIVAAAPTFRCTERAEKRKEFYSKLEEKHQALEAEKSQSEARTK  262

Query  1209  ESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             E  EA IK LRKSL FKA+PMP+FY + PPPKVELKK+PPTRAKSPKLGRRK+ S
Sbjct  263   EETEAAIKQLRKSLTFKASPMPSFYHDGPPPKVELKKMPPTRAKSPKLGRRKSCS  317



>ref|XP_006838831.1| hypothetical protein AMTR_s00002p00263250 [Amborella trichopoda]
 gb|ERN01400.1| hypothetical protein AMTR_s00002p00263250 [Amborella trichopoda]
Length=427

 Score =   140 bits (354),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  1101  FKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTF  1280
             F+C+ERAEKRKEFY+KLEEK HA+E E+S ++A+ KE QEA +K+LRKS+ FKA+PMP+F
Sbjct  250   FRCSERAEKRKEFYSKLEEKHHAQEAEKSQVEAKCKEEQEAALKLLRKSMTFKASPMPSF  309

Query  1281  YQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRD  1385
             Y E PPPKVELKK PPTRAKSPKLGRRK+   + D
Sbjct  310   YHEGPPPKVELKKPPPTRAKSPKLGRRKSCDGHSD  344



>dbj|BAK04989.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   140 bits (352),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = +3

Query  1092  SFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPM  1271
              FSF+  ERAEKRKEF  KLEEKIHAKE+E++N+Q ++KESQEAEIK LRKSL FKA PM
Sbjct  226   GFSFRLEERAEKRKEFLKKLEEKIHAKEIEQTNLQEKSKESQEAEIKRLRKSLTFKAAPM  285

Query  1272  PTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             P+FY+E  PPKVELKKI PTRA+SPKLGR K +S
Sbjct  286   PSFYKE-QPPKVELKKIAPTRARSPKLGRHKPTS  318



>gb|KDO45899.1| hypothetical protein CISIN_1g0150552mg [Citrus sinensis]
Length=414

 Score =   140 bits (352),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  1029  SSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTK  1208
             S  S TAA  ++ ++  + + + +F+C ERAEKRKEFY+KLEEK  A E E+S  +A+TK
Sbjct  219   SVASSTAASVRTVKSRIIVAAAPTFRCTERAEKRKEFYSKLEEKHQALEAEKSQSEARTK  278

Query  1209  ESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             E  EA IK LRKSL FKA+PMP+FY + PPPKVELKK+PPTRAKSPKLGRRK+ S
Sbjct  279   EETEAAIKQLRKSLTFKASPMPSFYHDGPPPKVELKKMPPTRAKSPKLGRRKSCS  333



>ref|XP_006489531.1| PREDICTED: uncharacterized protein LOC102620677 isoform X1 [Citrus 
sinensis]
 ref|XP_006489532.1| PREDICTED: uncharacterized protein LOC102620677 isoform X2 [Citrus 
sinensis]
Length=398

 Score =   139 bits (351),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  1029  SSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTK  1208
             S  S TAA  ++ ++  + + + +F+C ERA+KRKEFY+KLEEK  A E E+S  +A+TK
Sbjct  203   SVASSTAASVRTVKSRIIVTAAPTFRCTERAQKRKEFYSKLEEKHQALEAEKSQSEARTK  262

Query  1209  ESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             E  EA IK LRKSL FKA+PMP+FY + PPPKVELKK+PPTRAKSPKLGRRK+ S
Sbjct  263   EETEAAIKQLRKSLTFKASPMPSFYHDGPPPKVELKKMPPTRAKSPKLGRRKSCS  317



>ref|XP_009348636.1| PREDICTED: uncharacterized protein LOC103940268 [Pyrus x bretschneideri]
 ref|XP_009348642.1| PREDICTED: uncharacterized protein LOC103940268 [Pyrus x bretschneideri]
Length=475

 Score =   140 bits (354),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 118/174 (68%), Gaps = 12/174 (7%)
 Frame = +3

Query  1041  PTAADTKSHR-AGTLPS------YSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQA  1199
             P   D  +H  A T PS        FSF+  ERAEKRKEF+TKLEEK  AKE E++N QA
Sbjct  232   PIKEDDDAHSVASTTPSGRRISASGFSFRLEERAEKRKEFFTKLEEKTQAKEEEKNNSQA  291

Query  1200  QTKESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN  1379
             ++KESQEAEIK LRKSL FKA PMP+FY+E PPPKVELKKIP TR KSPKLGR K+S  +
Sbjct  292   KSKESQEAEIKRLRKSLTFKAAPMPSFYKE-PPPKVELKKIPTTRPKSPKLGRNKSSISS  350

Query  1380  RDGKNE-NGLQTS-RLSLDEKPSQDNLARR--RSLIDVKKPQRKSLPKLPSEKT  1529
              +  +E  G+  S RL+ +   S+  L  +  + +ID KKP +KS  +L S++T
Sbjct  351   LNNSSEVAGVSLSPRLNRELNNSKKGLKTKSEKDVIDPKKPVKKSQTRLHSQET  404



>ref|XP_006420125.1| hypothetical protein CICLE_v10005113mg [Citrus clementina]
 ref|XP_006420126.1| hypothetical protein CICLE_v10005113mg [Citrus clementina]
 gb|ESR33365.1| hypothetical protein CICLE_v10005113mg [Citrus clementina]
 gb|ESR33366.1| hypothetical protein CICLE_v10005113mg [Citrus clementina]
Length=398

 Score =   139 bits (351),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  1029  SSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTK  1208
             S  S TAA  ++ ++  + + + +F+C ERAEKRKEFY+KLEEK  A E E++  +A+TK
Sbjct  203   SVASSTAASVRTVKSRIIVAAAPTFRCTERAEKRKEFYSKLEEKHQALEAEKNQSEARTK  262

Query  1209  ESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             E  EA IK LRKSL FKA+PMP+FY + PPPKVELKK+PPTRAKSPKLGRRK+ S
Sbjct  263   EETEAAIKQLRKSLTFKASPMPSFYHDGPPPKVELKKMPPTRAKSPKLGRRKSCS  317



>ref|XP_002517010.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45173.1| conserved hypothetical protein [Ricinus communis]
Length=391

 Score =   139 bits (350),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  1029  SSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTK  1208
             S  S TAA  ++ ++ +  + +  F+C+ERAEKRKEFY+KLEEK  A E E++  +A+TK
Sbjct  205   SVTSITAASARTTKSRSAAASAPVFRCSERAEKRKEFYSKLEEKHQALEAEKTESEARTK  264

Query  1209  ESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             E +EA+IK LRKSL FKA PMP+FY E PPPK ELKK+PPTRAKSPKLGRRK+ S
Sbjct  265   EEKEADIKQLRKSLLFKANPMPSFYHEGPPPKTELKKLPPTRAKSPKLGRRKSCS  319



>gb|EMT19041.1| hypothetical protein F775_30851 [Aegilops tauschii]
Length=461

 Score =   140 bits (352),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = +3

Query  1092  SFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPM  1271
              FSF+  ERAEKRKEF  KLEEKIHAKE+E++N+Q ++KESQEAEIK LRKSL FKA PM
Sbjct  226   GFSFRLEERAEKRKEFLKKLEEKIHAKEIEQTNLQEKSKESQEAEIKRLRKSLTFKAAPM  285

Query  1272  PTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             P+FY+E  PPKVELKKI PTRA+SPKLGR K +S
Sbjct  286   PSFYKE-QPPKVELKKIAPTRARSPKLGRHKPTS  318



>ref|XP_011030549.1| PREDICTED: uncharacterized protein LOC105129966 isoform X3 [Populus 
euphratica]
Length=393

 Score =   139 bits (349),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 8/106 (8%)
 Frame = +3

Query  1101  FKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTF  1280
             F+CNERAEKRKEFY+KLEEK  A E E++  +A+TKE +EA IK LRKSL FKA+PMP+F
Sbjct  236   FRCNERAEKRKEFYSKLEEKHLALEAEKTQSEARTKEEKEAAIKQLRKSLMFKASPMPSF  295

Query  1281  YQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             Y E PPPKVELKK+PPTRAKSPKLGRRK+ S        NG+ +S+
Sbjct  296   YHEGPPPKVELKKLPPTRAKSPKLGRRKSCS--------NGVNSSQ  333



>ref|XP_011030546.1| PREDICTED: uncharacterized protein LOC105129966 isoform X1 [Populus 
euphratica]
 ref|XP_011030547.1| PREDICTED: uncharacterized protein LOC105129966 isoform X1 [Populus 
euphratica]
Length=404

 Score =   139 bits (349),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 8/106 (8%)
 Frame = +3

Query  1101  FKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTF  1280
             F+CNERAEKRKEFY+KLEEK  A E E++  +A+TKE +EA IK LRKSL FKA+PMP+F
Sbjct  236   FRCNERAEKRKEFYSKLEEKHLALEAEKTQSEARTKEEKEAAIKQLRKSLMFKASPMPSF  295

Query  1281  YQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             Y E PPPKVELKK+PPTRAKSPKLGRRK+ S        NG+ +S+
Sbjct  296   YHEGPPPKVELKKLPPTRAKSPKLGRRKSCS--------NGVNSSQ  333



>ref|XP_006410757.1| hypothetical protein EUTSA_v10016634mg [Eutrema salsugineum]
 gb|ESQ52210.1| hypothetical protein EUTSA_v10016634mg [Eutrema salsugineum]
Length=452

 Score =   139 bits (351),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 99/152 (65%), Gaps = 20/152 (13%)
 Frame = +3

Query  1059  KSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKML  1238
             +  R+    +  FSF+  ERAEKRKEFY KLEEKIHAKE+E++ +QA++KESQE EIK L
Sbjct  235   RGRRSSVGSASGFSFRLEERAEKRKEFYMKLEEKIHAKEVEKTTLQAKSKESQEEEIKRL  294

Query  1239  RKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             RKSL FKA PMP+FY+EPPP      KIP TR KSPKLGRRK+SS    G  E G + ++
Sbjct  295   RKSLTFKAGPMPSFYKEPPP------KIPTTRPKSPKLGRRKSSSDATGG--EAGPRVTK  346

Query  1419  LSLDEKPSQDNLARRRSLIDVKKPQRKSLPKL  1514
                          +  SL  +KKP  KS PKL
Sbjct  347   ------------PKDSSLSTLKKPITKSQPKL  366



>ref|XP_009398385.1| PREDICTED: protein WVD2-like 1 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=361

 Score =   138 bits (347),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKRKEFY+KLE+K  A E E+   +A+T+E QEA +K LRKSL FKATPMP+
Sbjct  195   SFRCSERAEKRKEFYSKLEDKHQALEAEKLECEARTREEQEAALKQLRKSLNFKATPMPS  254

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKT  1367
             FY E PPPK+ELKK+PPTRAKSPKLGRRK+
Sbjct  255   FYHEGPPPKIELKKVPPTRAKSPKLGRRKS  284



>ref|XP_003575947.1| PREDICTED: E3 ubiquitin-protein ligase TRIP12 [Brachypodium distachyon]
Length=456

 Score =   139 bits (351),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 86/112 (77%), Gaps = 7/112 (6%)
 Frame = +3

Query  1029  SSLSPTAADTKSHRAGTLPSYSFSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTK  1208
             S+ S T    KS  AG      FSF+  ERAEKRKEF  KLEEKIHAKE+E++N+Q ++K
Sbjct  218   STTSSTNTQRKSAAAG------FSFRLEERAEKRKEFLKKLEEKIHAKELEQTNLQEKSK  271

Query  1209  ESQEAEIKMLRKSLKFKATPMPTFYQEPPPPKVELKKIPPTRAKSPKLGRRK  1364
             ESQEAEIK LRKSL FKA PMP+FY+E  PPKVELKKI PTRA+SPKLGR K
Sbjct  272   ESQEAEIKRLRKSLTFKAAPMPSFYKE-QPPKVELKKIAPTRARSPKLGRHK  322



>gb|EYU32521.1| hypothetical protein MIMGU_mgv1a024698mg, partial [Erythranthe 
guttata]
Length=287

 Score =   136 bits (342),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             +FK + RAE+RKEFYTKLEEK HA E E++  +A+TKE  EA IK LRKSL FKA+PMP+
Sbjct  163   TFKSSARAERRKEFYTKLEEKHHALEAEKTQYEARTKEESEAAIKQLRKSLTFKASPMPS  222

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKTSS  1373
             FY E PPPK+ELKK+PPTRAKSPKLGRRK+SS
Sbjct  223   FYNEGPPPKIELKKLPPTRAKSPKLGRRKSSS  254



>gb|ABK93119.1| unknown [Populus trichocarpa]
Length=404

 Score =   139 bits (349),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 8/106 (8%)
 Frame = +3

Query  1101  FKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTF  1280
             F+CNERAEKRKEFY+KLEEK  A E E++  +A+TKE +EA IK LRKSL FKA+PMP+F
Sbjct  236   FRCNERAEKRKEFYSKLEEKHLALEAEKTQSEARTKEEKEAAIKQLRKSLMFKASPMPSF  295

Query  1281  YQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             Y E PPPKVELKK+PPTRAKSPKLGRRK+ S        NG+ +S+
Sbjct  296   YHEGPPPKVELKKLPPTRAKSPKLGRRKSCS--------NGVNSSQ  333



>ref|XP_009398386.1| PREDICTED: protein WVD2-like 1 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=359

 Score =   137 bits (346),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  1098  SFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPT  1277
             SF+C+ERAEKRKEFY+KLE+K  A E E+   +A+T+E QEA +K LRKSL FKATPMP+
Sbjct  193   SFRCSERAEKRKEFYSKLEDKHQALEAEKLECEARTREEQEAALKQLRKSLNFKATPMPS  252

Query  1278  FYQEPPPPKVELKKIPPTRAKSPKLGRRKT  1367
             FY E PPPK+ELKK+PPTRAKSPKLGRRK+
Sbjct  253   FYHEGPPPKIELKKVPPTRAKSPKLGRRKS  282



>ref|XP_011030548.1| PREDICTED: uncharacterized protein LOC105129966 isoform X2 [Populus 
euphratica]
Length=403

 Score =   138 bits (348),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 8/106 (8%)
 Frame = +3

Query  1101  FKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTF  1280
             F+CNERAEKRKEFY+KLEEK  A E E++  +A+TKE +EA IK LRKSL FKA+PMP+F
Sbjct  235   FRCNERAEKRKEFYSKLEEKHLALEAEKTQSEARTKEEKEAAIKQLRKSLMFKASPMPSF  294

Query  1281  YQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             Y E PPPKVELKK+PPTRAKSPKLGRRK+ S        NG+ +S+
Sbjct  295   YHEGPPPKVELKKLPPTRAKSPKLGRRKSCS--------NGVNSSQ  332



>gb|AFK46777.1| unknown [Lotus japonicus]
Length=406

 Score =   138 bits (348),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF++KLEEK+ AKE E++N Q ++KE+QEAEIK LRKSL FKA PMP
Sbjct  221   FSFRLEERAEKRKEFFSKLEEKVLAKEAEKTNQQEKSKENQEAEIKKLRKSLAFKAAPMP  280

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRD  1385
             +FY+E PPPKVELKKIP TRA+SPKLGR K S+ N +
Sbjct  281   SFYKE-PPPKVELKKIPTTRARSPKLGRHKASAMNNN  316



>ref|XP_003519103.1| PREDICTED: uncharacterized protein DDB_G0284459 isoform X1 [Glycine 
max]
 ref|XP_006575273.1| PREDICTED: uncharacterized protein DDB_G0284459 isoform X2 [Glycine 
max]
 gb|KHN23220.1| hypothetical protein glysoja_046201 [Glycine soja]
Length=448

 Score =   139 bits (350),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 104/151 (69%), Gaps = 10/151 (7%)
 Frame = +3

Query  1095  FSFKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMP  1274
             FSF+  ERAEKRKEF++KLEEKI  KE E++N Q ++KE+QEAEIK LRK++ FKATPMP
Sbjct  238   FSFRLEERAEKRKEFFSKLEEKIQEKEAEKTNQQEKSKENQEAEIKQLRKTMTFKATPMP  297

Query  1275  TFYQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPN----RDGKNENGLQTSRLSLDEKPS  1442
             +FY+E PPPKVELKKIP TR KSPKLGR K S+ N    +   + +G Q    S   K  
Sbjct  298   SFYKE-PPPKVELKKIPITRPKSPKLGRHKGSAVNNSEDKSSSSPHGKQQQNDSTKAKAK  356

Query  1443  QDNLARRRSLIDVKKPQRKSLPKLPSEKTYI  1535
               N    + +I  KKP RKS  KL S+++ I
Sbjct  357   GSN----KEVIP-KKPIRKSQAKLQSQESAI  382



>ref|XP_002314647.2| hypothetical protein POPTR_0010s08670g [Populus trichocarpa]
 gb|EEF00818.2| hypothetical protein POPTR_0010s08670g [Populus trichocarpa]
Length=456

 Score =   139 bits (350),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 8/106 (8%)
 Frame = +3

Query  1101  FKCNERAEKRKEFYTKLEEKIHAKEMEESNMQAQTKESQEAEIKMLRKSLKFKATPMPTF  1280
             F+CNERAEKRKEFY+KLEEK  A E E++  +A+TKE +EA IK LRKSL FKA+PMP+F
Sbjct  288   FRCNERAEKRKEFYSKLEEKHLALEAEKTQSEARTKEEKEAAIKQLRKSLMFKASPMPSF  347

Query  1281  YQEPPPPKVELKKIPPTRAKSPKLGRRKTSSPNRDGKNENGLQTSR  1418
             Y E PPPKVELKK+PPTRAKSPKLGRRK+ S        NG+ +S+
Sbjct  348   YHEGPPPKVELKKLPPTRAKSPKLGRRKSCS--------NGVNSSQ  385



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7041065150936