BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25195_g1_i3 len=432 path=[4607:0-122 4730:123-130 4738:131-134
1391:135-431]

Length=432
                                                                      Score     E

emb|CBI24550.3|  unnamed protein product                                123   4e-31   
ref|XP_006365253.1|  PREDICTED: mitochondrial intermediate peptid...    125   2e-30   
ref|XP_009619587.1|  PREDICTED: probable mitochondrial intermedia...    124   4e-30   
ref|XP_009619584.1|  PREDICTED: probable mitochondrial intermedia...    124   5e-30   
ref|XP_011076322.1|  PREDICTED: probable mitochondrial intermedia...    123   5e-30   
ref|XP_009775959.1|  PREDICTED: probable mitochondrial intermedia...    124   5e-30   
ref|XP_009775958.1|  PREDICTED: probable mitochondrial intermedia...    124   6e-30   
ref|XP_009775957.1|  PREDICTED: probable mitochondrial intermedia...    124   6e-30   
ref|XP_011076321.1|  PREDICTED: probable mitochondrial intermedia...    123   9e-30   
ref|XP_011076320.1|  PREDICTED: probable mitochondrial intermedia...    123   1e-29   
ref|XP_002265587.1|  PREDICTED: probable mitochondrial intermedia...    123   2e-29   Vitis vinifera
ref|XP_004148134.1|  PREDICTED: mitochondrial intermediate peptid...    122   3e-29   
ref|XP_010318005.1|  PREDICTED: probable mitochondrial intermedia...    120   6e-29   
ref|XP_004234939.1|  PREDICTED: probable mitochondrial intermedia...    121   8e-29   
ref|XP_008439104.1|  PREDICTED: probable mitochondrial intermedia...    118   6e-28   
emb|CDP05312.1|  unnamed protein product                                118   1e-27   
ref|XP_008439103.1|  PREDICTED: probable mitochondrial intermedia...    118   1e-27   
ref|XP_008234377.1|  PREDICTED: probable mitochondrial intermedia...    115   8e-27   
ref|XP_004499673.1|  PREDICTED: mitochondrial intermediate peptid...    114   8e-27   
ref|XP_007220617.1|  hypothetical protein PRUPE_ppa002117mg             115   8e-27   
ref|XP_004966251.1|  PREDICTED: mitochondrial intermediate peptid...    115   9e-27   
ref|XP_003523867.2|  PREDICTED: mitochondrial intermediate peptid...    115   1e-26   
ref|XP_004499672.1|  PREDICTED: mitochondrial intermediate peptid...    115   1e-26   
ref|XP_006421723.1|  hypothetical protein CICLE_v10004402mg             115   1e-26   
ref|XP_004309061.1|  PREDICTED: mitochondrial intermediate peptid...    114   2e-26   
gb|EYU24977.1|  hypothetical protein MIMGU_mgv1a002254mg                114   2e-26   
ref|XP_006656401.1|  PREDICTED: mitochondrial intermediate peptid...    113   4e-26   
ref|XP_006656400.1|  PREDICTED: mitochondrial intermediate peptid...    113   5e-26   
ref|XP_006490084.1|  PREDICTED: mitochondrial intermediate peptid...    113   5e-26   
gb|KDO65426.1|  hypothetical protein CISIN_1g037955mg                   113   6e-26   
ref|XP_009372901.1|  PREDICTED: probable mitochondrial intermedia...    113   6e-26   
ref|XP_008784647.1|  PREDICTED: probable mitochondrial intermedia...    112   7e-26   
ref|XP_008376448.1|  PREDICTED: probable mitochondrial intermedia...    112   7e-26   
ref|XP_007148694.1|  hypothetical protein PHAVU_005G006700g             112   9e-26   
ref|XP_010276941.1|  PREDICTED: probable mitochondrial intermedia...    112   9e-26   
gb|KDP22401.1|  hypothetical protein JCGZ_26232                         112   1e-25   
ref|XP_008784645.1|  PREDICTED: probable mitochondrial intermedia...    112   1e-25   
ref|XP_008784646.1|  PREDICTED: probable mitochondrial intermedia...    112   1e-25   
gb|KHG27312.1|  Mitochondrial intermediate peptidase                    112   1e-25   
dbj|BAK06873.1|  predicted protein                                      112   2e-25   
emb|CDY38869.1|  BnaA03g13100D                                          103   2e-25   
ref|XP_009370488.1|  PREDICTED: probable mitochondrial intermedia...    111   2e-25   
ref|XP_002510927.1|  mitochondrial intermediate peptidase, putative     111   2e-25   Ricinus communis
ref|XP_003563448.1|  PREDICTED: probable mitochondrial intermedia...    110   3e-25   
gb|KEH32859.1|  intermediate peptidase                                  110   4e-25   
gb|KEH32858.1|  intermediate peptidase                                  110   4e-25   
gb|AES68514.2|  intermediate peptidase                                  110   6e-25   
gb|KEH32857.1|  intermediate peptidase                                  110   6e-25   
ref|XP_003598263.1|  Mitochondrial intermediate peptidase               110   6e-25   
ref|XP_007038427.1|  Zincin-like metalloproteases family protein        110   8e-25   
ref|XP_010442660.1|  PREDICTED: probable mitochondrial intermedia...    108   3e-24   
ref|XP_010482491.1|  PREDICTED: probable mitochondrial intermedia...    107   7e-24   
gb|KCW46284.1|  hypothetical protein EUGRSUZ_K00152                     106   7e-24   
ref|XP_010482490.1|  PREDICTED: probable mitochondrial intermedia...    107   8e-24   
ref|XP_006854483.1|  hypothetical protein AMTR_s00175p00027370          107   8e-24   
ref|XP_010919044.1|  PREDICTED: probable mitochondrial intermedia...    107   9e-24   
ref|XP_002864117.1|  predicted protein                                  107   9e-24   
ref|NP_001170634.1|  hypothetical protein                               104   1e-23   Zea mays [maize]
ref|XP_010035018.1|  PREDICTED: probable mitochondrial intermedia...    106   2e-23   
ref|NP_199967.2|  zincin-like metalloproteases family protein           106   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AFW69157.1|  hypothetical protein ZEAMMB73_824976                    104   2e-23   
gb|AFW69159.1|  hypothetical protein ZEAMMB73_824976                    103   2e-23   
ref|XP_009398461.1|  PREDICTED: probable mitochondrial intermedia...    105   2e-23   
ref|XP_006280095.1|  hypothetical protein CARUB_v10025983mg             105   2e-23   
ref|XP_009398460.1|  PREDICTED: probable mitochondrial intermedia...    105   3e-23   
ref|XP_002437475.1|  hypothetical protein SORBIDRAFT_10g027820          105   3e-23   Sorghum bicolor [broomcorn]
ref|XP_009132601.1|  PREDICTED: probable mitochondrial intermedia...    104   8e-23   
gb|KFK26756.1|  hypothetical protein AALP_AA8G289400                    103   9e-23   
ref|XP_006401966.1|  hypothetical protein EUTSA_v10012823mg             103   1e-22   
ref|XP_010443409.1|  PREDICTED: probable mitochondrial intermedia...    103   1e-22   
ref|XP_011041713.1|  PREDICTED: probable mitochondrial intermedia...    103   1e-22   
ref|XP_011041711.1|  PREDICTED: probable mitochondrial intermedia...    103   2e-22   
ref|XP_002321840.2|  peptidase M3 family protein                        103   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011041712.1|  PREDICTED: probable mitochondrial intermedia...    103   2e-22   
ref|XP_010536529.1|  PREDICTED: probable mitochondrial intermedia...    101   4e-22   
ref|XP_010536528.1|  PREDICTED: probable mitochondrial intermedia...    102   4e-22   
dbj|BAB08670.1|  unnamed protein product                                100   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb|EEC81203.1|  hypothetical protein OsI_24231                        98.6    6e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001058401.1|  Os06g0686500                                     98.6    7e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEE66241.1|  hypothetical protein OsJ_22414                        98.6    8e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010101746.1|  Mitochondrial intermediate peptidase             94.0    3e-19   
ref|XP_010672007.1|  PREDICTED: probable mitochondrial intermedia...  86.3    9e-17   
ref|XP_010672006.1|  PREDICTED: probable mitochondrial intermedia...  86.3    1e-16   
ref|XP_002976927.1|  hypothetical protein SELMODRAFT_416778           85.1    3e-16   
ref|XP_008362200.1|  PREDICTED: probable mitochondrial intermedia...  80.5    2e-15   
gb|EPS66980.1|  hypothetical protein M569_07793                       82.8    2e-15   
ref|XP_002980670.1|  hypothetical protein SELMODRAFT_420134           82.8    3e-15   
ref|XP_008341472.1|  PREDICTED: probable mitochondrial intermedia...  78.6    3e-15   
ref|XP_001768859.1|  predicted protein                                82.0    5e-15   
ref|XP_002504666.1|  predicted protein                                74.3    2e-12   Micromonas commoda
emb|CCA14361.1|  mitochondrial intermediate peptidase putative        66.6    8e-10   
ref|XP_009831972.1|  hypothetical protein, variant 2                  63.2    9e-09   
ref|XP_009831974.1|  hypothetical protein H257_07950                  63.2    1e-08   
gb|KDO35266.1|  hypothetical protein SPRG_00112                       62.8    1e-08   
ref|XP_008615771.1|  hypothetical protein SDRG_11506                  62.4    2e-08   
emb|CBJ26455.1|  Mitochondrial intermediate peptidase (N-terminal)    61.6    4e-08   
ref|XP_008866563.1|  hypothetical protein H310_04144                  61.2    5e-08   
emb|CCI47478.1|  unnamed protein product                              57.8    5e-07   
ref|XP_004336759.1|  peptidase family M3 protein                      57.0    9e-07   
gb|EFX75629.1|  hypothetical protein DAPPUDRAFT_32444                 53.9    2e-06   
ref|XP_008909033.1|  hypothetical protein, variant                    55.8    2e-06   
gb|ETO70753.1|  hypothetical protein, variant                         55.8    2e-06   
ref|XP_003081451.1|  peptidase M3 family protein / thimet oligope...  55.8    3e-06   
gb|ETP11871.1|  hypothetical protein F441_12639                       55.8    3e-06   
ref|XP_008909032.1|  hypothetical protein PPTG_14229                  55.8    3e-06   
gb|ETO70752.1|  hypothetical protein F444_12785                       55.8    3e-06   
gb|AAZ20156.1|  mitochondrial intermediate peptidase                  53.1    7e-06   Coprinellus disseminatus [Fairies Bonnets]
gb|AAZ20153.1|  mitochondrial intermediate peptidase                  53.1    7e-06   Coprinellus disseminatus [Fairies Bonnets]
gb|EFX75650.1|  hypothetical protein DAPPUDRAFT_107701                53.9    9e-06   
ref|XP_001420059.1|  predicted protein                                53.9    9e-06   Ostreococcus lucimarinus CCE9901
ref|XP_009536776.1|  hypothetical protein PHYSODRAFT_565255           53.5    1e-05   
ref|XP_009044968.1|  hypothetical protein LOTGIDRAFT_198714           53.5    1e-05   
gb|AAZ20171.1|  mitochondrial intermediate peptidase                  52.4    1e-05   Coprinellus disseminatus [Fairies Bonnets]
gb|KDR24371.1|  Mitochondrial intermediate peptidase                  53.1    2e-05   
ref|XP_002428451.1|  mitochondrial intermediate peptidase, putative   53.1    2e-05   Pediculus humanus corporis [human body lice]
gb|AAZ20150.1|  mitochondrial intermediate peptidase                  52.0    2e-05   Coprinellus disseminatus [Fairies Bonnets]
ref|XP_005648037.1|  zincin                                           52.8    2e-05   
dbj|GAA92292.1|  neurolysin                                           52.8    2e-05   
emb|CCM06153.1|  predicted protein                                    50.1    3e-05   
ref|XP_002904359.1|  mitochondrial intermediate peptidase, putative   52.4    3e-05   
emb|CDO71484.1|  hypothetical protein BN946_scf184909.g78             52.4    3e-05   
gb|AAZ20162.1|  mitochondrial intermediate peptidase                  51.2    4e-05   Coprinellus disseminatus [Fairies Bonnets]
gb|AAZ20165.1|  mitochondrial intermediate peptidase                  51.2    4e-05   Coprinellus disseminatus [Fairies Bonnets]
ref|XP_005709233.1|  mitochondrial intermediate peptidase             52.4    4e-05   
ref|XP_003064745.1|  predicted protein                                52.0    4e-05   
gb|AAZ20168.1|  mitochondrial intermediate peptidase                  50.8    5e-05   Coprinellus disseminatus [Fairies Bonnets]
ref|XP_003850224.1|  hypothetical protein MYCGRDRAFT_46264            52.0    5e-05   
gb|EUC62779.1|  metallopeptidase MepB                                 51.6    5e-05   
ref|XP_007510104.1|  predicted protein                                51.6    5e-05   
gb|KEP47998.1|  metallopeptidase MepB                                 51.6    5e-05   
gb|KDR83280.1|  hypothetical protein GALMADRAFT_239146                51.6    5e-05   
ref|XP_005827485.1|  hypothetical protein GUITHDRAFT_75461            51.6    6e-05   
gb|KDR67452.1|  hypothetical protein GALMADRAFT_273237                51.6    6e-05   
emb|CDK24765.1|  unnamed protein product                              51.6    6e-05   
gb|ELU11712.1|  hypothetical protein CAPTEDRAFT_198580                51.6    6e-05   
ref|XP_008478056.1|  PREDICTED: mitochondrial intermediate peptid...  50.8    9e-05   
emb|CEJ82713.1|  hypothetical protein VHEMI02762                      47.8    1e-04   
emb|CDI55389.1|  related to mitochondrial intermediate peptidase ...  50.4    1e-04   
sp|Q6Y5M6.1|PMIP_COPDI  RecName: Full=Mitochondrial intermediate ...  50.4    1e-04   Coprinellus disseminatus [Fairies Bonnets]
emb|CCG83405.1|  Mitochondrial intermediate peptidase                 50.4    1e-04   
sp|A8QB25.2|PMIP_MALGO  RecName: Full=Mitochondrial intermediate ...  50.1    2e-04   Malassezia globosa CBS 7966
ref|XP_001729086.1|  hypothetical protein MGL_3874                    50.1    2e-04   Malassezia globosa CBS 7966
ref|WP_017429530.1|  oligopeptidase A                                 50.1    2e-04   
ref|XP_003737717.1|  PREDICTED: mitochondrial intermediate peptid...  50.1    2e-04   
ref|XP_002475688.1|  mitochondrial intermediate peptidase             50.1    2e-04   Postia placenta Mad-698-R
ref|WP_022253038.1|  peptidyl-dipeptidase Dcp                         47.4    2e-04   
gb|KDR70896.1|  hypothetical protein GALMADRAFT_254514                49.7    2e-04   
gb|EHA23688.1|  hypothetical protein ASPNIDRAFT_180255                49.7    2e-04   
emb|CAK39271.1|  unnamed protein product                              49.7    2e-04   Aspergillus niger CBS 513.88
gb|AGS09207.1|  mitochondrial intermediate peptidase                  48.5    3e-04   
gb|ADN97178.1|  mitochondrial intermediate peptidase                  48.1    3e-04   
gb|ESA20941.1|  hypothetical protein GLOINDRAFT_319748                49.3    3e-04   
gb|AGS09319.1|  mitochondrial intermediate peptidase                  48.1    3e-04   
ref|XP_007402198.1|  hypothetical protein PHACADRAFT_265723           48.1    3e-04   
gb|EPT01518.1|  hypothetical protein FOMPIDRAFT_1029754               49.3    3e-04   
gb|AGS09401.1|  mitochondrial intermediate peptidase                  48.1    3e-04   
emb|CCO29707.1|  metallopeptidase MepB                                48.9    4e-04   
gb|AGS09237.1|  mitochondrial intermediate peptidase                  48.1    4e-04   
gb|AGS09219.1|  mitochondrial intermediate peptidase                  48.1    4e-04   
gb|ADN97190.1|  mitochondrial intermediate peptidase                  47.4    5e-04   
gb|AGS09373.1|  mitochondrial intermediate peptidase                  48.1    5e-04   
ref|XP_002498853.1|  ZYRO0G20130p                                     48.5    5e-04   Zygosaccharomyces rouxii CBS 732
gb|AGS09367.1|  mitochondrial intermediate peptidase                  48.1    5e-04   
gb|ADN97170.1|  mitochondrial intermediate peptidase                  46.2    5e-04   
dbj|GAA31501.1|  thimet oligopeptidase                                48.5    6e-04   
gb|KEP47236.1|  metallopeptidase MepB                                 48.5    6e-04   
emb|CDH57548.1|  mitochondrial intermediate peptidase                 48.5    6e-04   
emb|CDS08648.1|  hypothetical protein LRAMOSA10009                    48.5    6e-04   
ref|XP_002167738.2|  PREDICTED: mitochondrial intermediate peptid...  48.1    6e-04   
gb|ADN97174.1|  mitochondrial intermediate peptidase                  45.8    7e-04   
ref|XP_008181092.1|  PREDICTED: mitochondrial intermediate peptid...  48.1    7e-04   
ref|XP_002108409.1|  hypothetical protein TRIADDRAFT_51263            48.1    7e-04   Trichoplax adhaerens
ref|XP_001635122.1|  predicted protein                                48.1    7e-04   Nematostella vectensis
ref|XP_001950913.1|  PREDICTED: mitochondrial intermediate peptid...  48.1    8e-04   Acyrthosiphon pisum
ref|XP_007312937.1|  mitochondrial intermediate peptidase             48.1    9e-04   
ref|XP_005107554.1|  PREDICTED: mitochondrial intermediate peptid...  47.8    9e-04   
ref|XP_002491343.1|  Mitochondrial intermediate peptidase             47.8    0.001   Komagataella phaffii GS115
dbj|GAC98595.1|  mitochondrial intermediate peptidase                 47.8    0.001   
dbj|BAH22601.1|  mitochondrial intermediate peptidase                 47.8    0.001   Pholiota nameko
gb|EST05934.1|  mitochondrial intermediate peptidase                  47.8    0.001   
emb|CCA38542.1|  mitochondrial intermediate peptidase                 47.8    0.001   
emb|CCO26235.1|  mitochondrial intermediate peptidase                 47.8    0.001   



>emb|CBI24550.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS ATG+ LR KFL+HGGAKD  ++L DLVG+ I +
Sbjct  186  GYYSYLYAKCFAATIWQKLCQEDPLSLATGTALRTKFLEHGGAKDPADLLTDLVGDGILQ  245

Query  318  PAGEGVIPDVTSLCNMLELTKC  383
                G++PD+TSLC+ L+L +C
Sbjct  246  SRDGGIVPDLTSLCDELKLEEC  267



>ref|XP_006365253.1| PREDICTED: mitochondrial intermediate peptidase-like [Solanum 
tuberosum]
Length=710

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ +IW+++CQEDPLS  TGS LR KFLQHGGAKD  +ILNDL G+ I R
Sbjct  629  GYYSYLYAKCFATSIWQRMCQEDPLSLDTGSALRTKFLQHGGAKDPADILNDLAGSGIVR  688

Query  318  PAGEGVIPDVTSLCNMLELTKC  383
                G+IPD+TSLC  +EL KC
Sbjct  689  SCHGGIIPDITSLCKEMELLKC  710



>ref|XP_009619587.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Nicotiana tomentosiformis]
Length=667

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ TIW++ICQEDPLS  TG  LR KFLQHGGAKD  +ILNDLVG+ I R
Sbjct  586  GYYSYLYAKCFATTIWQRICQEDPLSLDTGLALRTKFLQHGGAKDPADILNDLVGSGIVR  645

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G+IPD+TSLC  +EL K
Sbjct  646  NCSGGIIPDITSLCEEMELKK  666



>ref|XP_009619584.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009619585.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009619586.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
Length=708

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ TIW++ICQEDPLS  TG  LR KFLQHGGAKD  +ILNDLVG+ I R
Sbjct  627  GYYSYLYAKCFATTIWQRICQEDPLSLDTGLALRTKFLQHGGAKDPADILNDLVGSGIVR  686

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G+IPD+TSLC  +EL K
Sbjct  687  NCSGGIIPDITSLCEEMELKK  707



>ref|XP_011076322.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X3 [Sesamum indicum]
Length=571

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+KI Q+DPLS A GS LR KFLQHGGAKD T ILNDLVGNS+ R
Sbjct  489  GYYSYLYAKCFAATIWQKILQQDPLSLAAGSALRSKFLQHGGAKDPTIILNDLVGNSVVR  548

Query  318  PAGEGVIPDVTSLCNMLELT  377
                G+IPD+TSL   ++L+
Sbjct  549  KQNGGIIPDITSLVEEMQLS  568



>ref|XP_009775959.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X3 [Nicotiana sylvestris]
Length=667

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ TIW++ICQEDPLS  TG  LR KFLQHGGAKD  +ILNDLVG+ I R
Sbjct  586  GYYSYLYAKCFATTIWQRICQEDPLSLDTGLALRTKFLQHGGAKDPADILNDLVGSGIIR  645

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G+IPD+TSLC  +EL K
Sbjct  646  NCSGGIIPDITSLCEEMELMK  666



>ref|XP_009775958.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Nicotiana sylvestris]
Length=708

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ TIW++ICQEDPLS  TG  LR KFLQHGGAKD  +ILNDLVG+ I R
Sbjct  627  GYYSYLYAKCFATTIWQRICQEDPLSLDTGLALRTKFLQHGGAKDPADILNDLVGSGIIR  686

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G+IPD+TSLC  +EL K
Sbjct  687  NCSGGIIPDITSLCEEMELMK  707



>ref|XP_009775957.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Nicotiana sylvestris]
Length=710

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ TIW++ICQEDPLS  TG  LR KFLQHGGAKD  +ILNDLVG+ I R
Sbjct  629  GYYSYLYAKCFATTIWQRICQEDPLSLDTGLALRTKFLQHGGAKDPADILNDLVGSGIIR  688

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G+IPD+TSLC  +EL K
Sbjct  689  NCSGGIIPDITSLCEEMELMK  709



>ref|XP_011076321.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Sesamum indicum]
Length=646

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+KI Q+DPLS A GS LR KFLQHGGAKD T ILNDLVGNS+ R
Sbjct  564  GYYSYLYAKCFAATIWQKILQQDPLSLAAGSALRSKFLQHGGAKDPTIILNDLVGNSVVR  623

Query  318  PAGEGVIPDVTSLCNMLELT  377
                G+IPD+TSL   ++L+
Sbjct  624  KQNGGIIPDITSLVEEMQLS  643



>ref|XP_011076320.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Sesamum indicum]
Length=709

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+KI Q+DPLS A GS LR KFLQHGGAKD T ILNDLVGNS+ R
Sbjct  627  GYYSYLYAKCFAATIWQKILQQDPLSLAAGSALRSKFLQHGGAKDPTIILNDLVGNSVVR  686

Query  318  PAGEGVIPDVTSLCNMLELT  377
                G+IPD+TSL   ++L+
Sbjct  687  KQNGGIIPDITSLVEEMQLS  706



>ref|XP_002265587.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Vitis vinifera]
Length=771

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS ATG+ LR KFL+HGGAKD  ++L DLVG+ I +
Sbjct  683  GYYSYLYAKCFAATIWQKLCQEDPLSLATGTALRTKFLEHGGAKDPADLLTDLVGDGILQ  742

Query  318  PAGEGVIPDVTSLCNMLELTKC  383
                G++PD+TSLC+ L+L +C
Sbjct  743  SRDGGIVPDLTSLCDELKLEEC  764



>ref|XP_004148134.1| PREDICTED: mitochondrial intermediate peptidase-like [Cucumis 
sativus]
 ref|XP_004160875.1| PREDICTED: mitochondrial intermediate peptidase-like [Cucumis 
sativus]
 gb|KGN57283.1| hypothetical protein Csa_3G176300 [Cucumis sativus]
Length=718

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYY+YLYAKCF+ATIWEK+C+EDPLS  TG+ LR KFLQHGG+K+A ++L DLVG+ I R
Sbjct  636  GYYTYLYAKCFAATIWEKLCKEDPLSRETGNALRTKFLQHGGSKEAVDLLTDLVGDGIIR  695

Query  318  PAGEGVIPDVTSLCNMLELTK  380
             +  GVIPD+TSLC  + LTK
Sbjct  696  YSEGGVIPDITSLCKEMGLTK  716



>ref|XP_010318005.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Solanum lycopersicum]
 ref|XP_010318006.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Solanum lycopersicum]
 ref|XP_010318007.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Solanum lycopersicum]
Length=568

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ +IW+++CQEDPLS  TG  LR KFLQHGGAKD  +ILNDL G+   R
Sbjct  487  GYYSYLYAKCFATSIWQRMCQEDPLSLDTGLALRTKFLQHGGAKDPADILNDLAGSGTVR  546

Query  318  PAGEGVIPDVTSLCNMLELTKC  383
                G+IPD+TSLC  +EL KC
Sbjct  547  SCHGGIIPDITSLCKEMELLKC  568



>ref|XP_004234939.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Solanum lycopersicum]
Length=710

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ +IW+++CQEDPLS  TG  LR KFLQHGGAKD  +ILNDL G+   R
Sbjct  629  GYYSYLYAKCFATSIWQRMCQEDPLSLDTGLALRTKFLQHGGAKDPADILNDLAGSGTVR  688

Query  318  PAGEGVIPDVTSLCNMLELTKC  383
                G+IPD+TSLC  +EL KC
Sbjct  689  SCHGGIIPDITSLCKEMELLKC  710



>ref|XP_008439104.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Cucumis melo]
Length=595

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYY+YLYAKCF+ATIWEK+C+EDPLS  TG+ LR KFL+HGG+K+  ++L DLVG+ I R
Sbjct  513  GYYTYLYAKCFAATIWEKLCKEDPLSRETGNALRTKFLEHGGSKEPVDLLTDLVGDGIIR  572

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                GVIPD+TSLC  + LTK
Sbjct  573  YREGGVIPDITSLCKEMGLTK  593



>emb|CDP05312.1| unnamed protein product [Coffea canephora]
Length=730

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+KIC+EDPLS A GS +R KFLQHGGAKD  +ILNDLVG  I  
Sbjct  650  GYYSYLYAKCFAATIWQKICEEDPLSLAAGSAIRHKFLQHGGAKDPGDILNDLVGKRILN  709

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD+TSL + +EL
Sbjct  710  SRYGGIVPDITSLSHEMEL  728



>ref|XP_008439103.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Cucumis melo]
Length=718

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYY+YLYAKCF+ATIWEK+C+EDPLS  TG+ LR KFL+HGG+K+  ++L DLVG+ I R
Sbjct  636  GYYTYLYAKCFAATIWEKLCKEDPLSRETGNALRTKFLEHGGSKEPVDLLTDLVGDGIIR  695

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                GVIPD+TSLC  + LTK
Sbjct  696  YREGGVIPDITSLCKEMGLTK  716



>ref|XP_008234377.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Prunus mume]
Length=714

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS  TG+ LR KFLQHGGAK+ +++L+ LVG+ I R
Sbjct  633  GYYSYLYAKCFAATIWQKLCQEDPLSLTTGTALRTKFLQHGGAKEPSHLLSGLVGDGILR  692

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G++PD++ LCN ++L K
Sbjct  693  NFNGGMVPDISCLCNEMKLEK  713



>ref|XP_004499673.1| PREDICTED: mitochondrial intermediate peptidase-like isoform 
X2 [Cicer arietinum]
Length=579

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW K+CQEDPLS  TGS LR KFLQHGGA++   ILNDLV + I R
Sbjct  490  GYYSYLYAKCFAATIWTKLCQEDPLSLTTGSALRTKFLQHGGAREPAAILNDLVPDGIYR  549

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G+IPD++SLC  ++L +
Sbjct  550  YHDGGIIPDISSLCEEMKLME  570



>ref|XP_007220617.1| hypothetical protein PRUPE_ppa002117mg [Prunus persica]
 gb|EMJ21816.1| hypothetical protein PRUPE_ppa002117mg [Prunus persica]
Length=714

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS  TG+ LR KFLQHGGAK+ +++L+ LVG+ I R
Sbjct  633  GYYSYLYAKCFAATIWQKLCQEDPLSLTTGTALRTKFLQHGGAKEPSHLLSGLVGDGILR  692

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G++PD++ LCN ++L K
Sbjct  693  NFNGGMVPDISCLCNEMKLEK  713



>ref|XP_004966251.1| PREDICTED: mitochondrial intermediate peptidase-like [Setaria 
italica]
Length=699

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ TIW++ICQEDPLS + GS +R KFLQHGG+KD +++L D  G++I R
Sbjct  621  GYYSYLYARCFATTIWQEICQEDPLSRSAGSAIREKFLQHGGSKDPSSLLKDFAGDAIIR  680

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IPD++SLC  + L
Sbjct  681  NSGAGIIPDISSLCKEIGL  699



>ref|XP_003523867.2| PREDICTED: mitochondrial intermediate peptidase-like [Glycine 
max]
 gb|KHN44776.1| Mitochondrial intermediate peptidase [Glycine soja]
Length=715

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLSP TG  LR KFLQHGGA++   +LNDL G+ I R
Sbjct  635  GYYSYLYAKCFAATIWKKLCQEDPLSPTTGFALRTKFLQHGGAREPAALLNDLAGDGIYR  694

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD++ LC+ ++L
Sbjct  695  YCDGGIMPDISCLCDEMKL  713



>ref|XP_004499672.1| PREDICTED: mitochondrial intermediate peptidase-like isoform 
X1 [Cicer arietinum]
Length=722

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW K+CQEDPLS  TGS LR KFLQHGGA++   ILNDLV + I R
Sbjct  633  GYYSYLYAKCFAATIWTKLCQEDPLSLTTGSALRTKFLQHGGAREPAAILNDLVPDGIYR  692

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G+IPD++SLC  ++L +
Sbjct  693  YHDGGIIPDISSLCEEMKLME  713



>ref|XP_006421723.1| hypothetical protein CICLE_v10004402mg [Citrus clementina]
 gb|ESR34963.1| hypothetical protein CICLE_v10004402mg [Citrus clementina]
Length=745

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS  TG+ +R KFLQHGGAK+  ++LNDLVG+ I R
Sbjct  657  GYYSYLYAKCFAATIWQKLCQEDPLSLTTGTTIRTKFLQHGGAKEPADMLNDLVGDGILR  716

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G++PD+TS  + ++L +
Sbjct  717  YCNGGIVPDITSFSDEVKLME  737



>ref|XP_004309061.1| PREDICTED: mitochondrial intermediate peptidase-like [Fragaria 
vesca subsp. vesca]
Length=706

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS  TG+ LR +FLQHGGAK+  ++LN LVG+ I R
Sbjct  624  GYYSYLYAKCFAATIWQKLCQEDPLSLTTGTALRTRFLQHGGAKEPDDLLNGLVGDGILR  683

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD+T LCN ++ 
Sbjct  684  DCNGGLVPDITCLCNEMKF  702



>gb|EYU24977.1| hypothetical protein MIMGU_mgv1a002254mg [Erythranthe guttata]
Length=695

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K C+EDPLS   GS LR KFLQ+GGAKDA  IL+DLVGNS+T+
Sbjct  615  GYYSYLYAKCFAATIWQKKCKEDPLSVEAGSALRSKFLQYGGAKDAPAILDDLVGNSVTK  674

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G++PD+T L   ++L K
Sbjct  675  NRNGGIVPDITCLGQEMKLFK  695



>ref|XP_006656401.1| PREDICTED: mitochondrial intermediate peptidase-like isoform 
X2 [Oryza brachyantha]
Length=630

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ TIW+++CQ+DPLS +TGS LR KFL++GGAKD + +L D VG+SI R
Sbjct  552  GYYSYLYARCFATTIWQEVCQDDPLSHSTGSALRDKFLKYGGAKDPSALLKDFVGDSIIR  611

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IPD++SLC  + L
Sbjct  612  NSGGGIIPDISSLCKEVGL  630



>ref|XP_006656400.1| PREDICTED: mitochondrial intermediate peptidase-like isoform 
X1 [Oryza brachyantha]
Length=655

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ TIW+++CQ+DPLS +TGS LR KFL++GGAKD + +L D VG+SI R
Sbjct  577  GYYSYLYARCFATTIWQEVCQDDPLSHSTGSALRDKFLKYGGAKDPSALLKDFVGDSIIR  636

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IPD++SLC  + L
Sbjct  637  NSGGGIIPDISSLCKEVGL  655



>ref|XP_006490084.1| PREDICTED: mitochondrial intermediate peptidase-like [Citrus 
sinensis]
Length=721

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS  TG+ LR K LQHGGAK+  ++LNDLVG+ I R
Sbjct  633  GYYSYLYAKCFAATIWQKLCQEDPLSLTTGTTLRTKILQHGGAKEPADMLNDLVGDGILR  692

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G++PD+TS  + ++L +
Sbjct  693  YCNGGIVPDITSFSDEVKLME  713



>gb|KDO65426.1| hypothetical protein CISIN_1g037955mg, partial [Citrus sinensis]
Length=733

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS  TG+ LR K LQHGGAK+  ++LNDLVG+ I R
Sbjct  645  GYYSYLYAKCFAATIWQKLCQEDPLSLTTGTTLRTKILQHGGAKEPADMLNDLVGDGILR  704

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G++PD+TS  + ++L +
Sbjct  705  YCNGGIVPDITSFSDEVKLME  725



>ref|XP_009372901.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Pyrus x bretschneideri]
Length=722

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW+K+C EDPLS  TG+ LR K LQHGGAKD  ++LN LVG+ I R
Sbjct  640  GYYSYLYARCFAATIWQKLCHEDPLSLTTGTALRTKLLQHGGAKDPADLLNGLVGDGILR  699

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD+T LC+ ++L
Sbjct  700  DCNGGIVPDITCLCDEMKL  718



>ref|XP_008784647.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X3 [Phoenix dactylifera]
 ref|XP_008778256.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X3 [Phoenix dactylifera]
Length=586

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW++IC+E PLS  TGS LR KFLQHGGAKD +++L +LVGNSI R
Sbjct  508  GYYSYLYARCFAATIWQEICREHPLSHCTGSALRTKFLQHGGAKDPSDLLKELVGNSIVR  567

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD +SL   + L
Sbjct  568  NCSHGIVPDTSSLLKEIGL  586



>ref|XP_008376448.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Malus domestica]
Length=723

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW+K+C EDPLS  TG+ LR K LQHGGAKD  ++LN LVG+ I R
Sbjct  640  GYYSYLYARCFAATIWQKLCHEDPLSLTTGTALRTKLLQHGGAKDPADLLNGLVGDGILR  699

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD+T LC+ ++L
Sbjct  700  DCNGGIVPDITCLCDEMKL  718



>ref|XP_007148694.1| hypothetical protein PHAVU_005G006700g [Phaseolus vulgaris]
 gb|ESW20688.1| hypothetical protein PHAVU_005G006700g [Phaseolus vulgaris]
Length=721

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS  TG  LR KFLQHGGA++   +L DLVG+ I R
Sbjct  633  GYYSYLYAKCFAATIWKKVCQEDPLSSTTGFALRTKFLQHGGAREPDAVLKDLVGDGIYR  692

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G++PD++ LC+ ++L +
Sbjct  693  YHDGGIMPDISCLCDEMKLVE  713



>ref|XP_010276941.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Nelumbo nucifera]
Length=722

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+A+IW+++C EDPLS ATGS LR KFLQHGGAK+ +++L +LVG+ + R
Sbjct  634  GYYSYLYAKCFAASIWKEVCSEDPLSLATGSALRTKFLQHGGAKEPSDLLKELVGDDMLR  693

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G+IP++++LC  +EL +
Sbjct  694  NYNNGIIPNISNLCEEMELME  714



>gb|KDP22401.1| hypothetical protein JCGZ_26232 [Jatropha curcas]
Length=720

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW+K+C EDPLS  TG+ LRMK LQHGGAKD + +LND+ G  I R
Sbjct  637  GYYSYLYARCFAATIWKKLCHEDPLSLTTGTALRMKVLQHGGAKDPSEMLNDIAGEGILR  696

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +  G++PD+TS  + L L
Sbjct  697  HSNGGIVPDMTSFLDELRL  715



>ref|XP_008784645.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Phoenix dactylifera]
 ref|XP_008778254.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Phoenix dactylifera]
Length=720

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW++IC+E PLS  TGS LR KFLQHGGAKD +++L +LVGNSI R
Sbjct  642  GYYSYLYARCFAATIWQEICREHPLSHCTGSALRTKFLQHGGAKDPSDLLKELVGNSIVR  701

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD +SL   + L
Sbjct  702  NCSHGIVPDTSSLLKEIGL  720



>ref|XP_008784646.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Phoenix dactylifera]
 ref|XP_008778255.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Phoenix dactylifera]
Length=688

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW++IC+E PLS  TGS LR KFLQHGGAKD +++L +LVGNSI R
Sbjct  610  GYYSYLYARCFAATIWQEICREHPLSHCTGSALRTKFLQHGGAKDPSDLLKELVGNSIVR  669

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD +SL   + L
Sbjct  670  NCSHGIVPDTSSLLKEIGL  688



>gb|KHG27312.1| Mitochondrial intermediate peptidase [Gossypium arboreum]
Length=721

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLSP TG++LR K LQ+GGAK+  ++L DLVG+ I R
Sbjct  633  GYYSYLYAKCFAATIWKKLCQEDPLSPTTGTLLRTKLLQYGGAKEPADLLTDLVGDGIIR  692

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PDVTS    ++L
Sbjct  693  YHNGGIVPDVTSCLEEMKL  711



>dbj|BAK06873.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ TIW+++CQ DPLS  TGS +R KFL+HGGAKD + +L D VG+S+ +
Sbjct  691  GYYSYLYARCFATTIWQEVCQGDPLSRNTGSAIRDKFLRHGGAKDPSALLKDFVGDSVIK  750

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G+G+IPD++SLC  + L
Sbjct  751  NSGDGIIPDISSLCKEVGL  769



>emb|CDY38869.1| BnaA03g13100D [Brassica napus]
Length=82

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSY+YAKCF++TIW+ +C+EDPLS +TG++LR KF +HGGAKD   +L DL G  I  
Sbjct  4    GYYSYIYAKCFASTIWQSVCEEDPLSLSTGTLLREKFFKHGGAKDPGELLKDLAGKEIIS  63

Query  318  PAGEGVIPDVTSLCNMLEL  374
              GEG++P  T + N L+L
Sbjct  64   VHGEGIVPATTCVLNELKL  82



>ref|XP_009370488.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Pyrus x bretschneideri]
Length=722

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW+K+C EDPLS  TG+ LR K LQHGGAKD  ++LN LVG+ I R
Sbjct  640  GYYSYLYARCFAATIWQKLCHEDPLSLTTGTALRTKLLQHGGAKDPADLLNGLVGDGILR  699

Query  318  PAGEGVIPDVTSLCNMLE  371
                G++PD+T LC+ ++
Sbjct  700  DCNGGIVPDITCLCDEMK  717



>ref|XP_002510927.1| mitochondrial intermediate peptidase, putative [Ricinus communis]
 gb|EEF51529.1| mitochondrial intermediate peptidase, putative [Ricinus communis]
Length=718

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW+K+CQEDPLS  TG+ LR K LQHGGAK+   +LNDL G  I R
Sbjct  625  GYYSYLYARCFAATIWQKLCQEDPLSLTTGTALRTKLLQHGGAKEPAEMLNDLAGEGIVR  684

Query  318  PAGEGVIPDVTSLCNMLELTK  380
                G++PD+TS  + L+L +
Sbjct  685  YCNGGIVPDMTSFLDELDLVE  705



>ref|XP_003563448.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Brachypodium distachyon]
Length=696

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ T+W+++CQ+DPLS +TGS LR KFL+ GGAKD + +L DL G+S+ R
Sbjct  618  GYYSYLYARCFATTVWQEVCQDDPLSRSTGSALRDKFLRFGGAKDPSALLKDLAGDSVIR  677

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IPD++SLC  + L
Sbjct  678  NSGGGIIPDISSLCKEIGL  696



>gb|KEH32859.1| intermediate peptidase [Medicago truncatula]
Length=547

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+C+EDPLSP  G+ LR KFLQHGGA+D   ILNDLV + I R
Sbjct  458  GYYSYLYAKCFAATIWKKVCKEDPLSPIAGNALRTKFLQHGGARDPAVILNDLVPDGIYR  517

Query  318  PAGEGVIPDVTS  353
                G+IPD++S
Sbjct  518  SYNGGIIPDISS  529



>gb|KEH32858.1| intermediate peptidase [Medicago truncatula]
Length=579

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+C+EDPLSP  G+ LR KFLQHGGA+D   ILNDLV + I R
Sbjct  490  GYYSYLYAKCFAATIWKKVCKEDPLSPIAGNALRTKFLQHGGARDPAVILNDLVPDGIYR  549

Query  318  PAGEGVIPDVTS  353
                G+IPD++S
Sbjct  550  SYNGGIIPDISS  561



>gb|AES68514.2| intermediate peptidase [Medicago truncatula]
Length=719

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+C+EDPLSP  G+ LR KFLQHGGA+D   ILNDLV + I R
Sbjct  630  GYYSYLYAKCFAATIWKKVCKEDPLSPIAGNALRTKFLQHGGARDPAVILNDLVPDGIYR  689

Query  318  PAGEGVIPDVTS  353
                G+IPD++S
Sbjct  690  SYNGGIIPDISS  701



>gb|KEH32857.1| intermediate peptidase [Medicago truncatula]
Length=687

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+C+EDPLSP  G+ LR KFLQHGGA+D   ILNDLV + I R
Sbjct  598  GYYSYLYAKCFAATIWKKVCKEDPLSPIAGNALRTKFLQHGGARDPAVILNDLVPDGIYR  657

Query  318  PAGEGVIPDVTS  353
                G+IPD++S
Sbjct  658  SYNGGIIPDISS  669



>ref|XP_003598263.1| Mitochondrial intermediate peptidase [Medicago truncatula]
Length=737

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+C+EDPLSP  G+ LR KFLQHGGA+D   ILNDLV + I R
Sbjct  648  GYYSYLYAKCFAATIWKKVCKEDPLSPIAGNALRTKFLQHGGARDPAVILNDLVPDGIYR  707

Query  318  PAGEGVIPDVTS  353
                G+IPD++S
Sbjct  708  SYNGGIIPDISS  719



>ref|XP_007038427.1| Zincin-like metalloproteases family protein [Theobroma cacao]
 gb|EOY22928.1| Zincin-like metalloproteases family protein [Theobroma cacao]
Length=725

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+C+EDPLS ATG+ LR K LQHGGAK+ T++L DLVG+ I R
Sbjct  637  GYYSYLYAKCFAATIWKKLCEEDPLSLATGTALRAKLLQHGGAKEPTDLLTDLVGDGIIR  696

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD++S    ++L
Sbjct  697  CRNGGIVPDISSYLEEVKL  715



>ref|XP_010442660.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Camelina sativa]
Length=706

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++TIW+ IC+EDPLS +TG++LR KF +HGGAKD + +L DL G  I  
Sbjct  628  GYYSYLYAKCFASTIWQSICEEDPLSLSTGTLLREKFFKHGGAKDPSELLMDLAGKKIIS  687

Query  318  PAGEGVIPDVTSLCNMLEL  374
              GEG+IP  T L N L L
Sbjct  688  IHGEGIIPATTGLLNELRL  706



>ref|XP_010482491.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Camelina sativa]
Length=706

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++TIW+ IC+EDPLS +TG++LR KF +HGGAKD   +L DL G  I  
Sbjct  628  GYYSYLYAKCFASTIWQSICEEDPLSLSTGTLLREKFFKHGGAKDPAELLTDLAGKEIIS  687

Query  318  PAGEGVIPDVTSLCNMLEL  374
              G+G+IP  T L N L L
Sbjct  688  IHGQGIIPATTGLLNELRL  706



>gb|KCW46284.1| hypothetical protein EUGRSUZ_K00152 [Eucalyptus grandis]
Length=525

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS-IT  314
            GYYSYLYAKCF+ATIW+K+CQ+DPLS  TG+ LR KFLQHGGAKD + +L DLVG + I 
Sbjct  440  GYYSYLYAKCFAATIWQKLCQDDPLSLTTGTALRTKFLQHGGAKDPSEMLKDLVGGTGIV  499

Query  315  RPAGEGVIPDVTSLCNMLEL  374
            +    G++PD  SL + + L
Sbjct  500  KNLNGGIVPDTASLADEMGL  519



>ref|XP_010482490.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Camelina sativa]
Length=716

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++TIW+ IC+EDPLS +TG++LR KF +HGGAKD   +L DL G  I  
Sbjct  638  GYYSYLYAKCFASTIWQSICEEDPLSLSTGTLLREKFFKHGGAKDPAELLTDLAGKEIIS  697

Query  318  PAGEGVIPDVTSLCNMLEL  374
              G+G+IP  T L N L L
Sbjct  698  IHGQGIIPATTGLLNELRL  716



>ref|XP_006854483.1| hypothetical protein AMTR_s00175p00027370 [Amborella trichopoda]
 gb|ERN15950.1| hypothetical protein AMTR_s00175p00027370 [Amborella trichopoda]
Length=736

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+ +C EDPLS + G  LR +FLQHGGAKD +++L D V + I +
Sbjct  651  GYYSYLYAKCFAATIWQDVCVEDPLSRSVGEALRTQFLQHGGAKDPSHLLRDFVDDGILK  710

Query  318  PAGEGVIPDVTSLCNMLEL  374
            P   G++P+ +SLC  L L
Sbjct  711  PCKGGIVPNTSSLCRELNL  729



>ref|XP_010919044.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Elaeis guineensis]
Length=720

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW++IC E PLS  TGS +R KFLQHGGAKD +++L +L GNS+ R
Sbjct  642  GYYSYLYARCFAATIWQEICCEHPLSHCTGSAIRTKFLQHGGAKDPSDLLKELAGNSVIR  701

Query  318  PAGEGVIPDVTSL  356
                G++PD +SL
Sbjct  702  NCSHGIVPDTSSL  714



>ref|XP_002864117.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40376.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=706

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++TIW+ IC+EDPLS  TG++LR KF +HGGAKD   +L DL G  I  
Sbjct  628  GYYSYLYAKCFASTIWQSICEEDPLSLNTGTLLREKFFKHGGAKDPAELLTDLAGKEIIS  687

Query  318  PAGEGVIPDVTSLCNMLEL  374
              GEG+IP  T L N L L
Sbjct  688  VHGEGIIPATTYLLNELRL  706



>ref|NP_001170634.1| hypothetical protein [Zea mays]
 gb|ACR34294.1| unknown [Zea mays]
 gb|AFW69158.1| hypothetical protein ZEAMMB73_824976 [Zea mays]
Length=415

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYY+YLYA+CF+ TIW+++CQEDPLS + GS +R KFL+ GG+KD +++L D  G+++ R
Sbjct  337  GYYTYLYARCFATTIWQEVCQEDPLSRSAGSAIRDKFLRFGGSKDPSSLLKDFAGDAVIR  396

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IP+ +SLC  + L
Sbjct  397  NSGSGIIPNASSLCKEIGL  415



>ref|XP_010035018.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Eucalyptus grandis]
Length=723

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS-IT  314
            GYYSYLYAKCF+ATIW+K+CQ+DPLS  TG+ LR KFLQHGGAKD + +L DLVG + I 
Sbjct  638  GYYSYLYAKCFAATIWQKLCQDDPLSLTTGTALRTKFLQHGGAKDPSEMLKDLVGGTGIV  697

Query  315  RPAGEGVIPDVTSLCNMLEL  374
            +    G++PD  SL + + L
Sbjct  698  KNLNGGIVPDTASLADEMGL  717



>ref|NP_199967.2| zincin-like metalloproteases family protein [Arabidopsis thaliana]
 sp|F4KDA5.1|MIPEP_ARATH RecName: Full=Probable mitochondrial intermediate peptidase, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AED96095.1| zincin-like metalloproteases family protein [Arabidopsis thaliana]
Length=706

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++TIW+ IC+EDPLS  TG++LR KF +HGGAKD   +L DL G  I  
Sbjct  628  GYYSYLYAKCFASTIWQSICEEDPLSLNTGTLLREKFFKHGGAKDPAELLTDLAGKEIIS  687

Query  318  PAGEGVIPDVTSLCNMLEL  374
              GEG++P  T L N L L
Sbjct  688  VHGEGIVPATTYLLNELRL  706



>gb|AFW69157.1| hypothetical protein ZEAMMB73_824976 [Zea mays]
Length=449

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYY+YLYA+CF+ TIW+++CQEDPLS + GS +R KFL+ GG+KD +++L D  G+++ R
Sbjct  371  GYYTYLYARCFATTIWQEVCQEDPLSRSAGSAIRDKFLRFGGSKDPSSLLKDFAGDAVIR  430

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IP+ +SLC  + L
Sbjct  431  NSGSGIIPNASSLCKEIGL  449



>gb|AFW69159.1| hypothetical protein ZEAMMB73_824976 [Zea mays]
Length=412

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYY+YLYA+CF+ TIW+++CQEDPLS + GS +R KFL+ GG+KD +++L D  G+++ R
Sbjct  334  GYYTYLYARCFATTIWQEVCQEDPLSRSAGSAIRDKFLRFGGSKDPSSLLKDFAGDAVIR  393

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IP+ +SLC  + L
Sbjct  394  NSGSGIIPNASSLCKEIGL  412



>ref|XP_009398461.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=689

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW   C EDPLSP TG+ LR KFL+HGGAKD  N+L D +G+ I  
Sbjct  612  GYYSYLYARCFAATIWWDTCHEDPLSPDTGTALREKFLKHGGAKDPLNLLKDFIGDGILS  671

Query  318  PAGEGVIPDVTSLCNMLEL  374
              G G IPD +SLC  ++L
Sbjct  672  CNG-GSIPDASSLCREMDL  689



>ref|XP_006280095.1| hypothetical protein CARUB_v10025983mg [Capsella rubella]
 gb|EOA12993.1| hypothetical protein CARUB_v10025983mg [Capsella rubella]
Length=706

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++TIW+ IC+EDPLS +TG++LR KF +HGGAKD   +L DL G  I  
Sbjct  628  GYYSYLYAKCFASTIWQSICEEDPLSLSTGTLLREKFFKHGGAKDPAELLTDLAGKEIIS  687

Query  318  PAGEGVIPDVTSLCNMLEL  374
              GEG++P  T L   L L
Sbjct  688  VHGEGIVPATTGLLKELRL  706



>ref|XP_009398460.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=717

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ATIW   C EDPLSP TG+ LR KFL+HGGAKD  N+L D +G+ I  
Sbjct  640  GYYSYLYARCFAATIWWDTCHEDPLSPDTGTALREKFLKHGGAKDPLNLLKDFIGDGILS  699

Query  318  PAGEGVIPDVTSLCNMLEL  374
              G G IPD +SLC  ++L
Sbjct  700  CNG-GSIPDASSLCREMDL  717



>ref|XP_002437475.1| hypothetical protein SORBIDRAFT_10g027820 [Sorghum bicolor]
 gb|EER88842.1| hypothetical protein SORBIDRAFT_10g027820 [Sorghum bicolor]
Length=693

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ TIW+++CQEDPLS + GS +R KFL+ GG+KD +++L D  G++I R
Sbjct  615  GYYSYLYARCFATTIWQEVCQEDPLSCSAGSAIRNKFLRFGGSKDPSSLLKDFAGDAIIR  674

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IP++ SLC  + L
Sbjct  675  NSGSGIIPNIGSLCKEIGL  693



>ref|XP_009132601.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Brassica rapa]
Length=700

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSY+YAKCF++TIW+ +C+EDPLS +TG++LR KF +HGGAKD   +L DL G  I  
Sbjct  622  GYYSYIYAKCFASTIWQSVCEEDPLSLSTGTLLREKFFKHGGAKDPGELLKDLAGKEIIS  681

Query  318  PAGEGVIPDVTSLCNMLEL  374
              GEG++P  T + N L+L
Sbjct  682  VHGEGIVPATTCVLNELKL  700



>gb|KFK26756.1| hypothetical protein AALP_AA8G289400 [Arabis alpina]
Length=708

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++TIW+ IC+EDPLS +TG++LR KF +HGGAKD   +L D+ G  I  
Sbjct  628  GYYSYLYAKCFASTIWQSICEEDPLSLSTGTLLREKFFKHGGAKDPAELLKDVAGKEIIS  687

Query  318  PAGEGVIPDVTSLCNMLEL  374
              G G+IP  T L N L L
Sbjct  688  VHGGGIIPSTTCLLNELRL  706



>ref|XP_006401966.1| hypothetical protein EUTSA_v10012823mg [Eutrema salsugineum]
 gb|ESQ43419.1| hypothetical protein EUTSA_v10012823mg [Eutrema salsugineum]
Length=703

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++TIW+ IC+EDPLS +TG++LR KF +HGGAK    +L DL G  I  
Sbjct  625  GYYSYLYAKCFASTIWQSICEEDPLSLSTGTLLREKFFKHGGAKAPAELLMDLAGKEIIS  684

Query  318  PAGEGVIPDVTSLCNMLEL  374
              GEG+IP  T L N L L
Sbjct  685  VHGEGIIPATTCLLNELRL  703



>ref|XP_010443409.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Camelina sativa]
Length=707

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++TIW+ IC+EDPLS +TG++LR KF +HGGAKD   +L DL G  I  
Sbjct  628  GYYSYLYAKCFASTIWQSICEEDPLSLSTGTLLREKFFKHGGAKDPAELLTDLAGKEIIS  687

Query  318  PAGEG-VIPDVTSLCNMLEL  374
              GEG +IP  T L N L L
Sbjct  688  IHGEGIIIPATTGLLNELRL  707



>ref|XP_011041713.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X3 [Populus euphratica]
Length=596

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS   G+ LR K LQHGG+K+   +LNDLVG  I +
Sbjct  513  GYYSYLYAKCFAATIWKKLCQEDPLSLTAGTALRTKVLQHGGSKEPAELLNDLVGEGILK  572

Query  318  PAGEGVIPDVT  350
                G++PD+T
Sbjct  573  HCDGGIVPDIT  583



>ref|XP_011041711.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Populus euphratica]
Length=726

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS   G+ LR K LQHGG+K+   +LNDLVG  I +
Sbjct  643  GYYSYLYAKCFAATIWKKLCQEDPLSLTAGTALRTKVLQHGGSKEPAELLNDLVGEGILK  702

Query  318  PAGEGVIPDVT  350
                G++PD+T
Sbjct  703  HCDGGIVPDIT  713



>ref|XP_002321840.2| peptidase M3 family protein [Populus trichocarpa]
 gb|EEF05967.2| peptidase M3 family protein [Populus trichocarpa]
Length=726

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS   G+ LR K LQHGG+K+   +LNDLVG  I +
Sbjct  643  GYYSYLYAKCFAATIWKKLCQEDPLSLTAGTALRTKVLQHGGSKEPAELLNDLVGEGILK  702

Query  318  PAGEGVIPDVT  350
                G++PD+T
Sbjct  703  HCDGGIVPDIT  713



>ref|XP_011041712.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Populus euphratica]
Length=726

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF+ATIW+K+CQEDPLS   G+ LR K LQHGG+K+   +LNDLVG  I +
Sbjct  643  GYYSYLYAKCFAATIWKKLCQEDPLSLTAGTALRTKVLQHGGSKEPAELLNDLVGEGILK  702

Query  318  PAGEGVIPDVT  350
                G++PD+T
Sbjct  703  HCDGGIVPDIT  713



>ref|XP_010536529.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Tarenaya hassleriana]
Length=596

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++T W KIC+EDPLSP+TG  LR KF +HGGAKD   +L DL G  I  
Sbjct  518  GYYSYLYAKCFASTAWRKICEEDPLSPSTGRALREKFFRHGGAKDPGELLKDLSGQDIIS  577

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD   L + L L
Sbjct  578  FRDGGIVPDTACLLDELRL  596



>ref|XP_010536528.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Tarenaya hassleriana]
Length=708

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++T W KIC+EDPLSP+TG  LR KF +HGGAKD   +L DL G  I  
Sbjct  630  GYYSYLYAKCFASTAWRKICEEDPLSPSTGRALREKFFRHGGAKDPGELLKDLSGQDIIS  689

Query  318  PAGEGVIPDVTSLCNMLEL  374
                G++PD   L + L L
Sbjct  690  FRDGGIVPDTACLLDELRL  708



>dbj|BAB08670.1| unnamed protein product [Arabidopsis thaliana]
Length=860

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYAKCF++TIW+ IC+EDPLS  TG++LR KF +HGGAKD   +L DL G  I  
Sbjct  628  GYYSYLYAKCFASTIWQSICEEDPLSLNTGTLLREKFFKHGGAKDPAELLTDLAGKEIIS  687

Query  318  PAGEGVIPDVTS  353
              GEG++P  T+
Sbjct  688  VHGEGIVPATTN  699



>gb|EEC81203.1| hypothetical protein OsI_24231 [Oryza sativa Indica Group]
Length=699

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ TIW+++CQ DPLS +TGS LR KFL+HGGAKD + +L D VG+SI  
Sbjct  621  GYYSYLYARCFATTIWQEVCQGDPLSRSTGSALRDKFLKHGGAKDPSALLKDFVGDSIII  680

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IPD++SLC  + L
Sbjct  681  NSGGGIIPDISSLCKEVGL  699



>ref|NP_001058401.1| Os06g0686500 [Oryza sativa Japonica Group]
 dbj|BAD45574.1| putative mitochondrial intermediate peptidase [Oryza sativa Japonica 
Group]
 dbj|BAD46044.1| putative mitochondrial intermediate peptidase [Oryza sativa Japonica 
Group]
 dbj|BAF20315.1| Os06g0686500 [Oryza sativa Japonica Group]
Length=707

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ TIW+++CQ DPLS +TGS LR KFL+HGGAKD + +L D VG+SI  
Sbjct  629  GYYSYLYARCFATTIWQEVCQGDPLSRSTGSALRDKFLKHGGAKDPSALLKDFVGDSIII  688

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IPD++SLC  + L
Sbjct  689  NSGGGIIPDISSLCKEVGL  707



>gb|EEE66241.1| hypothetical protein OsJ_22414 [Oryza sativa Japonica Group]
Length=761

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            GYYSYLYA+CF+ TIW+++CQ DPLS +TGS LR KFL+HGGAKD + +L D VG+SI  
Sbjct  683  GYYSYLYARCFATTIWQEVCQGDPLSRSTGSALRDKFLKHGGAKDPSALLKDFVGDSIII  742

Query  318  PAGEGVIPDVTSLCNMLEL  374
             +G G+IPD++SLC  + L
Sbjct  743  NSGGGIIPDISSLCKEVGL  761



>ref|XP_010101746.1| Mitochondrial intermediate peptidase [Morus notabilis]
 gb|EXB89501.1| Mitochondrial intermediate peptidase [Morus notabilis]
Length=717

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +3

Query  156  YAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRPAGEGV  335
            Y+KCF+A+IW+K+C+EDPLS +TG  LR KFLQHGGA++  ++L  LVG+ + R    G+
Sbjct  644  YSKCFAASIWQKVCKEDPLSLSTGEALRTKFLQHGGAREPADLLKGLVGDGVLRYCDGGI  703

Query  336  IPDVTSLCNMLEL  374
            +PD+TSLC+ ++L
Sbjct  704  VPDITSLCDEMKL  716



>ref|XP_010672007.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=572

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +3

Query  156  YAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRPAGEGV  335
            YAKC +ATIW+ +C+EDPLS  TG+ LR +FLQHGGA +   +LNDL+G+   R +  GV
Sbjct  499  YAKCLAATIWKNVCEEDPLSLETGAALRTRFLQHGGAVEPVELLNDLIGSDSIRYSNGGV  558

Query  336  IPDVTSLCNMLEL  374
            IPD+ +L   ++L
Sbjct  559  IPDIRALSEEMKL  571



>ref|XP_010672006.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=708

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +3

Query  156  YAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRPAGEGV  335
            YAKC +ATIW+ +C+EDPLS  TG+ LR +FLQHGGA +   +LNDL+G+   R +  GV
Sbjct  635  YAKCLAATIWKNVCEEDPLSLETGAALRTRFLQHGGAVEPVELLNDLIGSDSIRYSNGGV  694

Query  336  IPDVTSLCNMLEL  374
            IPD+ +L   ++L
Sbjct  695  IPDIRALSEEMKL  707



>ref|XP_002976927.1| hypothetical protein SELMODRAFT_416778 [Selaginella moellendorffii]
 gb|EFJ22037.1| hypothetical protein SELMODRAFT_416778 [Selaginella moellendorffii]
Length=724

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS--I  311
            GYYSYLYA+C +A+IW+K+C E+PLS  TG  LR   LQHGGAK+  +IL D +G    I
Sbjct  645  GYYSYLYARCIAASIWQKVCAENPLSLETGQTLRRGILQHGGAKEPADILRDCLGQDSLI  704

Query  312  TRPAGEGVIPDVTSLCNML  368
            T P+G GV P V  L + L
Sbjct  705  TAPSG-GVRPCVKQLLSDL  722



>ref|XP_008362200.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Malus domestica]
Length=294

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 57/82 (70%), Gaps = 8/82 (10%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS---  308
            G YSYLYAKCF+ATIW K+C+EDPLS ATGS LR+K LQ+GGAK+A ++LN LVG     
Sbjct  199  GXYSYLYAKCFAATIWLKLCEEDPLSLATGSALRLKLLQYGGAKEAADLLNGLVGGGGGG  258

Query  309  ----ITRPA-GEGVIPDVTSLC  359
                I R   G G +P  T LC
Sbjct  259  DGGIIVRDCDGGGKVPXTTCLC  280



>gb|EPS66980.1| hypothetical protein M569_07793, partial [Genlisea aurea]
Length=652

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDL  296
            GYYSYLYAKCF+ATIW+    EDPLSP+ GS LR K LQHGGAKD   +LNDL
Sbjct  600  GYYSYLYAKCFAATIWKAKFCEDPLSPSAGSALRSKLLQHGGAKDPDVMLNDL  652



>ref|XP_002980670.1| hypothetical protein SELMODRAFT_420134 [Selaginella moellendorffii]
 gb|EFJ18321.1| hypothetical protein SELMODRAFT_420134 [Selaginella moellendorffii]
Length=724

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 3/79 (4%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS--I  311
            GYYSYLYA+C +A+IW+K+C  +PLS  TG  LR   LQHGGAK+  +IL D +G    I
Sbjct  645  GYYSYLYARCIAASIWQKVCAANPLSLETGQTLRRGILQHGGAKEPADILRDCLGQDSLI  704

Query  312  TRPAGEGVIPDVTSLCNML  368
            T P+G GV P V  L + L
Sbjct  705  TAPSG-GVRPCVKQLLSDL  722



>ref|XP_008341472.1| PREDICTED: probable mitochondrial intermediate peptidase, mitochondrial 
[Malus domestica]
Length=164

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 7/84 (8%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            G YSYLYAKCF+ATIW K+C+EDPLS ATGS LR+K LQ+GGAK+A ++LN LVG     
Sbjct  70   GXYSYLYAKCFAATIWLKLCEEDPLSLATGSALRLKLLQYGGAKEAADLLNGLVGGGGGD  129

Query  318  PA-------GEGVIPDVTSLCNML  368
                     G G +P  T LC  +
Sbjct  130  GGIIVRDCDGGGKVPXTTCLCTEM  153



>ref|XP_001768859.1| predicted protein [Physcomitrella patens]
 gb|EDQ66412.1| predicted protein [Physcomitrella patens]
Length=686

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 7/82 (9%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSI--  311
            GYYSYLYA+CF+A+IW+K C EDPL+ ATG  LR  FL HGGA+D + ++  L+G     
Sbjct  604  GYYSYLYARCFAASIWQKHCIEDPLNLATGDSLRRGFLMHGGARDPSKMMRKLLGEDSLI  663

Query  312  -----TRPAGEGVIPDVTSLCN  362
                  RP  E ++ D+  + N
Sbjct  664  CTAAGVRPCTEQLLADIGLVAN  685



>ref|XP_002504666.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65924.1| predicted protein [Micromonas sp. RCC299]
Length=697

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +3

Query  132  STGYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSI  311
            ++ YYSY YAKC +A +W K  +EDPL+P  G  LR   L+HGGA++   IL D++G+  
Sbjct  615  ASTYYSYPYAKCVAADLWGKFFREDPLAPGAGEALREGMLRHGGAREPGAILRDMLGDGA  674

Query  312  TRPAGEGVIPDVTSL  356
                  G  PD TS+
Sbjct  675  LMTDPVGAAPDPTSM  689



>emb|CCA14361.1| mitochondrial intermediate peptidase putative [Albugo laibachii 
Nc14]
Length=720

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGN  305
            GYYSYLYAK F++TIW+ +   +PLS   G ++  K + HGGAKD   +LN+L+G+
Sbjct  649  GYYSYLYAKMFASTIWQTVFAHNPLSRDAGDLIMNKMMVHGGAKDPMVMLNELIGD  704



>ref|XP_009831972.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 gb|ETV78393.1| hypothetical protein, variant 2 [Aphanomyces astaci]
Length=637

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            GYYSYLYA+ F+A +W+     DP +P  G VL  + L+HGGAKD  ++L +++G   T
Sbjct  566  GYYSYLYARVFAADVWQHCFAADPWNPKAGQVLYDEVLRHGGAKDPMDMLVNVLGRRPT  624



>ref|XP_009831974.1| hypothetical protein H257_07950 [Aphanomyces astaci]
 gb|ETV78391.1| hypothetical protein H257_07950 [Aphanomyces astaci]
Length=711

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            GYYSYLYA+ F+A +W+     DP +P  G VL  + L+HGGAKD  ++L +++G   T
Sbjct  640  GYYSYLYARVFAADVWQHCFAADPWNPKAGQVLYDEVLRHGGAKDPMDMLVNVLGRRPT  698



>gb|KDO35266.1| hypothetical protein SPRG_00112 [Saprolegnia parasitica CBS 223.65]
Length=699

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            GYYSYLYA+ F+A IW     EDP  PA+G ++  +  +HGGAK+   +L  +VG + T
Sbjct  631  GYYSYLYARVFAAEIWGACFAEDPWRPASGRLVYEELFRHGGAKEPLAMLTSIVGKTPT  689



>ref|XP_008615771.1| hypothetical protein SDRG_11506 [Saprolegnia diclina VS20]
 gb|EQC30747.1| hypothetical protein SDRG_11506 [Saprolegnia diclina VS20]
Length=684

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            GYYSYLYA+ F+A IW     EDP  PA+G ++  +  +HGGAK+   +L  +VG + T
Sbjct  616  GYYSYLYARVFAAEIWGACFAEDPWRPASGRLVYDELFRHGGAKEPLAMLTSIVGKTPT  674



>emb|CBJ26455.1| Mitochondrial intermediate peptidase (N-terminal) [Ectocarpus 
siliculosus]
Length=815

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRP  320
            YY+YLYAK F++ IWE+   +DPL+   G +L  + L HGGAKD   +L  L+G      
Sbjct  735  YYAYLYAKMFTSAIWERHFAKDPLNSDAGELLWKELLIHGGAKDPHEMLRVLLGEEQGSG  794

Query  321  AGEGVIPDVTSL  356
               G+   VTSL
Sbjct  795  GDAGLRAGVTSL  806



>ref|XP_008866563.1| hypothetical protein H310_04144 [Aphanomyces invadans]
 gb|ETW05125.1| hypothetical protein H310_04144 [Aphanomyces invadans]
Length=681

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            GYYSYLYA+ F+A +W+     DP +P  G VL  + L+HGGAK   ++L +++G   T
Sbjct  610  GYYSYLYARVFAADVWQHCFAADPWNPKAGQVLYEEVLRHGGAKKPMDMLVNVLGREPT  668



>emb|CCI47478.1| unnamed protein product [Albugo candida]
Length=644

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGN  305
            GYYSYLYAK F+++IW+ +   + LS   G ++  K + HGGAKD   +L++++G 
Sbjct  573  GYYSYLYAKMFASSIWQSVFAHNSLSRDAGELIINKMMVHGGAKDPMIMLHEIIGE  628



>ref|XP_004336759.1| peptidase family M3 protein, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR14746.1| peptidase family M3 protein, partial [Acanthamoeba castellanii 
str. Neff]
Length=652

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            GYYSYL+ + FSA IW +  + DPL+   G   R + L++GGAKD   ++  L+G
Sbjct  580  GYYSYLFCRVFSANIWHRCFEHDPLNRQLGERYRAEILRYGGAKDPHEMMRALLG  634



>gb|EFX75629.1| hypothetical protein DAPPUDRAFT_32444 [Daphnia pulex]
Length=182

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGN  305
            YYSYL ++  +A IW++  QEDP S   G   R  FL HGG+K A +++   +G 
Sbjct  128  YYSYLLSRGVAAWIWQQNFQEDPFSREAGESFRHGFLAHGGSKPARDMVTSFLGK  182



>ref|XP_008909033.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI42147.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK82166.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL35570.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL88802.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM42046.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN05511.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETP11872.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
 gb|ETP40009.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=550

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEK--ICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSYLYA+ F+A IW    +  + PL+   G  L  K + HGGAKD  ++L D++G  
Sbjct  480  GYYSYLYARVFAADIWHTNFLGSQGPLNREAGDKLYQKLMGHGGAKDPNDLLVDMLGRE  538



>gb|ETO70753.1| hypothetical protein, variant [Phytophthora parasitica P1976]
Length=550

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEK--ICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSYLYA+ F+A IW    +  + PL+   G  L  K + HGGAKD  ++L D++G  
Sbjct  480  GYYSYLYARVFAADIWHTNFLGSQGPLNREAGDKLYQKLMGHGGAKDPNDLLVDMLGRE  538



>ref|XP_003081451.1| peptidase M3 family protein / thimet oligopeptidase family protein 
(ISS) [Ostreococcus tauri]
 emb|CAL55973.1| Metallopeptidase, catalytic domain [Ostreococcus tauri]
Length=710

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRP  320
            YYSYLYA   +  IW++    D L+   G  LR K L+HGG+KD   ++ +++G      
Sbjct  642  YYSYLYADVLANDIWQRYFVSDSLASGAGETLRDKLLRHGGSKDPEKLVREVLGKDSLVE  701

Query  321  AGEGVIP  341
             G G  P
Sbjct  702  VGGGFRP  708



>gb|ETP11871.1| hypothetical protein F441_12639 [Phytophthora parasitica CJ01A1]
Length=704

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEK--ICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSYLYA+ F+A IW    +  + PL+   G  L  K + HGGAKD  ++L D++G  
Sbjct  634  GYYSYLYARVFAADIWHTNFLGSQGPLNREAGDKLYQKLMGHGGAKDPNDLLVDMLGRE  692



>ref|XP_008909032.1| hypothetical protein PPTG_14229 [Phytophthora parasitica INRA-310]
 gb|ETI42146.1| hypothetical protein F443_12678 [Phytophthora parasitica P1569]
 gb|ETK82165.1| hypothetical protein L915_12400 [Phytophthora parasitica]
 gb|ETL35569.1| hypothetical protein L916_12311 [Phytophthora parasitica]
 gb|ETL88801.1| hypothetical protein L917_12152 [Phytophthora parasitica]
 gb|ETM42045.1| hypothetical protein L914_12234 [Phytophthora parasitica]
 gb|ETN05510.1| hypothetical protein PPTG_14229 [Phytophthora parasitica INRA-310]
 gb|ETP40008.1| hypothetical protein F442_12588 [Phytophthora parasitica P10297]
Length=704

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEK--ICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSYLYA+ F+A IW    +  + PL+   G  L  K + HGGAKD  ++L D++G  
Sbjct  634  GYYSYLYARVFAADIWHTNFLGSQGPLNREAGDKLYQKLMGHGGAKDPNDLLVDMLGRE  692



>gb|ETO70752.1| hypothetical protein F444_12785 [Phytophthora parasitica P1976]
Length=704

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEK--ICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSYLYA+ F+A IW    +  + PL+   G  L  K + HGGAKD  ++L D++G  
Sbjct  634  GYYSYLYARVFAADIWHTNFLGSQGPLNREAGDKLYQKLMGHGGAKDPNDLLVDMLGRE  692



>gb|AAZ20156.1| mitochondrial intermediate peptidase [Coprinellus disseminatus]
Length=245

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+  E+PL  ++G  LR + L HGGA+D  ++++ LV
Sbjct  162  YYSYLFDRAIASRVWSKVFAENPLDRSSGERLRGEVLMHGGARDPWHMVSALV  214



>gb|AAZ20153.1| mitochondrial intermediate peptidase [Coprinellus disseminatus]
 gb|AAZ20159.1| mitochondrial intermediate peptidase [Coprinellus disseminatus]
Length=245

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+  E+PL  ++G  LR + L HGGA+D  ++++ LV
Sbjct  162  YYSYLFDRAIASRVWSKVFAENPLDRSSGERLRGEVLMHGGARDPWHMVSALV  214



>gb|EFX75650.1| hypothetical protein DAPPUDRAFT_107701 [Daphnia pulex]
Length=654

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            YYSYL ++  +A IW++  QEDP S   G   R  FL HGG+K A +++   +G  + 
Sbjct  571  YYSYLLSRGVAAWIWQQNFQEDPFSREAGESFRHGFLAHGGSKPARDMVTSFLGKEVN  628



>ref|XP_001420059.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98352.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=657

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            YYSYLYA   +  IW++  + D L+      LR K L+HGG++D   ++ DL+G
Sbjct  595  YYSYLYADVLADDIWKRYFEGDSLAAGAAESLRDKLLRHGGSRDPEKVIRDLLG  648



>ref|XP_009536776.1| hypothetical protein PHYSODRAFT_565255 [Phytophthora sojae]
 gb|EGZ07210.1| hypothetical protein PHYSODRAFT_565255 [Phytophthora sojae]
Length=704

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEK--ICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSYLYA+ F+A IW       + PL+ A G  L  K + HGGAKD  ++L +++G  
Sbjct  634  GYYSYLYARVFAADIWHTNFAGPKGPLNRAAGEKLYQKLMVHGGAKDPNDLLVEMLGRE  692



>ref|XP_009044968.1| hypothetical protein LOTGIDRAFT_198714 [Lottia gigantea]
 gb|ESP04365.1| hypothetical protein LOTGIDRAFT_198714 [Lottia gigantea]
Length=686

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT-R  317
            YYSYL +K  ++TIW K  ++DPL+ + G   R  FL HGG + + +++  ++  + T  
Sbjct  615  YYSYLLSKAIASTIWNKYFEKDPLNRSMGEKFRYNFLAHGGGQPSKDLVQGMLNETPTIE  674

Query  318  PAGEGVIPDVT  350
               + ++PD T
Sbjct  675  TLVDSLVPDKT  685



>gb|AAZ20171.1| mitochondrial intermediate peptidase [Coprinellus disseminatus]
Length=245

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+  E+PL  + G  LR + L HGGA+D  ++++ LV
Sbjct  162  YYSYLFDRAIASRVWSKVFAENPLDRSRGERLRGEVLMHGGARDPWHMVSALV  214



>gb|KDR24371.1| Mitochondrial intermediate peptidase [Zootermopsis nevadensis]
Length=698

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (56%), Gaps = 6/79 (8%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRP  320
            YYSYL ++  +A IW+   + DPL+ ++G   R + L HGG K A  ++ D +G  +T P
Sbjct  617  YYSYLLSRAVAAWIWQMYFEADPLNSSSGEQYRQECLAHGGGKPARELVADFLGREVT-P  675

Query  321  AGEGVIPDVTSLCNMLELT  377
            A         SL N +++T
Sbjct  676  ANLA-----NSLINEIDIT  689



>ref|XP_002428451.1| mitochondrial intermediate peptidase, putative [Pediculus humanus 
corporis]
 gb|EEB15713.1| mitochondrial intermediate peptidase, putative [Pediculus humanus 
corporis]
Length=699

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            YYSYL +   +++IW+   +E+P S   G   R K L+HGG K A  ++ND +   IT
Sbjct  617  YYSYLLSTSIASSIWQNYFKENPFSREQGEKYRQKCLKHGGGKPARQMINDFLKEDIT  674



>gb|AAZ20150.1| mitochondrial intermediate peptidase [Coprinellus disseminatus]
Length=245

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+  E+PL  + G  LR + L HGGAKD  ++++ L+
Sbjct  162  YYSYLFDRAIASRVWSKVFAENPLDRSRGERLRGEVLMHGGAKDPWHMVSALM  214



>ref|XP_005648037.1| zincin [Coccomyxa subellipsoidea C-169]
 gb|EIE23493.1| zincin [Coccomyxa subellipsoidea C-169]
Length=661

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRP  320
            YYSYLYA+  S+ IW++      ++ ++G  +R   LQ G A++  + ++ ++G+S   P
Sbjct  583  YYSYLYAQALSSAIWQQHFANGQINRSSGDHIRRTMLQCGSAREPAHYVHGMLGDSHLVP  642

Query  321  AGEGVIPDVTSLCNMLEL  374
               G  P+++SL   L L
Sbjct  643  VNGGFKPEISSLLKDLGL  660



>dbj|GAA92292.1| neurolysin [Aspergillus kawachii IFO 4308]
Length=690

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/73 (33%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +3

Query  129  KSTGYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            +   Y+SYLY +  +A IW    ++DP+S   G   R   L HGG++D   +L + +G S
Sbjct  616  QEANYFSYLYTRTLAADIWTSNFRDDPMSAEAGLRYRRMILAHGGSRDELEMLREFLGRS  675

Query  309  ITRPAGEGVIPDV  347
               P+ E  + D+
Sbjct  676  ---PSPEAYLGDL  685



>emb|CCM06153.1| predicted protein [Fibroporia radiculosa]
Length=163

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGN  305
            GYY YLY+  F++ ++  + ++DPL PA G+  R   L+ GG++D    L + +G 
Sbjct  89   GYYGYLYSLVFASDMYATVFKQDPLDPARGAKYRAAILRPGGSRDDDESLKEFLGR  144



>ref|XP_002904359.1| mitochondrial intermediate peptidase, putative [Phytophthora 
infestans T30-4]
 gb|EEY54537.1| mitochondrial intermediate peptidase, putative [Phytophthora 
infestans T30-4]
Length=704

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 2/59 (3%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQ--EDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSYLYA+ F+A IW    +    PL+   G  L  K + HGGAKD   +L D++G  
Sbjct  634  GYYSYLYARVFAADIWHTNFKGSPGPLNREAGEKLYQKLMIHGGAKDPNGLLVDMLGRE  692



>emb|CDO71484.1| hypothetical protein BN946_scf184909.g78 [Trametes cinnabarina]
Length=641

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/69 (32%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = +3

Query  132  STGYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSI  311
            + GYY Y Y+  F+A ++  + ++DP+ PA G   R   L+ G +KD  ++L D +G   
Sbjct  567  NVGYYGYFYSDVFAADMYATVFKDDPVDPARGRRYRENILRPGSSKDEMDLLKDFLGR--  624

Query  312  TRPAGEGVI  338
              P+ E  +
Sbjct  625  -EPSSEAFV  632



>gb|AAZ20162.1| mitochondrial intermediate peptidase [Coprinellus disseminatus]
Length=245

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+  E+PL  + G  LR + L HGGA+D  ++++ L+
Sbjct  162  YYSYLFDRAIASRVWSKVFAENPLDRSRGERLRGEVLMHGGARDPWHMVSALM  214



>gb|AAZ20165.1| mitochondrial intermediate peptidase [Coprinellus disseminatus]
Length=245

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+  E+PL  + G  LR + L HGGA+D  ++++ L+
Sbjct  162  YYSYLFDRAIASRVWSKVFAENPLDRSRGERLRGEVLMHGGARDPWHMVSALM  214



>ref|XP_005709233.1| mitochondrial intermediate peptidase [Galdieria sulphuraria]
 gb|EME32713.1| mitochondrial intermediate peptidase [Galdieria sulphuraria]
Length=706

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSI  311
            YYSYL AK  ++ IW+++  ++PLS  +G +L+ K L  GG+K    IL  ++ N +
Sbjct  622  YYSYLVAKVLASKIWQRLFSDNPLSKESGKLLQEKVLMVGGSKSPQEILESILDNDM  678



>ref|XP_003064745.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51079.1| predicted protein [Micromonas pusilla CCMP1545]
Length=746

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +3

Query  132  STGYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            ++ YYSY+YA+C +AT+W +  + D L+   G  LR   L+HGGA +   +L   VG S
Sbjct  657  ASTYYSYVYARCVAATVWGRFFEGDALARGAGESLRDGLLRHGGAVEPVEMLR-CVGRS  714



>gb|AAZ20168.1| mitochondrial intermediate peptidase [Coprinellus disseminatus]
Length=245

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+  E+PL  + G  LR + L HGGA+D  ++++ L+
Sbjct  162  YYSYLFDRAIASRVWSKVFAENPLDRSGGERLRGEVLMHGGARDPWHMVSALM  214



>ref|XP_003850224.1| hypothetical protein MYCGRDRAFT_46264 [Zymoseptoria tritici IPO323]
 gb|EGP85200.1| hypothetical protein MYCGRDRAFT_46264 [Zymoseptoria tritici IPO323]
Length=770

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +3

Query  132  STGYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSI  311
            S GYYSY+++K  +A ++E   ++DP+S   G   R   LQ GG++DA  ++ + +G   
Sbjct  696  SAGYYSYIFSKVLAADMFESTFRQDPMSRWEGRRYRYTILQPGGSRDAMEMVREFLG---  752

Query  312  TRPAGEGVIPDVTSLCNMLEL  374
             R  G G       +C+  EL
Sbjct  753  -REPGSGAFD--LRICSNTEL  770



>gb|EUC62779.1| metallopeptidase MepB [Rhizoctonia solani AG-3 Rhs1AP]
Length=596

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSY Y+  F+A +++ + +  PL PA G + R K L+ GG++D  + L D +G  
Sbjct  524  GYYSYAYSLVFAADMYKTVFKGAPLDPARGKLYREKILRPGGSRDEIDSLKDFLGRE  580



>ref|XP_007510104.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18449.1| predicted protein [Bathycoccus prasinos]
Length=746

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +3

Query  159  AKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG-NSITRPAGEGV  335
            AKC SA IW++    D +     ++LR K L++GG++D  +IL +++G N++ +    GV
Sbjct  672  AKCLSAKIWQQEFTNDKIGQGGCTILRDKMLKYGGSRDPAHILENVLGPNTLEKSFDGGV  731

Query  336  IPDVTSLCNMLELTK  380
             P+ + L    +L K
Sbjct  732  YPNSSHLLKEFDLAK  746



>gb|KEP47998.1| metallopeptidase MepB [Rhizoctonia solani 123E]
Length=720

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSY Y+  F+A +++ + +  PL PA G + R K L+ GG++D  + L D +G  
Sbjct  648  GYYSYAYSLVFAADMYKTVFKGAPLDPARGKLYREKILRPGGSRDEIDSLKDFLGRE  704



>gb|KDR83280.1| hypothetical protein GALMADRAFT_239146 [Galerina marginata CBS 
339.88]
Length=682

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            GYY Y+Y+  F+A ++  + + DPL    G + R K LQ GG+++A  I+ D +G
Sbjct  603  GYYGYMYSNVFAADMYATVFKADPLDSVRGKLYRDKVLQPGGSRNALEIVQDFLG  657



>ref|XP_005827485.1| hypothetical protein GUITHDRAFT_75461 [Guillardia theta CCMP2712]
 gb|EKX40505.1| hypothetical protein GUITHDRAFT_75461 [Guillardia theta CCMP2712]
Length=714

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +3

Query  135  TGYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            + YYSYL+ K  ++ IW+ + + +   P  G  L +KFL HGG+KD   ++ +L+ + + 
Sbjct  627  SNYYSYLWCKVIASFIWKHVFERNKSQPLAGLPLILKFLSHGGSKDPNEMIGELLEDVLH  686

Query  315  R  317
            R
Sbjct  687  R  687



>gb|KDR67452.1| hypothetical protein GALMADRAFT_273237 [Galerina marginata CBS 
339.88]
Length=684

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            GYY Y+Y+  F+A ++  + + DPL P  G + R K L  G ++D  +IL D +G
Sbjct  601  GYYGYMYSNVFAADMYATVFKADPLDPIRGKLYRDKILLPGSSRDELDILQDFLG  655



>emb|CDK24765.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=784

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRP  320
            YYSYL+ +  ++ IW+ +  EDPLS A G   R   L+ GG+K A  +L D++ N   + 
Sbjct  710  YYSYLFDRAIASKIWDHLFAEDPLSRANGDKFRDSVLKWGGSKGAWELLADVLDNPELKK  769

Query  321  AGE  329
              E
Sbjct  770  GDE  772



>gb|ELU11712.1| hypothetical protein CAPTEDRAFT_198580 [Capitella teleta]
Length=684

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL ++  +A IW +   EDP S A+G     + L HGG KD+ ++++DL+
Sbjct  613  YYSYLMSRAVAARIWRQFFAEDPFSRASGYKYWKQVLAHGGGKDSIDLVHDLL  665



>ref|XP_008478056.1| PREDICTED: mitochondrial intermediate peptidase-like [Diaphorina 
citri]
Length=371

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            YYSYL ++  ++ IW+   ++DP S  +G   R+  L HGG K A+ +++D +   IT
Sbjct  289  YYSYLLSRAVASWIWQSYFEKDPFSRDSGDAYRLNCLSHGGGKPASKLVSDFLQKDIT  346



>emb|CEJ82713.1| hypothetical protein VHEMI02762 [Torrubiella hemipterigena]
Length=105

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (54%), Gaps = 10/80 (13%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRP  320
            YYSYL++K F+  ++E I ++DPL+ + G   R   L+ GG++ A   + +L+G      
Sbjct  36   YYSYLWSKAFAVDMFESIFRDDPLNGSHGRRYRRLVLEPGGSRGALEGVTELLGRE----  91

Query  321  AGEGVIPDVTSLCNMLELTK  380
                  P V + C+ L + K
Sbjct  92   ------PSVDAFCSYLGIHK  105



>emb|CDI55389.1| related to mitochondrial intermediate peptidase precursor [Melanopsichium 
pennsylvanicum 4]
Length=876

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            YYSYL  +  +  IW ++  ++PLS   G V + K L+ GG KD  +IL D+VG    R
Sbjct  802  YYSYLLDRVIANKIWAELFAQNPLSREAGEVFKSKCLKFGGGKDPWHILADVVGAENVR  860



>sp|Q6Y5M6.1|PMIP_COPDI RecName: Full=Mitochondrial intermediate peptidase; Short=MIP; 
AltName: Full=Octapeptidyl aminopeptidase; Flags: Precursor 
[Coprinellus disseminatus]
 gb|AAO61501.1| mitochondrial intermediate peptidase [Coprinellus disseminatus]
 gb|AAZ14915.1| mitochondrial intermediate peptidase [Coprinellus disseminatus]
Length=773

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/53 (38%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+  E+PL  + G  LR + L HGGA+D  ++++ L+
Sbjct  690  YYSYLFDRAIASRVWSKVFAENPLDRSRGERLRGEVLMHGGARDPWHMVSALM  742



>emb|CCG83405.1| Mitochondrial intermediate peptidase [Taphrina deformans PYCC 
5710]
Length=650

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSY++ K  +  IW K  Q +PLS   G   +M  L+HGGA+D    L D++
Sbjct  575  YYSYIFDKAIADRIWTKTFQVNPLSRDAGENFKMNLLRHGGARDPWKCLADVL  627



>sp|A8QB25.2|PMIP_MALGO RecName: Full=Mitochondrial intermediate peptidase; Short=MIP; 
AltName: Full=Octapeptidyl aminopeptidase; Flags: Precursor 
[Malassezia globosa CBS 7966]
Length=806

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/53 (38%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  +A +WE++  + PLS   G   +M+ L+HGG K    +L+ L+
Sbjct  720  YYSYLFDRAIAARVWEQVFAKKPLSREAGERFKMEVLRHGGGKSPWEMLSRLL  772



>ref|XP_001729086.1| hypothetical protein MGL_3874 [Malassezia globosa CBS 7966]
 gb|EDP41872.1| hypothetical protein MGL_3874 [Malassezia globosa CBS 7966]
Length=656

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/53 (38%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  +A +WE++  + PLS   G   +M+ L+HGG K    +L+ L+
Sbjct  570  YYSYLFDRAIAARVWEQVFAKKPLSREAGERFKMEVLRHGGGKSPWEMLSRLL  622



>ref|WP_017429530.1| oligopeptidase A [Halomonas jeotgali]
Length=682

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = +3

Query  132  STGYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            + GYYSY +A+  SA  W    +  PL  ATG   R + L+ GGA+DA  +     G +
Sbjct  609  AAGYYSYKWAEVLSADAWSAFEEAGPLDAATGRRFRQQILEQGGARDAAELFAAFRGRA  667



>ref|XP_003737717.1| PREDICTED: mitochondrial intermediate peptidase-like [Metaseiulus 
occidentalis]
Length=693

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG--NSIT  314
            YYSYL ++  +A+ W+K  + DPLS   G   R K L HGG+     ++ D +G     T
Sbjct  614  YYSYLMSRAVAASFWQKAFKADPLSREAGLSYREKVLAHGGSLPPAELVRDFLGLERLNT  673

Query  315  RPAGEGVIPDV  347
            +   E +I D+
Sbjct  674  QKLAEALIRDI  684



>ref|XP_002475688.1| mitochondrial intermediate peptidase [Postia placenta Mad-698-R]
 gb|EED79121.1| mitochondrial intermediate peptidase [Postia placenta Mad-698-R]
Length=778

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            YYSYL+ +  ++ +W+K+   +PL+  TG   +   L HGG KD   +++ L+G
Sbjct  695  YYSYLFDRAIASRVWQKLFSHNPLTRTTGEKFKRDVLSHGGGKDPWMMVSKLLG  748



>ref|WP_022253038.1| peptidyl-dipeptidase Dcp [Prevotella sp. CAG:386]
 emb|CDC26015.1| peptidyl-dipeptidase Dcp [Prevotella sp. CAG:386]
Length=135

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 33/71 (46%), Gaps = 2/71 (3%)
 Frame = +3

Query  126  IKSTGYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGN  305
            + + GYYSYL+ +  +  + +   Q   L PA G   R K L  G  KD   +  D  G 
Sbjct  62   VYAAGYYSYLWTEVLAVNVADYFAQHGALDPAVGQAFRTKILSRGNTKDQLEMFTDFTG-  120

Query  306  SITRPAGEGVI  338
             + +P   G++
Sbjct  121  -MKQPDASGLL  130



>gb|KDR70896.1| hypothetical protein GALMADRAFT_254514 [Galerina marginata CBS 
339.88]
Length=676

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            G Y Y Y++ F+  ++  + + DPL PA G + R K L+ G ++D  +IL D +G +
Sbjct  602  GLYGYPYSQVFAVDMYTTVFKADPLDPARGKLYRDKILRPGSSRDEIDILTDFLGRA  658



>gb|EHA23688.1| hypothetical protein ASPNIDRAFT_180255 [Aspergillus niger ATCC 
1015]
Length=670

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/73 (32%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +3

Query  129  KSTGYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            +   Y+SYLY +  +A IW    ++DP+S   G   R   L +GG++D  ++L + +G S
Sbjct  596  QEANYFSYLYTRTLAADIWTSNFRDDPMSAEAGLRYRRIVLANGGSRDELDMLREFLGRS  655

Query  309  ITRPAGEGVIPDV  347
               P+ E  + D+
Sbjct  656  ---PSPEAYLRDL  665



>emb|CAK39271.1| unnamed protein product [Aspergillus niger]
Length=683

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/73 (32%), Positives = 40/73 (55%), Gaps = 3/73 (4%)
 Frame = +3

Query  129  KSTGYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            +   Y+SYLY +  +A IW    ++DP+S   G   R   L +GG++D  ++L + +G S
Sbjct  609  QEANYFSYLYTRTLAADIWTSNFRDDPMSAEAGLRYRRIVLANGGSRDELDMLREFLGRS  668

Query  309  ITRPAGEGVIPDV  347
               P+ E  + D+
Sbjct  669  ---PSPEAYLRDL  678



>gb|AGS09207.1| mitochondrial intermediate peptidase, partial [Heterobasidion 
occidentale]
Length=221

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            YYSYL+ +  ++ +W K+   DPL+   G   + + L+HGG +D   ++  L+G
Sbjct  138  YYSYLFDRAIASRVWRKLSARDPLNREMGERYKREILRHGGGEDPWAMIGSLLG  191



>gb|ADN97178.1| mitochondrial intermediate peptidase, partial [Phanerochaete 
chrysosporium]
Length=199

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ IW K+  +DPL   TG   + + L+HGG KD   +++ L+
Sbjct  116  YYSYLFDRAIASRIWRKLFAQDPLKRETGERYKNEILKHGGGKDPWCMVSTLL  168



>gb|ESA20941.1| hypothetical protein GLOINDRAFT_319748 [Rhizophagus irregularis 
DAOM 181602]
Length=808

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 7/64 (11%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKD----ATNILND---L  296
            GYYSYL+ +  +  IW++I ++DPL+   G + R + L+ GG++D        LND   +
Sbjct  732  GYYSYLFGRALAGKIWKEIFEKDPLNREAGQLFREEVLKWGGSRDPWLCIGKALNDDKII  791

Query  297  VGNS  308
            VG+S
Sbjct  792  VGDS  795



>gb|AGS09319.1| mitochondrial intermediate peptidase, partial [Heterobasidion 
parviporum]
Length=208

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            YYSYL+ +  ++ +W K+   DPL+   G   + + L+HGG +D   ++  L+G
Sbjct  125  YYSYLFDRAIASRVWRKLFARDPLNREMGERYKREILRHGGGEDPWAMIGSLLG  178



>ref|XP_007402198.1| hypothetical protein PHACADRAFT_265723 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM49251.1| hypothetical protein PHACADRAFT_265723 [Phanerochaete carnosa 
HHB-10118-sp]
Length=207

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITR  317
            YYSYL+ +  ++ IW K+   DPL+  TG   + + L++GG KD   ++  L+    TR
Sbjct  124  YYSYLFDRAIASRIWRKLFAHDPLNRETGERYKNEILKYGGGKDPWEMVGTLLDAPETR  182



>gb|EPT01518.1| hypothetical protein FOMPIDRAFT_1029754 [Fomitopsis pinicola 
FP-58527 SS1]
Length=768

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/55 (35%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGN  305
            YYSYL+ +  ++ +W+K+   DPL+  TG   + + L+HGG KD   +++ L+ +
Sbjct  685  YYSYLFDRAIASRVWQKLFFHDPLNRRTGERYKHEILRHGGGKDPWTMVSSLLSS  739



>gb|AGS09401.1| mitochondrial intermediate peptidase, partial [Heterobasidion 
araucariae]
Length=221

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            YYSYL+ +  ++ +W K+   DPLS A G   + + L+ GG +D   ++  L+G
Sbjct  138  YYSYLFDRAIASRVWRKLFARDPLSRAMGERYKREILRRGGGEDPWAMIGSLLG  191



>emb|CCO29707.1| metallopeptidase MepB [Rhizoctonia solani AG-1 IB]
Length=674

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSY Y+  F+A +++ + +  PL PA G + R K L+ G ++D  + L D +G  
Sbjct  602  GYYSYAYSLVFAADMYKTVFKGAPLDPARGKLYRDKILRPGASRDEIDSLKDFLGRE  658



>gb|AGS09237.1| mitochondrial intermediate peptidase, partial [Heterobasidion 
occidentale]
Length=221

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            YYSYL+ +  ++ +W K+   DPL+   G   + + L+HGG +D   ++  L+G
Sbjct  138  YYSYLFDRAIASRVWRKLFARDPLNREMGERYKREILRHGGGEDPWAMIGSLLG  191



>gb|AGS09219.1| mitochondrial intermediate peptidase, partial [Heterobasidion 
occidentale]
Length=221

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            YYSYL+ +  ++ +W K+   DPL+   G   + + L+HGG +D   ++  L+G
Sbjct  138  YYSYLFDRAIASRVWRKLFARDPLNREMGERYKREILRHGGGEDPWAMIGSLLG  191



>gb|ADN97190.1| mitochondrial intermediate peptidase, partial [Phanerochaete 
chrysosporium]
Length=199

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+   DPL   TG   + + L+HGG KD   +++ L+
Sbjct  116  YYSYLFDRAIASRVWRKLFAHDPLKRETGERYKAEILKHGGGKDPWKMVSCLL  168



>gb|AGS09373.1| mitochondrial intermediate peptidase, partial [Heterobasidion 
abietinum]
Length=352

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            YYSYL+ +  ++ +W K+   DPL+   G   + + L+HGG +D   ++  L+G
Sbjct  269  YYSYLFDRAIASRVWRKLFARDPLNREMGERYKREILRHGGGEDPWAMIGSLLG  322



>ref|XP_002498853.1| ZYRO0G20130p [Zygosaccharomyces rouxii]
 emb|CAR29920.1| ZYRO0G20130p [Zygosaccharomyces rouxii]
Length=786

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +WE + QEDP S A G   +   L+ GGAKD    + D++
Sbjct  712  YYSYLFDRAIASKVWESLFQEDPFSRAGGQRFKEYVLKWGGAKDPWQCIADVL  764



>gb|AGS09367.1| mitochondrial intermediate peptidase, partial [Heterobasidion 
abietinum]
Length=356

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            YYSYL+ +  ++ +W K+   DPL+   G   + + L+HGG +D   ++  L+G
Sbjct  273  YYSYLFDRAIASRVWRKLFARDPLNREMGERYKREILRHGGGEDPWAMIGSLLG  326



>gb|ADN97170.1| mitochondrial intermediate peptidase, partial [Phanerochaete 
chrysosporium]
Length=125

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+   DPL+  TG   + + L++GG +D   +++ L+
Sbjct  42   YYSYLFDRAIASRVWRKLFAHDPLNRTTGERYKNEILRYGGGRDPWKMVSTLL  94



>dbj|GAA31501.1| thimet oligopeptidase [Clonorchis sinensis]
Length=690

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 4/65 (6%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDP----LSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            YY YL+++ FSA ++E   +  P    LS   G   R K LQ GG+KDA+++L D +G  
Sbjct  617  YYGYLWSEVFSADLYESRFRRAPDGGCLSKTVGREYRTKILQPGGSKDASDMLRDFLGRD  676

Query  309  ITRPA  323
             +  A
Sbjct  677  PSNSA  681



>gb|KEP47236.1| metallopeptidase MepB [Rhizoctonia solani 123E]
Length=711

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNS  308
            GYYSY Y+  F+A +++ I +  PL PA G + R K L+ G ++D  + L + +G  
Sbjct  639  GYYSYAYSLVFAADMYKTIFKGAPLDPARGKLYREKILRPGASRDEIDSLKEFLGRE  695



>emb|CDH57548.1| mitochondrial intermediate peptidase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=792

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            GYYSYL+ +  +  IWE   ++DPL    G   R + L  GGA+D    + D++G
Sbjct  713  GYYSYLFDRTLARRIWETCFEKDPLDRDQGLAFRDRLLMWGGARDPWECVADVLG  767



>emb|CDS08648.1| hypothetical protein LRAMOSA10009 [Absidia idahoensis var. thermophila]
Length=793

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +3

Query  138  GYYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            GYYSYL+ +  +  IWE   ++DPL    G   R + L  GGA+D    + D++G
Sbjct  714  GYYSYLFDRTLARRIWETCFEKDPLDRDQGLAFRDRLLMWGGARDPWECVADVLG  768



>ref|XP_002167738.2| PREDICTED: mitochondrial intermediate peptidase-like [Hydra vulgaris]
Length=663

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            YY+Y+++K  ++ IW    + +PLS  TG   R   L+HGG +    ++ D++G  ++
Sbjct  590  YYAYVWSKAIASQIWFSCFEHNPLSRVTGEKYRETMLRHGGGRPPHQMVEDMIGKKVS  647



>gb|ADN97174.1| mitochondrial intermediate peptidase, partial [Phanerochaete 
chrysosporium]
Length=125

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  ++ +W K+   DPL+  TG   + + L+ GG KD   +++ L+
Sbjct  42   YYSYLFDRAIASRVWRKLFVHDPLNRETGERYKREILKFGGGKDPWKMVSTLL  94



>ref|XP_008181092.1| PREDICTED: mitochondrial intermediate peptidase isoform X2 [Acyrthosiphon 
pisum]
Length=590

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            YYSYL +K  +A  W      DPL+   G  LR + LQ+GG K A  +++D +   +T
Sbjct  509  YYSYLVSKALAAHTWHAFLSNDPLNRIQGERLRTECLQYGGGKPARKLVSDYLKTPVT  566



>ref|XP_002108409.1| hypothetical protein TRIADDRAFT_51263 [Trichoplax adhaerens]
 gb|EDV29207.1| hypothetical protein TRIADDRAFT_51263 [Trichoplax adhaerens]
Length=604

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRP  320
            YYSY++++  ++ IW +  +E+P S  +G   R K L +GG K    ++ D++G  I+  
Sbjct  533  YYSYIWSRAIASMIWTECFKENPFSSVSGENYRRKALAYGGGKMPKLMVEDILGREISSD  592

Query  321  A-GEGVIPDVTS  353
            A  + ++ D+ S
Sbjct  593  ALVQALVEDIES  604



>ref|XP_001635122.1| predicted protein [Nematostella vectensis]
 gb|EDO43059.1| predicted protein [Nematostella vectensis]
Length=666

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 0/74 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRP  320
            YYSYL+++  ++ +W +    +P S   G   R + L HGG KD   ++  ++G  +T  
Sbjct  589  YYSYLWSRAVASMVWHQCFHANPFSREVGDRYRSQMLAHGGGKDPNALVAGMLGKELTTE  648

Query  321  AGEGVIPDVTSLCN  362
                 + D  + CN
Sbjct  649  DMVQALWDDLADCN  662



>ref|XP_001950913.1| PREDICTED: mitochondrial intermediate peptidase isoform X1 [Acyrthosiphon 
pisum]
Length=690

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            YYSYL +K  +A  W      DPL+   G  LR + LQ+GG K A  +++D +   +T
Sbjct  609  YYSYLVSKALAAHTWHAFLSNDPLNRIQGERLRTECLQYGGGKPARKLVSDYLKTPVT  666



>ref|XP_007312937.1| mitochondrial intermediate peptidase [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO31053.1| mitochondrial intermediate peptidase [Serpula lacrymans var. 
lacrymans S7.9]
Length=734

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVG  302
            YYSYL+ +  ++ +W K+  ++PL+  TG   + + L++GG KD   +L+ L+G
Sbjct  651  YYSYLFDRAIASHVWRKVFSDNPLNRETGEKYKREVLRYGGGKDPWMMLSALLG  704



>ref|XP_005107554.1| PREDICTED: mitochondrial intermediate peptidase-like isoform 
X1 [Aplysia californica]
 ref|XP_005107555.1| PREDICTED: mitochondrial intermediate peptidase-like isoform 
X2 [Aplysia californica]
 ref|XP_005107556.1| PREDICTED: mitochondrial intermediate peptidase-like isoform 
X3 [Aplysia californica]
Length=720

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSIT  314
            YY+YL ++  +A +W    + DP S   G+  R + L HGG K    I+ D++G   T
Sbjct  641  YYAYLVSRAVAAELWHTCFKADPFSRTMGTRYREEMLAHGGEKHPAQIVQDMLGKPPT  698



>ref|XP_002491343.1| Mitochondrial intermediate peptidase [Komagataella pastoris GS115]
 emb|CAY69063.1| Mitochondrial intermediate peptidase [Komagataella pastoris GS115]
Length=789

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  +  IWE +  +DPLS   G   R K L+ GG++D   ++ D++
Sbjct  718  YYSYLFDRAIAKKIWEHLFAKDPLSRENGEKFRNKVLKWGGSRDPWELVADVL  770



>dbj|GAC98595.1| mitochondrial intermediate peptidase [Pseudozyma hubeiensis SY62]
Length=884

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (54%), Gaps = 0/69 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRP  320
            YYSYL  +  ++ +W ++  EDPL    G + + + L+ GG KD  +IL D++     R 
Sbjct  810  YYSYLLDRVIASKVWNRLFAEDPLDREKGELFKKECLKFGGGKDPWHILADVLKEEGVRD  869

Query  321  AGEGVIPDV  347
              +  + +V
Sbjct  870  GDKRAMEEV  878



>dbj|BAH22601.1| mitochondrial intermediate peptidase [Pholiota nameko]
Length=772

 Score = 47.8 bits (112),  Expect = 0.001, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKD  272
            YYSYL+ +  ++ +W+ +   DPLS  TG   + + LQ+GG KD
Sbjct  689  YYSYLFDRAIASRVWQNVFTHDPLSRETGEKYKREVLQYGGGKD  732



>gb|EST05934.1| mitochondrial intermediate peptidase [Pseudozyma brasiliensis 
GHG001]
Length=772

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (54%), Gaps = 0/69 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLVGNSITRP  320
            YYSYL  +  ++ IW  + + +PL    G V +M+ L++GG +D   +L D++G    R 
Sbjct  698  YYSYLLDRVIASKIWNHLFEGNPLDRDKGEVFKMQCLKYGGGRDPWGMLADVLGAEEVRD  757

Query  321  AGEGVIPDV  347
              +  +  V
Sbjct  758  GDKRAMQQV  766



>emb|CCA38542.1| mitochondrial intermediate peptidase [Komagataella pastoris CBS 
7435]
Length=1191

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDLV  299
            YYSYL+ +  +  IWE +  +DPLS   G   R K L+ GG++D   ++ D++
Sbjct  718  YYSYLFDRAIAKKIWEHLFAKDPLSRENGEKFRNKVLKWGGSRDPWELVADVL  770



>emb|CCO26235.1| mitochondrial intermediate peptidase [Rhizoctonia solani AG-1 
IB]
Length=962

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +3

Query  141  YYSYLYAKCFSATIWEKICQEDPLSPATGSVLRMKFLQHGGAKDATNILNDL  296
            YYSYL+ +  ++ +W+K+   DPL+   G   + + L+HGG+KD  ++L  L
Sbjct  888  YYSYLFDRAIASQVWKKMFARDPLNREMGERYKREVLRHGGSKDPWHMLAAL  939



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521715387024