BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25166_g3_i1 len=966 path=[3524:0-750 2581:751-965]

Length=966
                                                                      Score     E

gb|AFN85535.1|  PRp27-like protein                                      350   1e-117   
emb|CDP10877.1|  unnamed protein product                                346   7e-116   
ref|XP_009630650.1|  PREDICTED: uncharacterized protein LOC104120561    338   9e-113   
ref|XP_002518664.1|  conserved hypothetical protein                     337   4e-112   Ricinus communis
emb|CDO97229.1|  unnamed protein product                                335   1e-111   
ref|XP_009784386.1|  PREDICTED: uncharacterized protein LOC104232799    335   2e-111   
dbj|BAA81904.1|  NtPRp27                                                335   4e-111   Nicotiana tabacum [American tobacco]
gb|EYU42704.1|  hypothetical protein MIMGU_mgv1a012982mg                334   5e-111   
ref|NP_001275036.1|  NtPRp27-like protein precursor                     332   2e-110   
ref|XP_004230730.1|  PREDICTED: uncharacterized protein LOC101249498    332   2e-110   
ref|XP_009800743.1|  PREDICTED: uncharacterized protein LOC104246599    332   3e-110   
ref|XP_009625149.1|  PREDICTED: uncharacterized protein LOC104116070    330   9e-110   
ref|XP_004229500.1|  PREDICTED: uncharacterized protein LOC101249206    328   9e-109   
ref|XP_006346357.1|  PREDICTED: uncharacterized protein LOC102601131    328   1e-108   
emb|CAC40754.1|  putative NtPRp27-like protein                          324   4e-107   Atropa belladonna [deadly nightshade]
gb|AFK40641.1|  unknown                                                 323   5e-107   
ref|XP_011092712.1|  PREDICTED: uncharacterized protein LOC105172834    323   2e-106   
ref|XP_009595677.1|  PREDICTED: uncharacterized protein LOC104091939    322   2e-106   
ref|XP_011088200.1|  PREDICTED: uncharacterized protein LOC105169499    321   4e-106   
gb|KDP45917.1|  hypothetical protein JCGZ_15477                         321   5e-106   
ref|XP_007143065.1|  hypothetical protein PHAVU_007G040900g             320   6e-106   
ref|XP_004496932.1|  PREDICTED: uncharacterized protein LOC101506848    318   9e-105   
ref|XP_006486988.1|  PREDICTED: uncharacterized protein LOC102627881    317   1e-104   
ref|NP_001235031.1|  uncharacterized protein LOC100306181 precursor     317   2e-104   
gb|AFK45291.1|  unknown                                                 316   3e-104   
ref|XP_010908301.1|  PREDICTED: uncharacterized protein LOC105034737    315   7e-104   
gb|KHN42351.1|  hypothetical protein glysoja_020063                     315   1e-103   
ref|XP_006422910.1|  hypothetical protein CICLE_v10029208mg             313   5e-103   
ref|XP_010023668.1|  PREDICTED: uncharacterized protein LOC104414298    312   2e-102   
emb|CAN65930.1|  hypothetical protein VITISV_038846                     311   5e-102   Vitis vinifera
ref|XP_002269365.1|  PREDICTED: uncharacterized protein LOC100259535    310   6e-102   Vitis vinifera
ref|XP_004304055.1|  PREDICTED: uncharacterized protein LOC101291548    310   7e-102   
ref|XP_007199197.1|  hypothetical protein PRUPE_ppa021584mg             310   1e-101   
ref|NP_001238289.1|  uncharacterized protein LOC100499938 precursor     310   1e-101   
gb|AEZ51831.1|  pathogenesis-related protein 17                         309   3e-101   
ref|XP_009347532.1|  PREDICTED: uncharacterized protein LOC103939198    308   4e-101   
gb|EYU37622.1|  hypothetical protein MIMGU_mgv1a025422mg                307   5e-101   
ref|XP_006486993.1|  PREDICTED: uncharacterized protein LOC102629327    308   5e-101   
ref|XP_002269470.1|  PREDICTED: uncharacterized protein LOC100254416    308   6e-101   Vitis vinifera
ref|XP_008236459.1|  PREDICTED: uncharacterized protein LOC103335226    308   7e-101   
ref|XP_006422913.1|  hypothetical protein CICLE_v10030248mg             308   9e-101   
gb|AFK34400.1|  unknown                                                 307   1e-100   
ref|XP_008800414.1|  PREDICTED: uncharacterized protein LOC103714784    306   3e-100   
ref|XP_010065957.1|  PREDICTED: uncharacterized protein LOC104453134    306   4e-100   
ref|XP_009370126.1|  PREDICTED: uncharacterized protein LOC103959498    305   6e-100   
ref|XP_007042546.1|  Plant basic secretory protein (BSP) family p...    304   2e-99    
ref|XP_009384579.1|  PREDICTED: uncharacterized protein LOC103972102    303   4e-99    
ref|XP_008365753.1|  PREDICTED: uncharacterized protein LOC103429378    303   8e-99    
ref|XP_010918048.1|  PREDICTED: uncharacterized protein LOC105042502    302   2e-98    
gb|KHN06773.1|  hypothetical protein glysoja_021319                     301   2e-98    
ref|XP_009371399.1|  PREDICTED: uncharacterized protein LOC103960644    301   4e-98    
ref|XP_002300243.2|  plant basic secretory family protein               300   5e-98    Populus trichocarpa [western balsam poplar]
ref|XP_007143066.1|  hypothetical protein PHAVU_007G041000g             300   7e-98    
ref|XP_008338236.1|  PREDICTED: uncharacterized protein LOC103401302    300   7e-98    
ref|XP_010024060.1|  PREDICTED: uncharacterized protein LOC104414606    300   1e-97    
ref|XP_009370123.1|  PREDICTED: uncharacterized protein LOC103959494    300   1e-97    
ref|XP_010065960.1|  PREDICTED: uncharacterized protein LOC104453136    298   2e-97    
ref|XP_008236385.1|  PREDICTED: uncharacterized protein LOC103335160    299   3e-97    
ref|XP_009343550.1|  PREDICTED: proline-rich receptor-like protei...    305   3e-97    
ref|XP_002313879.2|  plant basic secretory family protein               298   4e-97    Populus trichocarpa [western balsam poplar]
ref|XP_007042549.1|  Plant basic secretory protein (BSP) family p...    298   4e-97    
ref|XP_008382539.1|  PREDICTED: uncharacterized protein LOC103445323    298   5e-97    
ref|NP_001235412.1|  uncharacterized protein LOC100527902 precursor     296   4e-96    
ref|XP_010065956.1|  PREDICTED: uncharacterized protein LOC104453133    295   6e-96    
ref|XP_008800415.1|  PREDICTED: uncharacterized protein LOC103714785    294   9e-96    
ref|XP_011001221.1|  PREDICTED: uncharacterized protein LOC105108570    295   1e-95    
gb|KCW63683.1|  hypothetical protein EUGRSUZ_G01330                     294   1e-95    
ref|XP_002300242.2|  plant basic secretory family protein               292   8e-95    Populus trichocarpa [western balsam poplar]
ref|XP_008236388.1|  PREDICTED: uncharacterized protein LOC103335161    292   8e-95    
gb|KCW60472.1|  hypothetical protein EUGRSUZ_H03199                     291   2e-94    
ref|XP_011030392.1|  PREDICTED: uncharacterized protein LOC105129852    291   5e-94    
ref|XP_011016346.1|  PREDICTED: uncharacterized protein LOC105119849    289   2e-93    
ref|NP_001149395.1|  LOC100283021 precursor                             288   3e-93    Zea mays [maize]
ref|XP_009346859.1|  PREDICTED: uncharacterized protein LOC103938567    288   3e-93    
ref|XP_007200728.1|  hypothetical protein PRUPE_ppa018700mg             288   4e-93    
ref|XP_010026884.1|  PREDICTED: uncharacterized protein LOC104417275    287   5e-93    
ref|XP_010028408.1|  PREDICTED: uncharacterized protein LOC104418692    288   6e-93    
ref|XP_011030391.1|  PREDICTED: uncharacterized protein LOC105129851    286   2e-92    
ref|XP_002313151.1|  plant basic secretory family protein               285   4e-92    Populus trichocarpa [western balsam poplar]
ref|XP_011001233.1|  PREDICTED: uncharacterized protein LOC105108579    285   5e-92    
ref|XP_002467027.1|  hypothetical protein SORBIDRAFT_01g018490          285   1e-91    Sorghum bicolor [broomcorn]
ref|XP_003574106.1|  PREDICTED: uncharacterized protein LOC100828815    284   1e-91    
ref|XP_004305960.1|  PREDICTED: uncharacterized protein LOC101310442    284   2e-91    
ref|XP_010068403.1|  PREDICTED: uncharacterized protein LOC104455286    281   1e-90    
ref|XP_006369747.1|  plant basic secretory family protein               281   2e-90    
ref|XP_011030429.1|  PREDICTED: uncharacterized protein LOC105129884    277   3e-89    
emb|CAA74594.1|  hypothetical protein                                   278   4e-89    Hordeum vulgare [barley]
gb|EMT16068.1|  hypothetical protein F775_26852                         276   1e-88    
ref|XP_006661891.1|  PREDICTED: uncharacterized protein LOC102706684    276   2e-88    
ref|XP_004496927.1|  PREDICTED: uncharacterized protein LOC101505538    275   5e-88    
gb|ABV22582.1|  PR17c precursor                                         274   1e-87    Hordeum vulgare subsp. vulgare [barley]
emb|CAN65929.1|  hypothetical protein VITISV_038845                     273   5e-87    Vitis vinifera
ref|XP_002467026.1|  hypothetical protein SORBIDRAFT_01g018480          272   8e-87    Sorghum bicolor [broomcorn]
ref|XP_010271313.1|  PREDICTED: uncharacterized protein LOC104607374    271   2e-86    
ref|XP_003549177.1|  PREDICTED: TMV resistance protein N                283   4e-86    
ref|XP_008646584.1|  PREDICTED: uncharacterized protein LOC103628086    269   2e-85    
ref|XP_009788961.1|  PREDICTED: uncharacterized protein LOC104236679    268   3e-85    
gb|EMS47839.1|  hypothetical protein TRIUR3_32088                       265   3e-84    
ref|XP_004159905.1|  PREDICTED: uncharacterized LOC101221124            265   3e-84    
ref|NP_565369.1|  basic secretory protein family protein                265   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004136961.1|  PREDICTED: uncharacterized protein LOC101221124    265   4e-84    
ref|XP_008454989.1|  PREDICTED: uncharacterized protein LOC103495269    265   6e-84    
ref|XP_004982761.1|  PREDICTED: cysteine-rich receptor-like prote...    277   9e-84    
ref|XP_010691662.1|  PREDICTED: uncharacterized protein LOC104904936    264   1e-83    
gb|AAD46133.1|AF079526_1  secretory protein                             264   1e-83    Triticum aestivum [Canadian hard winter wheat]
ref|XP_007200255.1|  hypothetical protein PRUPE_ppa015159mg             263   2e-83    
ref|XP_010691661.1|  PREDICTED: uncharacterized protein LOC104904935    263   2e-83    
ref|XP_010547976.1|  PREDICTED: uncharacterized protein LOC104819...    263   3e-83    
gb|ACE97817.1|  peptidase M                                             261   3e-83    Populus tremula [European aspen]
ref|XP_010467285.1|  PREDICTED: uncharacterized protein LOC104747353    263   4e-83    
gb|ACE97836.1|  peptidase M                                             261   5e-83    Populus tremula [European aspen]
ref|XP_004982764.1|  PREDICTED: uncharacterized protein LOC101755530    262   5e-83    
ref|XP_006422909.1|  hypothetical protein CICLE_v10029973mg             262   5e-83    
gb|ACE97813.1|  peptidase M                                             260   6e-83    Populus tremula [European aspen]
ref|XP_002883881.1|  hypothetical protein ARALYDRAFT_899731             261   1e-82    
gb|EEC67221.1|  hypothetical protein OsI_34133                          260   2e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_006300232.1|  hypothetical protein CARUB_v10016469mg             261   2e-82    
ref|XP_009136267.1|  PREDICTED: uncharacterized protein LOC103860417    260   2e-82    
ref|XP_010065959.1|  PREDICTED: uncharacterized protein LOC104453135    260   3e-82    
ref|XP_007042545.1|  Plant basic secretory protein (BSP) family p...    260   3e-82    
gb|ACE97835.1|  peptidase M                                             258   4e-82    Populus tremula [European aspen]
gb|ACE97814.1|  peptidase M                                             258   7e-82    Populus tremula [European aspen]
ref|XP_008236389.1|  PREDICTED: uncharacterized protein LOC103335162    259   1e-81    
ref|XP_006422908.1|  hypothetical protein CICLE_v10030275mg             259   1e-81    
ref|XP_008454988.1|  PREDICTED: uncharacterized protein LOC103495268    259   2e-81    
gb|KFK39997.1|  hypothetical protein AALP_AA3G316700                    258   2e-81    
gb|AGW45466.1|  PRp27                                                   256   1e-80    
ref|XP_010024062.1|  PREDICTED: uncharacterized protein LOC104414607    256   1e-80    
ref|XP_002267568.2|  PREDICTED: uncharacterized protein LOC100247270    255   2e-80    Vitis vinifera
ref|XP_002518665.1|  conserved hypothetical protein                     254   3e-80    Ricinus communis
gb|KGN43893.1|  hypothetical protein Csa_7G072800                       261   6e-80    
ref|XP_010918047.1|  PREDICTED: uncharacterized protein LOC105042501    254   6e-80    
emb|CDX89654.1|  BnaC03g45680D                                          253   1e-79    
ref|XP_004229501.1|  PREDICTED: uncharacterized protein LOC101249488    250   4e-79    
ref|XP_006409598.1|  hypothetical protein EUTSA_v10022957mg             252   5e-79    
ref|XP_006600106.1|  PREDICTED: TMV resistance protein N-like           264   8e-79    
gb|KCW63684.1|  hypothetical protein EUGRSUZ_G01332                     249   1e-78    
gb|KFK39998.1|  hypothetical protein AALP_AA3G316800                    250   2e-78    
gb|ABV22584.1|  PR17d precursor                                         248   2e-77    Hordeum vulgare subsp. vulgare [barley]
ref|XP_002467025.1|  hypothetical protein SORBIDRAFT_01g018470          248   2e-77    Sorghum bicolor [broomcorn]
ref|XP_006409585.1|  hypothetical protein EUTSA_v10022994mg             247   5e-77    
gb|AAC49288.1|  unknown                                                 247   5e-77    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004230729.1|  PREDICTED: uncharacterized protein LOC101249214    245   4e-76    
gb|KDP45915.1|  hypothetical protein JCGZ_15475                         244   4e-76    
ref|XP_008644748.1|  PREDICTED: uncharacterized protein LOC103626141    242   3e-75    
ref|NP_179117.1|  basic secretory protein family protein                242   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008646583.1|  PREDICTED: uncharacterized protein LOC103628085    242   5e-75    
ref|XP_010488942.1|  PREDICTED: uncharacterized protein LOC104766701    241   7e-75    
ref|XP_008800443.1|  PREDICTED: uncharacterized protein LOC103714804    241   1e-74    
ref|XP_004496933.1|  PREDICTED: uncharacterized protein LOC101507183    240   2e-74    
ref|XP_003574107.1|  PREDICTED: uncharacterized protein LOC100829117    240   2e-74    
ref|XP_006300143.1|  hypothetical protein CARUB_v10016373mg             239   5e-74    
gb|AAG13529.1|AC023240_2  putative secretory protein                    240   6e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008236461.1|  PREDICTED: uncharacterized protein LOC103335229    238   1e-73    
ref|XP_006840580.1|  hypothetical protein AMTR_s00045p00230850          238   2e-73    
ref|XP_007042547.1|  Plant basic secretory protein (BSP) family p...    236   2e-72    
gb|EAY79023.1|  hypothetical protein OsI_34132                          235   2e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_004304056.1|  PREDICTED: uncharacterized protein LOC101291846    234   6e-72    
ref|XP_010253329.1|  PREDICTED: uncharacterized protein LOC104594638    233   8e-72    
ref|NP_001064924.1|  Os10g0490800                                       233   1e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002983435.1|  hypothetical protein SELMODRAFT_118266             233   1e-71    
gb|AAG13532.1|AC023240_5  putative secretory protein                    233   2e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002313878.2|  hypothetical protein POPTR_0009s09770g             231   3e-71    Populus trichocarpa [western balsam poplar]
ref|XP_002974055.1|  hypothetical protein SELMODRAFT_100588             231   6e-71    
gb|EMS45729.1|  hypothetical protein TRIUR3_05356                       231   8e-71    
ref|NP_001064925.2|  Os10g0490900                                       229   1e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010253341.1|  PREDICTED: uncharacterized protein LOC104594644    229   4e-70    
ref|XP_002973860.1|  hypothetical protein SELMODRAFT_232195             229   4e-70    
ref|XP_010065955.1|  PREDICTED: uncharacterized protein LOC104453132    228   2e-69    
gb|KGN43891.1|  NtPRp27-like protein                                    228   2e-69    
ref|XP_004982765.1|  PREDICTED: uncharacterized protein LOC101755936    227   3e-69    
ref|XP_004137101.1|  PREDICTED: uncharacterized protein LOC101216297    226   7e-69    
ref|XP_002883880.1|  hypothetical protein ARALYDRAFT_899730             224   2e-68    
ref|XP_007199606.1|  hypothetical protein PRUPE_ppa024467mg             223   8e-68    
gb|KEH44067.1|  peptidase M                                             220   9e-67    
ref|XP_004986458.1|  PREDICTED: uncharacterized protein LOC101768140    220   2e-66    
gb|EAY79025.1|  hypothetical protein OsI_34134                          219   5e-66    Oryza sativa Indica Group [Indian rice]
ref|NP_001064926.1|  Os10g0491000                                       217   3e-65    Oryza sativa Japonica Group [Japonica rice]
gb|KCW55147.1|  hypothetical protein EUGRSUZ_I01097                     211   3e-64    
emb|CAA74593.1|  hypothetical protein                                   213   5e-64    Hordeum vulgare [barley]
gb|EMS51254.1|  hypothetical protein TRIUR3_34420                       209   2e-63    
ref|XP_010026882.1|  PREDICTED: uncharacterized protein LOC104417274    209   2e-62    
ref|XP_011088738.1|  PREDICTED: uncharacterized protein LOC105169882    205   2e-60    
gb|EMS62515.1|  hypothetical protein TRIUR3_15559                       204   2e-60    
gb|KDO59826.1|  hypothetical protein CISIN_1g041464mg                   203   2e-60    
gb|EYU42702.1|  hypothetical protein MIMGU_mgv1a022130mg                204   2e-60    
gb|EYU37621.1|  hypothetical protein MIMGU_mgv1a026144mg                204   2e-60    
ref|XP_006661892.1|  PREDICTED: uncharacterized protein LOC102706968    202   2e-59    
gb|EPS57342.1|  hypothetical protein M569_17476                         195   3e-58    
gb|EMT28762.1|  hypothetical protein F775_43050                         197   3e-57    
ref|XP_002467028.1|  hypothetical protein SORBIDRAFT_01g018500          195   3e-57    Sorghum bicolor [broomcorn]
ref|XP_002973863.1|  hypothetical protein SELMODRAFT_100635             196   3e-57    
ref|XP_002974051.1|  hypothetical protein SELMODRAFT_100633             195   4e-57    
ref|XP_002973864.1|  hypothetical protein SELMODRAFT_100667             193   3e-56    
ref|XP_006409600.1|  hypothetical protein EUTSA_v10023033mg             189   2e-55    
ref|XP_002983439.1|  hypothetical protein SELMODRAFT_118325             190   4e-55    
ref|XP_002983536.1|  hypothetical protein SELMODRAFT_118618             189   2e-54    
gb|EMS65358.1|  hypothetical protein TRIUR3_33397                       189   1e-53    
gb|EYU42703.1|  hypothetical protein MIMGU_mgv1a026133mg                184   1e-52    
ref|XP_002983442.1|  hypothetical protein SELMODRAFT_118519             181   1e-51    
ref|XP_011088737.1|  PREDICTED: uncharacterized protein LOC105169881    179   2e-51    
ref|NP_001118322.1|  basic secretory protein family protein             177   7e-51    Arabidopsis thaliana [mouse-ear cress]
gb|EMS45730.1|  hypothetical protein TRIUR3_05357                       182   5e-50    
ref|XP_007214050.1|  hypothetical protein PRUPE_ppa017454mg             165   9e-47    
gb|EEE51183.1|  hypothetical protein OsJ_31986                          164   2e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002990552.1|  hypothetical protein SELMODRAFT_131787             162   4e-45    
emb|CBI22517.3|  unnamed protein product                                159   7e-45    
ref|XP_002976187.1|  hypothetical protein SELMODRAFT_104167             160   1e-43    
ref|XP_002968192.1|  hypothetical protein SELMODRAFT_89504              160   1e-43    
gb|KCW45368.1|  hypothetical protein EUGRSUZ_L00955                     159   2e-43    
ref|XP_010058923.1|  PREDICTED: uncharacterized protein LOC104446815    156   5e-42    
ref|XP_007042550.1|  Plant basic secretory protein (BSP) family p...    157   1e-41    
gb|KCW73984.1|  hypothetical protein EUGRSUZ_E02597                     155   1e-41    
gb|AFV29735.1|  NtPRp27-like                                            154   2e-41    
gb|AFV29754.1|  NtPRp27-like                                            154   3e-41    
ref|XP_002976188.1|  hypothetical protein SELMODRAFT_104190             154   4e-41    
gb|KHN30423.1|  hypothetical protein glysoja_033161                     152   5e-41    
gb|AFV29745.1|  NtPRp27-like                                            152   1e-40    
gb|AFV29736.1|  NtPRp27-like                                            150   3e-40    
gb|AFV29764.1|  NtPRp27-like                                            150   3e-40    
gb|AFV29744.1|  NtPRp27-like                                            150   4e-40    
emb|CDX71203.1|  BnaC07g04820D                                          148   7e-40    
gb|AFV29753.1|  NtPRp27-like                                            149   1e-39    
ref|XP_010058770.1|  PREDICTED: uncharacterized protein LOC104446635    149   3e-39    
gb|AFV29803.1|  NtPRp27-like                                            148   3e-39    
ref|XP_010059095.1|  PREDICTED: uncharacterized protein LOC104447008    149   4e-39    
ref|XP_007206698.1|  hypothetical protein PRUPE_ppa023753mg             144   6e-39    
ref|XP_010058921.1|  PREDICTED: uncharacterized protein LOC104446812    148   2e-38    
ref|XP_010068304.1|  PREDICTED: uncharacterized protein LOC104455165    146   4e-38    
gb|AFG58755.1|  hypothetical protein 0_6799_01                          141   2e-37    
ref|XP_002983524.1|  hypothetical protein SELMODRAFT_118420             140   7e-37    
gb|AEW07608.1|  hypothetical protein 0_6799_01                          139   2e-36    
gb|KCW63680.1|  hypothetical protein EUGRSUZ_G01326                     139   4e-36    
ref|XP_010096295.1|  hypothetical protein L484_027034                   137   2e-35    
ref|XP_010040231.1|  PREDICTED: uncharacterized protein LOC104429024    137   4e-35    
ref|XP_002974056.1|  hypothetical protein SELMODRAFT_100569             137   5e-35    
ref|XP_010058831.1|  PREDICTED: uncharacterized protein LOC104446708    134   2e-33    
ref|XP_004137102.1|  PREDICTED: uncharacterized protein LOC101216547    127   2e-32    
ref|XP_009603712.1|  PREDICTED: uncharacterized protein LOC104098630    123   2e-31    
ref|XP_010040232.1|  PREDICTED: uncharacterized protein LOC104429025    119   2e-29    
ref|XP_007265342.1|  plant basic secretory protein                      120   2e-28    
emb|CDX71206.1|  BnaC07g04850D                                          117   3e-28    
gb|EPS60839.1|  hypothetical protein M569_13962                         115   3e-28    
ref|XP_001772715.1|  predicted protein                                  119   4e-28    
gb|KGQ04395.1|  hypothetical protein BBAD15_g10344                      119   4e-28    
ref|XP_006667644.1|  PBSP domain protein                                120   5e-28    
ref|XP_008602581.1|  plant Basic Secretory protein                      119   5e-28    
ref|XP_007360623.1|  plant basic secretory protein                      119   5e-28    
gb|KGN43892.1|  hypothetical protein Csa_7G072790                       115   7e-28    
gb|EKG14227.1|  hypothetical protein MPH_08602                          119   1e-27    
ref|XP_003009154.1|  PBSP domain-containing protein                     120   1e-27    
ref|XP_007320441.1|  hypothetical protein SERLADRAFT_416620             118   1e-27    
gb|EPT01612.1|  hypothetical protein FOMPIDRAFT_129361                  116   3e-27    
gb|KDR85565.1|  hypothetical protein GALMADRAFT_218662                  120   4e-27    
ref|XP_003038849.1|  hypothetical protein SCHCODRAFT_48191              115   6e-27    
emb|CCM03636.1|  predicted protein                                      115   2e-26    
ref|XP_007860761.1|  plant basic secretory protein                      115   2e-26    
ref|XP_007745994.1|  hypothetical protein A1O5_07215                    115   2e-26    
ref|XP_008032340.1|  plant basic secretory protein                      114   2e-26    
ref|XP_007701723.1|  hypothetical protein COCSADRAFT_72726              114   2e-26    
ref|XP_001829358.2|  NtPRp27                                            115   4e-26    Coprinopsis cinerea okayama7#130
gb|EMT25171.1|  hypothetical protein F775_42975                         110   5e-26    
gb|KDR85566.1|  hypothetical protein GALMADRAFT_218663                  114   5e-26    
ref|XP_007378757.1|  BSP-domain-containing protein                      114   5e-26    
ref|XP_009650124.1|  PBSP domain-containing protein                     115   8e-26    
ref|XP_007713219.1|  hypothetical protein COCCADRAFT_67412              112   9e-26    
gb|EUN22885.1|  hypothetical protein COCVIDRAFT_66014                   112   1e-25    
ref|XP_006454277.1|  hypothetical protein AGABI2DRAFT_214116            113   1e-25    
ref|XP_007325051.1|  hypothetical protein AGABI1DRAFT_51550             113   1e-25    
ref|XP_007588927.1|  putative pbsp domain-containing protein            113   2e-25    
ref|XP_007346198.1|  plant basic secretory protein                      112   2e-25    
ref|XP_002836216.1|  hypothetical protein                               114   2e-25    Tuber melanosporum Mel28
gb|KDQ31274.1|  hypothetical protein PLEOSDRAFT_1075407                 111   3e-25    
gb|EMF15725.1|  BSP-domain-containing protein                           112   3e-25    
ref|XP_003653131.1|  hypothetical protein THITE_2115207                 112   4e-25    
ref|XP_007807669.1|  PBSP domain protein                                111   5e-25    
gb|KEF55067.1|  hypothetical protein A1O9_08720                         110   6e-25    
gb|EQB44973.1|  plant Basic Secretory protein                           112   6e-25    
ref|XP_007917554.1|  putative pbsp domain-containing protein            112   6e-25    
gb|ELU45618.1|  BSP domain-containing protein                           113   7e-25    
ref|XP_003660460.1|  hypothetical protein MYCTH_2298824                 111   8e-25    
ref|XP_003719639.1|  hypothetical protein MGG_04184                     112   9e-25    
gb|KFH40795.1|  hypothetical protein ACRE_085060                        110   9e-25    
ref|XP_010068399.1|  PREDICTED: uncharacterized protein LOC104455282    108   2e-24    
gb|KDQ63167.1|  hypothetical protein JAAARDRAFT_120420                  109   2e-24    
gb|KID92101.1|  PBSP domain protein                                     109   2e-24    
ref|XP_003842756.1|  hypothetical protein LEMA_P085160.1                110   2e-24    
ref|XP_007284236.1|  pbsp domain-containing protein                     110   2e-24    
gb|EFW98677.1|  NADH-ubiquinone oxidoreductase                          114   4e-24    
ref|XP_007734560.1|  hypothetical protein A1O3_06250                    109   4e-24    
ref|XP_007793733.1|  putative pbsp domain-containing protein            110   4e-24    
ref|XP_007687166.1|  hypothetical protein COCMIDRAFT_76552              107   4e-24    
gb|AFG52519.1|  hypothetical protein CL1752Contig1_03                   102   8e-24    
ref|XP_009160726.1|  hypothetical protein HMPREF1120_08233              108   9e-24    
gb|ENH80787.1|  pbsp domain protein                                     108   1e-23    
ref|XP_007762077.1|  hypothetical protein A1O7_09903                    107   1e-23    
gb|KIH90201.1|  PBSP domain-containing protein                          108   1e-23    
ref|XP_002972397.1|  hypothetical protein SELMODRAFT_97026              107   1e-23    
gb|ERS97802.1|  hypothetical protein HMPREF1624_05973                   108   1e-23    
gb|KEQ70811.1|  BSP-domain-containing protein                           107   2e-23    
ref|XP_007802850.1|  hypothetical protein EPUS_00630                    108   2e-23    
ref|XP_007822541.1|  PBSP domain protein                                106   2e-23    
ref|XP_008715373.1|  hypothetical protein HMPREF1541_02796              107   2e-23    
gb|EPE06050.1|  pbsp domain-containing protein                          107   2e-23    
gb|EMD85965.1|  hypothetical protein COCHEDRAFT_1024204                 107   3e-23    
ref|XP_007676213.1|  hypothetical protein BAUCODRAFT_47939              105   3e-23    
ref|XP_008730912.1|  hypothetical protein G647_08378                    106   4e-23    
emb|CCF36359.1|  plant Basic Secretory protein                          106   5e-23    
ref|XP_007298165.1|  plant basic secretory protein                      105   5e-23    
ref|XP_007602717.1|  plant Basic Secretory protein                      106   6e-23    
gb|KID79217.1|  PBSP domain protein                                     104   1e-22    
gb|KIE02235.1|  PBSP domain protein                                     104   1e-22    
gb|KDN70568.1|  putative plant Basic Secretory protein                  105   2e-22    
gb|KFG83548.1|  PBSP domain protein                                     104   2e-22    
gb|KHN94225.1|  PBSP domain protein                                     104   2e-22    
gb|EUC66554.1|  peptidase                                               103   2e-22    
ref|XP_008026216.1|  hypothetical protein SETTUDRAFT_169330             103   2e-22    
ref|XP_009218999.1|  hypothetical protein GGTG_02957                    104   2e-22    
gb|EJU03372.1|  BSP-domain-containing protein                           103   2e-22    
ref|XP_001392666.1|  PBSP domain protein                                103   3e-22    
gb|KDN51229.1|  hypothetical protein RSAG8_00858                        103   4e-22    
ref|XP_009253940.1|  hypothetical protein FPSE_02546                    102   7e-22    
ref|XP_002966185.1|  hypothetical protein SELMODRAFT_86137            98.2    7e-22    
ref|XP_007289643.1|  plant Basic Secretory protein                      103   8e-22    
ref|XP_386366.1|  hypothetical protein FG06190.1                        102   8e-22    
emb|CCA74993.1|  related to pathogenesis-related protein NtPRp27        102   8e-22    
gb|KFA77930.1|  hypothetical protein S40288_02479                       102   8e-22    
gb|KFA65209.1|  hypothetical protein S40285_01537                       102   8e-22    
gb|KEY74250.1|  hypothetical protein S7711_00407                        102   8e-22    
ref|XP_009614757.1|  PREDICTED: uncharacterized protein LOC104107608  99.0    9e-22    
gb|KEQ84172.1|  plant basic secretory protein                           102   1e-21    
gb|EHA18130.1|  hypothetical protein ASPNIDRAFT_175666                  102   1e-21    
ref|XP_008087131.1|  hypothetical protein GLAREA_01724                  102   1e-21    
gb|KDB15579.1|  PBSP domain protein                                     103   1e-21    
ref|XP_003848895.1|  hypothetical protein MYCGRDRAFT_76388              102   1e-21    
gb|EMT33762.1|  hypothetical protein F775_26861                       98.2    1e-21    
gb|ESZ98689.1|  plant Basic Secretory protein                           102   1e-21    
dbj|GAA88507.1|  PBSP domain protein                                    102   2e-21    
ref|XP_003295755.1|  hypothetical protein PTT_02686                     101   2e-21    
gb|EWG45330.1|  hypothetical protein FVEG_06154                         101   2e-21    
gb|KEQ63491.1|  PBSP domain protein                                     101   2e-21    
emb|CCT63876.1|  related to pathogenesis-related protein NtPRp27        100   2e-21    
gb|EXA01488.1|  hypothetical protein FOWG_01331                         101   2e-21    
gb|EXA48325.1|  hypothetical protein FOVG_05117                         101   2e-21    
gb|EWY96753.1|  hypothetical protein FOYG_05348                         101   2e-21    
ref|XP_001597133.1|  hypothetical protein SS1G_01327                    102   2e-21    
gb|ENH69132.1|  hypothetical protein FOC1_g10010309                     100   3e-21    
gb|EFQ33207.1|  plant Basic Secretory protein                           101   3e-21    
ref|XP_001873484.1|  predicted protein                                99.8    3e-21    
gb|EGU84242.1|  hypothetical protein FOXB_05199                         100   3e-21    
gb|EMS22237.1|  PBSP domain protein                                     100   3e-21    
ref|XP_007726706.1|  hypothetical protein A1O1_07649                    100   5e-21    
ref|XP_007784558.1|  hypothetical protein W97_08501                     100   5e-21    
gb|EXK32175.1|  hypothetical protein FOMG_12466                         100   6e-21    
ref|XP_011124824.1|  hypothetical protein AOL_s00109g41                 101   6e-21    
gb|KDQ07294.1|  hypothetical protein BOTBODRAFT_38911                 99.4    7e-21    
ref|XP_001551481.1|  hypothetical protein BC1G_09751                    100   7e-21    
gb|EMR91002.1|  putative pbsp domain-containing protein                 100   7e-21    
emb|CCD46128.1|  hypothetical protein BofuT4_P116780.1                  100   7e-21    
ref|XP_011106685.1|  hypothetical protein H072_693                      100   1e-20    
ref|XP_001796300.1|  hypothetical protein SNOG_05906                  99.4    2e-20    
ref|XP_007923496.1|  hypothetical protein MYCFIDRAFT_210409           98.2    2e-20    
emb|CCE28116.1|  related to pathogenesis-related protein NtPRp27      97.4    3e-20    
gb|EIT78751.1|  PBSP domain protein                                   97.8    5e-20    
ref|XP_001727624.1|  PBSP domain protein                              97.8    5e-20    
ref|XP_002375917.1|  PBSP domain protein                              97.8    5e-20    
ref|XP_009849333.1|  hypothetical protein NEUTE1DRAFT_78736           97.1    8e-20    
gb|KEY81372.1|  hypothetical protein PBSP                             97.4    8e-20    
gb|KEQ91086.1|  hypothetical protein AUEXF2481DRAFT_50895             95.9    1e-19    
gb|ESA42845.1|  PBSP domain-containing protein                        95.9    2e-19    
emb|CCC06829.1|  unnamed protein product                              95.9    2e-19    
ref|XP_003349966.1|  hypothetical protein SMAC_00858                  95.5    3e-19    
ref|XP_006962160.1|  predicted protein                                95.1    3e-19    
ref|XP_001935611.1|  hypothetical protein PTRG_05278                  93.6    3e-19    
ref|XP_752642.1|  PBSP domain protein                                 95.5    3e-19    
ref|XP_002146273.1|  PBSP domain protein                              95.1    4e-19    
emb|CAF31990.1|  hypothetical protein, conserved                      95.1    4e-19    
emb|CEJ88152.1|  hypothetical protein VHEMI04626                      94.4    4e-19    
ref|XP_002848748.1|  PBSP domain-containing protein                   95.1    4e-19    
ref|XP_002464442.1|  hypothetical protein SORBIDRAFT_01g018506        90.9    6e-19    
ref|XP_009540379.1|  hypothetical protein HETIRDRAFT_58706            92.0    2e-18    
ref|XP_001264492.1|  PBSP domain protein                              92.8    2e-18    
ref|XP_001910218.1|  hypothetical protein                             92.4    3e-18    
gb|EHK22180.1|  hypothetical protein TRIVIDRAFT_28248                 91.7    3e-18    
ref|XP_001268987.1|  PBSP domain protein                              92.4    4e-18    
ref|XP_007831039.1|  hypothetical protein PFICI_04267                 91.7    6e-18    
gb|EGD93164.1|  PBSP domain-containing protein                        91.7    6e-18    
gb|EZF31714.1|  hypothetical protein H101_04691                       91.7    6e-18    
gb|EZF78287.1|  hypothetical protein H105_00679                       91.7    6e-18    
gb|EZF27329.1|  hypothetical protein H100_00685                       91.7    6e-18    
gb|KDB27786.1|  hypothetical protein H109_00428                       91.7    6e-18    
ref|XP_003231505.1|  PBSP domain-containing protein                   91.3    7e-18    
gb|EME47759.1|  hypothetical protein DOTSEDRAFT_167086                90.9    7e-18    
ref|XP_007848540.1|  pbsp domain protein                              91.3    7e-18    
gb|EGU12955.1|  Proteophosphoglycan ppg4                              94.7    7e-18    
gb|EWC48498.1|  hypothetical protein DRE_07742                        92.4    8e-18    
ref|XP_003174209.1|  PBSP domain-containing protein                   90.9    1e-17    
ref|XP_001223830.1|  hypothetical protein CHGG_04616                  90.1    1e-17    
gb|AAD03369.1|  unknown protein                                       85.9    3e-17    
ref|XP_006680105.1|  hypothetical protein BATDEDRAFT_89950            91.3    3e-17    
gb|EHK43315.1|  hypothetical protein TRIATDRAFT_258514                88.6    3e-17    
ref|XP_006600105.1|  PREDICTED: uncharacterized protein LOC102666548  85.1    4e-17    
ref|XP_002544115.1|  conserved hypothetical protein                   88.2    4e-17    
gb|EEH06523.1|  PBSP domain-containing protein                        89.4    6e-17    
gb|EER40703.1|  PBSP domain-containing protein                        88.6    1e-16    
gb|EAS31697.2|  PBSP domain-containing protein                        87.0    2e-16    
ref|XP_003014947.1|  hypothetical protein ARB_06706                   87.4    2e-16    
ref|XP_962280.2|  hypothetical protein NCU07694                       86.7    2e-16    
gb|ESA42844.1|  PBSP domain-containing protein, variant               86.7    3e-16    
gb|EPS25425.1|  hypothetical protein PDE_00358                        86.7    4e-16    
ref|XP_002790439.1|  PBSP domain-containing protein                   86.7    5e-16    
ref|XP_003021871.1|  hypothetical protein TRV_04048                   85.9    6e-16    
ref|XP_010758605.1|  hypothetical protein PADG_02796                  85.9    1e-15    
gb|EEH17823.1|  hypothetical protein PABG_00386                       85.5    1e-15    
emb|CDM28709.1|  Uncharacterised protein family, basic secretory ...  85.1    1e-15    
gb|KGO46575.1|  Uncharacterized protein family, basic secretory p...  84.7    2e-15    
ref|XP_010041966.1|  PREDICTED: uncharacterized protein LOC104430954  82.4    2e-15    
gb|EFW13855.1|  PBSP domain-containing protein                        83.6    3e-15    
ref|XP_003070063.1|  Plant Basic Secretory Protein containing pro...  83.6    3e-15    
ref|WP_006038083.1|  carbohydrate-binding protein                     85.9    4e-15    
ref|XP_002627983.1|  PBSP domain-containing protein                   84.0    6e-15    
ref|XP_002559548.1|  Pc13g11300                                       83.2    6e-15    
emb|CDX71204.1|  BnaC07g04830D                                        77.8    7e-15    
dbj|GAM42955.1|  PBSP domain protein                                  82.8    8e-15    
gb|EEQ88780.1|  PBSP domain-containing protein                        82.8    1e-14    
ref|XP_009395214.1|  PREDICTED: uncharacterized protein LOC103980500  82.0    2e-14    
gb|KDE03324.1|  hypothetical protein MVLG_06194                       79.3    3e-14    
gb|KGO68254.1|  Uncharacterized protein family, basic secretory p...  80.9    4e-14    
gb|EKV05788.1|  hypothetical protein PDIG_79850                       80.5    4e-14    
ref|WP_009673949.1|  MULTISPECIES: carbohydrate-binding protein       82.4    4e-14    
ref|WP_036576596.1|  hypothetical protein                             78.6    7e-14    
ref|WP_023399105.1|  Plant Basic secretory protein                    79.3    7e-14    
emb|CDO03568.1|  Plant Basic Secretory Protein                        79.0    9e-14    
ref|WP_039610425.1|  secretion protein                                78.6    1e-13    
ref|XP_007002687.1|  hypothetical protein TREMEDRAFT_60022            80.1    1e-13    
ref|XP_002971873.1|  hypothetical protein SELMODRAFT_59499            75.5    2e-13    
ref|XP_009381678.1|  PREDICTED: uncharacterized protein LOC103969752  78.6    2e-13    
ref|XP_007882474.1|  hypothetical protein PFL1_06737                  79.7    3e-13    
emb|CBI22518.3|  unnamed protein product                              75.9    3e-13    
ref|XP_007200505.1|  hypothetical protein PRUPE_ppa012897mg           75.1    6e-13    
dbj|GAD96526.1|  PBSP domain protein                                  77.8    6e-13    
ref|WP_017216857.1|  secretion protein                                76.6    6e-13    
ref|WP_010605505.1|  secretion protein                                76.6    6e-13    
ref|WP_036682319.1|  hypothetical protein                             78.6    7e-13    
ref|XP_006573908.1|  PREDICTED: uncharacterized protein LOC102661582  73.6    9e-13    
ref|XP_003196343.1|  hypothetical protein CGB_J0300W                  77.4    9e-13    
ref|XP_007010005.1|  Uncharacterized protein TCM_043303               73.6    2e-12    
gb|AFR97327.1|  hypothetical protein CNAG_04889                       75.9    2e-12    
ref|NP_179120.2|  basic secretory protein family protein              72.0    3e-12    
gb|EQL03534.1|  putative protein family, basic secretory protein      76.6    3e-12    
ref|WP_025851809.1|  hypothetical protein                             76.6    3e-12    
ref|WP_039478972.1|  secretory protein                                75.1    5e-12    
ref|WP_036706352.1|  hypothetical protein                             76.3    5e-12    
ref|WP_039833192.1|  hypothetical protein                             75.9    6e-12    
ref|WP_006038085.1|  carbohydrate-binding protein                     76.3    6e-12    
ref|WP_039787791.1|  hypothetical protein                             75.5    9e-12    
ref|WP_039495311.1|  secretion protein                                73.2    1e-11    
gb|AAM76750.1|  hypothetical protein                                  69.7    2e-11    
ref|WP_012793161.1|  secretory protein                                72.0    2e-11    
ref|WP_005492338.1|  putative secretory protein                       72.0    3e-11    
ref|WP_010378698.1|  secretion protein                                71.2    4e-11    
ref|WP_021032827.1|  Basic Secretory Protein                          70.9    5e-11    
ref|WP_021190050.1|  hypothetical protein                             70.9    5e-11    
ref|WP_010491675.1|  coagulation factor 5/8 type-like protein         73.2    5e-11    
gb|EMT17703.1|  hypothetical protein F775_43141                       68.6    6e-11    
ref|WP_025145101.1|  secretory protein                                72.0    6e-11    
ref|WP_010361953.1|  secretion protein                                70.9    7e-11    
ref|WP_037533803.1|  secretory protein                                70.1    8e-11    
ref|WP_012790458.1|  secretory protein                                70.5    1e-10    
ref|WP_038701341.1|  secretory protein                                70.1    1e-10    
ref|WP_010601564.1|  secretory protein                                70.9    2e-10    
gb|KGB80059.1|  hypothetical protein CNBG_5815                        70.5    2e-10    
ref|WP_017216733.1|  hypothetical protein                             71.2    2e-10    
ref|WP_010373072.1|  hypothetical protein                             70.9    2e-10    
ref|XP_002478574.1|  PBSP domain protein                              69.7    3e-10    
emb|CBI29656.3|  unnamed protein product                              62.4    3e-10    
ref|WP_039495092.1|  hypothetical protein                             70.9    3e-10    
emb|CDT06458.1|  conserved exported hypothetical protein              68.6    4e-10    
gb|AAD25574.1|  hypothetical protein                                  66.6    4e-10    
ref|WP_010361841.1|  hypothetical protein                             68.9    1e-09    
gb|KEQ30732.1|  secretory protein                                     66.6    2e-09    
ref|WP_037439149.1|  secretory protein                                66.2    2e-09    
ref|WP_037317843.1|  secretory protein                                65.9    2e-09    
ref|XP_001543729.1|  predicted protein                                66.6    4e-09    
ref|WP_014221722.1|  secretory protein                                65.5    4e-09    
ref|WP_014218021.1|  secretory protein                                65.5    5e-09    
ref|XP_007206958.1|  hypothetical protein PRUPE_ppb018642mg           62.8    5e-09    
ref|WP_034244538.1|  hypothetical protein                             64.7    8e-09    
ref|WP_013111499.1|  hypothetical protein                             64.3    8e-09    
sp|C0HJG8.1|BSP_BOSSE  RecName: Full=Basic secretory protease; Al...  61.2    1e-08    
ref|WP_010605362.1|  hypothetical protein                             65.9    1e-08    
ref|XP_006484851.1|  PREDICTED: uncharacterized protein LOC102627682  64.7    1e-08    
ref|WP_021259304.1|  coagulation factor 5/8 type-like protein         65.9    2e-08    
ref|WP_009836632.1|  secretion protein                                63.9    2e-08    
ref|XP_008782162.1|  PREDICTED: uncharacterized protein LOC103701767  64.3    2e-08    
ref|WP_029282850.1|  secretory protein                                64.7    2e-08    
ref|WP_013071585.1|  secretory protein                                63.2    2e-08    
ref|WP_035097264.1|  hypothetical protein                             63.2    3e-08    
ref|WP_002650061.1|  hypothetical protein                             63.5    3e-08    
ref|XP_010035918.1|  PREDICTED: uncharacterized protein LOC104425043  63.9    3e-08    



>gb|AFN85535.1| PRp27-like protein [Olea europaea subsp. europaea]
Length=229

 Score =   350 bits (899),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 196/227 (86%), Gaps = 3/227 (1%)
 Frame = +2

Query  32   DRITLSLCI--LILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANF  205
            + ITL LC   L + AAI G  AV+YT TNTAANTPGG RF   IGE+YS Q LDAA NF
Sbjct  3    NSITLCLCFSSLAILAAIQGIHAVDYTFTNTAANTPGGVRFTNEIGEQYSIQTLDAATNF  62

Query  206  IWRVFQQNS-PGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVL  382
            IW++FQQ++ P DRK+VQKVS+F+DDMDGVAYASNNEIHVSARYI GYSGDVK EITGVL
Sbjct  63   IWKIFQQDTTPADRKNVQKVSLFIDDMDGVAYASNNEIHVSARYIQGYSGDVKTEITGVL  122

Query  383  YHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLD  562
            YHE THIWQWNGNG A GGLIEGIAD+VRLKAGYAPSHW KPGEGDRWD GYDVTARFLD
Sbjct  123  YHEMTHIWQWNGNGQAPGGLIEGIADYVRLKAGYAPSHWVKPGEGDRWDQGYDVTARFLD  182

Query  563  YCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            YC+ L++GFVAELN KM++GY+++YF D+LGKTVDQLW DYKAKYNT
Sbjct  183  YCDSLRSGFVAELNKKMRDGYNNTYFVDLLGKTVDQLWMDYKAKYNT  229



>emb|CDP10877.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   346 bits (888),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = +2

Query  47   SLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ  226
            ++ + +L A I G  AVEY VTNTAA+TPGGARF + IG +YSKQ LD+AANFIWR+FQ+
Sbjct  13   AVILFLLAAVIQGSHAVEYAVTNTAASTPGGARFGRDIGVQYSKQTLDSAANFIWRIFQE  72

Query  227  NSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIW  406
            N+P DRK+VQKV MFVDDMDGVAY SN++IHVSARYI GYSGDV+ EITG LYHE TH+W
Sbjct  73   NAPADRKNVQKVDMFVDDMDGVAYTSNDQIHVSARYIQGYSGDVRREITGALYHEMTHVW  132

Query  407  QWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNG  586
            QW GNG A  GLIEGIAD+VRL+AGYAPSHW KPG+GD+WD GYDVTARFLDYCN LKNG
Sbjct  133  QWKGNGQAPEGLIEGIADYVRLQAGYAPSHWVKPGQGDQWDQGYDVTARFLDYCNSLKNG  192

Query  587  FVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
            FVA+LN KM NGYS++YF ++LGK+VDQLW DYKAK+NTN
Sbjct  193  FVAQLNKKMGNGYSNNYFVELLGKSVDQLWNDYKAKFNTN  232



>ref|XP_009630650.1| PREDICTED: uncharacterized protein LOC104120561 [Nicotiana tomentosiformis]
 ref|XP_009600942.1| PREDICTED: uncharacterized protein LOC104096292 [Nicotiana tomentosiformis]
Length=227

 Score =   338 bits (867),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            L+  ++IL        AV+Y VTN A NTPGGARFN+ IG +YSKQ L AA +FIW++FQ
Sbjct  8    LASLLIILAIFTPEIHAVDYAVTNRATNTPGGARFNRDIGAQYSKQTLSAATSFIWKIFQ  67

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QNSP DRK+VQKVSMFVDDM GVAYASNNEIHVSARYI  YSG+VK EITGVLYHESTHI
Sbjct  68   QNSPADRKNVQKVSMFVDDMGGVAYASNNEIHVSARYIQSYSGNVKREITGVLYHESTHI  127

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG A GGLIEGIAD+VRLKAG+APSHW KPG+GDRWD GYDVTARFLDYCN L+N
Sbjct  128  WQWNGNGRAPGGLIEGIADYVRLKAGFAPSHWVKPGQGDRWDQGYDVTARFLDYCNSLRN  187

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            GFVA+LN KM+NGYS+ +F D+LGKTVDQLW DYKAK++
Sbjct  188  GFVAQLNKKMRNGYSNQFFVDLLGKTVDQLWRDYKAKFS  226



>ref|XP_002518664.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43589.1| conserved hypothetical protein [Ricinus communis]
Length=225

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M   TL L +L+  A I G  AVEYTVTNTA +T GGARF+  IGE+YS Q L AA +FI
Sbjct  1    MSPHTLILSLLVTLATIQGNYAVEYTVTNTAGSTAGGARFSAEIGEDYSLQTLSAATDFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            WR+FQQ +  DRK+VQKVS+F+DDMDGVAYASNNEIHVSARYI GYSGD+K E TGV+YH
Sbjct  61   WRLFQQPNAEDRKNVQKVSLFIDDMDGVAYASNNEIHVSARYIGGYSGDLKREYTGVIYH  120

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E THIWQWNGNG A GGLIEGIADFVRLKA YAPSHW +PG+GDRWD GYDVTARFLDYC
Sbjct  121  EMTHIWQWNGNGQAPGGLIEGIADFVRLKANYAPSHWVQPGQGDRWDQGYDVTARFLDYC  180

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            NDL+NGFVAELN KMK+GYSD +F D+LGK+VDQLW+DYKAKY
Sbjct  181  NDLRNGFVAELNKKMKDGYSDQFFVDLLGKSVDQLWSDYKAKY  223



>emb|CDO97229.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +2

Query  80   HGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQK  259
             G  AVEYTVTN+AA+TPGGARF + IG +Y+KQ LD+A NFIWR+FQ+N+P DRK+VQ+
Sbjct  22   QGSHAVEYTVTNSAASTPGGARFERDIGVQYTKQTLDSATNFIWRIFQENAPADRKNVQR  81

Query  260  VSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaangg  439
            V MFVDDMDGVAY SN++IHVSARYI GYSGDV+ EITGVLYHE TH+WQWNGNG A GG
Sbjct  82   VDMFVDDMDGVAYTSNDQIHVSARYIQGYSGDVRSEITGVLYHEMTHVWQWNGNGQAPGG  141

Query  440  LIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKN  619
            LIEGIAD+VRLKAGYAPSHW KPG+GDRWD GYDVTARFLDYCN LKNGFVA+LN KM+N
Sbjct  142  LIEGIADYVRLKAGYAPSHWVKPGQGDRWDQGYDVTARFLDYCNSLKNGFVAQLNNKMRN  201

Query  620  GYSDSYFSDILGKTVDQLWTDYKAKYN  700
            GYS+ YF ++LGK+VDQLW DYKAK+N
Sbjct  202  GYSNDYFVELLGKSVDQLWNDYKAKFN  228



>ref|XP_009784386.1| PREDICTED: uncharacterized protein LOC104232799 [Nicotiana sylvestris]
Length=227

 Score =   335 bits (858),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = +2

Query  35   RITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR  214
            +I     + +L        AV+Y+VTNTAANT GGARFN+ IG +YS+Q L AA +FIW 
Sbjct  5    KIFFFSSLFVLAIFTQKIHAVDYSVTNTAANTAGGARFNRDIGAQYSQQTLAAATSFIWN  64

Query  215  VFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
             FQQNSP DRK+VQKVSMFVDDMDGVAYASNNEIHVSA YI GYSGDV+ EITGVLYHES
Sbjct  65   TFQQNSPADRKNVQKVSMFVDDMDGVAYASNNEIHVSASYIQGYSGDVRREITGVLYHES  124

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            TH+WQWNGNG A GGLIEGIAD+VRLKAG+APSHW KPG+GDRWD GYDVTARFLDYCN 
Sbjct  125  THVWQWNGNGGAPGGLIEGIADYVRLKAGFAPSHWVKPGQGDRWDQGYDVTARFLDYCNS  184

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            L+NGFVA+LN KM+ GYS+ +F D+LGKTVDQLW+DYKAK+
Sbjct  185  LRNGFVAQLNKKMRTGYSNQFFIDLLGKTVDQLWSDYKAKF  225



>dbj|BAA81904.1| NtPRp27 [Nicotiana tabacum]
Length=242

 Score =   335 bits (858),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = +2

Query  20   KTSMDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAA  199
            K +  +I     + +L        AV+Y+VTNTAANT GGARFN+ IG +YS+Q L AA 
Sbjct  15   KRAHHKIFFFYSLFVLAIFTQKIHAVDYSVTNTAANTAGGARFNRDIGAQYSQQTLAAAT  74

Query  200  NFIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGV  379
            +FIW  FQQN P DRK+VQKVSMFVDDMDGVAYASNNEIHVSA YI GYSGDV+ EITGV
Sbjct  75   SFIWNTFQQNFPADRKNVQKVSMFVDDMDGVAYASNNEIHVSASYIQGYSGDVRREITGV  134

Query  380  LYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFL  559
            LYHESTH+WQWNGNG A GGLIEGIAD+VRLKAG+APSHW KPG+GDRWD GYDVTARFL
Sbjct  135  LYHESTHVWQWNGNGGAPGGLIEGIADYVRLKAGFAPSHWVKPGQGDRWDQGYDVTARFL  194

Query  560  DYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            DYCN L+NGFVA+LN KM+ GYS+ +F D+LGKTVDQLW+DYKAK+
Sbjct  195  DYCNSLRNGFVAQLNKKMRTGYSNQFFIDLLGKTVDQLWSDYKAKF  240



>gb|EYU42704.1| hypothetical protein MIMGU_mgv1a012982mg [Erythranthe guttata]
Length=234

 Score =   334 bits (856),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 188/233 (81%), Gaps = 0/233 (0%)
 Frame = +2

Query  5    IKEIAKTSMDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQV  184
            +K I    M  + L L  L + +A+ G  AV+YTVTNTAA+T GGARF + IG +Y+ Q 
Sbjct  1    MKSIKYNKMVNLVLILSSLAILSALQGILAVQYTVTNTAASTAGGARFVRDIGVQYTLQS  60

Query  185  LDAAANFIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKG  364
            ++A+  +IWR FQQN+  DRK VQ VS+F+DDMDGVAYASNN+IHVSARYI  YSGDVK 
Sbjct  61   MNASTGYIWRTFQQNTAADRKTVQTVSLFIDDMDGVAYASNNQIHVSARYIQSYSGDVKK  120

Query  365  EITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDV  544
            E TGVLYHE THIWQWNGNG   GGLIEG+ADFVRLKAGYAPSHW  PG+GDRWD GYDV
Sbjct  121  EFTGVLYHEMTHIWQWNGNGQTPGGLIEGVADFVRLKAGYAPSHWVGPGKGDRWDQGYDV  180

Query  545  TARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            TARFLDYCN L+NGFVAELN KMK GYS+SYF D+LGKTVDQLWTDYKAKY T
Sbjct  181  TARFLDYCNGLRNGFVAELNKKMKTGYSNSYFVDLLGKTVDQLWTDYKAKYAT  233



>ref|NP_001275036.1| NtPRp27-like protein precursor [Solanum tuberosum]
 gb|AAO22065.1| NtPRp27-like protein [Solanum tuberosum]
Length=226

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  53   CILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNS  232
             + +L        AV+Y+VTNTAANTPGGARF++ IG +YS+Q L AA +FIW +FQQNS
Sbjct  10   SLFVLAIFTQKIDAVDYSVTNTAANTPGGARFDRDIGAQYSQQTLVAATSFIWNIFQQNS  69

Query  233  PGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW  412
            P DRK+V KVSMFVDDMDGVAYASNNEIHVSARYI GYSGDV+ EITGVLYHE+TH+WQW
Sbjct  70   PADRKNVPKVSMFVDDMDGVAYASNNEIHVSARYIQGYSGDVRREITGVLYHEATHVWQW  129

Query  413  ngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFV  592
            NGNG A GGLIEGIAD+VRLKAG  PSHW KPG+G+RWD GYDVTA+FLDYCN L+NGFV
Sbjct  130  NGNGGAPGGLIEGIADYVRLKAGLGPSHWVKPGQGNRWDQGYDVTAQFLDYCNSLRNGFV  189

Query  593  AELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            AELN KM+NGYSD +F D+LGKTVDQLW+DYKAK+
Sbjct  190  AELNKKMRNGYSDQFFVDLLGKTVDQLWSDYKAKF  224



>ref|XP_004230730.1| PREDICTED: uncharacterized protein LOC101249498 [Solanum lycopersicum]
Length=232

 Score =   332 bits (851),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 184/220 (84%), Gaps = 0/220 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            L+  I+IL        AV+YTVTN AANTPGGARFN+ IG +YSKQ L AA +FIW + Q
Sbjct  8    LASLIIILAIFTQKINAVDYTVTNRAANTPGGARFNREIGAQYSKQTLAAATSFIWNILQ  67

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QNSP DRK+VQK+SM+VDDM GVAYA  NEIHVSARYI  YSG+VK EITGVLYHE+THI
Sbjct  68   QNSPADRKNVQKISMYVDDMGGVAYAVGNEIHVSARYIQSYSGNVKREITGVLYHENTHI  127

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG A GGLIEGIAD+VRLKAGYAPSHW KPG+GDRWD GYDVTARFLDYCN LK+
Sbjct  128  WQWNGNGRAPGGLIEGIADYVRLKAGYAPSHWVKPGQGDRWDQGYDVTARFLDYCNSLKS  187

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            GFVA+LN KM+ GYS+ YF D++GKTVDQLW DYKAK+ T
Sbjct  188  GFVAQLNKKMRTGYSNQYFVDLMGKTVDQLWRDYKAKFPT  227



>ref|XP_009800743.1| PREDICTED: uncharacterized protein LOC104246599 [Nicotiana sylvestris]
Length=227

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            L+  ++IL        AV+Y VTN A NT GGARFN+ IG +YSKQ L A+ +FIW++FQ
Sbjct  8    LASLLIILAIFTPEIHAVDYAVTNRATNTAGGARFNRDIGAQYSKQTLAASTSFIWKIFQ  67

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QNSP DRK+VQKVSMFVDD+ GVAYASNNEIHVSARYI  YSG+VK EITGVLYHESTHI
Sbjct  68   QNSPADRKNVQKVSMFVDDIGGVAYASNNEIHVSARYIQSYSGNVKREITGVLYHESTHI  127

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG A GGLIEGIAD+VRLKAG+APSHW KPG+GDRWD GYDVTARFLDYCN L+N
Sbjct  128  WQWNGNGRAPGGLIEGIADYVRLKAGFAPSHWVKPGQGDRWDQGYDVTARFLDYCNSLRN  187

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GFVA+LN KM+NGYS+ +F D+LGKTVDQLW+DYKAK+
Sbjct  188  GFVAQLNKKMRNGYSNQFFVDLLGKTVDQLWSDYKAKF  225



>ref|XP_009625149.1| PREDICTED: uncharacterized protein LOC104116070 [Nicotiana tomentosiformis]
Length=226

 Score =   330 bits (847),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 184/221 (83%), Gaps = 0/221 (0%)
 Frame = +2

Query  35   RITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR  214
            +I     + +L        AV+Y+VTNTAANT GGARFN+ IG +YS+Q L AA +FIW 
Sbjct  4    KIFFISSLFVLAIFTQKIHAVDYSVTNTAANTAGGARFNRDIGAQYSQQTLAAATSFIWN  63

Query  215  VFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
             FQQNSP DRK+VQKVSMFVDDM GVAYASNNEIHVSARYI  YSGDV+ EITGVLYHES
Sbjct  64   TFQQNSPADRKNVQKVSMFVDDMGGVAYASNNEIHVSARYIQSYSGDVRREITGVLYHES  123

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            TH+WQWNGNG A GGLIEGIAD+VRLKA  APSHW KPG+GDRWD GYDVTARFLDYCN 
Sbjct  124  THVWQWNGNGGAPGGLIEGIADYVRLKADLAPSHWVKPGQGDRWDQGYDVTARFLDYCNS  183

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            L+NGFVA+LN KM+NGYS+ +F D+LGKTVDQLW+DYKAK+
Sbjct  184  LRNGFVAQLNQKMRNGYSNQFFVDLLGKTVDQLWSDYKAKF  224



>ref|XP_004229500.1| PREDICTED: uncharacterized protein LOC101249206 [Solanum lycopersicum]
Length=226

 Score =   328 bits (840),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = +2

Query  56   ILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSP  235
            + +L        AV+Y VTNTAANTPGGARF++ IG +YS+Q L AA +FIW +FQQNSP
Sbjct  11   LFVLAIFTQKMEAVDYFVTNTAANTPGGARFDRDIGAQYSQQTLVAATSFIWNIFQQNSP  70

Query  236  GDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWn  415
             DRKDV KV+MFVDDMDGVAYASNNEIHVSARYI GYSGDV+ EI GVLYHE+TH+WQWN
Sbjct  71   ADRKDVPKVNMFVDDMDGVAYASNNEIHVSARYIQGYSGDVRREIIGVLYHEATHVWQWN  130

Query  416  gngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVA  595
             N  A  GLIEGIAD+VRLKAG  PSHW KPG+GDRWD GYDVTA+FLDYCN+L+NGFVA
Sbjct  131  ANNGAPEGLIEGIADYVRLKAGLGPSHWVKPGQGDRWDQGYDVTAQFLDYCNNLRNGFVA  190

Query  596  ELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            ELN KM+NGY+D +F D+LGKTV+QLW DYKAK+
Sbjct  191  ELNKKMRNGYNDQFFVDLLGKTVNQLWGDYKAKF  224



>ref|XP_006346357.1| PREDICTED: uncharacterized protein LOC102601131 [Solanum tuberosum]
Length=237

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 183/220 (83%), Gaps = 0/220 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            L+  I+IL        AV+YTVTN A NTPGGARFN+ IG +YSKQ L AA +FIW +FQ
Sbjct  8    LASLIIILAIFTQKINAVDYTVTNRAVNTPGGARFNRDIGAQYSKQTLAAATSFIWNIFQ  67

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QNSP DRK+VQ ++M+VDDM GVAY S NEIHVSARYI  YSG+VK EITGVLYHE+THI
Sbjct  68   QNSPADRKNVQIINMYVDDMGGVAYTSGNEIHVSARYIQSYSGNVKREITGVLYHENTHI  127

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG A GGLIEGIAD+VRLKAGYAPSHW KPG+GDRWD GYDVTARFLDYCN LK+
Sbjct  128  WQWNGNGRAPGGLIEGIADYVRLKAGYAPSHWVKPGQGDRWDQGYDVTARFLDYCNSLKS  187

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            GFVA+LN KM+ GYS+ YF D++GKTVDQLW DYKAK+ T
Sbjct  188  GFVAQLNKKMRTGYSNQYFVDLMGKTVDQLWRDYKAKFPT  227



>emb|CAC40754.1| putative NtPRp27-like protein [Atropa belladonna]
Length=223

 Score =   324 bits (830),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = +2

Query  56   ILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSP  235
            +LIL        AVEYTVTN AANTPGGARF++ IG  YS+  L  + +FIWR+F+QNSP
Sbjct  3    LLILAIFTEKIHAVEYTVTNRAANTPGGARFDRDIGVPYSRLTLAFSTSFIWRIFEQNSP  62

Query  236  GDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWn  415
             DRK+VQK+SMFVDDMDGVAYA N+EIHVSARYI  YSGDV+ EI GVLYHE TH+WQWN
Sbjct  63   ADRKNVQKISMFVDDMDGVAYAVNDEIHVSARYIQSYSGDVRREIAGVLYHECTHVWQWN  122

Query  416  gngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVA  595
            GNG A GGLIEGIAD+VRLKAG APSHW KPG+GDRWD GYDVTARFLDYCN LKNGFVA
Sbjct  123  GNGRAPGGLIEGIADYVRLKAGLAPSHWVKPGQGDRWDQGYDVTARFLDYCNSLKNGFVA  182

Query  596  ELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +LN KM+NGYS+ +F ++LGKTVDQLW+DYKAK+
Sbjct  183  QLNKKMRNGYSNQFFVELLGKTVDQLWSDYKAKF  216



>gb|AFK40641.1| unknown [Medicago truncatula]
 gb|KEH44066.1| plant basic secretory protein (BSP) family protein [Medicago 
truncatula]
Length=224

 Score =   323 bits (829),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = +2

Query  56   ILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSP  235
             L+L A IHG +AV+Y+VTN A +TPGG RF   +G +Y+ Q LD+A  FIWRVFQQN+P
Sbjct  7    FLVLLAIIHGIQAVDYSVTNNALSTPGGVRFRDQLGAQYATQTLDSATQFIWRVFQQNNP  66

Query  236  GDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWn  415
             DRK+VQKVS+FVDDMDGVAY SNNEIH+SARY+N Y GD++ EITGVLYHE TH+WQWN
Sbjct  67   ADRKNVQKVSLFVDDMDGVAYTSNNEIHLSARYVNSYGGDLRKEITGVLYHEMTHVWQWN  126

Query  416  gngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVA  595
            GNG ANGGLIEGIAD+VRLKA YAPSHW KPG+G++WD GYDVTARFLDYC+ L++GFVA
Sbjct  127  GNGQANGGLIEGIADYVRLKANYAPSHWVKPGQGNKWDQGYDVTARFLDYCDTLRSGFVA  186

Query  596  ELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            ELN  M+NGYSD +F  +LGKTV+QLWT+YKAKY
Sbjct  187  ELNKLMRNGYSDQFFVQLLGKTVNQLWTEYKAKY  220



>ref|XP_011092712.1| PREDICTED: uncharacterized protein LOC105172834 [Sesamum indicum]
Length=247

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M    L L  L +  A+ G  AVE+TV+N AA T GGARF + IG +Y+ Q ++ +  FI
Sbjct  21   MANFMLILFSLAVLPAMRGVVAVEFTVSNNAAGTTGGARFERDIGAQYTLQTMNVSTEFI  80

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            WR FQQN P DRK +QKVS+FVDDMDGVAY  N++IHVSARYI GYSGDVK E TGVLYH
Sbjct  81   WRTFQQNVPSDRKTLQKVSLFVDDMDGVAYTVNDQIHVSARYIQGYSGDVKREFTGVLYH  140

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E TH+WQW+GNG A GGLIEGIADFVRLKAGYAPSHW KPG+GDRWD GYDVTARFLDYC
Sbjct  141  EMTHVWQWSGNGQAPGGLIEGIADFVRLKAGYAPSHWVKPGQGDRWDQGYDVTARFLDYC  200

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            N L++GFVAELN KMK+GYS++YF ++LGKTVDQLW DYKAKY T
Sbjct  201  NGLRSGFVAELNKKMKSGYSNNYFVELLGKTVDQLWKDYKAKYGT  245



>ref|XP_009595677.1| PREDICTED: uncharacterized protein LOC104091939 [Nicotiana tomentosiformis]
Length=215

 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFV  274
            V+Y  TN AANTPGG RFN+ IG +YSKQ L AAA+FIW++FQQNSP DRK+VQKVSMFV
Sbjct  10   VDYAGTNRAANTPGGVRFNRDIGAQYSKQTLAAAASFIWKIFQQNSPADRKNVQKVSMFV  69

Query  275  DDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGI  454
            DDM GVAY SNNEIHVSARYI  YSG+VK EI GVL HESTH+WQWNGNG A  GLIEGI
Sbjct  70   DDMGGVAYTSNNEIHVSARYIQSYSGNVKREIAGVLLHESTHVWQWNGNGGAPSGLIEGI  129

Query  455  ADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDS  634
            AD+VRLKAG APSHW KPG+GDRWD GY VTARFLDYCN L+NGFVA+LN KM+NGYS+ 
Sbjct  130  ADYVRLKAGLAPSHWVKPGQGDRWDQGYGVTARFLDYCNSLRNGFVAQLNKKMRNGYSNQ  189

Query  635  YFSDILGKTVDQLWTDYKAKYNT  703
            +F D+LGKTVDQLW DYKAK+ T
Sbjct  190  FFVDLLGKTVDQLWRDYKAKFRT  212



>ref|XP_011088200.1| PREDICTED: uncharacterized protein LOC105169499 [Sesamum indicum]
Length=227

 Score =   321 bits (823),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 188/222 (85%), Gaps = 1/222 (0%)
 Frame = +2

Query  38   ITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRV  217
            + + L  L + +A+ G  AVEY+VTNTAANTP GARF+  IG +Y+++ ++AA  FIW +
Sbjct  5    VFVMLSALAILSAMEGSSAVEYSVTNTAANTPLGARFDTDIGAQYTREAMNAATTFIWGI  64

Query  218  FQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHEST  397
            FQQN+P DRK V++VS+F+DDMDGVAYASNNEIHVSARYI GY+GDVK E TGVLYHE T
Sbjct  65   FQQNNPSDRKSVERVSLFIDDMDGVAYASNNEIHVSARYIQGYTGDVKTEFTGVLYHEMT  124

Query  398  HIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDL  577
            HIWQWNGNG   GGLIEGIADFVRLKAGYAPSHW K G+GDRWD GYDVTARFLDYC+ L
Sbjct  125  HIWQWNGNGQTPGGLIEGIADFVRLKAGYAPSHWVKAGQGDRWDQGYDVTARFLDYCDGL  184

Query  578  KNG-FVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            ++G FVAELN KM++GYSD +F ++LGK+V++LWTDYKAKY+
Sbjct  185  RSGTFVAELNKKMRDGYSDGFFQELLGKSVNELWTDYKAKYS  226



>gb|KDP45917.1| hypothetical protein JCGZ_15477 [Jatropha curcas]
Length=225

 Score =   321 bits (822),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 181/216 (84%), Gaps = 0/216 (0%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            L +L+  A IHG  AV+YTVTN A +T GGARF   IG++Y+K+ L AA +FIWRVFQQ 
Sbjct  8    LSLLVTLATIHGNHAVDYTVTNPATSTAGGARFTTDIGDDYAKKTLSAATDFIWRVFQQV  67

Query  230  SPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQ  409
            +  DRKDVQ+VS+F+DDMDGVAYASNNEIHVSA YI  YSGD+  E +GV+YHE THIWQ
Sbjct  68   NAEDRKDVQQVSLFIDDMDGVAYASNNEIHVSANYIGNYSGDLVREFSGVIYHEMTHIWQ  127

Query  410  WngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGF  589
            WNGNG   GGLIEGIADFVRLKA YAPSHW +PG+GD+WD GYDVTARFLDYCNDL+NGF
Sbjct  128  WNGNGQTPGGLIEGIADFVRLKANYAPSHWVQPGQGDKWDQGYDVTARFLDYCNDLRNGF  187

Query  590  VAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            VAELN KM+ GYS+ YF D+LGK+VDQLW+DYKAKY
Sbjct  188  VAELNKKMRTGYSNQYFVDLLGKSVDQLWSDYKAKY  223



>ref|XP_007143065.1| hypothetical protein PHAVU_007G040900g [Phaseolus vulgaris]
 gb|ESW15059.1| hypothetical protein PHAVU_007G040900g [Phaseolus vulgaris]
Length=221

 Score =   320 bits (821),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 175/216 (81%), Gaps = 4/216 (2%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            +C L+  AA+ G  AVEY+ TN A +TPGG RF   IGEEY+KQ LD+A  FIW +FQQN
Sbjct  6    VCFLLFLAAMQGTEAVEYSFTNNALSTPGGVRFRDEIGEEYTKQTLDSATQFIWGIFQQN  65

Query  230  SPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQ  409
            SP DRK V+KVS+FVDDMDGVAY SN+EIHVSARY+NGYSGDV+ EITGVLYHE  H+WQ
Sbjct  66   SPADRKSVEKVSLFVDDMDGVAYTSNDEIHVSARYVNGYSGDVRIEITGVLYHEMVHVWQ  125

Query  410  WngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGF  589
            W    +   G+IEGIAD+VRLKA YAPSHW+KPGEG +WD GYDVTA FLDYC+ LK+GF
Sbjct  126  W----SGPTGVIEGIADYVRLKANYAPSHWKKPGEGQKWDQGYDVTAHFLDYCDSLKSGF  181

Query  590  VAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            VA+LN +M++GYSD  F  +LGKTVDQLW +YKAKY
Sbjct  182  VAQLNQQMRSGYSDELFVQLLGKTVDQLWQEYKAKY  217



>ref|XP_004496932.1| PREDICTED: uncharacterized protein LOC101506848 [Cicer arietinum]
Length=225

 Score =   318 bits (814),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = +2

Query  47   SLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR-VFQ  223
            +LC L+L A IH  +A EY+VTNTA +TPGG RF   IG +Y+ Q LD+A  FIW  VFQ
Sbjct  4    TLCFLVLFATIHVTQAAEYSVTNTALSTPGGTRFRDQIGTQYATQTLDSATQFIWNNVFQ  63

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QN+P DRK V+KVS+F+DDMDGVAY SN+EIH+S RY+N Y GDV+ EITGVLYHE TH+
Sbjct  64   QNNPSDRKPVEKVSLFIDDMDGVAYTSNDEIHLSGRYVNSYIGDVRNEITGVLYHEMTHV  123

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG A GGLIEG+AD+VRLKA YAPSHW+K GEGD+WD GY+VTARFLDYC+ L+N
Sbjct  124  WQWNGNGEAPGGLIEGVADYVRLKANYAPSHWKKAGEGDKWDQGYEVTARFLDYCDGLRN  183

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GFVAELN  M++GYSD +F  +LGKTVDQLWT+YKAKY
Sbjct  184  GFVAELNKMMRSGYSDQFFVQLLGKTVDQLWTEYKAKY  221



>ref|XP_006486988.1| PREDICTED: uncharacterized protein LOC102627881 [Citrus sinensis]
Length=226

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = +2

Query  80   HGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQK  259
                AV+Y VTNTA  T GGARFN  IG +YSKQ L +A +FIWR FQQ +P DRK+VQK
Sbjct  19   QAVHAVDYVVTNTAPTTAGGARFNNEIGADYSKQTLASATDFIWRTFQQTNPADRKNVQK  78

Query  260  VSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaangg  439
            VS+FVDDMDGVAYASNNEIHVSARYI  YSGD+K EITGVLYHE THIWQWNGNG   GG
Sbjct  79   VSLFVDDMDGVAYASNNEIHVSARYIGSYSGDLKREITGVLYHEMTHIWQWNGNGQTPGG  138

Query  440  LIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKN  619
            LIEGIADFVRLKA YAPSHW +PG+GDRWD GYDVTARFLDY N L+NGFVAELN KM+ 
Sbjct  139  LIEGIADFVRLKANYAPSHWVQPGQGDRWDQGYDVTARFLDYLNSLRNGFVAELNKKMRT  198

Query  620  GYSDSYFSDILGKTVDQLWTDYKAKY  697
            GYS +YF ++LGK VDQLW+DYKAKY
Sbjct  199  GYSANYFVELLGKNVDQLWSDYKAKY  224



>ref|NP_001235031.1| uncharacterized protein LOC100306181 precursor [Glycine max]
 gb|ACU14241.1| unknown [Glycine max]
 gb|KHN42352.1| hypothetical protein glysoja_020064 [Glycine soja]
Length=225

 Score =   317 bits (812),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 180/221 (81%), Gaps = 1/221 (0%)
 Frame = +2

Query  47   SLCILI-LGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            SLC L+ L AA+ G  AV+YTVTN A +T GG RF   IG++Y+KQ LD+A  FIW V Q
Sbjct  5    SLCFLVFLAAAMQGTLAVDYTVTNNALSTSGGVRFRDAIGDDYAKQTLDSATQFIWGVLQ  64

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QN+P DRKDVQKV++FVDDMDGVAY SN+EIH+SARY+N YSGD+K EITGVLYHE  H+
Sbjct  65   QNAPADRKDVQKVNLFVDDMDGVAYTSNDEIHLSARYVNDYSGDLKTEITGVLYHEMVHV  124

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG    GLIEGIAD+VRLKA YAPSHW K G+G++WD GYDVTA FLDYC+ LK+
Sbjct  125  WQWNGNGQTPSGLIEGIADYVRLKANYAPSHWVKAGQGEKWDQGYDVTAHFLDYCDSLKS  184

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
            GFVA+LN +M++GYSD  F  +LGKTVDQLW DYKAKY T+
Sbjct  185  GFVAQLNQQMRDGYSDQLFVQLLGKTVDQLWQDYKAKYGTS  225



>gb|AFK45291.1| unknown [Lotus japonicus]
Length=225

 Score =   316 bits (810),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            + +LI   A+ G +AV+YTVTN A +TPGG RF   IGE  ++Q LD+A  FIWR+FQQN
Sbjct  6    IGLLIFLTAMQGTKAVDYTVTNKALSTPGGVRFRDQIGEASARQTLDSATQFIWRIFQQN  65

Query  230  SPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQ  409
            +  DRK+V+KVS+F+DDMDGVAY SNNEIH+SARY+N Y GD+K EI+GVLYHE  H+ Q
Sbjct  66   TAADRKNVEKVSLFIDDMDGVAYTSNNEIHLSARYVNSYGGDLKREISGVLYHEMVHVRQ  125

Query  410  WngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGF  589
            WNGNG A GGLIEGIAD+VRLKA YAPSHW KPG+G++WD GYDVTARFLDYCN LKNGF
Sbjct  126  WNGNGGAPGGLIEGIADYVRLKADYAPSHWVKPGQGNKWDHGYDVTARFLDYCNSLKNGF  185

Query  590  VAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            VAELN KM+ GYSD +F  ILGK+VDQLWTDYKAKY
Sbjct  186  VAELNKKMRTGYSDQFFVQILGKSVDQLWTDYKAKY  221



>ref|XP_010908301.1| PREDICTED: uncharacterized protein LOC105034737 [Elaeis guineensis]
Length=224

 Score =   315 bits (808),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 184/223 (83%), Gaps = 1/223 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M  ++L +  L+  A +   RAVEY V+N AA TPGG RF+  IG +YSKQVL+AA++FI
Sbjct  1    MALLSLFIASLLASATLDTARAVEYEVSNNAAGTPGGTRFDNEIGLDYSKQVLEAASSFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            W  F+Q S GDRKDVQ +++ ++ MDGVAY SNN IHVSA YI  YSGDVK EITGVLYH
Sbjct  61   WSTFEQ-SEGDRKDVQLITLVIETMDGVAYTSNNGIHVSANYIASYSGDVKTEITGVLYH  119

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E TH+WQWNGNGAA GGLIEGIAD+VRLKAGYAPSHW KPG+GDRWD GYDVTARFLDYC
Sbjct  120  EMTHVWQWNGNGAAPGGLIEGIADYVRLKAGYAPSHWVKPGQGDRWDQGYDVTARFLDYC  179

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            + LK+GFVA+LNAKMKNGYSD +F ++LGKTVDQLW DYKAKY
Sbjct  180  DSLKSGFVAQLNAKMKNGYSDDFFVELLGKTVDQLWNDYKAKY  222



>gb|KHN42351.1| hypothetical protein glysoja_020063 [Glycine soja]
Length=225

 Score =   315 bits (806),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 176/220 (80%), Gaps = 0/220 (0%)
 Frame = +2

Query  38   ITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRV  217
            I  +LC L+  +A+H   AVEYTVTN A +TPGG  F   IG EY+K+ LD+A  FIWR+
Sbjct  2    INHALCFLVFLSALHATHAVEYTVTNNALSTPGGVAFRDKIGAEYAKRTLDSATQFIWRI  61

Query  218  FQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHEST  397
            FQQN+P DRK+VQKVS+FVDDMDGVAY SNN+IH+SARY+    GDVK EITGVLYHE  
Sbjct  62   FQQNNPSDRKNVQKVSLFVDDMDGVAYTSNNQIHLSARYVGNNKGDVKTEITGVLYHEMV  121

Query  398  HIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDL  577
            H+WQW+GNG A GGLIEGIAD+VRLKA YAPSHW K G+G +WD GYDVTARFLDYC+ L
Sbjct  122  HVWQWSGNGRAPGGLIEGIADYVRLKANYAPSHWVKAGQGQKWDQGYDVTARFLDYCDSL  181

Query  578  KNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            K+GFVA+LN  M+ GYSD YF  +LGK VDQLW DYKAKY
Sbjct  182  KSGFVAQLNKLMRTGYSDQYFVQLLGKPVDQLWRDYKAKY  221



>ref|XP_006422910.1| hypothetical protein CICLE_v10029208mg [Citrus clementina]
 gb|ESR36150.1| hypothetical protein CICLE_v10029208mg [Citrus clementina]
Length=231

 Score =   313 bits (803),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 173/208 (83%), Gaps = 3/208 (1%)
 Frame = +2

Query  74   AIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDV  253
            A+H   AV+Y VTNTA  T GGARFN  IG +YS+Q L +A +FIWR FQQ +P DRK+V
Sbjct  20   AVH---AVDYVVTNTAPTTAGGARFNNEIGADYSRQTLASATDFIWRTFQQTNPADRKNV  76

Query  254  QKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaan  433
            QKVS+FVDDMDGVAY+SNNEIH SARYI  YSGD+K EITGVLYHE THIWQWNGNG   
Sbjct  77   QKVSLFVDDMDGVAYSSNNEIHASARYIGSYSGDLKREITGVLYHEMTHIWQWNGNGQTP  136

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
            GGLIEGIADFVRLKA YAPSHW +PG+GDRWD GYDVTARFLDY N L+NGFVAELN KM
Sbjct  137  GGLIEGIADFVRLKANYAPSHWVQPGQGDRWDQGYDVTARFLDYLNSLRNGFVAELNKKM  196

Query  614  KNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            + GYS +YF ++LGK VDQLW DYKAKY
Sbjct  197  RTGYSANYFVELLGKNVDQLWRDYKAKY  224



>ref|XP_010023668.1| PREDICTED: uncharacterized protein LOC104414298 [Eucalyptus grandis]
 gb|KCW59978.1| hypothetical protein EUGRSUZ_H02706 [Eucalyptus grandis]
Length=223

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 175/220 (80%), Gaps = 0/220 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            L L  L++ +      AV+YTVTN A +TPG  RF   IG  YS+Q +  + +FIWR FQ
Sbjct  4    LFLATLVILSCSLQSHAVDYTVTNNAGDTPGAVRFTNEIGIPYSQQTMTESTDFIWRTFQ  63

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QN P DRKDV KVS+F+D+MDGVAY SNNEIHVSA Y+ G SGDVK E TGVLYHE TH+
Sbjct  64   QNDPADRKDVAKVSLFIDNMDGVAYTSNNEIHVSATYLGGVSGDVKREFTGVLYHEMTHV  123

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNG G A GGLIEGIADFVRL++GYAP HW +PG+GD+WD GYDVTARFLDYCN L+N
Sbjct  124  WQWNGAGQAPGGLIEGIADFVRLRSGYAPGHWVQPGQGDKWDQGYDVTARFLDYCNGLRN  183

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            GFVAELN KM+ GYSD++F D+LGKTVDQLWT+YKAKY T
Sbjct  184  GFVAELNKKMRTGYSDNFFVDLLGKTVDQLWTEYKAKYAT  223



>emb|CAN65930.1| hypothetical protein VITISV_038846 [Vitis vinifera]
Length=226

 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 178/221 (81%), Gaps = 1/221 (0%)
 Frame = +2

Query  35   RITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR  214
             I L  C + L AA HG +AVEY VTN A ++ GG RF   IG  YS+Q L +A +FIW 
Sbjct  5    HIVLLSCFVFL-AAQHGIQAVEYEVTNNAGSSAGGVRFTNEIGIPYSRQTLVSATDFIWG  63

Query  215  VFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            VFQQN+P +RK VQKVS+ +++MDGVAYASNNEIHV+A YI  YSGDVK E TGVLYHE 
Sbjct  64   VFQQNTPEERKTVQKVSLIIENMDGVAYASNNEIHVNANYIGSYSGDVKTEFTGVLYHEM  123

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            THIWQWNGNG   GGLIEGIAD+VRLKA YAPSHW +PG+G+RWD GYDVTARFLDYCN 
Sbjct  124  THIWQWNGNGQTPGGLIEGIADYVRLKANYAPSHWVQPGQGNRWDQGYDVTARFLDYCNS  183

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            L+NGFVAELN KM++GYS  +F ++LGKTVDQLWTDYKAKY
Sbjct  184  LRNGFVAELNKKMRSGYSADFFVELLGKTVDQLWTDYKAKY  224



>ref|XP_002269365.1| PREDICTED: uncharacterized protein LOC100259535 [Vitis vinifera]
Length=226

 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 175/216 (81%), Gaps = 0/216 (0%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            L  L++ AA+HG  AVEY VTN A N+ GG RFN  IG EYS+Q L +A  FIWR+FQQN
Sbjct  9    LSSLVVLAALHGIHAVEYVVTNNAENSTGGVRFNNDIGIEYSRQTLVSATEFIWRLFQQN  68

Query  230  SPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQ  409
            +P DRKDVQ+V++ +++ DG+AYA N+EIHV+A YI  YSGD+KGE TGVLYHE THIWQ
Sbjct  69   TPADRKDVQRVTLIIENTDGIAYAENDEIHVNANYIKEYSGDLKGEFTGVLYHEMTHIWQ  128

Query  410  WngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGF  589
            WNGNG   GGLIEGIADFVRLKA Y PSHW +PG+GDRWD GYDVTARFLDYCN L+NGF
Sbjct  129  WNGNGQTPGGLIEGIADFVRLKANYIPSHWVQPGQGDRWDQGYDVTARFLDYCNSLRNGF  188

Query  590  VAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            VAELN KM++GYS  +F ++L   VDQLWTDYKAKY
Sbjct  189  VAELNKKMRSGYSADFFVELLRNNVDQLWTDYKAKY  224



>ref|XP_004304055.1| PREDICTED: uncharacterized protein LOC101291548 [Fragaria vesca 
subsp. vesca]
Length=227

 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 174/217 (80%), Gaps = 1/217 (0%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
              +LI  A IH   AV+Y VTNTA ++ G  RFN  IG +YS Q L +AA+FIW+VFQQ+
Sbjct  9    FSLLITLAGIHAADAVDYAVTNTAGSSAGAVRFNNDIGADYSLQTLASAADFIWKVFQQS  68

Query  230  SPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQ  409
            +  DRK V KVS+F+D+MDGVAYAS  EIHVSA YI GYSGDVK EITGVLYHESTH+WQ
Sbjct  69   TAADRKSVDKVSLFIDNMDGVAYASGGEIHVSASYIAGYSGDVKKEITGVLYHESTHVWQ  128

Query  410  Wn-gngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNG  586
            WN    A  GGLIEGIADFVRL+AGYAPSHW +PGEGDRWD GYDVTARFLDYC  LK+G
Sbjct  129  WNGNGQAIPGGLIEGIADFVRLRAGYAPSHWVQPGEGDRWDQGYDVTARFLDYCTSLKDG  188

Query  587  FVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            FVAELN K+K GYS +YF+DILGK VDQLW DYKAKY
Sbjct  189  FVAELNNKLKTGYSVNYFADILGKNVDQLWADYKAKY  225



>ref|XP_007199197.1| hypothetical protein PRUPE_ppa021584mg [Prunus persica]
 gb|EMJ00396.1| hypothetical protein PRUPE_ppa021584mg [Prunus persica]
Length=226

 Score =   310 bits (794),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M  I L   +L L  A+HG  AV+Y VTN A  +PGG RFN  IG +YS+Q L +A  FI
Sbjct  1    MAHIFLLSFLLTLATALHGTHAVDYVVTNKAGASPGGVRFNTDIGAKYSRQTLISATGFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            WRVFQQN+  DRK VQKV++ +D++ GVAYASNNEIHVSA YI GYSGDVK EI+GVLYH
Sbjct  61   WRVFQQNTAADRKSVQKVTLIIDNITGVAYASNNEIHVSAGYIAGYSGDVKREISGVLYH  120

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            ESTH+WQWNGNG A GGLI+GIAD+VRLKAG+ PSHW +PG+G+RWD GYDVTARFLDY 
Sbjct  121  ESTHVWQWNGNGQAPGGLIDGIADYVRLKAGFVPSHWVQPGQGNRWDQGYDVTARFLDYL  180

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
            N  ++GFVAELN K+++GYS  YF D+LGK VDQLW+DYKAKY  N
Sbjct  181  NGRRSGFVAELNKKLRSGYSAKYFVDLLGKNVDQLWSDYKAKYAQN  226



>ref|NP_001238289.1| uncharacterized protein LOC100499938 precursor [Glycine max]
 gb|ACU14269.1| unknown [Glycine max]
Length=225

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 174/220 (79%), Gaps = 0/220 (0%)
 Frame = +2

Query  38   ITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRV  217
            I  +LC L+  +A+H    VEYTVTN A +TPGG  F   IG EY+K+ LD+A  FIWR+
Sbjct  2    INHALCFLVFLSALHATHGVEYTVTNNALSTPGGVAFRDKIGAEYAKRTLDSATQFIWRI  61

Query  218  FQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHEST  397
            FQQN+P DRK+VQKVS+FVDDMDGVAY SNN+IH+SA Y+    GDVK EITGVLYHE  
Sbjct  62   FQQNNPSDRKNVQKVSLFVDDMDGVAYTSNNQIHLSAGYVGNNKGDVKTEITGVLYHEMV  121

Query  398  HIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDL  577
            H+WQW+GNG A GGLIEGIAD+VRLKA YAPSHW K G+G +WD GYDVTARFLDYC+ L
Sbjct  122  HVWQWSGNGRAPGGLIEGIADYVRLKANYAPSHWVKAGQGQKWDQGYDVTARFLDYCDSL  181

Query  578  KNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            K+GFVA+LN  M+ GYSD YF  +LGK VDQLW DYKAKY
Sbjct  182  KSGFVAQLNKLMRTGYSDQYFVQLLGKPVDQLWRDYKAKY  221



>gb|AEZ51831.1| pathogenesis-related protein 17 [Vitis pseudoreticulata]
Length=226

 Score =   309 bits (791),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 177/221 (80%), Gaps = 1/221 (0%)
 Frame = +2

Query  35   RITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR  214
             I L  C + L AA HG +AVEY VTN A ++ GG RF   IG  YS+Q L +A +FIW 
Sbjct  5    HIVLLSCFVFL-AAQHGIQAVEYEVTNNAGSSAGGVRFTNEIGIPYSRQTLVSATDFIWG  63

Query  215  VFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            VFQQN+P +RK VQKVS+ +++ +GVAYASNNEIHV+A YI  YSGDVK E TGVLYHE 
Sbjct  64   VFQQNTPEERKTVQKVSLIIENTNGVAYASNNEIHVNANYIGSYSGDVKSEFTGVLYHEM  123

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            THIWQWNGNG   GGLIEGIAD+VRLKA YAPSHW KPG+G+RWD GYDVTARFLDYCN 
Sbjct  124  THIWQWNGNGQTPGGLIEGIADYVRLKANYAPSHWVKPGQGNRWDQGYDVTARFLDYCNS  183

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            L+NGFVAELN KM++GYS  +F ++LGKTVDQLWTDYKAKY
Sbjct  184  LRNGFVAELNKKMRSGYSADFFVELLGKTVDQLWTDYKAKY  224



>ref|XP_009347532.1| PREDICTED: uncharacterized protein LOC103939198 [Pyrus x bretschneideri]
Length=230

 Score =   308 bits (790),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 174/221 (79%), Gaps = 0/221 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            LSL + +    + G  AV+Y VTNTA  TPGG RFN  IG EYS+Q L AA NFIW +FQ
Sbjct  10   LSLLVTLAAGFLPGTHAVDYIVTNTARGTPGGIRFNNEIGAEYSRQTLIAATNFIWSLFQ  69

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            Q +  DRK V KV++ V+++ GVAY  NNEIHVSA YI GYSGDVK EITGVLYHESTH+
Sbjct  70   QKTTDDRKSVSKVTLIVENITGVAYTINNEIHVSASYIAGYSGDVKSEITGVLYHESTHV  129

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGN  A GGLIEGIAD+VRLKAGYAPSHW KPG+GDRWD GYDVTARFLDY N LKN
Sbjct  130  WQWNGNPRAPGGLIEGIADYVRLKAGYAPSHWVKPGQGDRWDQGYDVTARFLDYLNSLKN  189

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
            GFVAE+N K+++GYS  YF D+LGK VDQLW +YKAKY  N
Sbjct  190  GFVAEMNKKLRSGYSADYFVDLLGKNVDQLWREYKAKYAGN  230



>gb|EYU37622.1| hypothetical protein MIMGU_mgv1a025422mg [Erythranthe guttata]
Length=204

 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 175/203 (86%), Gaps = 1/203 (0%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFV  274
            +EY+VTNTAA+TPGGA+F   IG EYS + LDAA  FIW +FQQ++P DRK + +V++F+
Sbjct  1    MEYSVTNTAADTPGGAKFETDIGGEYSLETLDAATTFIWGIFQQDNPSDRKSIDRVNLFI  60

Query  275  DDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGI  454
            DDMDGVAYA N+EIHVSARYI GYSGDVK EITGVLYHE THIWQWNGNG A GGLIEGI
Sbjct  61   DDMDGVAYAVNDEIHVSARYIGGYSGDVKIEITGVLYHEMTHIWQWNGNGQAPGGLIEGI  120

Query  455  ADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNG-FVAELNAKMKNGYSD  631
            ADFVRLKAGYAPSHW  PG+GDRWD GYDVTARFLDYC++L +G FVAELN KM++GYSD
Sbjct  121  ADFVRLKAGYAPSHWVAPGQGDRWDQGYDVTARFLDYCDELSSGTFVAELNKKMRDGYSD  180

Query  632  SYFSDILGKTVDQLWTDYKAKYN  700
             +F D+LGK+VD LW DYKA+YN
Sbjct  181  GFFEDLLGKSVDTLWMDYKARYN  203



>ref|XP_006486993.1| PREDICTED: uncharacterized protein LOC102629327 [Citrus sinensis]
Length=226

 Score =   308 bits (789),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +2

Query  86   CRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVS  265
              AV Y VTNTA  T GGARF + IG  YSKQ L +A +FIWR FQQ +P DRK+V+KVS
Sbjct  21   VHAVHYVVTNTAPTTAGGARFKKEIGAGYSKQTLASATHFIWRTFQQTNPADRKNVRKVS  80

Query  266  MFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLI  445
            +FVDDMDGVAYA NNEIHVSARYI  YSGDVK EITGVLYHE THIWQWNGNG   GGLI
Sbjct  81   LFVDDMDGVAYAVNNEIHVSARYIGSYSGDVKREITGVLYHEMTHIWQWNGNGQTPGGLI  140

Query  446  EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGY  625
            EGIADFVRLKA YAPSHW +PG+GDRWD GYDVTA FLDY N L+NGFVAELN KM+ GY
Sbjct  141  EGIADFVRLKANYAPSHWVQPGQGDRWDQGYDVTAWFLDYLNSLRNGFVAELNKKMRTGY  200

Query  626  SDSYFSDILGKTVDQLWTDYKAKY  697
            S +YF ++LGK VDQLW+DYKAKY
Sbjct  201  STNYFVELLGKNVDQLWSDYKAKY  224



>ref|XP_002269470.1| PREDICTED: uncharacterized protein LOC100254416 [Vitis vinifera]
 emb|CBI22516.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   308 bits (789),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 177/221 (80%), Gaps = 1/221 (0%)
 Frame = +2

Query  35   RITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR  214
             I L  C + L A  HG +AVEY VTN A ++ GG RF   IG  YS+Q L +A +FIW 
Sbjct  5    HIVLLSCFVFL-ADQHGIQAVEYEVTNNAGSSAGGVRFTNEIGIPYSRQTLVSATDFIWG  63

Query  215  VFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            VFQQN+P +RK VQKVS+ +++MDGVAYASNNEIHV+A YI  YSGDVK E TGVLYHE 
Sbjct  64   VFQQNTPEERKTVQKVSLIIENMDGVAYASNNEIHVNANYIGSYSGDVKTEFTGVLYHEM  123

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            THIWQWNGNG   GGLIEGIAD+VRLKA YAPSHW +PG+G+RWD GYDVTARFLDYCN 
Sbjct  124  THIWQWNGNGQTPGGLIEGIADYVRLKANYAPSHWVQPGQGNRWDQGYDVTARFLDYCNS  183

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            L+NGFVAELN KM++GYS  +F ++LGKTVDQLWTDYKAKY
Sbjct  184  LRNGFVAELNKKMRSGYSADFFVELLGKTVDQLWTDYKAKY  224



>ref|XP_008236459.1| PREDICTED: uncharacterized protein LOC103335226 [Prunus mume]
Length=226

 Score =   308 bits (788),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M  I     +L L  A+HG  AV+Y VTN A  +PGG RFN  IG +YS+Q L +A  FI
Sbjct  1    MAHIFFLSFLLTLATALHGTHAVDYVVTNKAGASPGGVRFNTDIGAKYSRQTLISATGFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            WRVFQQN+  DRK VQKV++ +D++ GVAYASNNEIHVSA YI GYSGDVK EI+GVLYH
Sbjct  61   WRVFQQNTAADRKIVQKVTLIIDNITGVAYASNNEIHVSAGYIAGYSGDVKREISGVLYH  120

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            ESTH+WQWNGNG A GGLIEGIAD+VRLKAG+ PSHW +PG+G+RWD GYDVTARFLDY 
Sbjct  121  ESTHVWQWNGNGQAPGGLIEGIADYVRLKAGFVPSHWVQPGQGNRWDQGYDVTARFLDYL  180

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
            N  ++GFVAELN K+++GYS  YF D+LGK VDQLW+DYKAKY  N
Sbjct  181  NGRRSGFVAELNKKLRSGYSAKYFVDLLGKDVDQLWSDYKAKYAQN  226



>ref|XP_006422913.1| hypothetical protein CICLE_v10030248mg [Citrus clementina]
 gb|ESR36153.1| hypothetical protein CICLE_v10030248mg [Citrus clementina]
Length=226

 Score =   308 bits (788),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  86   CRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVS  265
              AV+Y VTNTA  T GGARF + IG  YSKQ L +A +FIWR FQQ  P DRK+V+KVS
Sbjct  21   VHAVDYVVTNTAPTTAGGARFKKEIGAGYSKQTLASATDFIWRTFQQTKPADRKNVRKVS  80

Query  266  MFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLI  445
            +FVDDMDGVAYA NNEIHVSARYI  YSGDVK EITGVLYHE THIWQWNGNG A GGLI
Sbjct  81   LFVDDMDGVAYAVNNEIHVSARYIGSYSGDVKREITGVLYHEMTHIWQWNGNGQAPGGLI  140

Query  446  EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGY  625
            EGIADFVRLKA YAPSHW +PG+GDRWD GYDVTA FLDY N L+NGFVAELN KM+ GY
Sbjct  141  EGIADFVRLKANYAPSHWVQPGQGDRWDQGYDVTAWFLDYLNSLRNGFVAELNKKMRTGY  200

Query  626  SDSYFSDILGKTVDQLWTDYKAKY  697
            S +YF ++LGK VDQLW+DYKAKY
Sbjct  201  SANYFVELLGKNVDQLWSDYKAKY  224



>gb|AFK34400.1| unknown [Lotus japonicus]
Length=226

 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 176/218 (81%), Gaps = 3/218 (1%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            LC+L+   A+ G +AV+YTVTN A  T GGARF   IG EY+KQ LD+A  F WRVFQQN
Sbjct  6    LCLLMFLTAMQGTKAVDYTVTNNALTTAGGARFRDQIGAEYAKQTLDSATQFTWRVFQQN  65

Query  230  SPGDRKDVQKVSMFVDDMDGVAYA--SNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            +P DR++VQ VS+FVDDMDGVAY   SN++IH+SARY+N YSGD+K EITGVLYHE  H+
Sbjct  66   TPADRRNVQTVSLFVDDMDGVAYTTPSNSQIHLSARYVNSYSGDLKREITGVLYHEIVHV  125

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQ NG G+A GGLIEGIAD+VRLKA YAPSHW KPG+G++WD GYDVTA+FLDYCN LKN
Sbjct  126  WQ-NGIGSAPGGLIEGIADYVRLKANYAPSHWVKPGQGNKWDQGYDVTAQFLDYCNSLKN  184

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GFVAE+N  + NGYSD YF  + GK VDQLWTDYK KY
Sbjct  185  GFVAEMNKLLSNGYSDQYFVQLQGKNVDQLWTDYKTKY  222



>ref|XP_008800414.1| PREDICTED: uncharacterized protein LOC103714784 [Phoenix dactylifera]
Length=226

 Score =   306 bits (784),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 175/216 (81%), Gaps = 0/216 (0%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            +  L+  A +   RAVEY  +N A  TPGG RF+  IG +YSKQVL A+++F+W    + 
Sbjct  9    IASLLASATLDTARAVEYEASNKATGTPGGTRFDNEIGLDYSKQVLAASSSFVWTSIFEQ  68

Query  230  SPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQ  409
            S GDRKDVQ +++ ++ MDGVAY SNN IHVSA YI GYSGDVK EITGVLYHE TH+WQ
Sbjct  69   SEGDRKDVQLITLVIETMDGVAYTSNNGIHVSANYIAGYSGDVKTEITGVLYHEVTHVWQ  128

Query  410  WngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGF  589
            WNGNG A GGLIEGIAD+VRLKAGYAPSHW KPG+GDRWD GYDVTARFLDYC+ LK GF
Sbjct  129  WNGNGNAPGGLIEGIADYVRLKAGYAPSHWVKPGQGDRWDQGYDVTARFLDYCDSLKTGF  188

Query  590  VAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            VA+LNAKMKNGYSD +F ++LGKTVDQLW+DYKAKY
Sbjct  189  VAQLNAKMKNGYSDDFFVELLGKTVDQLWSDYKAKY  224



>ref|XP_010065957.1| PREDICTED: uncharacterized protein LOC104453134 [Eucalyptus grandis]
 gb|KCW63686.1| hypothetical protein EUGRSUZ_G01335 [Eucalyptus grandis]
Length=225

 Score =   306 bits (783),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M    L L  L++ ++     AVEYTVTN+A NT GG RF+  IG  YS++ L AA  FI
Sbjct  1    MSTQMLFLATLVVLSSSMQSHAVEYTVTNSAGNTTGGVRFSSEIGIPYSRRTLSAATRFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            W VF Q +PGDRK V+KVS+F++ MDGVAY SN+EIHVSA Y+ G+SGDVK E TGVLYH
Sbjct  61   WMVFHQKAPGDRKSVEKVSLFIETMDGVAYESNDEIHVSATYLGGFSGDVKREFTGVLYH  120

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E  H+WQW+G+G A GGLIEGIADFVRL++GY P HW  PG+GDRWD GYDVTARFLDYC
Sbjct  121  EMAHVWQWDGDGQAPGGLIEGIADFVRLRSGYVPGHWVGPGQGDRWDQGYDVTARFLDYC  180

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            N L+NGFVAELN KM+ GYSD+YF D+L K+VDQLW DYKAKY T
Sbjct  181  NGLRNGFVAELNKKMRTGYSDNYFVDLLDKSVDQLWKDYKAKYTT  225



>ref|XP_009370126.1| PREDICTED: uncharacterized protein LOC103959498 [Pyrus x bretschneideri]
Length=230

 Score =   305 bits (782),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 174/221 (79%), Gaps = 0/221 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            LSL + +    + G  AV+Y VTNTA  TPGG RFN  IG EYS+Q L +A NFIW +FQ
Sbjct  10   LSLLVTLAAGFLPGTHAVDYIVTNTARGTPGGIRFNNEIGAEYSRQTLISATNFIWSLFQ  69

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            Q +  DRK V KV++ V+++ GVAY  NNEIHVSA YI GYSGDVK EITGVLYHESTH+
Sbjct  70   QKTTDDRKRVSKVTLIVENITGVAYTINNEIHVSASYIAGYSGDVKSEITGVLYHESTHV  129

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGN  A GGLIEGIAD+VRLKAGYAPSHW KPG+GDRWD GYDVTARFLDY + LKN
Sbjct  130  WQWNGNPQAPGGLIEGIADYVRLKAGYAPSHWVKPGQGDRWDQGYDVTARFLDYLSSLKN  189

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
            GFVAE+N K+++GYS  YF D+LGK VDQLW +YKAKY  N
Sbjct  190  GFVAEMNKKLRSGYSADYFVDLLGKNVDQLWREYKAKYAGN  230



>ref|XP_007042546.1| Plant basic secretory protein (BSP) family protein [Theobroma 
cacao]
 gb|EOX98377.1| Plant basic secretory protein (BSP) family protein [Theobroma 
cacao]
Length=226

 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 176/218 (81%), Gaps = 1/218 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
             SL IL L AAI G  AVEY V +   N+ GG RF   IG +YS+Q L +A +FIWR+FQ
Sbjct  8    FSLLILSL-AAIQGTHAVEYAVKDNTGNSGGGNRFRNEIGVDYSQQTLSSATDFIWRIFQ  66

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QN+P DRK+VQKV++F+++ +GVA+A NNEIHV+A+Y+  YSGDVK E TGVLYHE THI
Sbjct  67   QNNPADRKNVQKVTLFIENGNGVAFAVNNEIHVNAKYLGDYSGDVKREFTGVLYHEMTHI  126

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGN  A GGLIEGIADFVRLKA Y PSHW +PG+G+RWD GYDVTARFLDYCN L+N
Sbjct  127  WQWNGNSQAPGGLIEGIADFVRLKANYIPSHWVQPGQGNRWDQGYDVTARFLDYCNSLRN  186

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GFVAELN KM+ GYS  YF ++LGKTVDQLW+DYKAKY
Sbjct  187  GFVAELNTKMRTGYSADYFVELLGKTVDQLWSDYKAKY  224



>ref|XP_009384579.1| PREDICTED: uncharacterized protein LOC103972102 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   303 bits (776),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 180/223 (81%), Gaps = 4/223 (2%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M+ + L++  L++ AA     AV+Y  TN AA TPGG RF+  IG EYSKQVL  A++FI
Sbjct  1    MEAVALAVAFLLVSAA----GAVQYEATNNAAGTPGGTRFDNEIGLEYSKQVLATASSFI  56

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            W  F Q S  DRKDV  +++ V+ MDGVAY S++ IH+SA Y+ GY+GDV+ EI GVLYH
Sbjct  57   WTTFDQQSEADRKDVSLITLIVETMDGVAYTSSDTIHLSADYVAGYNGDVRTEIVGVLYH  116

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E TH+WQW+G GAANGGLIEGIAD+VRLKAGYAPSHW +PG GDRWD GYDVTARFLDYC
Sbjct  117  EDTHVWQWDGRGAANGGLIEGIADYVRLKAGYAPSHWVQPGGGDRWDQGYDVTARFLDYC  176

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            NDLK+GFVA+LNAKMK+GYSD +F D+LGKTVDQLW+DYKAKY
Sbjct  177  NDLKSGFVAQLNAKMKDGYSDDFFVDLLGKTVDQLWSDYKAKY  219



>ref|XP_008365753.1| PREDICTED: uncharacterized protein LOC103429378 [Malus domestica]
Length=231

 Score =   303 bits (775),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 176/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  44   LSLCILILGAAIH-GCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVF  220
            LS  I+ L A +  G  AV Y VTNTA  TPGG RFN  IG +YS+Q L +A NFIW +F
Sbjct  10   LSFLIITLAAGLFPGTHAVNYKVTNTAGGTPGGIRFNNKIGADYSRQTLVSATNFIWILF  69

Query  221  QQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTH  400
            QQN+  DRK V KV++ V+++ GVA+A NNEIHVSA YI GYSGDVK EITGVLYHESTH
Sbjct  70   QQNTAADRKSVSKVTLIVENITGVAFAVNNEIHVSASYIAGYSGDVKREITGVLYHESTH  129

Query  401  IWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLK  580
            +WQWNGNG A GGLIEGIAD+VRLKAGYAPSHW +PG+GDRWD GYDVTA FLDY N LK
Sbjct  130  VWQWNGNGQAPGGLIEGIADYVRLKAGYAPSHWVQPGQGDRWDQGYDVTAWFLDYLNSLK  189

Query  581  NGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            NGFVAE+N KM++ Y+ +YF DILGK VDQLW++YKAKY
Sbjct  190  NGFVAEMNKKMRSAYNANYFVDILGKNVDQLWSEYKAKY  228



>ref|XP_010918048.1| PREDICTED: uncharacterized protein LOC105042502 [Elaeis guineensis]
Length=237

 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 178/226 (79%), Gaps = 1/226 (0%)
 Frame = +2

Query  20   KTSMDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAA  199
            ++ M  + L +  L+  AA+    AV+Y  +N AA TPGG RFN+ IG  Y +QVL AA+
Sbjct  10   ESRMALLALFIASLLTSAAMDTTEAVQYKASNNAAGTPGGTRFNKEIGLAYCQQVLAAAS  69

Query  200  NFIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGV  379
            +F+W  F+Q S  DRK VQ +++ V+ MDGVAY SNN IHVSA Y+  YSGDVK EITGV
Sbjct  70   SFVWSTFKQ-SAADRKKVQLITLVVETMDGVAYTSNNGIHVSANYVASYSGDVKTEITGV  128

Query  380  LYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFL  559
            LYHE TH+WQWNG GAA GGLIEGIAD+VRLKAGYAPSHW KPG+GDRWD GYDVTA FL
Sbjct  129  LYHEVTHVWQWNGKGAAPGGLIEGIADYVRLKAGYAPSHWVKPGQGDRWDQGYDVTAYFL  188

Query  560  DYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            DYCN LK GFVA+LNA MKNGYSD++F ++LGKTVDQLW+DYKAKY
Sbjct  189  DYCNSLKGGFVAQLNAMMKNGYSDNFFVELLGKTVDQLWSDYKAKY  234



>gb|KHN06773.1| hypothetical protein glysoja_021319 [Glycine soja]
Length=230

 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 176/221 (80%), Gaps = 5/221 (2%)
 Frame = +2

Query  50   LCI-LILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ  226
            LC  + L AA+ G  AVEY+VTN A +TPGG RF   IG+EY+KQ LD+A  FIW VFQQ
Sbjct  6    LCFSVFLAAAMQGTLAVEYSVTNNALSTPGGVRFRDAIGDEYAKQTLDSATQFIWGVFQQ  65

Query  227  NSPGDRKDVQKVSMFVDDM---DGV-AYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            N+P DRKD+QK+++FV+D    +GV AY S +EIHV A+Y+N Y GDVK EITGVLYHE 
Sbjct  66   NAPADRKDIQKINLFVEDRVVPNGVVAYTSKDEIHVIAKYVNDYGGDVKTEITGVLYHEM  125

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
             H+WQWNGNG A  GLIEGIAD+VRLKA YAPSHW+K GEG +WD GYDVTARFLDYCN 
Sbjct  126  VHVWQWNGNGQAPSGLIEGIADYVRLKANYAPSHWKKAGEGQKWDQGYDVTARFLDYCNT  185

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            LK+GFVA+LN +M+ GYSD +F  +LGKTVDQLW DYKAKY
Sbjct  186  LKSGFVAQLNKQMRTGYSDQFFVQLLGKTVDQLWQDYKAKY  226



>ref|XP_009371399.1| PREDICTED: uncharacterized protein LOC103960644 [Pyrus x bretschneideri]
Length=231

 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  44   LSLCILILGAAIH-GCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVF  220
            LS  I+ L A +  G  AV Y VTNTA  TPGG RFN  IG  YS+Q L +A NFIW +F
Sbjct  10   LSFLIITLAAGLFPGTHAVYYKVTNTAGGTPGGIRFNNKIGAAYSRQTLVSATNFIWSLF  69

Query  221  QQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTH  400
            QQN+  DRK V KV++ V+++ GVAYA NNEIHVSA YI  YSGDVK EITGVLYHESTH
Sbjct  70   QQNTAADRKSVSKVTLIVENITGVAYAVNNEIHVSANYIADYSGDVKKEITGVLYHESTH  129

Query  401  IWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLK  580
            +WQWNGNG A GGLIEGIAD+VRLKAGYAPSHW +PG+GDRWD GY+VTA FLDY N LK
Sbjct  130  VWQWNGNGQAPGGLIEGIADYVRLKAGYAPSHWVQPGQGDRWDRGYEVTAWFLDYLNSLK  189

Query  581  NGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            NGFVAE+N KM++GY+ +YF DILGK VDQLW++YKAKY
Sbjct  190  NGFVAEMNKKMRSGYNANYFVDILGKNVDQLWSEYKAKY  228



>ref|XP_002300243.2| plant basic secretory family protein [Populus trichocarpa]
 gb|EEE85048.2| plant basic secretory family protein [Populus trichocarpa]
Length=224

 Score =   300 bits (769),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 174/218 (80%), Gaps = 3/218 (1%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            LSL + +   AI+   AV+YTVTN A+ T GGARF + IG +YSKQ L +A +FIWR FQ
Sbjct  8    LSLLVFL---AINAVSAVDYTVTNRASATAGGARFTRDIGVDYSKQTLASATDFIWRTFQ  64

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            Q++  DRK+VQ V++F+D M GVAYA+NNEIHVS  YI  YSGDV+ EITGVLYHE  HI
Sbjct  65   QSNAADRKNVQTVNLFIDVMGGVAYATNNEIHVSNDYIGNYSGDVRREITGVLYHEMAHI  124

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG   GGLIEGIADFVRLKA YAPSHW + G+GDRWD GYDVTA+FLDYCN L+N
Sbjct  125  WQWNGNGQTPGGLIEGIADFVRLKANYAPSHWVQAGQGDRWDQGYDVTAKFLDYCNGLRN  184

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GFVAELN KMK GYS  YF D+LGKTVDQLW DYKAKY
Sbjct  185  GFVAELNKKMKTGYSAQYFVDLLGKTVDQLWKDYKAKY  222



>ref|XP_007143066.1| hypothetical protein PHAVU_007G041000g [Phaseolus vulgaris]
 gb|ESW15060.1| hypothetical protein PHAVU_007G041000g [Phaseolus vulgaris]
Length=230

 Score =   300 bits (769),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 171/220 (78%), Gaps = 0/220 (0%)
 Frame = +2

Query  38   ITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRV  217
            I  +LC L+   A H   AV+Y VTN A  T GG  F   IGE+Y+KQ LD+A  FIWR+
Sbjct  2    IKQALCFLVFLHAFHQTHAVQYAVTNRALTTSGGVAFRDKIGEQYAKQTLDSATQFIWRI  61

Query  218  FQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHEST  397
             QQ++P DRK+VQ+VS+FVDDMDGVAY S ++IH+SARY+  Y+GDVK EI+GVLYHE  
Sbjct  62   LQQSNPADRKNVQRVSLFVDDMDGVAYTSGDQIHLSARYVGKYNGDVKKEISGVLYHEMV  121

Query  398  HIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDL  577
            H+WQWNGNG   GGLIEGIAD+VRLKA YAPSHW KPG+G +WD GYDVTARFLDYC  L
Sbjct  122  HVWQWNGNGRVPGGLIEGIADYVRLKANYAPSHWVKPGQGQKWDQGYDVTARFLDYCESL  181

Query  578  KNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            ++GFVA+LN   ++GYSD YF  +LGK VDQLW DYKAKY
Sbjct  182  RSGFVAQLNKLSRSGYSDQYFVQLLGKPVDQLWRDYKAKY  221



>ref|XP_008338236.1| PREDICTED: uncharacterized protein LOC103401302 [Malus domestica]
Length=230

 Score =   300 bits (769),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 174/221 (79%), Gaps = 0/221 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            LSL I +    + G  AV+Y+VTNTA  TPGG RFN  IG +Y +Q L +A +FIW +FQ
Sbjct  10   LSLLITLAAGFLPGTHAVDYSVTNTAXGTPGGIRFNNEIGADYGRQTLISATDFIWSLFQ  69

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            Q +  DRK V KV++ V+++ GVAY  NNEIHVSA YI GYSG+VK EITGVLYHESTH+
Sbjct  70   QKTTDDRKSVSKVTLIVENITGVAYTINNEIHVSASYIAGYSGNVKSEITGVLYHESTHV  129

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG A GGLIEGIAD+VRLKAGYAP HW KPG+GDRWD GYDVTARFLDY N LKN
Sbjct  130  WQWNGNGRAPGGLIEGIADYVRLKAGYAPGHWVKPGQGDRWDQGYDVTARFLDYLNSLKN  189

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
            GFVAE+N K+++GYS  YF D+LGK VDQLW +YKAKY  N
Sbjct  190  GFVAEMNKKLRSGYSADYFVDLLGKNVDQLWREYKAKYAGN  230



>ref|XP_010024060.1| PREDICTED: uncharacterized protein LOC104414606 [Eucalyptus grandis]
Length=225

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M    L L +L++ ++     AV+YTVTN A NT G  RF++ IG  YS++ L  A  FI
Sbjct  1    MSTQMLFLAMLVILSSSMQSHAVQYTVTNNAGNTNGSVRFSRDIGIPYSRKTLTKATGFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            WR+FQQN P DRK V KVS+F+++M GVAY SN+EIHVSA Y+ G+S DVK E TGVLYH
Sbjct  61   WRLFQQNVPRDRKSVAKVSLFIENMAGVAYTSNDEIHVSATYLGGFSADVKREFTGVLYH  120

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E TH+WQWNG G A GGLIEGIADFVRLK+GYAP HW KPG+G+RWD GYDVTARFLDYC
Sbjct  121  EMTHVWQWNGAGQAPGGLIEGIADFVRLKSGYAPGHWVKPGQGNRWDQGYDVTARFLDYC  180

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            N  K GFVA LN KM+ GYSD+YF D+LGK+VDQLW DYKAKY T
Sbjct  181  NGRKKGFVAALNKKMRTGYSDNYFVDLLGKSVDQLWKDYKAKYAT  225



>ref|XP_009370123.1| PREDICTED: uncharacterized protein LOC103959494 [Pyrus x bretschneideri]
Length=234

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 174/225 (77%), Gaps = 4/225 (2%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            LSL + +    + G  AV+Y VTNTA  TPGG RFN  IG EYS+Q L +A NFIW +FQ
Sbjct  10   LSLLVTLAAGFLPGTHAVDYIVTNTARGTPGGIRFNNEIGAEYSRQTLISATNFIWSLFQ  69

Query  224  QNSPGDRKD----VQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHE  391
            Q +  DRK     V KV++ V+++ GVAY  NNEIHVSA YI GYSGDVK EITGVLYHE
Sbjct  70   QKTTDDRKSIWSFVSKVTLIVENITGVAYTINNEIHVSASYIAGYSGDVKSEITGVLYHE  129

Query  392  STHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCN  571
            STH+WQWNGN  A GGLIEGIAD+VRLKAGYAPSHW KPG+GDRWD GYDVTARFLDY +
Sbjct  130  STHVWQWNGNPQAPGGLIEGIADYVRLKAGYAPSHWVKPGQGDRWDQGYDVTARFLDYLS  189

Query  572  DLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
             LKNGFVAE+N K+++GYS  YF D+LGK VDQLW +YKAKY  N
Sbjct  190  SLKNGFVAEMNKKLRSGYSADYFVDLLGKNVDQLWREYKAKYAGN  234



>ref|XP_010065960.1| PREDICTED: uncharacterized protein LOC104453136 [Eucalyptus grandis]
 gb|KCW63689.1| hypothetical protein EUGRSUZ_G01341 [Eucalyptus grandis]
Length=215

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 168/211 (80%), Gaps = 0/211 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            L L  L++ +      AV+YTVTN A +TPG  RF   IG  YS+Q +  + +FIWR FQ
Sbjct  4    LFLATLVILSCSLQSHAVDYTVTNNAGDTPGAVRFTNEIGIPYSQQTMTESTDFIWRTFQ  63

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QN P DRKDV KVS+F+D+MDGVAYASNNEIHVSA Y+ G SGDVK E TGVLYHE TH+
Sbjct  64   QNDPADRKDVAKVSLFIDNMDGVAYASNNEIHVSATYLGGVSGDVKREFTGVLYHEMTHV  123

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNG G A GGL EGIADFVRL++GYAP HW +PG+GD+WD GYDVTARFLDYCNDL+N
Sbjct  124  WQWNGAGQAPGGLTEGIADFVRLRSGYAPGHWVQPGQGDKWDQGYDVTARFLDYCNDLRN  183

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLW  676
            GFVAELN KM+ GYSD++F D+LGKTV+QLW
Sbjct  184  GFVAELNKKMRTGYSDNFFVDLLGKTVEQLW  214



>ref|XP_008236385.1| PREDICTED: uncharacterized protein LOC103335160 [Prunus mume]
Length=227

 Score =   299 bits (765),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +2

Query  83   GCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKV  262
            G  AV+Y VTN A  +PGG RFN  IG EYS+Q L +AA+FIWRVFQQN+  DR  V KV
Sbjct  21   GTHAVDYVVTNNAGTSPGGVRFNNDIGAEYSRQTLISAADFIWRVFQQNAAADRNSVDKV  80

Query  263  SMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggL  442
            S+ V++MDGVA+A  NEIHVSA YI GYSGDVK EITGVLYHESTH+WQWNGNG A GGL
Sbjct  81   SLIVENMDGVAFARGNEIHVSAGYIAGYSGDVKKEITGVLYHESTHVWQWNGNGQAPGGL  140

Query  443  IEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNG  622
            IEGIAD+VRLKAGY P HW +PG+G++WD GYDVTARFLDY N L+NGFVAELN K+++G
Sbjct  141  IEGIADYVRLKAGYVPGHWVQPGQGNKWDQGYDVTARFLDYLNGLRNGFVAELNKKLRSG  200

Query  623  YSDSYFSDILGKTVDQLWTDYKAKY  697
            YS +YF D+LGK VDQLWT+YKAKY
Sbjct  201  YSPNYFVDLLGKNVDQLWTEYKAKY  225



>ref|XP_009343550.1| PREDICTED: proline-rich receptor-like protein kinase PERK14 [Pyrus 
x bretschneideri]
Length=411

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 176/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  44   LSLCILILGAAIH-GCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVF  220
            LS  I+ L A +  G  AV Y VTNTA  TPGG RFN  IG  YS+Q L +A NFIW +F
Sbjct  190  LSFLIITLAAGLFPGTHAVYYKVTNTAGGTPGGIRFNNKIGAAYSRQTLVSATNFIWSLF  249

Query  221  QQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTH  400
            QQN+  DRK V KV++ V+++ GVAYA NNEIHVSA YI GYSGDVK EITGVLYHESTH
Sbjct  250  QQNTAADRKSVSKVTLIVENITGVAYAVNNEIHVSASYIAGYSGDVKKEITGVLYHESTH  309

Query  401  IWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLK  580
            +WQWNGNG A GGLIEGIAD+VRLKAGYAPSHW +PG+GDRWD GY+VTA FLDY N LK
Sbjct  310  VWQWNGNGQAPGGLIEGIADYVRLKAGYAPSHWVQPGQGDRWDRGYEVTAWFLDYLNSLK  369

Query  581  NGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            NGFVAE+N KM++GY+ +YF DILGK VDQLW++YKAKY
Sbjct  370  NGFVAEMNKKMRSGYNANYFVDILGKNVDQLWSEYKAKY  408



>ref|XP_002313879.2| plant basic secretory family protein [Populus trichocarpa]
 gb|EEE87834.2| plant basic secretory family protein [Populus trichocarpa]
Length=224

 Score =   298 bits (763),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = +2

Query  74   AIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDV  253
            AI+   AV+YTVTN A  T GGARF   IG +YSKQ L +A +FIW  FQQ++  DRK++
Sbjct  15   AINTVSAVDYTVTNRATATAGGARFITDIGVDYSKQTLASATDFIWETFQQSNAADRKNI  74

Query  254  QKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaan  433
            Q V++F+D MDGVAY+ N+EIHVS  YI  YSGDV+ EITGVLYHE THIWQWNGNG A 
Sbjct  75   QTVNLFIDVMDGVAYSVNDEIHVSDSYIASYSGDVRTEITGVLYHEMTHIWQWNGNGQAP  134

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
            GGLIEGIADFVRLKA YAPSHW +PG+GDRWD GYDVTA+FLDYCNDL+NGFVAELN KM
Sbjct  135  GGLIEGIADFVRLKANYAPSHWVQPGQGDRWDQGYDVTAKFLDYCNDLRNGFVAELNKKM  194

Query  614  KNGYSDSYFSDILGKTVDQLWTDYKAKY  697
              GYS  YF D+LGKTVDQLWTDYKA+Y
Sbjct  195  MTGYSAQYFVDLLGKTVDQLWTDYKARY  222



>ref|XP_007042549.1| Plant basic secretory protein (BSP) family protein [Theobroma 
cacao]
 gb|EOX98380.1| Plant basic secretory protein (BSP) family protein [Theobroma 
cacao]
Length=226

 Score =   298 bits (763),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 174/218 (80%), Gaps = 1/218 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
             SL IL L  A  G  AVEY V +   N+ GG RF   IG +YS Q L +A++FIWR+FQ
Sbjct  8    FSLIILSL-VATQGTLAVEYAVNDNTGNSGGGIRFRNEIGVDYSLQTLSSASDFIWRIFQ  66

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QN+P +RK+VQ+V++F+++ DGVA+A NNEIHV+A Y+  YSGDVK E TGVLYHE THI
Sbjct  67   QNNPAERKNVQRVTLFIENGDGVAFAINNEIHVNANYLGNYSGDVKREFTGVLYHEMTHI  126

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG   GGLIEGIADFVRLKA Y PSHW +PG+GDRWD GYDVTARFLDYCN L+N
Sbjct  127  WQWNGNGQTPGGLIEGIADFVRLKANYIPSHWVQPGQGDRWDQGYDVTARFLDYCNSLRN  186

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GFVA+LN KM+ GYS +YF ++LGKTVDQLW+DYKAKY
Sbjct  187  GFVAKLNKKMRTGYSANYFVELLGKTVDQLWSDYKAKY  224



>ref|XP_008382539.1| PREDICTED: uncharacterized protein LOC103445323 [Malus domestica]
Length=230

 Score =   298 bits (763),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 175/221 (79%), Gaps = 0/221 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            LSL I +    + G  AV+Y+VTNTA+ TPGG RFN  IG +Y +Q L +A +FIW +FQ
Sbjct  10   LSLXITLAAGFLPGTHAVDYSVTNTASGTPGGIRFNNEIGADYGRQTLISATDFIWSLFQ  69

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            Q +  DRK V KV++ V+++ GVAY  NNEIHVSA YI GYSG+VK EITGVLYHESTH+
Sbjct  70   QKTTDDRKSVSKVTLIVENITGVAYTINNEIHVSASYIAGYSGNVKSEITGVLYHESTHV  129

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG A GGLIEGIAD+VRLKAGYAP HW KPG+GDRWD GYDVTARFLDY N LKN
Sbjct  130  WQWNGNGRAPGGLIEGIADYVRLKAGYAPGHWVKPGQGDRWDQGYDVTARFLDYLNSLKN  189

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
            GFVAE+N K+++GYS  YF D+LGK V+Q+W +YKAKY  N
Sbjct  190  GFVAEMNKKLRSGYSADYFVDLLGKNVEQIWREYKAKYAGN  230



>ref|NP_001235412.1| uncharacterized protein LOC100527902 precursor [Glycine max]
 gb|ACU17113.1| unknown [Glycine max]
Length=237

 Score =   296 bits (758),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 172/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  50   LCI-LILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ  226
            LC  + L AA+ G  AVEY+VTN A +TPGG RF   IG+EY+KQ LD+A  FIW VFQQ
Sbjct  6    LCFSVFLAAAMQGTLAVEYSVTNNALSTPGGVRFRDAIGDEYAKQTLDSATQFIWGVFQQ  65

Query  227  NSPGDRKDVQKVSMFVDDM---DGV-AYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            N+P DRKD+QK+++FV+D    +GV AY S +EIHV A+Y+N Y GDVK EITGVLYHE 
Sbjct  66   NAPADRKDIQKINLFVEDRVVPNGVVAYTSKDEIHVIAKYVNDYGGDVKTEITGVLYHEM  125

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
             H+WQWNGNG    GLIEGIAD+VRLKA YAPSHW+K GEG +WD GYDVTARFLDYCN 
Sbjct  126  VHVWQWNGNGQVPSGLIEGIADYVRLKANYAPSHWKKAGEGQKWDQGYDVTARFLDYCNT  185

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYK  688
            LK+GFVA+LN +M+ GYSD +F  +LGKTVDQLW DYK
Sbjct  186  LKSGFVAQLNKQMRTGYSDQFFVQLLGKTVDQLWQDYK  223



>ref|XP_010065956.1| PREDICTED: uncharacterized protein LOC104453133 [Eucalyptus grandis]
Length=225

 Score =   295 bits (755),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 172/225 (76%), Gaps = 0/225 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M    L L +L++ ++     AV+YTVTN A NT G  RF++ IG  YS++ L  A  FI
Sbjct  1    MSTQMLFLAMLVILSSSMQSHAVQYTVTNNAGNTNGSVRFSRDIGIPYSRKTLTKATGFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            WR+FQQN P DRK V KVS+F+++M GVAY SN+EIHVSA Y+ G+S DVK E TGVLYH
Sbjct  61   WRLFQQNVPRDRKSVAKVSLFIENMAGVAYTSNDEIHVSATYLGGFSADVKREFTGVLYH  120

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E TH+WQWNG G A GGLIEGIADFVRLK+G+AP HW K G+GDRWD GYDVTARFLDYC
Sbjct  121  EMTHVWQWNGAGQAPGGLIEGIADFVRLKSGHAPGHWVKLGQGDRWDQGYDVTARFLDYC  180

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            N  K GFVA LN KM+ GYSD+YF D+LGK+VDQLW DYKAKY T
Sbjct  181  NGRKKGFVAALNKKMRTGYSDNYFVDLLGKSVDQLWKDYKAKYAT  225



>ref|XP_008800415.1| PREDICTED: uncharacterized protein LOC103714785 [Phoenix dactylifera]
Length=208

 Score =   294 bits (753),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = +2

Query  86   CRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVS  265
              AV Y  +N AA TPGG RFN+ IG  YSKQVL AA++F+W  F+Q S  DRKDVQ ++
Sbjct  4    TEAVRYKASNNAAGTPGGTRFNKEIGLAYSKQVLAAASSFVWSTFRQ-SAMDRKDVQLIT  62

Query  266  MFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLI  445
            + ++ M+GVAY SNN IHVSA YI GYSGDVK EITGVLYHE TH+WQWNGNG A GGLI
Sbjct  63   LVIETMNGVAYTSNNGIHVSANYIAGYSGDVKTEITGVLYHEVTHVWQWNGNGKAPGGLI  122

Query  446  EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGY  625
            EGIAD+VRLKAGYAPSHW KPG+GDRWD GYDVTA FLDYCN LK GFVA+LNAKMKNGY
Sbjct  123  EGIADYVRLKAGYAPSHWVKPGQGDRWDQGYDVTAYFLDYCNSLKGGFVAQLNAKMKNGY  182

Query  626  SDSYFSDILGKTVDQLWTDYKAKY  697
            SD++F ++LGK V+QLW DYKAKY
Sbjct  183  SDNFFVELLGKPVNQLWNDYKAKY  206



>ref|XP_011001221.1| PREDICTED: uncharacterized protein LOC105108570 [Populus euphratica]
Length=224

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = +2

Query  74   AIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDV  253
            AI+   AV+YTVTN A  T GGARF   IG +YSKQ L +A +FIW  FQQ +  DRK++
Sbjct  15   AINTVSAVDYTVTNRATATAGGARFITDIGVDYSKQTLASATDFIWETFQQTNAADRKNI  74

Query  254  QKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaan  433
            Q V++F+D MDGVAY+ ++EIHVS  YI  YSGDV+ EITGVLYHE THIWQWNGNG A 
Sbjct  75   QTVNLFIDVMDGVAYSVSDEIHVSDSYIASYSGDVRTEITGVLYHEMTHIWQWNGNGQAP  134

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
            GGLIEGIADFVRLKA YAPSHW +PG+GDRWD GYDVTA+FLDYCNDL++GFVAELN KM
Sbjct  135  GGLIEGIADFVRLKANYAPSHWVQPGQGDRWDQGYDVTAKFLDYCNDLRSGFVAELNKKM  194

Query  614  KNGYSDSYFSDILGKTVDQLWTDYKAKY  697
              GYS  YF D+LGKTVDQLWTDYKA+Y
Sbjct  195  MTGYSAQYFVDLLGKTVDQLWTDYKARY  222



>gb|KCW63683.1| hypothetical protein EUGRSUZ_G01330 [Eucalyptus grandis]
Length=221

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 171/220 (78%), Gaps = 0/220 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            L L +L++ ++     AV+YTVTN A NT G  RF++ IG  YS++ L  A  FIWR+FQ
Sbjct  2    LFLAMLVILSSSMQSHAVQYTVTNNAGNTNGSVRFSRDIGIPYSRKTLTKATGFIWRLFQ  61

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QN P DRK V KVS+F+++M GVAY SN+EIHVSA Y+ G+S DVK E TGVLYHE TH+
Sbjct  62   QNVPRDRKSVAKVSLFIENMAGVAYTSNDEIHVSATYLGGFSADVKREFTGVLYHEMTHV  121

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNG G A GGLIEGIADFVRLK+G+AP HW K G+GDRWD GYDVTARFLDYCN  K 
Sbjct  122  WQWNGAGQAPGGLIEGIADFVRLKSGHAPGHWVKLGQGDRWDQGYDVTARFLDYCNGRKK  181

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            GFVA LN KM+ GYSD+YF D+LGK+VDQLW DYKAKY T
Sbjct  182  GFVAALNKKMRTGYSDNYFVDLLGKSVDQLWKDYKAKYAT  221



>ref|XP_002300242.2| plant basic secretory family protein [Populus trichocarpa]
 gb|EEE85047.2| plant basic secretory family protein [Populus trichocarpa]
Length=228

 Score =   292 bits (748),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 170/221 (77%), Gaps = 0/221 (0%)
 Frame = +2

Query  35   RITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR  214
             + LSL +++  + +       YTVTN A  T GGARF   IG ++SKQ+L +A  FIW 
Sbjct  6    HLFLSLLVILATSTVAAEDFTAYTVTNNACATAGGARFTGDIGVDHSKQILASATAFIWS  65

Query  215  VFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            +F Q  P DRK+V +V +F+D MDGVAYA NNEIHVS+ YI  Y+GD++ E +GVLYHE 
Sbjct  66   IFLQTDPADRKNVHRVDLFIDVMDGVAYADNNEIHVSSNYIGNYTGDLEREFSGVLYHEM  125

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            TH+WQW+GNG   GGLIEGIADFVRLKA Y PSHW +PG+GDRWD GYDVTARFLDYCND
Sbjct  126  THVWQWDGNGTTPGGLIEGIADFVRLKANYTPSHWVQPGQGDRWDRGYDVTARFLDYCND  185

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            L+NGFVAELN KM+ GYS  YF D+LGKTVD+LWT+YKAKY
Sbjct  186  LRNGFVAELNNKMRTGYSAQYFVDLLGKTVDELWTNYKAKY  226



>ref|XP_008236388.1| PREDICTED: uncharacterized protein LOC103335161 [Prunus mume]
Length=224

 Score =   292 bits (748),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 170/218 (78%), Gaps = 1/218 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            LS  IL L A++H   AVEY V N A NTPGG RF   +G +Y++Q +  A +FIW +F 
Sbjct  6    LSFFILAL-ASLHVAHAVEYVVENRALNTPGGIRFTNELGLDYTQQTMGTATDFIWNLFA  64

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            + +P DRKDVQ+VS+FV+D+DG+A++SN+EIHV A+YI G  GD+K +  GVLYHE TH 
Sbjct  65   ETTPADRKDVQRVSLFVEDIDGIAFSSNDEIHVGAKYIEGIQGDIKTDFNGVLYHEMTHT  124

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNG G A  GLIEGIADFVRLKA Y P+ W K GEG RWD GY VTARFLDYCNDL+ 
Sbjct  125  WQWNGQGQAPVGLIEGIADFVRLKADYVPNGWVKSGEGQRWDEGYSVTARFLDYCNDLQQ  184

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GFVAELN KM++GYSD++F D+LGKTVDQLWTDYKAK+
Sbjct  185  GFVAELNKKMRDGYSDNFFQDLLGKTVDQLWTDYKAKF  222



>gb|KCW60472.1| hypothetical protein EUGRSUZ_H03199, partial [Eucalyptus grandis]
Length=216

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 168/215 (78%), Gaps = 0/215 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            L L +L++ ++     AV+YTVTN A NT G  RF++ IG  YS++ L  A  FIWR+FQ
Sbjct  2    LFLAMLVILSSSMQSHAVQYTVTNNAGNTNGSVRFSRDIGIPYSRKTLTKATGFIWRLFQ  61

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            QN P DRK V KVS+F+++M GVAY SN+EIHVSA Y+ G+S DVK E TGVLYHE TH+
Sbjct  62   QNVPRDRKSVAKVSLFIENMAGVAYTSNDEIHVSATYLGGFSADVKREFTGVLYHEMTHV  121

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNG G A GGLIEGIADFVRLK+GYAP HW KPG+G+RWD GYDVTARFLDYCN  K 
Sbjct  122  WQWNGAGQAPGGLIEGIADFVRLKSGYAPGHWVKPGQGNRWDQGYDVTARFLDYCNGRKK  181

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYK  688
            GFVA LN KM+ GYSD+YF D+LGK+VDQLW DYK
Sbjct  182  GFVAALNKKMRTGYSDNYFVDLLGKSVDQLWKDYK  216



>ref|XP_011030392.1| PREDICTED: uncharacterized protein LOC105129852 [Populus euphratica]
Length=239

 Score =   291 bits (744),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 168/221 (76%), Gaps = 0/221 (0%)
 Frame = +2

Query  35   RITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR  214
             + LSL +++    +       YTVTN A  T GGARF   IG ++SK +L  A  FIW 
Sbjct  6    HLFLSLLVILATNTVAAEDLTAYTVTNNACATAGGARFAGDIGVDHSKHILAFATAFIWS  65

Query  215  VFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            +FQQ +P DRK+V +V +F+DDMDGVAYA NNEIHVS+ YI  Y+GD++ E +GVLYHE 
Sbjct  66   IFQQTNPADRKNVHRVDLFIDDMDGVAYADNNEIHVSSNYIGNYTGDLEREFSGVLYHEM  125

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
             HIWQW+GNG   GGLIEGIADFVRLKA Y PSHW +PG+GDRWD GYDVTARFLDYCND
Sbjct  126  AHIWQWDGNGTTPGGLIEGIADFVRLKANYTPSHWVQPGQGDRWDQGYDVTARFLDYCND  185

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            L+NGFVAELN KM+ GYS  YF D+LGKTVD+LW +YKAKY
Sbjct  186  LRNGFVAELNNKMRTGYSAQYFVDLLGKTVDELWRNYKAKY  226



>ref|XP_011016346.1| PREDICTED: uncharacterized protein LOC105119849 [Populus euphratica]
Length=224

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = +2

Query  74   AIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDV  253
            AI+   AV+YTVTN A+ T GGARF + IG +YSK+ L +A +FIWR F+Q++   RK+V
Sbjct  15   AINTVSAVDYTVTNRASATAGGARFTRDIGVDYSKKTLASATDFIWRTFKQSNAAGRKNV  74

Query  254  QKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaan  433
            Q V++FVD M GVAYAS+NEIHVS  YI  YSGDV+ EITGVLYHE  HIWQWNGNG   
Sbjct  75   QTVNLFVDVMGGVAYASSNEIHVSNDYIGNYSGDVRREITGVLYHEMAHIWQWNGNGQTP  134

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
            GGLIEGIADFVRLKA YAP HW + G+GDRWD GYDVTA+FLDYCN L+NGFVAELN KM
Sbjct  135  GGLIEGIADFVRLKANYAPGHWVQAGQGDRWDQGYDVTAKFLDYCNGLRNGFVAELNKKM  194

Query  614  KNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            K GYS  YF D+LGK VDQLWTDYKAKY
Sbjct  195  KTGYSAQYFVDLLGKKVDQLWTDYKAKY  222



>ref|NP_001149395.1| LOC100283021 precursor [Zea mays]
 gb|ACG35300.1| secretory protein [Zea mays]
 tpg|DAA49514.1| TPA: secretory protein [Zea mays]
Length=228

 Score =   288 bits (738),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AV +  TNTA++TPGG RF+Q +G +Y+KQVL  A+ FIW  F Q SP DRK V  V++ 
Sbjct  25   AVTFDATNTASDTPGGQRFDQAVGLDYAKQVLSDASTFIWNTFDQPSPADRKPVDAVTLV  84

Query  272  VDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEG  451
            V+D+ GVA+ S N IH+SA+Y+ GYSGDVK E+TGVLYHE+TH+WQW+G G ANGGLIEG
Sbjct  85   VEDIGGVAFTSANGIHLSAQYVGGYSGDVKTEVTGVLYHETTHVWQWDGQGQANGGLIEG  144

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            IAD+VRLKAGYAP HW +PG+GDRWD GYDVTARFLDYC+ LK GFVA LNAKMK+GY+D
Sbjct  145  IADYVRLKAGYAPGHWVQPGQGDRWDQGYDVTARFLDYCDSLKPGFVALLNAKMKDGYTD  204

Query  632  SYFSDILGKTVDQLWTDYKAKY  697
             +F+ ILGKTV QLW DYKAKY
Sbjct  205  DFFAQILGKTVQQLWQDYKAKY  226



>ref|XP_009346859.1| PREDICTED: uncharacterized protein LOC103938567 [Pyrus x bretschneideri]
Length=225

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  44   LSLCILILGAAIHG-CRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVF  220
            +   +LI  A +HG   AV+Y VTN A  + GG RF+  IG EYS+Q L +A +FI R+F
Sbjct  5    MYFLLLITLAGLHGTAHAVDYDVTNNAGTSAGGVRFDNDIGAEYSRQTLISATDFIRRLF  64

Query  221  QQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTH  400
            QQN+  D K VQK+S+ +++M GVAYASN+ IHVSA YI GYSGDVK EITGVLYHE+TH
Sbjct  65   QQNTAADGKRVQKISLVIENMSGVAYASNDVIHVSADYIAGYSGDVKREITGVLYHETTH  124

Query  401  IWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLK  580
            +WQWNGNG A  GLIEGIAD+VRLKAGY PSHW K G+GD+WD GYDVTARFLDY N L+
Sbjct  125  VWQWNGNGQAPVGLIEGIADYVRLKAGYDPSHWVKAGQGDKWDQGYDVTARFLDYLNGLR  184

Query  581  NGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +GFVAELN+K+++GYS +YF D+LGK VDQLWT+YKAKY
Sbjct  185  DGFVAELNSKLRDGYSATYFVDLLGKNVDQLWTEYKAKY  223



>ref|XP_007200728.1| hypothetical protein PRUPE_ppa018700mg [Prunus persica]
 gb|EMJ01927.1| hypothetical protein PRUPE_ppa018700mg [Prunus persica]
Length=228

 Score =   288 bits (737),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 168/216 (78%), Gaps = 0/216 (0%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            L   +  A++HG  AVE+ V N A NTPGG RF   +G +Y++Q +  A +FIW +F + 
Sbjct  11   LASFLALASLHGGHAVEFVVENRAPNTPGGIRFTNELGLDYTQQTMGTATDFIWNLFAET  70

Query  230  SPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQ  409
            +P DR+DVQ+VS+FV+D+DG+A++SN+EIHV A+YI G  GD+K +  GVLYHE TH WQ
Sbjct  71   TPADRRDVQRVSLFVEDIDGIAFSSNDEIHVGAKYIEGIQGDIKTDFNGVLYHEMTHSWQ  130

Query  410  WngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGF  589
            WNG G A  GLIEGIADFVRLKA Y P+ W K GEG RWD GY VTARFLDYCNDL+ GF
Sbjct  131  WNGQGQAPVGLIEGIADFVRLKADYVPNGWVKSGEGQRWDEGYSVTARFLDYCNDLQQGF  190

Query  590  VAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            VAELN KM++GYSD++F ++LGKTVDQLWTDYKAK+
Sbjct  191  VAELNKKMRDGYSDNFFQELLGKTVDQLWTDYKAKF  226



>ref|XP_010026884.1| PREDICTED: uncharacterized protein LOC104417275 [Eucalyptus grandis]
 gb|KCW60474.1| hypothetical protein EUGRSUZ_H03203 [Eucalyptus grandis]
Length=205

 Score =   287 bits (734),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AVEY V N A +TP G RF   IG  +S+Q L  + +FIWR FQQ    DRK+V +VS+F
Sbjct  2    AVEYLVMNNADDTPDGMRFIDEIGILHSQQTLTMSTDFIWRTFQQIDLADRKEVAQVSLF  61

Query  272  VDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEG  451
            +D+MDGVAY SNNEIHVSA+Y+ G SGDVKGE TGVLYHE TH+WQWNG G A GGLIEG
Sbjct  62   IDNMDGVAYTSNNEIHVSAKYLGGLSGDVKGEFTGVLYHEMTHVWQWNGAGQAPGGLIEG  121

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            IADFVRL++GY P HW +PG G+RWD GYDVTARFLDYC+DL+NGFVAELN KMK G+SD
Sbjct  122  IADFVRLRSGYVPGHWVQPGHGNRWDQGYDVTARFLDYCDDLRNGFVAELNKKMKTGFSD  181

Query  632  SYFSDILGKTVDQLWTDYKAKY  697
            +YF D+L KTVDQLW++YKA Y
Sbjct  182  NYFVDLLAKTVDQLWSEYKAAY  203



>ref|XP_010028408.1| PREDICTED: uncharacterized protein LOC104418692 [Eucalyptus grandis]
 gb|KCW55149.1| hypothetical protein EUGRSUZ_I01099 [Eucalyptus grandis]
Length=227

 Score =   288 bits (736),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 171/225 (76%), Gaps = 2/225 (1%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M R+ L L  L   AA     AVEYT  N A++T GGARF+  IG EY+K+V++++   I
Sbjct  1    MARLVLLLWYLGTLAAFRQASAVEYTALNNASSTAGGARFDGEIGTEYTKKVMNSSTVCI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYA--SNNEIHVSARYINGYSGDVKGEITGVL  382
            W++FQ+ +  DR+DVQ VS+F++ M+GVAYA    NEIHVS+ YI  YSGDVK EITGVL
Sbjct  61   WQIFQELTSEDRRDVQAVSVFIESMEGVAYALIDTNEIHVSSEYIGNYSGDVKNEITGVL  120

Query  383  YHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLD  562
            YHE THIWQW  N  A  GL EGIADFVRLKAGYAPSHW KPG+G+RWD GYDVTA FLD
Sbjct  121  YHEMTHIWQWFANQEAPTGLTEGIADFVRLKAGYAPSHWVKPGQGNRWDQGYDVTAHFLD  180

Query  563  YCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            YC+ L +GFVA++N KMK GYS  YF ++LGKTVDQLW+DYKAKY
Sbjct  181  YCDGLLSGFVADMNKKMKTGYSPQYFVELLGKTVDQLWSDYKAKY  225



>ref|XP_011030391.1| PREDICTED: uncharacterized protein LOC105129851 [Populus euphratica]
Length=224

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = +2

Query  74   AIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDV  253
            AI+   AV+YTVTN A+ T GGARF + IG +YSK+ L +A +FIWR F+Q++   RK+V
Sbjct  15   AINTVSAVDYTVTNRASATAGGARFTRDIGVDYSKKTLASATDFIWRTFKQSNAAGRKNV  74

Query  254  QKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaan  433
            Q V++FVD M GVAYAS+NEIHVS  YI  YSGDV+ EITGVLYHE  HIWQWNGNG   
Sbjct  75   QTVNLFVDVMGGVAYASSNEIHVSNDYIGNYSGDVRREITGVLYHEMAHIWQWNGNGQTP  134

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
            GGLIEGIADFVRLKA YAP HW + G+GDRWD GYDVTA+FLDYCN L+NGFVAELN KM
Sbjct  135  GGLIEGIADFVRLKANYAPGHWVQAGQGDRWDQGYDVTAKFLDYCNGLRNGFVAELNKKM  194

Query  614  KNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            K GYS  YF D+LGK VDQLW DYKAKY
Sbjct  195  KTGYSAQYFVDLLGKKVDQLWRDYKAKY  222



>ref|XP_002313151.1| plant basic secretory family protein [Populus trichocarpa]
 gb|EEE87106.1| plant basic secretory family protein [Populus trichocarpa]
Length=227

 Score =   285 bits (730),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M  +++ L  L+  + ++G  AVEYTVTN A  TPGG RF+  +G+ Y+ + +D A  F 
Sbjct  1    MACLSIFLAFLLTLSTLNGINAVEYTVTNRAPTTPGGIRFSNELGDNYTIKTMDQATIFF  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            WR+FQQN+  DRKDV +VS+FVDDM+ +AYASNNEIHV   YI G  GD+K +  GVLYH
Sbjct  61   WRLFQQNTEADRKDVPRVSLFVDDMEQIAYASNNEIHVGDDYIEGIKGDIKWDFNGVLYH  120

Query  389  ESTHIWQW--ngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLD  562
            E  H WQW  +    A  GLIEGIADF+RLKA YAPSHW KPG+GD WD GYDVTARFLD
Sbjct  121  EMAHTWQWDGSAGTKAPVGLIEGIADFMRLKANYAPSHWVKPGQGDSWDKGYDVTARFLD  180

Query  563  YCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            YCNDL+NGFVAELN KM+  YSD++F ++LGK VDQLW DYKA +
Sbjct  181  YCNDLRNGFVAELNKKMRVTYSDNFFVELLGKPVDQLWRDYKANF  225



>ref|XP_011001233.1| PREDICTED: uncharacterized protein LOC105108579 [Populus euphratica]
Length=227

 Score =   285 bits (730),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 166/225 (74%), Gaps = 2/225 (1%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M  +++ L  L+  + I+G  AVEYTVTN A  TPGG RF+  +G+ Y+ + +D A  F 
Sbjct  1    MACLSIFLAFLLTLSTINGINAVEYTVTNRAPTTPGGIRFSNELGDNYTMKTMDQATIFF  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            WR+FQQN+  DRKDV +VS+FVDDM+G+AYASNNEIHV   YI G  GD+K +  GVLYH
Sbjct  61   WRLFQQNTEADRKDVPRVSLFVDDMEGIAYASNNEIHVGDDYIEGIKGDIKWDFNGVLYH  120

Query  389  ESTHIWQW--ngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLD  562
            E  H WQW  +    A  GLIEGIADF+RLKA YAPS W KPG+GD WD GYDVTARFLD
Sbjct  121  EMAHTWQWDGSAGTKAPVGLIEGIADFMRLKANYAPSQWVKPGQGDSWDQGYDVTARFLD  180

Query  563  YCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            YCNDL+NGFVAELN KM+  YSD +F ++LGK VDQLW +YKA +
Sbjct  181  YCNDLRNGFVAELNKKMRVTYSDDFFVELLGKPVDQLWREYKASF  225



>ref|XP_002467027.1| hypothetical protein SORBIDRAFT_01g018490 [Sorghum bicolor]
 gb|EER94025.1| hypothetical protein SORBIDRAFT_01g018490 [Sorghum bicolor]
Length=225

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDD  280
            +  TNTA+NTPGG RF+Q +G  Y+KQVL  A+ FIW  F Q SP DRK V  +++ V+D
Sbjct  25   FDATNTASNTPGGQRFDQAVGVNYAKQVLSDASTFIWNTFNQRSPADRKPVDAITLVVED  84

Query  281  MDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIAD  460
            + GVA+ S N IH+S +Y+  YSGDVK E+TGVLYHE+TH+WQW+G G ANGGLIEGIAD
Sbjct  85   IGGVAFTSANRIHLSTQYVGNYSGDVKTEVTGVLYHETTHVWQWDGQGKANGGLIEGIAD  144

Query  461  FVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYF  640
            +VRLKAGYAPSHW KPG+GDRWD GYDVTARFLDYC+ LK GFVA LNAKMK GY+D +F
Sbjct  145  YVRLKAGYAPSHWVKPGQGDRWDQGYDVTARFLDYCDSLKPGFVALLNAKMKGGYTDDFF  204

Query  641  SDILGKTVDQLWTDYKAKY  697
            + ILGKTV QLW DYKAKY
Sbjct  205  AQILGKTVQQLWKDYKAKY  223



>ref|XP_003574106.1| PREDICTED: uncharacterized protein LOC100828815 [Brachypodium 
distachyon]
Length=222

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 165/199 (83%), Gaps = 0/199 (0%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDD  280
            +  +NTA++T GG RFNQ +G +YSKQVL  A+ FIW  F Q S  +RK V  V++ V++
Sbjct  22   FDASNTASSTAGGQRFNQAVGLDYSKQVLSDASTFIWTTFNQRSTANRKPVDAVTLVVEN  81

Query  281  MDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIAD  460
            +DGVA+ASNN IH+S++Y+ GYSG+VK E+TGVLYHE+TH+WQWNG G ANGGLIEGIAD
Sbjct  82   IDGVAFASNNRIHLSSKYVGGYSGNVKAEVTGVLYHEATHVWQWNGQGKANGGLIEGIAD  141

Query  461  FVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYF  640
            +VRLKAG+AP+HWRK GEGDRWD GYDVTARFLDYC+ LK GFVAELN KMK GY+D +F
Sbjct  142  YVRLKAGFAPAHWRKAGEGDRWDQGYDVTARFLDYCDSLKPGFVAELNGKMKGGYTDDFF  201

Query  641  SDILGKTVDQLWTDYKAKY  697
            + ILGK+V QLW DYKAKY
Sbjct  202  AQILGKSVQQLWKDYKAKY  220



>ref|XP_004305960.1| PREDICTED: uncharacterized protein LOC101310442 [Fragaria vesca 
subsp. vesca]
Length=227

 Score =   284 bits (726),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = +2

Query  29   MDRITLSLCI--LILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAAN  202
            M R  LS  +  ++  A +HG  AVE+ V N A NTPGG RF   +G  Y++Q + AA +
Sbjct  1    MARFLLSFILASVLALATLHGTHAVEFVVFNRALNTPGGVRFRNQLGRNYTQQRMRAATD  60

Query  203  FIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVL  382
            FIW +F++ +  DRK V +VS+FVDDMDG+AY  N+EIHV A+YI G  GD+K +  GVL
Sbjct  61   FIWNLFKETAAADRKSVARVSLFVDDMDGIAYTINDEIHVGAKYIQGIKGDIKTDFNGVL  120

Query  383  YHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLD  562
            +HE TH+WQWNG G A GGLIEGIADFVRLKA Y P+   KPG+G RWD GY +TARFLD
Sbjct  121  FHEMTHVWQWNGKGQAPGGLIEGIADFVRLKANYVPNGSVKPGQGQRWDEGYSITARFLD  180

Query  563  YCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            YCN LK GFVAELN KM+NGYSDS+F+ +LGKTVDQLW DYKAK+
Sbjct  181  YCNGLKKGFVAELNKKMRNGYSDSFFNQLLGKTVDQLWKDYKAKF  225



>ref|XP_010068403.1| PREDICTED: uncharacterized protein LOC104455286 [Eucalyptus grandis]
 gb|KCW63688.1| hypothetical protein EUGRSUZ_G01338 [Eucalyptus grandis]
Length=205

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AVEY V N A +TP G RF   IG  +S+Q L  + +FIWR FQQ    DRK+V +VS+F
Sbjct  2    AVEYLVMNNADDTPDGMRFIDEIGILHSQQTLTMSTDFIWRTFQQIDLVDRKEVARVSLF  61

Query  272  VDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEG  451
            VD+MDGVAY SNNEIHVSA+Y+ G SGDVKGE TGVLYHE TH+WQWNG G A GGLIEG
Sbjct  62   VDNMDGVAYTSNNEIHVSAKYLGGLSGDVKGEFTGVLYHEMTHVWQWNGAGQAPGGLIEG  121

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            IADFVRL++GY P HW +PG GDRWD GYDVTARFLDY + L+NGFVAELN KMK G+SD
Sbjct  122  IADFVRLRSGYVPGHWVQPGHGDRWDQGYDVTARFLDYWDGLRNGFVAELNKKMKTGFSD  181

Query  632  SYFSDILGKTVDQLWTDYKAKY  697
            +YF D+L KTVDQLW++YKA Y
Sbjct  182  NYFVDLLAKTVDQLWSEYKAAY  203



>ref|XP_006369747.1| plant basic secretory family protein [Populus trichocarpa]
 gb|ERP66316.1| plant basic secretory family protein [Populus trichocarpa]
Length=224

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 165/208 (79%), Gaps = 0/208 (0%)
 Frame = +2

Query  74   AIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDV  253
            AI+   AV+YTVTN A+ T GGARF + IG +YSK+ L +A +FIWR  +Q++   RK+V
Sbjct  15   AINTVSAVDYTVTNRASATAGGARFTRDIGIDYSKKTLASATDFIWRTLKQSNAAGRKNV  74

Query  254  QKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaan  433
            Q V++F+D M GVAYA +NEIHVS  YI  YSGDV+ EITGVLYHE  HIWQWNGNG   
Sbjct  75   QTVNLFIDVMGGVAYAIDNEIHVSNDYIGNYSGDVRREITGVLYHEMAHIWQWNGNGQTP  134

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
            GGLIEGIADFVRLKA YAPSHW + G+GD WD GYDVTA+FLDYCN L+NGFVA+LN KM
Sbjct  135  GGLIEGIADFVRLKANYAPSHWVQAGQGDSWDQGYDVTAKFLDYCNGLRNGFVAKLNKKM  194

Query  614  KNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            K GYS  YF D+LGKTVDQLW DYKAKY
Sbjct  195  KTGYSAQYFVDLLGKTVDQLWKDYKAKY  222



>ref|XP_011030429.1| PREDICTED: uncharacterized protein LOC105129884, partial [Populus 
euphratica]
Length=201

 Score =   277 bits (709),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDD  280
            YTVTN A+ T GGARF + IG +YSK+ L +A +FIWR F+Q++   RK+VQ V++FVD 
Sbjct  1    YTVTNRASATAGGARFTRDIGVDYSKKTLASATDFIWRTFKQSNAAGRKNVQTVNLFVDV  60

Query  281  MDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIAD  460
            M GVAYAS+NEIHVS  YI  YSGDV+ EITGVLYHE  HIWQWNGNG   GGLIEGIAD
Sbjct  61   MGGVAYASSNEIHVSNDYIGNYSGDVRREITGVLYHEMAHIWQWNGNGQTPGGLIEGIAD  120

Query  461  FVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYF  640
            FVRLKA YAP HW + G+GDRWD GYDVTA+FLDYCN L+NGFVAELN KMK GYS  YF
Sbjct  121  FVRLKANYAPGHWVQAGQGDRWDQGYDVTAKFLDYCNGLRNGFVAELNKKMKTGYSAQYF  180

Query  641  SDILGKTVDQLWTDYKAK  694
             D+LGK VDQLW DYKAK
Sbjct  181  VDLLGKKVDQLWRDYKAK  198



>emb|CAA74594.1| hypothetical protein [Hordeum vulgare]
 dbj|BAJ85547.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 167/219 (76%), Gaps = 2/219 (1%)
 Frame = +2

Query  41   TLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVF  220
            T++  +L+  AA    RAV +  +NTA+ T GG RF+  +G  YSKQVL  A+ FIW  F
Sbjct  7    TVAFFLLVTMAAT--ARAVTFDASNTASGTAGGQRFDNAVGLAYSKQVLSDASTFIWNTF  64

Query  221  QQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTH  400
             Q +  DRK V  V++ V+D+ GVA+AS N IH+SA+Y+ GYSGDVK E+TGVLYHE+TH
Sbjct  65   NQRAAADRKPVDAVTLVVEDIGGVAFASGNGIHLSAKYVGGYSGDVKKEVTGVLYHEATH  124

Query  401  IWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLK  580
            +WQWNG G ANGGLIEGIAD+VRLKAG AP HWR  G GDRWD GYD+TARFLDYC+ L 
Sbjct  125  VWQWNGRGTANGGLIEGIADYVRLKAGLAPGHWRPQGSGDRWDQGYDITARFLDYCDSLM  184

Query  581  NGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
             GFVA+LNAKMK+GYSD +F+ ILGK V QLW DYKAK+
Sbjct  185  PGFVAQLNAKMKSGYSDDFFAQILGKNVQQLWKDYKAKF  223



>gb|EMT16068.1| hypothetical protein F775_26852 [Aegilops tauschii]
Length=225

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 167/217 (77%), Gaps = 0/217 (0%)
 Frame = +2

Query  47   SLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ  226
            ++   +L A     +AV +  +N A+ T GG RFNQ +G  YSK+VL  A+ FIW+ F Q
Sbjct  7    TVASFLLVALAATAQAVTFDASNKASGTSGGRRFNQAVGLPYSKKVLSDASAFIWKTFNQ  66

Query  227  NSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIW  406
             + GDRK V  V++ V+D+ GVA+ S N IH+SA+Y  G SGDVK E+TGVLYHE+TH+W
Sbjct  67   RAAGDRKPVDAVTLVVEDISGVAFTSANGIHLSAQYSTGISGDVKKEVTGVLYHEATHVW  126

Query  407  QWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNG  586
            QWNG G ANGGLIEGIAD+VRLKAG+AP HW +PG+GDRWD GYDVTARFLDYC+ LK G
Sbjct  127  QWNGQGRANGGLIEGIADYVRLKAGFAPGHWVRPGQGDRWDQGYDVTARFLDYCDSLKPG  186

Query  587  FVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            FVA+LNAKMK+GY+D +F+ ILGK V QLW DYKAK+
Sbjct  187  FVAQLNAKMKSGYTDDFFAQILGKNVQQLWKDYKAKF  223



>ref|XP_006661891.1| PREDICTED: uncharacterized protein LOC102706684 [Oryza brachyantha]
Length=227

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 165/204 (81%), Gaps = 1/204 (0%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AV +  TNTA+NT GG RF+Q +G EY++QVL  A+ FIW  F Q + GDRK V  V++ 
Sbjct  23   AVTFDATNTASNTAGGQRFDQEVGVEYARQVLADASAFIWDAFGQPTDGDRKPVDAVTLA  82

Query  272  VDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEG  451
            V+D+ GVA+ S N IH+SA+Y+ GYSGDV+ E+TGVLYHE+TH+WQW+G G ANGGLIEG
Sbjct  83   VEDIGGVAFTSANGIHLSAQYVGGYSGDVRAEVTGVLYHEATHVWQWDGRGGANGGLIEG  142

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCN-DLKNGFVAELNAKMKNGYS  628
            IADFVRL+AGYAPSHW +PG+GDRWD GYDVTARFLDYC+  +  GFVA+LNAKMK+GYS
Sbjct  143  IADFVRLRAGYAPSHWVRPGQGDRWDQGYDVTARFLDYCDSSVVQGFVAQLNAKMKDGYS  202

Query  629  DSYFSDILGKTVDQLWTDYKAKYN  700
            D +F  I GKTVDQLW DYKAKY 
Sbjct  203  DDFFVQISGKTVDQLWQDYKAKYG  226



>ref|XP_004496927.1| PREDICTED: uncharacterized protein LOC101505538 [Cicer arietinum]
Length=226

 Score =   275 bits (703),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 165/223 (74%), Gaps = 10/223 (4%)
 Frame = +2

Query  47   SLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ  226
            +LC L+  AAI+G +AVEY+VTN+A +T    RF   IG +Y+ Q LD+A  FIW +FQQ
Sbjct  4    ALCFLVFLAAINGIQAVEYSVTNSALST----RFRDQIGTQYATQKLDSATQFIWNIFQQ  59

Query  227  NSPGDRKDVQKVSMFVDDMDG-VAYASNN--EIHVSARYINGYSGDVKGEITGVLYHEST  397
            N+P DR+ VQKV + +++ D  +AY + N  EIHVS  Y+N Y GDV+ EITGVLYHE T
Sbjct  60   NNPADRRHVQKVGLLIENFDNPIAYTNTNTEEIHVSGSYVNSYKGDVRNEITGVLYHEMT  119

Query  398  HIWQWng---ngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            H+WQW G         GL EGIAD+VRLKA Y PSHW KPGEG +WD GYDVTARFLDYC
Sbjct  120  HVWQWFGRYGVPRVPVGLTEGIADYVRLKANYIPSHWVKPGEGQKWDQGYDVTARFLDYC  179

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            + L++GFVAELN  ++NGYSD  F  +LGKTVDQLWTDYKAKY
Sbjct  180  DGLRSGFVAELNKMIRNGYSDQLFLQLLGKTVDQLWTDYKAKY  222



>gb|ABV22582.1| PR17c precursor [Hordeum vulgare subsp. vulgare]
 gb|ABV22583.1| PR17c precursor [Hordeum vulgare subsp. vulgare]
 gb|ABV22586.1| PR17c precursor [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 167/223 (75%), Gaps = 0/223 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M     ++   +L A     +AV +  +N A+ T GG RF Q +G  YSK+VL  A+ FI
Sbjct  1    MKLQVATVASFLLVALAATAQAVTFDASNKASGTSGGRRFEQAVGLPYSKKVLSEASAFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            W+ F Q + GDRK V  V++ V+D+ GVA+ S N IH+SA+Y+   SGDVK E+TGVLYH
Sbjct  61   WKTFNQRAVGDRKPVNAVTLVVEDISGVAFTSANGIHLSAQYVASISGDVKKEVTGVLYH  120

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E+TH+WQWNG G ANGGLIEGIAD+VRLKAG+AP HW KPG+GDRWD GYDVTARFLDYC
Sbjct  121  EATHVWQWNGQGKANGGLIEGIADYVRLKAGFAPGHWVKPGQGDRWDQGYDVTARFLDYC  180

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            + LK GFVA+LNAKMK+GY+D +F+ ILGK V QLW DYK+K+
Sbjct  181  DSLKPGFVAQLNAKMKSGYTDDFFAQILGKNVQQLWRDYKSKF  223



>emb|CAN65929.1| hypothetical protein VITISV_038845 [Vitis vinifera]
Length=227

 Score =   273 bits (697),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 165/218 (76%), Gaps = 1/218 (0%)
 Frame = +2

Query  53   CILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNS  232
            C++IL AA+HG  AVE+ V N A ++ GG RF   IG E S   L  +  FIW +FQQN+
Sbjct  11   CLVIL-AALHGIHAVEFEVINNAESSAGGIRFTNEIGTELSMLTLSDSTYFIWDLFQQNT  69

Query  233  PGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW  412
              DRKDVQKV++ +D+MDGVAYA+N+EIH +A YI  Y+GD++ E TG+++HE THIWQW
Sbjct  70   EQDRKDVQKVTLIIDNMDGVAYATNDEIHFNANYIGNYAGDLRMEFTGIIFHEMTHIWQW  129

Query  413  ngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFV  592
            NG+G A  GL EGIADFVRL A +AP HW +PGEG+RWD GYDVTARFLDYC  L +GFV
Sbjct  130  NGDGLAPRGLTEGIADFVRLSADFAPGHWVQPGEGERWDQGYDVTARFLDYCKGLSSGFV  189

Query  593  AELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
            AELN KM + YS+ +F ++LGKTVD+LW+DYK  Y  N
Sbjct  190  AELNKKMGSDYSEDFFVELLGKTVDELWSDYKDMYGKN  227



>ref|XP_002467026.1| hypothetical protein SORBIDRAFT_01g018480 [Sorghum bicolor]
 gb|EER94024.1| hypothetical protein SORBIDRAFT_01g018480 [Sorghum bicolor]
Length=237

 Score =   272 bits (696),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 158/200 (79%), Gaps = 0/200 (0%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDD  280
            ++ TN A++T GG RF + IG  YS++VL  A++F W+ F Q +PG RK V  V++ V+D
Sbjct  37   FSATNAASSTAGGKRFGRDIGVAYSRRVLSDASSFCWKTFSQPNPGSRKPVSSVTLVVED  96

Query  281  MDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIAD  460
            + GVA+ S N IH+SA+Y+ GYSGD+K E  GVLYHE TH+WQW+G G ANGGLIEGIAD
Sbjct  97   IGGVAFTSGNGIHLSAQYVGGYSGDIKTEAAGVLYHEVTHVWQWDGQGKANGGLIEGIAD  156

Query  461  FVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYF  640
            +VRLKAGYAP HW KPG+GDRWD GYDVTARFLDYC+ LK GFVA+LNAKMK GYSD +F
Sbjct  157  YVRLKAGYAPGHWGKPGQGDRWDQGYDVTARFLDYCDSLKPGFVAQLNAKMKGGYSDDFF  216

Query  641  SDILGKTVDQLWTDYKAKYN  700
            + ILGK V QLW DYKAKY 
Sbjct  217  AQILGKNVQQLWKDYKAKYG  236



>ref|XP_010271313.1| PREDICTED: uncharacterized protein LOC104607374 [Nelumbo nucifera]
Length=237

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 163/230 (71%), Gaps = 9/230 (4%)
 Frame = +2

Query  35   RITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR  214
             +   L  LI  +A+ G  AVEY   N A+ T GG RF+  IG EYS++ L +A+ FIW+
Sbjct  6    EMLFFLYYLIGLSALQGLNAVEYQAFNYASGTTGGTRFDTQIGVEYSREKLKSASEFIWQ  65

Query  215  VFQQNSPGDRKDVQKVSMFVDDM-DGV-------AYASNNEIHVSARYINGYSGDVKGEI  370
             F+Q S  +RK VQ VS+FV+ M DG+       AYA NNEIHV+A YI  Y GDV  EI
Sbjct  66   TFRQTSETERKSVQSVSLFVETMADGMNGWHGVPAYAVNNEIHVNATYIEVYKGDVNREI  125

Query  371  TGVLYHESTHIWQW-ngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVT  547
            TG+LYHE TH+WQW        G LIEG+ADF+RLKAGYAPSHW KPGEG+ WD GYDVT
Sbjct  126  TGILYHEVTHVWQWDGNGQPGAGVLIEGVADFIRLKAGYAPSHWVKPGEGNSWDQGYDVT  185

Query  548  ARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            A FLDYC+ LKNGFVAELNAKMK  YS  +F ++LGKTVDQLW DYKAKY
Sbjct  186  AHFLDYCDGLKNGFVAELNAKMKTAYSAQFFVELLGKTVDQLWADYKAKY  235



>ref|XP_003549177.1| PREDICTED: TMV resistance protein N [Glycine max]
 gb|AAO23072.1| R 14 protein [Glycine max]
Length=641

 Score =   283 bits (724),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 169/233 (73%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    EIKEIAKTSMDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQ  181
            EI +I K S D            A     +  ++TV N A  TPGG RF   IG EY+ +
Sbjct  417  EIVDILKVSFD------------ATKQETQGYKFTVINNALTTPGGVRFRDKIGAEYANR  464

Query  182  VLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSG-DV  358
             L+ A  F+WR+FQQ +P DRK+VQKVS+ VDDM+G+AY  NNEIHVSARY+NGYSG DV
Sbjct  465  TLELATQFVWRIFQQKNPSDRKNVQKVSLVVDDMEGIAYTMNNEIHVSARYVNGYSGGDV  524

Query  359  KGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGY  538
            K EITGVL+H+  ++WQW GNG A GGLI GIADFVRLKA YA SHWRKPG+G RWD GY
Sbjct  525  KREITGVLFHQVCYVWQWYGNGEAPGGLIGGIADFVRLKANYAASHWRKPGQGQRWDEGY  584

Query  539  DVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            D+TA FLDYC+ LK+GFVA+LN  M+ GYSD +F  +LGK VDQLW DYKA+Y
Sbjct  585  DITAHFLDYCDSLKSGFVAQLNQLMRTGYSDQFFVQLLGKPVDQLWRDYKAQY  637



>ref|XP_008646584.1| PREDICTED: uncharacterized protein LOC103628086 [Zea mays]
Length=240

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 173/233 (74%), Gaps = 5/233 (2%)
 Frame = +2

Query  17   AKTSMDR---ITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVL  187
            ++T+M R   + + L  L+ G A     AV +  TN A++T GG RF + +G  YS++VL
Sbjct  7    SETTMMRRAAVVVGLASLLAGVAATAGGAVRFRATNAASSTAGGKRFGRDVGVAYSRRVL  66

Query  188  DAAANFIWRVFQQNSPG--DRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVK  361
              A++F W+ F Q SPG   RK V  V++ V+D+ GVA+ S N IH+SA+Y+ GYSGDVK
Sbjct  67   SDASSFCWKTFNQPSPGPGSRKPVSSVTLVVEDIGGVAFTSGNGIHLSAQYVGGYSGDVK  126

Query  362  GEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYD  541
             E+ GVLYHE TH+WQW+G G ANGGL+EGIAD+VRLKAGYAP HW KPG+GDRWD GYD
Sbjct  127  TEVAGVLYHEVTHVWQWDGQGQANGGLVEGIADYVRLKAGYAPGHWVKPGQGDRWDQGYD  186

Query  542  VTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            VTARFLDYC+ LK GFVA+LNAK+K GYSD +F+ ILGK V QLW +YKAKY 
Sbjct  187  VTARFLDYCDSLKPGFVAQLNAKLKGGYSDDFFAQILGKNVQQLWQEYKAKYG  239



>ref|XP_009788961.1| PREDICTED: uncharacterized protein LOC104236679 [Nicotiana sylvestris]
Length=225

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 168/224 (75%), Gaps = 7/224 (3%)
 Frame = +2

Query  38   ITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR-  214
            +T  L  L+  A I+G  AV Y+VT     T  GARF++ IG +Y+ Q LD+A NFI   
Sbjct  3    MTYFLSSLLFLAIINGIHAVNYSVT---IKTASGARFDRDIGGQYTLQTLDSATNFICND  59

Query  215  VFQQNSPGDRKDVQKVSMFV-DDMDG--VAYASNNEIHVSARYINGYSGDVKGEITGVLY  385
            + + N P +RKDVQ +S+FV DDMDG  VAY  NNEI V++RYI GYSGDVK EITGVLY
Sbjct  60   ILKINCPINRKDVQHISIFVADDMDGDDVAYQDNNEIQVNSRYIEGYSGDVKREITGVLY  119

Query  386  HESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDY  565
            HE TH+WQW GNG A  GL+EG+AD+VRLKAG+APSHW   G+G  WD GYDVTARFLDY
Sbjct  120  HEMTHVWQWKGNGQATQGLVEGVADYVRLKAGFAPSHWVMSGQGSSWDQGYDVTARFLDY  179

Query  566  CNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            CN LK+GFV ELN KM++ YSDSYF D+LGK+VDQLW DYKA +
Sbjct  180  CNSLKDGFVVELNKKMRDAYSDSYFCDMLGKSVDQLWEDYKATF  223



>gb|EMS47839.1| hypothetical protein TRIUR3_32088 [Triticum urartu]
Length=211

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = +2

Query  86   CRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVS  265
             RAV +  +NTA+ T GG RF+  +G  YSKQVL  A+ FIW  F Q +  DRK V  V+
Sbjct  5    ARAVTFDASNTASGTAGGKRFDNAVGLAYSKQVLSDASTFIWSTFNQRAAADRKPVDAVT  64

Query  266  MFVDDMDGVAYASNNEIHVSARYINGY-SGDVKGEITGVLYHESTHIWQWngngaanggL  442
            + V+D+DGVA+ S N IH+SA Y+ GY SGDVK E TGVLYHE+ H+WQWNG GAANGGL
Sbjct  65   LVVEDIDGVAFPSGNGIHLSASYVGGYTSGDVKKEGTGVLYHEARHVWQWNGQGAANGGL  124

Query  443  IEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNG  622
            IEGIAD+VRLKAG AP HWR  G G RWD GYD+TARFLDYC+ LK GFVA+LNAKMK+G
Sbjct  125  IEGIADYVRLKAGLAPGHWRPQGSGSRWDEGYDITARFLDYCDSLKPGFVAQLNAKMKSG  184

Query  623  YSDSYFSDILGKTVDQLWTDYKAKY  697
            YSD +F+ ILGK V QLW DYKAK+
Sbjct  185  YSDDFFAQILGKNVQQLWQDYKAKF  209



>ref|XP_004159905.1| PREDICTED: uncharacterized LOC101221124 [Cucumis sativus]
Length=208

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AV++TVTN A  TPGG RF+  IG + S+Q++ A+ +FIW +FQQ+S  +RK+V KV +F
Sbjct  4    AVKFTVTNKAVGTPGGVRFDNEIGVDCSRQIMVASTDFIWNIFQQSSVANRKNVHKVKLF  63

Query  272  -VDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIE  448
             V D DGVA+ASNNEIHVSA YI  Y GDVK EITGVLYHE THIWQWNG   A GGLIE
Sbjct  64   IVTDYDGVAFASNNEIHVSAGYIANYGGDVKREITGVLYHEMTHIWQWNGIPNAPGGLIE  123

Query  449  GIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYS  628
            GIAD+VRLK+GY P HW  PG G  WD GYDVTARFLDY   L++GFVAELN +++NGYS
Sbjct  124  GIADYVRLKSGYIPGHWVGPGGGSSWDQGYDVTARFLDYLEGLRSGFVAELNRRLRNGYS  183

Query  629  DSYFSDILGKTVDQLWTDYKAKY  697
             +YF  +LGK VDQLW DYKA Y
Sbjct  184  ANYFVQLLGKPVDQLWADYKAAY  206



>ref|NP_565369.1| basic secretory protein family protein [Arabidopsis thaliana]
 gb|AAK31145.1|AF345341_1 unknown [Arabidopsis thaliana]
 gb|AAD25570.1| expressed protein [Arabidopsis thaliana]
 gb|AAL91278.1| At2g15220/F15A23.4 [Arabidopsis thaliana]
 gb|AEC06376.1| basic secretory protein family protein [Arabidopsis thaliana]
Length=225

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 168/225 (75%), Gaps = 4/225 (2%)
 Frame = +2

Query  26   SMDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGE-EYSKQVLDAAAN  202
            +  +I   + ++++ + ++   AV+Y+V + + ++ GG RF   IG   Y  Q L +A +
Sbjct  2    TFHKIFFVISLMLVVSLVN---AVDYSVVDNSGDSTGGRRFRGEIGGISYGTQTLRSATD  58

Query  203  FIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVL  382
            F+WR+FQQ +P DRK V K+++F+++ DGVAY S NEIH +  Y+ G SGDVK E TGV+
Sbjct  59   FVWRLFQQTNPSDRKSVTKITLFMENGDGVAYNSANEIHFNVGYLAGVSGDVKREFTGVV  118

Query  383  YHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLD  562
            YHE  H WQWNG G A GGLIEGIAD+VRLKAGYAPSHW  PG GDRWD GYDVTARFLD
Sbjct  119  YHEVVHSWQWNGAGRAPGGLIEGIADYVRLKAGYAPSHWVGPGRGDRWDQGYDVTARFLD  178

Query  563  YCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            YCN L+NGFVAELN KM+NGYSD +F D+LGK V+QLW +YKAKY
Sbjct  179  YCNGLRNGFVAELNKKMRNGYSDGFFVDLLGKDVNQLWREYKAKY  223



>ref|XP_004136961.1| PREDICTED: uncharacterized protein LOC101221124 [Cucumis sativus]
 gb|KGN43894.1| NtPRp27-like protein [Cucumis sativus]
Length=227

 Score =   265 bits (677),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AV++TVTN A  TPGG RF+  IG + S+Q++ A+ +FIW +FQQ+S  +RK+V KV +F
Sbjct  23   AVKFTVTNKAVGTPGGVRFDNEIGVDCSRQIMVASTDFIWNIFQQSSVANRKNVHKVKLF  82

Query  272  -VDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIE  448
             V D DGVA+ASNNEIHVSA YI  Y GDVK EITGVLYHE THIWQWNG   A GGLIE
Sbjct  83   IVTDYDGVAFASNNEIHVSAGYIANYGGDVKREITGVLYHEMTHIWQWNGIPNAPGGLIE  142

Query  449  GIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYS  628
            GIAD+VRLK+GY P HW  PG G  WD GYDVTARFLDY   L++GFVAELN +++NGYS
Sbjct  143  GIADYVRLKSGYIPGHWVGPGGGSSWDQGYDVTARFLDYLEGLRSGFVAELNRRLRNGYS  202

Query  629  DSYFSDILGKTVDQLWTDYKAKY  697
             +YF  +LGK VDQLW DYKA Y
Sbjct  203  ANYFVQLLGKPVDQLWADYKAAY  225



>ref|XP_008454989.1| PREDICTED: uncharacterized protein LOC103495269 [Cucumis melo]
Length=227

 Score =   265 bits (676),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 157/207 (76%), Gaps = 1/207 (0%)
 Frame = +2

Query  80   HGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQK  259
            H   +VE+TV N A  TPGG RF+  IG + SKQ++ A+ +FIW++FQQ+S  DRK+V +
Sbjct  19   HVVSSVEFTVVNKAVGTPGGVRFDNEIGVDCSKQIMVASTDFIWKIFQQSSIADRKNVHR  78

Query  260  VSMF-VDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaang  436
            VS+F V D DGVA+ASNNEIHVSA YI  Y GDVK EITGVLYHE THIWQWNG   A G
Sbjct  79   VSLFIVTDYDGVAFASNNEIHVSASYIANYGGDVKREITGVLYHEMTHIWQWNGIPNAPG  138

Query  437  gLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMK  616
            GLIEGIAD++RLK+GY P+HW  PG G  WD GYDVTARFLDY   L +GFVAELN ++K
Sbjct  139  GLIEGIADYIRLKSGYIPNHWVGPGGGSSWDQGYDVTARFLDYLEGLSSGFVAELNRRLK  198

Query  617  NGYSDSYFSDILGKTVDQLWTDYKAKY  697
             GYS +YF  +L K VDQLW DYKA Y
Sbjct  199  YGYSANYFVQLLEKPVDQLWADYKAAY  225



>ref|XP_004982761.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Setaria italica]
Length=652

 Score =   277 bits (709),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDD  280
            +  TN+A+NTPGG RF+Q +G +Y+K+VL  A+ FIW  F Q SP DRK V KV++ V+D
Sbjct  27   FDATNSASNTPGGQRFDQAVGLDYAKRVLSDASTFIWNTFNQPSPDDRKPVDKVTLVVED  86

Query  281  MDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIAD  460
            +DGVA+ S N IH+SA+Y+ GYSGDVK E+TGVLYHE TH+WQWNG G ANGGLIEGIAD
Sbjct  87   IDGVAFTSANGIHLSAKYVGGYSGDVKKEVTGVLYHEVTHVWQWNGQGRANGGLIEGIAD  146

Query  461  FVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYF  640
            +V+LKAGYAP  W  PG+G RWD GYDVTARFLDYC+ LK GFVA+LNAKMK+GY+D +F
Sbjct  147  YVQLKAGYAPGSWVLPGQGRRWDQGYDVTARFLDYCDSLKPGFVAQLNAKMKDGYTDDFF  206

Query  641  SDILGKTVDQLWTDYKA  691
            + ILGK+V QLW DYKA
Sbjct  207  AQILGKSVQQLWQDYKA  223



>ref|XP_010691662.1| PREDICTED: uncharacterized protein LOC104904936 [Beta vulgaris 
subsp. vulgaris]
Length=223

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = +2

Query  134  GGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKD-VQKVSMFVDDMDGVAYASNN  310
            GG RFN  IG  Y++Q L +A NFIWR FQQ++P DRK  VQ+VS+ V+ + GVAY   +
Sbjct  34   GGTRFNNEIGINYARQTLSSATNFIWRTFQQSNPADRKSTVQQVSLTVEAISGVAYTQGD  93

Query  311  EIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAP  490
             IH+++ Y+  YS +VK E+TG+LYHE  H+WQWNGNG A GGLIEGIAD+VRLKAGYAP
Sbjct  94   RIHLNSNYVQSYSRNVKAEVTGILYHEMAHVWQWNGNGQAPGGLIEGIADYVRLKAGYAP  153

Query  491  SHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQ  670
            SHW +PG+GDRWD GYDVTARFLDYCN L+NGFVA+LN KM+ GY+DSYF+D+LGK+V Q
Sbjct  154  SHWVQPGQGDRWDQGYDVTARFLDYCNSLRNGFVAQLNKKMRGGYNDSYFNDLLGKSVGQ  213

Query  671  LWTDYKAKYN  700
            L++DYKAKYN
Sbjct  214  LFSDYKAKYN  223



>gb|AAD46133.1|AF079526_1 secretory protein [Triticum aestivum]
Length=224

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 158/199 (79%), Gaps = 1/199 (1%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDD  280
            +  +N A+ T GG RFNQ +   YSK+VL  A+ FIW+ F Q + GDRK V  V++ V+D
Sbjct  25   FDASNKASGTSGGRRFNQAV-VPYSKKVLSDASAFIWKTFNQRAVGDRKTVDAVTLVVED  83

Query  281  MDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIAD  460
            + GVA+ S N IH+SA+Y+ G SGDVK E+TGVLYHE+TH+WQWNG G ANGGLIEGIAD
Sbjct  84   ISGVAFTSANGIHLSAQYVGGISGDVKKEVTGVLYHEATHVWQWNGPGQANGGLIEGIAD  143

Query  461  FVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYF  640
            +VRLKAG+AP HW KPG+GDRWD GYDVTARFLDYC+ LK GFVA +NAKMK+GY+D +F
Sbjct  144  YVRLKAGFAPGHWVKPGQGDRWDQGYDVTARFLDYCDSLKPGFVAHVNAKMKSGYTDDFF  203

Query  641  SDILGKTVDQLWTDYKAKY  697
            + ILGK V QLW DYKAK+
Sbjct  204  AQILGKNVQQLWKDYKAKF  222



>ref|XP_007200255.1| hypothetical protein PRUPE_ppa015159mg [Prunus persica]
 gb|EMJ01454.1| hypothetical protein PRUPE_ppa015159mg [Prunus persica]
Length=231

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 151/208 (73%), Gaps = 2/208 (1%)
 Frame = +2

Query  80   HGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQK  259
            HG  AV Y V N A NTPGG RF   +G  Y++Q +  A NFIW +F + +P DRK+V+ 
Sbjct  22   HGAHAVHYAVVNRAPNTPGGMRFKNKLGVNYTQQKMGNATNFIWNLFNETTPADRKNVKN  81

Query  260  VSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaangg  439
            VS+FVD++ G A+  NNEIHV A+YI    GD+K E +GVLYHE THIWQ + N  A  G
Sbjct  82   VSLFVDNIPGTAHVINNEIHVGAKYIESIPGDIKTEFSGVLYHEMTHIWQSHANHQAPNG  141

Query  440  LIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDL--KNGFVAELNAKM  613
            LIEGIADFVRLKA Y P  W KPGEG  W  G  VTARFLDYCN L  + GFVA+LN KM
Sbjct  142  LIEGIADFVRLKANYVPHSWAKPGEGLSWKQGSSVTARFLDYCNGLHQQQGFVAQLNKKM  201

Query  614  KNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            ++GYSDS+F ++LGKTVDQLWTDYKAK+
Sbjct  202  RDGYSDSFFHELLGKTVDQLWTDYKAKF  229



>ref|XP_010691661.1| PREDICTED: uncharacterized protein LOC104904935 [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = +2

Query  134  GGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKD-VQKVSMFVDDMDGVAYASNN  310
            GG RFN  IG +Y++Q L +A NFIW  FQQ++P DRK  VQ+VS+ V+ + GVA+   N
Sbjct  36   GGTRFNNEIGIDYARQTLSSATNFIWGNFQQSNPADRKSTVQQVSLTVESISGVAFTQGN  95

Query  311  EIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAP  490
            +IH+++ Y+  YSG+VK E+TG+LYHE TH+WQW+GN  A GGLIEGIAD+VRLKAGYAP
Sbjct  96   QIHLNSNYVQSYSGNVKAEVTGILYHEMTHVWQWDGNRQAPGGLIEGIADYVRLKAGYAP  155

Query  491  SHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQ  670
            SHW +PG+GDRWD GYDVTARFLDYC+ L++GFVA+LN KM+ GY+DSYF+D+LGK+V Q
Sbjct  156  SHWVQPGQGDRWDQGYDVTARFLDYCDSLRDGFVAQLNKKMRGGYNDSYFNDLLGKSVGQ  215

Query  671  LWTDYKAKYNTN  706
            L+ DYKAKYN N
Sbjct  216  LFRDYKAKYNMN  227



>ref|XP_010547976.1| PREDICTED: uncharacterized protein LOC104819552 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010547977.1| PREDICTED: uncharacterized protein LOC104819552 isoform X2 [Tarenaya 
hassleriana]
Length=225

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 166/218 (76%), Gaps = 2/218 (1%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARF-NQVIGEEYSKQVLDAAANFIWRVFQQ  226
            L ++ L   +    AV+Y+V +   N+ GG RF  ++ G  Y  Q L +A  F+WRVFQQ
Sbjct  6    LLVISLVLTLSLVNAVDYSVVDNTGNSAGGQRFRGEIGGVSYGTQSLRSATEFVWRVFQQ  65

Query  227  -NSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
             N+  DRK VQK+++F+++ +GVA+ S ++IH +A Y+  +SGDV+ E TGV+YHE  H+
Sbjct  66   SNAASDRKPVQKITLFMENGNGVAFTSGDQIHFNAGYLGSFSGDVRREFTGVVYHEIVHV  125

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNG+G A GGLIEGIADFVRLKAG  PSHW  PG+GDRWD GYDVTARFLDYCNDL+N
Sbjct  126  WQWNGSGGAPGGLIEGIADFVRLKAGLGPSHWVGPGQGDRWDQGYDVTARFLDYCNDLRN  185

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GFVAELN +M+NGYS+S+F ++LGK V+QLW DYKAKY
Sbjct  186  GFVAELNKRMRNGYSESFFVELLGKDVNQLWRDYKAKY  223



>gb|ACE97817.1| peptidase M [Populus tremula]
Length=182

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 147/179 (82%), Gaps = 1/179 (1%)
 Frame = +2

Query  158  IGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDDMD-GVAYASNNEIHVSARY  334
            IG +YSKQ L +A +FIW  FQQ +  DRK++Q V++F+D MD  VAYA N+EIHVS  Y
Sbjct  4    IGVDYSKQTLASATDFIWETFQQTNAADRKNIQTVNLFIDVMDRPVAYAVNDEIHVSDSY  63

Query  335  INGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGE  514
            I  YSGDV+ EITGVLYHE THIWQWNGNG A  GLIEGIADFVRLKA YAPSHW +PG+
Sbjct  64   IASYSGDVRTEITGVLYHEMTHIWQWNGNGQAPSGLIEGIADFVRLKANYAPSHWVQPGQ  123

Query  515  GDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKA  691
            GDRWD GYDVTA+FLDYCNDL+NGFVAELN KM  GYS  +F D+LGKTVDQLWTDYKA
Sbjct  124  GDRWDQGYDVTAKFLDYCNDLRNGFVAELNKKMMTGYSAQFFVDLLGKTVDQLWTDYKA  182



>ref|XP_010467285.1| PREDICTED: uncharacterized protein LOC104747353 [Camelina sativa]
Length=225

 Score =   263 bits (671),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 168/225 (75%), Gaps = 4/225 (2%)
 Frame = +2

Query  26   SMDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARF-NQVIGEEYSKQVLDAAAN  202
            +  +I   + ++++ + ++   AV+Y+V +   ++ GG RF  ++ G  Y  Q L +A  
Sbjct  2    TFHKIFFLISLMLVVSLVN---AVDYSVVDNTDDSAGGRRFRGEIGGVSYGTQSLRSATE  58

Query  203  FIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVL  382
            F+WR+FQQ +P DRK V K+++F+++ +GVAY S NEIH +A Y+ G SGDVK E TGV+
Sbjct  59   FVWRLFQQTNPSDRKSVTKITLFMENGNGVAYNSGNEIHFNAGYLAGVSGDVKREFTGVV  118

Query  383  YHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLD  562
            YHE  H WQWNG G A GGLIEGIAD+VRLKAGYAPSHW  PG GDRWD GYDVTARFLD
Sbjct  119  YHEVVHSWQWNGAGRAPGGLIEGIADYVRLKAGYAPSHWVGPGRGDRWDQGYDVTARFLD  178

Query  563  YCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            YCN L+NGFVAELN KM+NGYSD++F D+LGK V QLW +YKAKY
Sbjct  179  YCNGLRNGFVAELNKKMRNGYSDNFFVDLLGKDVTQLWREYKAKY  223



>gb|ACE97836.1| peptidase M [Populus tremula]
Length=182

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 147/179 (82%), Gaps = 1/179 (1%)
 Frame = +2

Query  158  IGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDDMD-GVAYASNNEIHVSARY  334
            IG +YSKQ L +A +FIW  FQQ +  DRK++Q V++F+D MD  VAYA N+EIHVS  Y
Sbjct  4    IGVDYSKQTLASATDFIWETFQQTNAADRKNIQTVNLFIDVMDRPVAYAVNDEIHVSDSY  63

Query  335  INGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGE  514
            I  YSGDV+ EITGVLYHE THIWQWNGNG A G LIEGIADFVRLKA YAPSHW +PG+
Sbjct  64   IASYSGDVRTEITGVLYHEMTHIWQWNGNGQAPGKLIEGIADFVRLKANYAPSHWVQPGQ  123

Query  515  GDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKA  691
            GDRWD GYDVTA+FLDYCNDL+NGFVAELN KM  GYS  +F D+LGKTVDQLWTDYKA
Sbjct  124  GDRWDQGYDVTAKFLDYCNDLRNGFVAELNKKMMTGYSAQFFVDLLGKTVDQLWTDYKA  182



>ref|XP_004982764.1| PREDICTED: uncharacterized protein LOC101755530 [Setaria italica]
Length=227

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = +2

Query  38   ITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRV  217
            I +S  +L++ A      AV +  TN+ A+T GGARF++ +G +Y+KQVL  A++FIW  
Sbjct  8    IAVSSVLLVMAAT---SGAVTFDATNSVASTDGGARFDREVGVDYAKQVLSDASSFIWGT  64

Query  218  FQQNSPGDRKDVQKVSM-FVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            F Q +P DRK V  V++  VD++   A  S   I ++A+Y+ G+ GDVK E+TGVLYHE+
Sbjct  65   FNQPNPEDRKPVDSVALNVVDNISAPAQTSGGAISLNAQYVAGFQGDVKTEVTGVLYHET  124

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            TH+WQW+G G ANGGLIEGIADFVRL+AG AP HWRK G+GD+WD GYDVTARFLDYC+ 
Sbjct  125  THVWQWDGQGQANGGLIEGIADFVRLRAGLAPDHWRKAGQGDKWDQGYDVTARFLDYCDS  184

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            LK GFVAELN KMK+GYSD +F DILGK V QLW DYKA+Y
Sbjct  185  LKQGFVAELNGKMKDGYSDGFFQDILGKDVQQLWQDYKAQY  225



>ref|XP_006422909.1| hypothetical protein CICLE_v10029973mg [Citrus clementina]
 gb|ESR36149.1| hypothetical protein CICLE_v10029973mg [Citrus clementina]
Length=225

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 161/217 (74%), Gaps = 3/217 (1%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            +C+L L AA+HG  AVEY V N A  TPGG RF   +G+EY+KQ + AA+ FIWR+F QN
Sbjct  9    ICMLAL-AALHGIHAVEYIVNNRATTTPGGIRFQNDLGDEYTKQRMAAASEFIWRIFHQN  67

Query  230  SPGDRKDVQKVSMFVD-DMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIW  406
            +P  R + QKV +FVD +   +AY  NNE+H+   YI G  GD+K +  GVL+HE  HIW
Sbjct  68   TPAQRINHQKVILFVDQESKYIAYVVNNELHIHDDYIQGIKGDIKWDFNGVLFHEMAHIW  127

Query  407  QWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNG  586
            Q NG G A G +IEGIAD+VRLKA Y P HW KPG G+RW+ GYDVTARFLDYCN L+NG
Sbjct  128  Q-NGIGKAPGEVIEGIADYVRLKANYIPPHWVKPGGGERWNQGYDVTARFLDYCNRLRNG  186

Query  587  FVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            FVAELN K+++GYSD YF D+LGK VDQLW +YKAK+
Sbjct  187  FVAELNKKIEDGYSDRYFVDLLGKNVDQLWREYKAKF  223



>gb|ACE97813.1| peptidase M [Populus tremula]
 gb|ACE97815.1| peptidase M [Populus tremula]
 gb|ACE97816.1| peptidase M [Populus tremula]
 gb|ACE97818.1| peptidase M [Populus tremula]
 gb|ACE97819.1| peptidase M [Populus tremula]
 gb|ACE97820.1| peptidase M [Populus tremula]
 gb|ACE97821.1| peptidase M [Populus tremula]
 gb|ACE97822.1| peptidase M [Populus tremula]
 gb|ACE97823.1| peptidase M [Populus tremula]
 gb|ACE97824.1| peptidase M [Populus tremula]
 gb|ACE97825.1| peptidase M [Populus tremula]
 gb|ACE97826.1| peptidase M [Populus tremula]
 gb|ACE97827.1| peptidase M [Populus tremula]
 gb|ACE97828.1| peptidase M [Populus tremula]
 gb|ACE97829.1| peptidase M [Populus tremula]
 gb|ACE97830.1| peptidase M [Populus tremula]
 gb|ACE97831.1| peptidase M [Populus tremula]
 gb|ACE97832.1| peptidase M [Populus tremula]
 gb|ACE97833.1| peptidase M [Populus tremula]
 gb|ACE97834.1| peptidase M [Populus tremula]
 gb|ACE97837.1| peptidase M [Populus tremula]
 gb|ACE97838.1| peptidase M [Populus tremula]
Length=182

 Score =   260 bits (665),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = +2

Query  158  IGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDDMD-GVAYASNNEIHVSARY  334
            IG +YSKQ L +A +FIW  FQQ +  DRK++Q V++F+D MD  VAYA N+EIHVS  Y
Sbjct  4    IGVDYSKQTLASATDFIWETFQQTNAADRKNIQTVNLFIDVMDRPVAYAVNDEIHVSDSY  63

Query  335  INGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGE  514
            I  YSGDV+ EITGVLYHE THIWQWNGNG A GGLIEGIADFVRLKA YAPSHW +PG+
Sbjct  64   IASYSGDVRTEITGVLYHEMTHIWQWNGNGQAPGGLIEGIADFVRLKANYAPSHWVQPGQ  123

Query  515  GDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKA  691
            GDRWD GYDVTA+FLDYCNDL+NGFVAELN KM  GYS  +F D+LGKTVDQLWTDYKA
Sbjct  124  GDRWDQGYDVTAKFLDYCNDLRNGFVAELNKKMMTGYSAQFFVDLLGKTVDQLWTDYKA  182



>ref|XP_002883881.1| hypothetical protein ARALYDRAFT_899731 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60140.1| hypothetical protein ARALYDRAFT_899731 [Arabidopsis lyrata subsp. 
lyrata]
Length=230

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 162/217 (75%), Gaps = 1/217 (0%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGE-EYSKQVLDAAANFIWRVFQQ  226
              ++ L   +   +AV+Y+V +   ++ GG RF   IG   Y  Q L AA +F+WR+FQQ
Sbjct  7    FFVISLVLVVSLVKAVDYSVVDNTGDSAGGRRFRGEIGGITYGTQSLRAATDFVWRLFQQ  66

Query  227  NSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIW  406
             +P DRK V K+++F+++ DGVAY S NEIH +A Y+ G SGDVK E TGV+YHE  H W
Sbjct  67   TNPSDRKPVTKITLFMENGDGVAYNSGNEIHFNAGYLAGVSGDVKREFTGVVYHEVVHSW  126

Query  407  QWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNG  586
            QWNG G A GGLIEGIAD+VRLKAGYAPSHW  PG GDRWD GYDVTARFL+YCNDL+NG
Sbjct  127  QWNGAGRAPGGLIEGIADYVRLKAGYAPSHWVAPGGGDRWDQGYDVTARFLEYCNDLRNG  186

Query  587  FVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            FVAELN KM++ Y+D +F D+LGK V+QLW +YKAKY
Sbjct  187  FVAELNKKMRSDYNDGFFVDLLGKDVNQLWREYKAKY  223



>gb|EEC67221.1| hypothetical protein OsI_34133 [Oryza sativa Indica Group]
Length=218

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 163/205 (80%), Gaps = 5/205 (2%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ-NSPGDRKDVQKVSMFVD  277
            +  TNTA+NT GG RF++ +G +Y+KQ+L  A++FIW  F+Q    GDRK V  V++ V+
Sbjct  13   FDATNTASNTAGGQRFDREVGVDYAKQMLADASSFIWDTFEQPGDGGDRKPVDAVTLTVE  72

Query  278  DMDGVAYASNNEIHVSARYINGYS--GDVKGEITGVLYHESTHIWQWngngaanggLIEG  451
            D+DGVA+ S + IH+SARY+ GYS  GDV+ E+TGVLYHE+TH+WQW+G G A+GGLIEG
Sbjct  73   DIDGVAFTSGDGIHLSARYVGGYSATGDVRAEVTGVLYHEATHVWQWDGRGGADGGLIEG  132

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND--LKNGFVAELNAKMKNGY  625
            IADFVRL+AGYAP HW +PG+GDRWD GYDVTARFLDYC+   +  GFVA+LN KMK+GY
Sbjct  133  IADFVRLRAGYAPPHWVQPGQGDRWDQGYDVTARFLDYCDSPAVVQGFVAQLNGKMKDGY  192

Query  626  SDSYFSDILGKTVDQLWTDYKAKYN  700
            SD +F  I GKTVDQLW DYKAKY 
Sbjct  193  SDDFFVQISGKTVDQLWQDYKAKYG  217



>ref|XP_006300232.1| hypothetical protein CARUB_v10016469mg [Capsella rubella]
 gb|EOA33130.1| hypothetical protein CARUB_v10016469mg [Capsella rubella]
Length=225

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 168/225 (75%), Gaps = 4/225 (2%)
 Frame = +2

Query  26   SMDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARF-NQVIGEEYSKQVLDAAAN  202
            +  +I   + ++++ + ++   AV+Y+V +   ++ GG RF  ++ G  Y  Q L +A +
Sbjct  2    TFHKIFFVISLMLIVSLVN---AVDYSVVDNTGDSAGGRRFRGEIGGVSYGTQSLRSATD  58

Query  203  FIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVL  382
            F+WR+FQQ +P DRK + K+++F+++  GVA+ + NEIH +  Y+ G SGDVK E TGV+
Sbjct  59   FVWRLFQQTNPSDRKSITKITLFMENGQGVAFNTGNEIHFNVGYLAGVSGDVKREFTGVV  118

Query  383  YHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLD  562
            YHE  H WQWNG G A GGLIEGIAD+VRLKAGYAPSHW  PG GDRWD GYDVTARFLD
Sbjct  119  YHEVVHSWQWNGAGRAPGGLIEGIADYVRLKAGYAPSHWVGPGRGDRWDQGYDVTARFLD  178

Query  563  YCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            YCN L+NGFVAELN KM+NGYSDS+F ++LGK V+QLW +YKAKY
Sbjct  179  YCNGLRNGFVAELNKKMRNGYSDSFFVELLGKDVNQLWREYKAKY  223



>ref|XP_009136267.1| PREDICTED: uncharacterized protein LOC103860417 [Brassica rapa]
 emb|CDX93158.1| BnaA03g38800D [Brassica napus]
Length=225

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 164/220 (75%), Gaps = 8/220 (4%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIG-EEYSKQVLDAAANFIWRVFQQ  226
            L I ++ A      AV++ V +   ++PGG +F + IG E Y  Q L +A +F+W +FQQ
Sbjct  8    LVISVMLAVSSLVNAVDFLVVDNTGDSPGGRKFREEIGGESYGTQSLRSATDFVWGLFQQ  67

Query  227  -NSPGDRKDVQKVSMFVDDMDGVAYASNN--EIHVSARYINGYSGDVKGEITGVLYHEST  397
             N+P DR+DV K+++F+D+ +GVAY +N+  EIH +A Y+ G+ GDVK E TGV+YHE  
Sbjct  68   TNNPSDRRDVTKITLFMDNGNGVAYNTNSGSEIHFNAGYLAGFPGDVKREFTGVIYHEVV  127

Query  398  HIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDL  577
            H WQWNG G     LIEGIAD+VRLKAGYAP HW  PG GDRWD GYDVTARFLDYCNDL
Sbjct  128  HSWQWNGPGG----LIEGIADYVRLKAGYAPGHWVGPGGGDRWDQGYDVTARFLDYCNDL  183

Query  578  KNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +NGFVAELN KM+NGYSDS+F D+LGK VDQLW +YKAKY
Sbjct  184  RNGFVAELNKKMRNGYSDSFFVDLLGKDVDQLWREYKAKY  223



>ref|XP_010065959.1| PREDICTED: uncharacterized protein LOC104453135 [Eucalyptus grandis]
 gb|KCW63687.1| hypothetical protein EUGRSUZ_G01336 [Eucalyptus grandis]
Length=225

 Score =   260 bits (664),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 163/224 (73%), Gaps = 2/224 (1%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M  ++  +  L++ +A HG  AVEY V+NT  NT GGARF   +G++Y++Q + +A +FI
Sbjct  1    MAHLSFLVSFLLVSSAFHGIHAVEYIVSNTVPNTEGGARFANELGDDYARQTMISATDFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSA-RYINGYSGDVKGEITGVLY  385
            W++FQQ S  DRK V +V++ +D+ DG+AYASNNEIH+ A  Y+    GD+K +  GVLY
Sbjct  61   WQLFQQTSEADRKSVARVTLVIDNYDGIAYASNNEIHMGAPNYLKNIKGDIKEDFNGVLY  120

Query  386  HESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDY  565
            HE THIWQW+G G A   L+EG+ADFVRLKA YAP+ W K G G  WD GY VTA FLDY
Sbjct  121  HEMTHIWQWDGKGKAGK-LVEGVADFVRLKANYAPASWPKRGSGTNWDEGYAVTAYFLDY  179

Query  566  CNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            C  L+ GFVAELN KM++ YS+ +F  +LGKTVDQLW++YKAKY
Sbjct  180  CESLRGGFVAELNKKMRDDYSNDFFVQLLGKTVDQLWSEYKAKY  223



>ref|XP_007042545.1| Plant basic secretory protein (BSP) family protein, putative 
[Theobroma cacao]
 gb|EOX98376.1| Plant basic secretory protein (BSP) family protein, putative 
[Theobroma cacao]
Length=225

 Score =   260 bits (664),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 161/225 (72%), Gaps = 0/225 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M  +   L  L+  A + G  AV + VTN A +T GG RF   IG +YS + L  A   +
Sbjct  1    MATLKFLLFSLVTSAILQGTYAVLFKVTNNATSTQGGVRFTDEIGVQYSTRSLKFATAIV  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            W +  Q  P +RK V++VS+F+D MDGVAY S++EIHVSA YI  YS DVK E TG+L H
Sbjct  61   WMLLGQLRPAERKKVEQVSLFIDVMDGVAYESDDEIHVSANYIGNYSRDVKREFTGILVH  120

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E+ H+WQWNGNG   GGLIEGIADF+RLKAGYAP HW + G+GD+WD GYD+TA FL+YC
Sbjct  121  ETAHVWQWNGNGQTPGGLIEGIADFIRLKAGYAPPHWVRAGQGDKWDQGYDITAWFLNYC  180

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            + L  GFVA+L+ KM++ Y+  YF ++LGK VDQLWTDYKAKYNT
Sbjct  181  DSLSRGFVAKLDRKMRSSYNSDYFVELLGKNVDQLWTDYKAKYNT  225



>gb|ACE97835.1| peptidase M [Populus tremula]
Length=182

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 147/179 (82%), Gaps = 1/179 (1%)
 Frame = +2

Query  158  IGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDDMD-GVAYASNNEIHVSARY  334
            IG +YSKQ L +A +FIW  FQQ +  DRK++Q V++F+D MD  VAYA N+EIHVS  Y
Sbjct  4    IGVDYSKQTLASATDFIWETFQQTNAADRKNIQTVNLFIDVMDRPVAYAVNDEIHVSDSY  63

Query  335  INGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGE  514
            I  YSGDV+ EITGVLYHE  HIWQWNGNG A GGLIEGIADFVRLKA YAPSHW +PG+
Sbjct  64   IASYSGDVRTEITGVLYHEMAHIWQWNGNGQAPGGLIEGIADFVRLKANYAPSHWVQPGQ  123

Query  515  GDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKA  691
            GDRWD GYDVTA+FLDYCNDL+NGFVAELN KM  GYS  +F D+LGKTVDQLWTDYKA
Sbjct  124  GDRWDQGYDVTAKFLDYCNDLRNGFVAELNKKMMTGYSAQFFVDLLGKTVDQLWTDYKA  182



>gb|ACE97814.1| peptidase M [Populus tremula]
Length=182

 Score =   258 bits (658),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 147/179 (82%), Gaps = 1/179 (1%)
 Frame = +2

Query  158  IGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDDMD-GVAYASNNEIHVSARY  334
            IG +YSKQ L +A +FIW  FQQ +  DRK++Q V++F+D MD  VAYA N+EIHVS  Y
Sbjct  4    IGVDYSKQTLASATDFIWETFQQTNAADRKNIQTVNLFIDVMDRPVAYAVNDEIHVSDSY  63

Query  335  INGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGE  514
            I  YSGDV+ EITGVLYHE THIWQWNGNG A GGLIEGIADFVR KA YAPSHW +PG+
Sbjct  64   IASYSGDVRTEITGVLYHEMTHIWQWNGNGQAPGGLIEGIADFVRSKANYAPSHWVQPGQ  123

Query  515  GDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKA  691
            GDRWD GYDVTA+FLDYCNDL+NGFVAELN KM  GYS  +F D+LGKTVDQLWTDYKA
Sbjct  124  GDRWDQGYDVTAKFLDYCNDLRNGFVAELNKKMMTGYSAQFFVDLLGKTVDQLWTDYKA  182



>ref|XP_008236389.1| PREDICTED: uncharacterized protein LOC103335162 [Prunus mume]
Length=221

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 149/208 (72%), Gaps = 2/208 (1%)
 Frame = +2

Query  80   HGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQK  259
            HG  AV Y V N A NT GG RF   +G  Y++Q +  A NFIW +F + +P DRK+V+ 
Sbjct  12   HGAHAVHYAVVNRALNTTGGMRFKNELGVNYTQQKMGTATNFIWNLFNETTPADRKNVKN  71

Query  260  VSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaangg  439
            VS+FVD++ G+A+  NNEIHV A+YI    GD+K E  GVLYHE THIWQ + N  A  G
Sbjct  72   VSLFVDNIPGIAHVINNEIHVGAKYIESIMGDIKTEFNGVLYHEMTHIWQSHANHQAPNG  131

Query  440  LIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDL--KNGFVAELNAKM  613
            LIEGIADFVRLKA Y P  W KPGEG  W  G  VTARFLDYCN L  + GFVA+LN KM
Sbjct  132  LIEGIADFVRLKANYVPHKWAKPGEGLSWKQGSSVTARFLDYCNGLHQQQGFVAQLNKKM  191

Query  614  KNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            ++GYSDS+F ++LGKTVDQLWTDYK K+
Sbjct  192  RDGYSDSFFQELLGKTVDQLWTDYKTKF  219



>ref|XP_006422908.1| hypothetical protein CICLE_v10030275mg [Citrus clementina]
 gb|ESR36148.1| hypothetical protein CICLE_v10030275mg [Citrus clementina]
 gb|KDO47977.1| hypothetical protein CISIN_1g036780mg [Citrus sinensis]
Length=231

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 166/227 (73%), Gaps = 5/227 (2%)
 Frame = +2

Query  32   DRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIW  211
            D     L  L+   A+HG  AV+YTV+N AA TPGG RF++ IG EY+KQ + AA +FIW
Sbjct  3    DHSAFFLISLLTLTAMHGIHAVDYTVSNRAATTPGGMRFDKEIGAEYAKQTMTAATDFIW  62

Query  212  RVFQQNSPGDRKDVQKVSMFVDDMDG--VAYASNNEIHVSARYINGYSGD-VKGEITGVL  382
            R+FQQN+  DRK++ +V +F+DDM    +A+ SNN IH    +I     D +K E +GV+
Sbjct  63   RLFQQNTEADRKNIPQVDLFIDDMKPGEIAFTSNNGIHYGDDFIQNIPVDLIKQEFSGVM  122

Query  383  YHESTHIWQWngngaangg-LIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGY-DVTARF  556
            YHE TH+WQWNGN A N G LIEGIADFVRLKA Y P  W KPGEG  W+ G+  V ARF
Sbjct  123  YHEMTHVWQWNGNNAPNIGWLIEGIADFVRLKANYVPEGWAKPGEGTMWNQGHSSVAARF  182

Query  557  LDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            LDYCNDL+NGFVAELN KM++GY+D++F ++LGK++DQLW DYKAKY
Sbjct  183  LDYCNDLRNGFVAELNKKMRDGYNDNFFMELLGKSIDQLWNDYKAKY  229



>ref|XP_008454988.1| PREDICTED: uncharacterized protein LOC103495268 [Cucumis melo]
Length=256

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 155/202 (77%), Gaps = 1/202 (0%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AVEY V N A+ TPGGARF+ +IG  YS+Q L AA   IW +F+Q++  DRK VQK+S+F
Sbjct  30   AVEYNVINNASGTPGGARFDSIIGANYSRQTLVAATALIWNIFRQSTAADRKHVQKISLF  89

Query  272  VDD-MDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIE  448
            +D+ MD VA+  NNEIHVSA YI+ YSGD+K EITG+LYHE T+I QW+GN  A  GLIE
Sbjct  90   IDNNMDAVAFNMNNEIHVSASYISSYSGDLKREITGLLYHEMTNILQWSGNMKAPSGLIE  149

Query  449  GIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYS  628
            GIAD+VRLK+GY    W +PG G+RWD GYDVTARFLDY   +++G VAELN KM+N YS
Sbjct  150  GIADYVRLKSGYISETWVEPGGGNRWDEGYDVTARFLDYLERVRSGLVAELNRKMRNEYS  209

Query  629  DSYFSDILGKTVDQLWTDYKAK  694
            D YF  +LGK VD+LWT+YK K
Sbjct  210  DDYFRQLLGKPVDELWTEYKTK  231



>gb|KFK39997.1| hypothetical protein AALP_AA3G316700 [Arabis alpina]
Length=214

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGE-EYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSM  268
            AV+++V +   ++ GG RF   IG   Y+ Q L +A  F WR+FQQN+P DR+   K+S+
Sbjct  10   AVDFSVVDNTGDSAGGRRFRGEIGGISYATQSLRSATEFTWRLFQQNNPSDRRPTPKISL  69

Query  269  FVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIE  448
             +++ +GVAY+SN+EIH +A Y+ G SGDVK E TGV+YHE  H WQWNG G A  GLIE
Sbjct  70   VMENGNGVAYSSNDEIHFNAGYLAGVSGDVKREFTGVVYHEVVHSWQWNGAGRAPSGLIE  129

Query  449  GIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYS  628
            GIADFVRLKAGY P +W  PG GDRWD GYDVTARFLDYCNDL+NGFVAELN KM+NGYS
Sbjct  130  GIADFVRLKAGYTPGYWVGPGRGDRWDQGYDVTARFLDYCNDLRNGFVAELNKKMRNGYS  189

Query  629  DSYFSDILGKTVDQLWTDYKAKY  697
            D +F ++LGK V+QLW +YKAKY
Sbjct  190  DGFFVELLGKDVNQLWREYKAKY  212



>gb|AGW45466.1| PRp27, partial [Reaumuria trigyna]
Length=216

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 147/190 (77%), Gaps = 0/190 (0%)
 Frame = +2

Query  86   CRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVS  265
             +AV   VTN A NTPGG RFN  I  +Y+ +V+  + NFIWR+F QNS  DRK+V +V 
Sbjct  27   IQAVSIAVTNHAPNTPGGTRFNNEITSQYALKVMSDSTNFIWRIFNQNSQSDRKNVDQVL  86

Query  266  MFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLI  445
            + ++ M GVAY S ++IH+SA YI G SGDVK E TGV+YHE TH+WQWNGNG A GGLI
Sbjct  87   LIIESMSGVAYTSGDQIHMSAEYIQGISGDVKREFTGVIYHEMTHVWQWNGNGQAPGGLI  146

Query  446  EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGY  625
            EGIAD+VRLK GYAP HW KPG GDRWD GYDVTA FLDYCN LKNGFVAELN KMK GY
Sbjct  147  EGIADYVRLKGGYAPGHWVKPGGGDRWDQGYDVTAYFLDYCNGLKNGFVAELNGKMKGGY  206

Query  626  SDSYFSDILG  655
            ++ YF+D+LG
Sbjct  207  NNGYFNDLLG  216



>ref|XP_010024062.1| PREDICTED: uncharacterized protein LOC104414607 [Eucalyptus grandis]
 gb|KCW60473.1| hypothetical protein EUGRSUZ_H03202 [Eucalyptus grandis]
Length=225

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 161/224 (72%), Gaps = 2/224 (1%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M  ++  +  L++ +A  G  AVEY V+NT  NT GGARF   +G++Y++Q + +A +FI
Sbjct  1    MAHLSFLVSFLLVSSAFPGIHAVEYIVSNTVPNTEGGARFANELGDDYARQTMISATDFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSA-RYINGYSGDVKGEITGVLY  385
            W++FQQ S  DRK V +V++ +D+ DG+AYASNNEIH+ A  Y+    GD+K +  GVLY
Sbjct  61   WQLFQQTSEADRKSVARVTLVIDNYDGIAYASNNEIHMGAPNYLKNIKGDIKEDFNGVLY  120

Query  386  HESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDY  565
            HE THIWQW+G G A   LIEG+ADFVRLKA YAP  W K G G  WD GY VTA FLDY
Sbjct  121  HEMTHIWQWDGKGKAGK-LIEGVADFVRLKANYAPVSWPKRGSGTNWDEGYAVTAYFLDY  179

Query  566  CNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            C  L+ GFVAELN KM++ YS+ +F  +LGKTVDQLW++YKAKY
Sbjct  180  CESLRGGFVAELNKKMRDDYSNDFFVQLLGKTVDQLWSEYKAKY  223



>ref|XP_002267568.2| PREDICTED: uncharacterized protein LOC100247270 [Vitis vinifera]
Length=225

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 160/207 (77%), Gaps = 1/207 (0%)
 Frame = +2

Query  86   CRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKD-VQKV  262
              AVE+ VTN A N+ GG RF+  IG EYS+Q L +A +FIW +FQQN+  DRK+ VQ V
Sbjct  3    VHAVEFFVTNNAGNSAGGIRFSDKIGVEYSRQTLKSATDFIWTIFQQNTKADRKESVQNV  62

Query  263  SMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggL  442
            ++ +++ +GVA++SN+EIH++A Y+  YS DVK E TGV+YHE THIWQWNG G A GGL
Sbjct  63   TLIIENGNGVAFSSNSEIHLNANYLGEYSSDVKREFTGVIYHEMTHIWQWNGKGQAPGGL  122

Query  443  IEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNG  622
            IEGIADFVRL+A  APS W +PG+GDRWD GYDVTA FLDY N L++GFVA+LN KM+  
Sbjct  123  IEGIADFVRLRADLAPSFWVQPGQGDRWDEGYDVTALFLDYFNSLRDGFVADLNKKMREE  182

Query  623  YSDSYFSDILGKTVDQLWTDYKAKYNT  703
            Y   +F ++LGKTVDQLW+DYKA+  T
Sbjct  183  YDSDFFVELLGKTVDQLWSDYKAQNET  209



>ref|XP_002518665.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43590.1| conserved hypothetical protein [Ricinus communis]
Length=210

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFV  274
            V+Y V N A  + GG RF   IG E S + L  A  FIW++   N   +RK   ++S+ +
Sbjct  7    VQYQVINKAETSTGGVRFAGEIGVELSNKTLTEATGFIWKLLDLNILRNRKCAARISLII  66

Query  275  DDMDGVAYASNNEIHVSARYINGYSGD-VKGEITGVLYHESTHIWQWngngaanggLIEG  451
            +D+DGVAY  +NE+H+S RYI   S + ++ E+TG+LYHE+THIWQWNGNG   GGLIEG
Sbjct  67   EDIDGVAYTEDNEMHISTRYIENCSRECLRSEVTGILYHETTHIWQWNGNGQTPGGLIEG  126

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            IADFVRLKA YAPSHW +PG+GDRWD GYDVTARFLDYCNDL+NGFVAELN KM + YSD
Sbjct  127  IADFVRLKANYAPSHWVQPGQGDRWDQGYDVTARFLDYCNDLRNGFVAELNKKMIDDYSD  186

Query  632  SYFSDILGKTVDQLWTDYKAKY  697
             +F ++LGK+VDQLW+DYKAKY
Sbjct  187  EFFIELLGKSVDQLWSDYKAKY  208



>gb|KGN43893.1| hypothetical protein Csa_7G072800 [Cucumis sativus]
Length=422

 Score =   261 bits (666),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 158/203 (78%), Gaps = 2/203 (1%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AVEYTVTN A+ TPGGARF+ +IG  YS+Q L AA   IW +FQQ++  DRK V+K+S+F
Sbjct  23   AVEYTVTNNASGTPGGARFDSIIGANYSRQTLVAATALIWNIFQQSTAADRKHVEKISLF  82

Query  272  VD-DMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIE  448
            +D ++DGVA   NNEIHVSA YI+ YSGD+K EITG+LYHE T+IWQWNGN  A  GLIE
Sbjct  83   IDKNLDGVALNMNNEIHVSANYISSYSGDLKREITGLLYHEMTNIWQWNGNLKAPSGLIE  142

Query  449  GIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC-NDLKNGFVAELNAKMKNGY  625
            GIAD+VRLK+GY P  W +PG G+ WD GYDVTARFLDY    +++G VAELN KM+NGY
Sbjct  143  GIADYVRLKSGYIPGTWVEPGGGNWWDEGYDVTARFLDYLERSVRSGLVAELNRKMRNGY  202

Query  626  SDSYFSDILGKTVDQLWTDYKAK  694
            SD YF  ++GK VD+LW +YK K
Sbjct  203  SDDYFRQLMGKPVDELWAEYKTK  225



>ref|XP_010918047.1| PREDICTED: uncharacterized protein LOC105042501 [Elaeis guineensis]
Length=229

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 165/229 (72%), Gaps = 4/229 (2%)
 Frame = +2

Query  29   MDRITLSL-CILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANF  205
            M+ + L +  +L+  +A +   AVEY VTN A  T GG  F+  +G +YSKQVL  A+ F
Sbjct  1    MELVALLISTLLVASSAFNAAGAVEYEVTNNAVGTDGGNLFDHELGVDYSKQVLADASAF  60

Query  206  IWRVFQQNSPGDRKDVQKVSMFVDDMDG---VAYASNNEIHVSARYINGYSGDVKGEITG  376
            +W  FQQ+S  DRK+VQ +++ +++++    VA    N IH +A++I G   D+K    G
Sbjct  61   VWTTFQQSSEADRKNVQLITLSIENLNKDNVVAETIQNNIHYNAKFITGTGDDLKRGFEG  120

Query  377  VLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARF  556
            VLYHE TH+WQWNGN AA   +IEGIADFVRLKAGY PS+W KPGEG  W+ GY VTARF
Sbjct  121  VLYHEMTHVWQWNGNNAAPTWVIEGIADFVRLKAGYVPSNWAKPGEGKNWEEGYSVTARF  180

Query  557  LDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            LDYCNDLK GFVA+LNAKM+NGYSD +F+++LGK VDQLW DYKA+Y +
Sbjct  181  LDYCNDLKGGFVAQLNAKMRNGYSDDFFAELLGKPVDQLWNDYKARYGS  229



>emb|CDX89654.1| BnaC03g45680D [Brassica napus]
Length=225

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 165/220 (75%), Gaps = 8/220 (4%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARF-NQVIGEEYSKQVLDAAANFIWRVFQQ  226
            L I ++ A     +AV+++V +   ++ GG RF  ++ G  Y  Q L +A +F+W +FQQ
Sbjct  8    LVISVMLAVSSLVKAVDFSVVDNTGDSAGGRRFRGEIDGVSYGTQSLRSATDFVWGLFQQ  67

Query  227  -NSPGDRKDVQKVSMFVDDMDGVAYASNN--EIHVSARYINGYSGDVKGEITGVLYHEST  397
             N+P DR+DV K+++F+++ +GVAY +N+  EIH +A Y+ G+SGDVK E TGV+YHE  
Sbjct  68   TNNPSDRRDVTKITLFMENGNGVAYNTNSGSEIHFNAGYLAGFSGDVKREFTGVIYHEVV  127

Query  398  HIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDL  577
            H WQWNG G     LIEGIAD+VRLKAGYAP HW  PG GDRWD GYDVTARFLDYCNDL
Sbjct  128  HSWQWNGPGG----LIEGIADYVRLKAGYAPGHWVGPGGGDRWDQGYDVTARFLDYCNDL  183

Query  578  KNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +NGFVAELN KM++GYSDS+F D+LGK V+QLW +YKAKY
Sbjct  184  RNGFVAELNKKMRSGYSDSFFVDLLGKDVNQLWREYKAKY  223



>ref|XP_004229501.1| PREDICTED: uncharacterized protein LOC101249488 [Solanum lycopersicum]
Length=178

 Score =   250 bits (639),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 143/204 (70%), Gaps = 32/204 (16%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFV  274
            + Y++TNTAANTPGGARFN+ IG +Y +Q L AA +FIW +FQQN P DRK+V KVSMFV
Sbjct  1    MTYSITNTAANTPGGARFNRDIGAQYCQQTLAAATSFIWNIFQQNFPADRKNVPKVSMFV  60

Query  275  DDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGI  454
            DDM GVAY +NN IHVSAR   G                                LIEGI
Sbjct  61   DDMAGVAYTNNNTIHVSARAPGG--------------------------------LIEGI  88

Query  455  ADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDS  634
            AD+VRLKAG   SHW KPG+GDRWD GYDVTA+FL+YCN L+NGFVAELN KMKNGYSD 
Sbjct  89   ADYVRLKAGLGLSHWVKPGQGDRWDQGYDVTAQFLNYCNSLRNGFVAELNKKMKNGYSDQ  148

Query  635  YFSDILGKTVDQLWTDYKAKYNTN  706
            +F D+LGKTVDQLW DYKAK+  N
Sbjct  149  FFVDLLGKTVDQLWGDYKAKFRGN  172



>ref|XP_006409598.1| hypothetical protein EUTSA_v10022957mg [Eutrema salsugineum]
 gb|ESQ51051.1| hypothetical protein EUTSA_v10022957mg [Eutrema salsugineum]
Length=224

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 162/220 (74%), Gaps = 8/220 (4%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARF-NQVIGEEYSKQVLDAAANFIWRVFQQ  226
              ++ L  A+    AVE++V +   ++ GG RF  ++ G  Y  Q L +A +F+WR+FQQ
Sbjct  7    FLVISLILAVSLVNAVEFSVVDNTGDSAGGRRFRGEIGGVSYGTQSLQSATDFVWRLFQQ  66

Query  227  -NSPGDRKDVQKVSMFVDDMDGVAYASNN--EIHVSARYINGYSGDVKGEITGVLYHEST  397
             N+P DR+ V K+++F+++ +GVAY +N+  EIH +A Y+ G SGDV+ E TGV+YHE  
Sbjct  67   TNNPSDRRPVTKITLFMENGNGVAYNTNSGSEIHFNAGYLAGVSGDVRREFTGVVYHEVV  126

Query  398  HIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDL  577
            H WQWNG G     LIEGIAD+VRLKAGYAP HW  PG GD+WD GYDVTARFLDYCNDL
Sbjct  127  HSWQWNGPGG----LIEGIADYVRLKAGYAPGHWVGPGGGDKWDQGYDVTARFLDYCNDL  182

Query  578  KNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +NGFVAELN KMKNGYSD +F D+LGK V+QLW +YKAKY
Sbjct  183  RNGFVAELNKKMKNGYSDGFFVDLLGKDVNQLWREYKAKY  222



>ref|XP_006600106.1| PREDICTED: TMV resistance protein N-like [Glycine max]
 gb|AAO23073.1| R 13 protein [Glycine max]
Length=641

 Score =   264 bits (674),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 152/200 (76%), Gaps = 1/200 (1%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDD  280
            +TV N A  T GG RF   IG EY+ Q LD+A  FIW +FQQN+P DRK VQKVS+FVDD
Sbjct  438  FTVINNALTTLGGVRFRDKIGAEYANQTLDSATQFIWEIFQQNNPSDRKSVQKVSLFVDD  497

Query  281  MDGVAYASNNEIHVSARYINGYSG-DVKGEITGVLYHESTHIWQWngngaanggLIEGIA  457
            MDG+AY   NEIHVSARY+NGYSG DVK EITGVL+H+  ++WQW GNG A GGL  GIA
Sbjct  498  MDGIAYTRKNEIHVSARYVNGYSGGDVKREITGVLFHQVCYVWQWKGNGKAPGGLTGGIA  557

Query  458  DFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSY  637
            DFVRLKA YA SHWRKPG+G +W+ GY++TA FLDYC+ LK+GFV +LN  M+  YSD +
Sbjct  558  DFVRLKANYAASHWRKPGQGQKWNEGYEITAHFLDYCDSLKSGFVGQLNQWMRTDYSDEF  617

Query  638  FSDILGKTVDQLWTDYKAKY  697
            F  +L K V+ LW DYKA Y
Sbjct  618  FFLLLAKPVNHLWRDYKAMY  637



>gb|KCW63684.1| hypothetical protein EUGRSUZ_G01332 [Eucalyptus grandis]
Length=198

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 150/204 (74%), Gaps = 10/204 (5%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AVEYTVTN+A NT GGA F+  IG  YS++ L  + +FIWRVF Q +P DRK V+KVS+F
Sbjct  5    AVEYTVTNSAGNTTGGALFSGEIGIPYSRRTLTVSTHFIWRVFHQKAPEDRKSVEKVSLF  64

Query  272  VDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEG  451
            +++M+G+           A Y+ G+SGDVK E TG+LYHE  H+WQW+G+  A  G I G
Sbjct  65   IENMEGLV----------ATYLGGFSGDVKREFTGILYHEMAHVWQWDGDRQAPEGPIRG  114

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            IADFVRL++ Y P HW  PG+GDRWD  + VTARFLDYCN L+NGFVAELN K++ GYSD
Sbjct  115  IADFVRLRSVYVPGHWVGPGQGDRWDQDHGVTARFLDYCNGLRNGFVAELNKKIRTGYSD  174

Query  632  SYFSDILGKTVDQLWTDYKAKYNT  703
             YF D+LG ++DQLW DYKAKY T
Sbjct  175  GYFVDLLGNSIDQLWKDYKAKYAT  198



>gb|KFK39998.1| hypothetical protein AALP_AA3G316800 [Arabis alpina]
Length=216

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 155/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFN-QVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSM  268
            AV+++V +   ++ GG RF  ++ G  Y+ Q L AA +F++R+FQQN+P DR+ V K+++
Sbjct  10   AVDFSVVDNTGDSAGGRRFRGEIGGVTYATQSLRAATDFVYRLFQQNNPSDRRTVTKITL  69

Query  269  FVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW--ngngaanggL  442
            F+++ DGVAY S NEIH +A Y+ G SGDVK E TGV+YHE  H  QW         GGL
Sbjct  70   FMENGDGVAYNSANEIHFNAGYLAGVSGDVKREFTGVVYHEVVHSLQWFGTSASRVPGGL  129

Query  443  IEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNG  622
            IEGIAD+VRLKAGY P+HW  PG GDRWD GYDVTARFLDYCN L+NGFVAELN KM+NG
Sbjct  130  IEGIADYVRLKAGYNPAHWVGPGRGDRWDQGYDVTARFLDYCNGLRNGFVAELNKKMRNG  189

Query  623  YSDSYFSDILGKTVDQLWTDYKAKY  697
            Y+D++F ++LGK V+QLW +YKAKY
Sbjct  190  YNDNFFVELLGKNVNQLWREYKAKY  214



>gb|ABV22584.1| PR17d precursor [Hordeum vulgare subsp. vulgare]
 gb|ABV22585.1| PR17d precursor [Hordeum vulgare subsp. vulgare]
 dbj|BAK03040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=232

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 149/202 (74%), Gaps = 1/202 (0%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSM-F  271
            V +  TNT  ++ GG RFNQ +G +Y+KQVL  A++FIW  F Q +PGDR+D   V++  
Sbjct  26   VTFDATNTVPDSAGGQRFNQDVGVDYAKQVLSDASSFIWTTFNQPNPGDRRDYDSVTLAV  85

Query  272  VDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEG  451
            VD+++ VA    N I + A+Y+ G+ GDVK E+ GVLYHE+TH+WQW  +     GL EG
Sbjct  86   VDNIEPVAQTVGNAIQLRAQYVAGFDGDVKQEVKGVLYHEATHVWQWIDHYGEKPGLFEG  145

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            IAD+VRLKA  AP HW K G GDRWD GYDVTARFLDYC+ LK GFVAE+N K+K+GYSD
Sbjct  146  IADYVRLKADLAPGHWVKDGGGDRWDQGYDVTARFLDYCDSLKPGFVAEMNGKLKDGYSD  205

Query  632  SYFSDILGKTVDQLWTDYKAKY  697
             YF  ILGK+VD+LW+DYKAKY
Sbjct  206  DYFVQILGKSVDELWSDYKAKY  227



>ref|XP_002467025.1| hypothetical protein SORBIDRAFT_01g018470 [Sorghum bicolor]
 gb|EER94023.1| hypothetical protein SORBIDRAFT_01g018470 [Sorghum bicolor]
Length=229

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 145/202 (72%), Gaps = 1/202 (0%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFV  274
            V + V N A  TPGG RF+Q  G  Y+ QVL  A++FIW VF Q SP DR+ V  V++ V
Sbjct  24   VTFEVINNATTTPGGLRFDQDYGVSYAAQVLSDASSFIWAVFNQTSPADRRPVDHVTLVV  83

Query  275  DDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLI-EG  451
            + MDG+AY   + I ++A Y+N Y+GDVK E+TGVLYHES H+WQW          + EG
Sbjct  84   NAMDGIAYTDGSTIVLNAGYVNNYTGDVKTEVTGVLYHESVHVWQWGLQDYDVYWWVYEG  143

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            IADFVRL+AGYAP+HW +PG+G  W+ GYDVTARFLDYC+ L+ GFVA LNAK+ NGYSD
Sbjct  144  IADFVRLRAGYAPAHWVQPGQGSSWEKGYDVTARFLDYCDSLRPGFVALLNAKLINGYSD  203

Query  632  SYFSDILGKTVDQLWTDYKAKY  697
             YF  ILGK V +LW +YKAKY
Sbjct  204  DYFVQILGKCVQELWQEYKAKY  225



>ref|XP_006409585.1| hypothetical protein EUTSA_v10022994mg [Eutrema salsugineum]
 gb|ESQ51038.1| hypothetical protein EUTSA_v10022994mg [Eutrema salsugineum]
Length=224

 Score =   247 bits (630),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 158/212 (75%), Gaps = 8/212 (4%)
 Frame = +2

Query  74   AIHGCRAVEYTVTNTAANTPGGARF-NQVIGEEYSKQVLDAAANFIWRVFQQ-NSPGDRK  247
            A+    AVE++V +   ++ GG RF  ++ G  Y  Q L +A +F+WR+FQQ N+P DR+
Sbjct  15   AVSLVNAVEFSVVDNTGDSAGGRRFRGEIGGVSYGTQSLQSATDFVWRLFQQTNNPSDRR  74

Query  248  DVQKVSMFVDDMDGVAYASNN--EIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngn  421
             V K+++ +++ +GVAY +N+  EIH +A Y+ G SGDV+ E TGV+YHE  H WQWNG 
Sbjct  75   PVTKITLIMENGNGVAYNTNSGSEIHFNAGYLAGVSGDVRREFTGVVYHEVVHSWQWNGP  134

Query  422  gaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAEL  601
            G     LIEGIAD++RLKAGYAP HW  PG GD+WD GYDVTARFLDYCNDL+NGFVAEL
Sbjct  135  GG----LIEGIADYMRLKAGYAPGHWVGPGGGDKWDQGYDVTARFLDYCNDLRNGFVAEL  190

Query  602  NAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            N KMKNGYSD +F D+LGK V+QLW +YKAKY
Sbjct  191  NKKMKNGYSDGFFVDLLGKDVNQLWREYKAKY  222



>gb|AAC49288.1| unknown [Triticum aestivum]
Length=231

 Score =   247 bits (630),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 156/203 (77%), Gaps = 2/203 (1%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSM-F  271
            V +  TNT  ++ GG RF+Q +G +Y+KQVL  A++FIW  F Q +P DR+D   V++  
Sbjct  24   VTFDATNTVPDSAGGQRFDQDVGVDYAKQVLSEASSFIWTTFNQPNPEDRRDYDSVTLAV  83

Query  272  VDDMDGVAYASNNEIHVSARYINGY-SGDVKGEITGVLYHESTHIWQWngngaanggLIE  448
            VD+++ VA  S N I + A+Y+ G+  GDVK E+ GVLYHE+TH+WQWNG G ANGGLIE
Sbjct  84   VDNIEPVAQTSGNAIQLRAQYVAGFDEGDVKKEVKGVLYHEATHVWQWNGQGRANGGLIE  143

Query  449  GIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYS  628
            GIAD+VRLKA  AP+HWR  G GDRWD GYDVTA+FLDYC+ LK GFVAE+N+K+K+GYS
Sbjct  144  GIADYVRLKADLAPTHWRPQGSGDRWDEGYDVTAKFLDYCDSLKAGFVAEMNSKLKDGYS  203

Query  629  DSYFSDILGKTVDQLWTDYKAKY  697
            D YF  ILGK+VDQLW DYKAKY
Sbjct  204  DDYFVQILGKSVDQLWNDYKAKY  226



>ref|XP_004230729.1| PREDICTED: uncharacterized protein LOC101249214 [Solanum lycopersicum]
Length=232

 Score =   245 bits (625),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 156/220 (71%), Gaps = 5/220 (2%)
 Frame = +2

Query  53   CILILGAAIHGCRA--VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ  226
            C   L A   G +A  V YTVTN   N+ GG RF   +G  Y+KQ L  + NFIW +FQQ
Sbjct  11   CFFFL-AFQKGNQALTVTYTVTNRDPNSSGGIRFTNEVGINYTKQTLANSTNFIWAIFQQ  69

Query  227  NSPGDRKDVQKVSMFVDDMDG--VAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTH  400
             +  D+K    ++ FV++     +AY   NEIH+   YI  YSG++K E+TG+L+HE+TH
Sbjct  70   TADADKKQYTALNAFVENTTNGYIAYTVGNEIHLGTSYIQSYSGNIKTELTGILFHEATH  129

Query  401  IWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLK  580
            +WQW GN +  GGLIEGIAD+VRLKAGY  S+W K G+G RWD GY VTARFLDYCN L+
Sbjct  130  VWQWFGNSSTPGGLIEGIADYVRLKAGYVVSNWAKNGQGTRWDEGYSVTARFLDYCNGLR  189

Query  581  NGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            NGFVAELN KM++GYS+++F ++LGKT DQL+ DYKAKYN
Sbjct  190  NGFVAELNKKMRSGYSNNFFVELLGKTPDQLFVDYKAKYN  229



>gb|KDP45915.1| hypothetical protein JCGZ_15475 [Jatropha curcas]
Length=211

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 148/199 (74%), Gaps = 0/199 (0%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDD  280
            + + N+   + G  R+ Q IG E SKQ L  A +FIW + Q N   +RK VQ++S+ ++D
Sbjct  11   HVIINSPRTSTGSVRYAQEIGIELSKQTLTNATDFIWTLLQLNKETERKGVQEISLIIED  70

Query  281  MDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIAD  460
            M+GVAY  +NEIH S +Y+  YS D+K E+ G+LYHE THIWQWNGNG   GGLIEGIAD
Sbjct  71   MEGVAYTDDNEIHFSTKYVANYSEDLKSEVIGILYHEMTHIWQWNGNGKTPGGLIEGIAD  130

Query  461  FVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYF  640
             VRLKA YAPSHW +PG+G+RWD GYDVT+RFLDYCNDL++GF A+LN KM++ Y   YF
Sbjct  131  LVRLKANYAPSHWVQPGQGERWDQGYDVTSRFLDYCNDLRDGFGADLNKKMRSDYKVEYF  190

Query  641  SDILGKTVDQLWTDYKAKY  697
             ++LGK V QLW +YKAK+
Sbjct  191  VELLGKPVHQLWNEYKAKH  209



>ref|XP_008644748.1| PREDICTED: uncharacterized protein LOC103626141 [Zea mays]
 gb|AFW68503.1| hypothetical protein ZEAMMB73_103154 [Zea mays]
Length=228

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFV  274
            V +   N A+ TPGG RF++  G  Y+ QVL  A+ F W VF Q SP DR+ V +V++ V
Sbjct  24   VTFEAINNASTTPGGQRFDRSYGVGYAAQVLSDASCFAWAVFNQTSPADRRPVDRVTLVV  83

Query  275  DDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaangg-LIEG  451
            + MDG+AY   + I ++A Y+N Y+GDVK E+TGVLYHE+ H+WQW          + EG
Sbjct  84   NAMDGIAYTEGSTIVLNAGYVNNYTGDVKTEVTGVLYHETVHVWQWGLQDYDAHWWVFEG  143

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            IADFVRL+AGYAP+HW +PG+G  WD GYDVTARFLDYC+ L+ GFVA LN K+KNGYSD
Sbjct  144  IADFVRLRAGYAPAHWVQPGQGSSWDKGYDVTARFLDYCDSLRPGFVALLNTKLKNGYSD  203

Query  632  SYFSDILGKTVDQLWTDYKAKY  697
             YF  I GK V +LW +YKAKY
Sbjct  204  DYFVQITGKCVQELWLEYKAKY  225



>ref|NP_179117.1| basic secretory protein family protein [Arabidopsis thaliana]
 gb|AAD25577.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM15095.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAP21677.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAT69160.1| hypothetical protein At2g15130 [Arabidopsis thaliana]
 gb|AEC06371.1| basic secretory protein family protein [Arabidopsis thaliana]
Length=225

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 159/217 (73%), Gaps = 1/217 (0%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARF-NQVIGEEYSKQVLDAAANFIWRVFQQ  226
              ++ L  A+    AV+++V +   ++PGG RF N++ G  Y +Q L  A +F WR+FQQ
Sbjct  7    FLVISLMLAVSLVSAVDFSVVDNTGDSPGGRRFRNEIGGVSYGEQSLRDATDFTWRLFQQ  66

Query  227  NSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIW  406
             +P DRKDV K+++F+++ +G+AY+S +EIH +A  +    G V+   TGV+YHE  H W
Sbjct  67   TNPSDRKDVTKITLFMENSNGIAYSSQDEIHYNAGSLVDDKGYVRRGFTGVVYHEVVHSW  126

Query  407  QWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNG  586
            QWNG G A GGLIEGIAD+VRLKAGY  SHW +PG GDRWD GYDVTARFL+YCNDL+NG
Sbjct  127  QWNGAGRAPGGLIEGIADYVRLKAGYVASHWVRPGGGDRWDQGYDVTARFLEYCNDLRNG  186

Query  587  FVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            FVAELN KM++ Y+D +F D+LGK V+QLW +YKA Y
Sbjct  187  FVAELNKKMRSDYNDGFFVDLLGKDVNQLWREYKANY  223



>ref|XP_008646583.1| PREDICTED: uncharacterized protein LOC103628085 [Zea mays]
 gb|AFW68499.1| hypothetical protein ZEAMMB73_491797 [Zea mays]
Length=227

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 152/206 (74%), Gaps = 3/206 (1%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR-VFQQNSPGDRKDVQKVSM  268
            AV +  TNTA  T GG RF+  +G +Y+  VL  A+ FIW   F Q  P DRK V  V++
Sbjct  21   AVTFNATNTATGTIGGLRFDVAVGLDYANLVLSNASAFIWSSAFNQTRPADRKPVDAVTL  80

Query  269  FV--DDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggL  442
             V  D     A+ + + I +SA Y+  YSGDV+ E+TGVL+HE+TH+WQW+G G ANGGL
Sbjct  81   VVAADVSGAAAFTAADVITLSAPYVGNYSGDVRTEVTGVLFHETTHVWQWDGQGHANGGL  140

Query  443  IEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNG  622
            +EG+ADFVRLKAGYAP+HW KPG+GDRWD GYDVTARFLDYC+ LK GFVA LNAKM++G
Sbjct  141  VEGVADFVRLKAGYAPAHWVKPGQGDRWDQGYDVTARFLDYCDSLKPGFVALLNAKMEDG  200

Query  623  YSDSYFSDILGKTVDQLWTDYKAKYN  700
            Y+D +F+ ILGK V QLW DYKA Y+
Sbjct  201  YTDDFFAGILGKGVQQLWQDYKANYD  226



>ref|XP_010488942.1| PREDICTED: uncharacterized protein LOC104766701 [Camelina sativa]
Length=225

 Score =   241 bits (615),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 157/217 (72%), Gaps = 1/217 (0%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGE-EYSKQVLDAAANFIWRVFQQ  226
              ++ L  A+    AVE++V +   ++ GG RF + IG   Y +Q L +A +FIWR+FQQ
Sbjct  7    FLVVSLMLAVSLVNAVEFSVIDNTGDSTGGRRFREEIGGVSYGEQSLRSATDFIWRLFQQ  66

Query  227  NSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIW  406
            N+P DR+D  K+++ +++   VAY+S ++IH +A  +   SGD++   TGV+YHE  H W
Sbjct  67   NNPSDRRDTPKITLIMENSKDVAYSSQDQIHYNAGSLVDDSGDIRRGFTGVIYHEVVHSW  126

Query  407  QWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNG  586
            QWNG G A  GLIEGIAD+VRLKAGYAPSHW  PG GDRWD GY VTARFLDYCNDL+NG
Sbjct  127  QWNGGGRAPVGLIEGIADYVRLKAGYAPSHWVAPGGGDRWDEGYAVTARFLDYCNDLRNG  186

Query  587  FVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            FVAELN KM++ Y+D +F D+LGK V+QLW +YKA Y
Sbjct  187  FVAELNKKMRSDYNDGFFFDLLGKDVNQLWREYKANY  223



>ref|XP_008800443.1| PREDICTED: uncharacterized protein LOC103714804 [Phoenix dactylifera]
Length=229

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 163/229 (71%), Gaps = 4/229 (2%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M+ + L +  L+  AA     AVEY VTN A  TPGG  F+  +G +YSK+VL  A+ F+
Sbjct  1    MELVALLISSLLASAAFTAAEAVEYEVTNNAVGTPGGTIFDDKLGVDYSKRVLADASAFV  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDM---DGVAYASNNEIHVSARYI-NGYSGDVKGEITG  376
            W  FQQ+S  DRK+VQ +++ ++++   D VA  SNN I  +A++I +G   D+K    G
Sbjct  61   WTTFQQSSEADRKNVQLITLSIENLNRDDVVALTSNNMIQYNAKFIADGNVDDLKRGFEG  120

Query  377  VLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARF  556
            VLYHE TH+WQWNGN AA G LIEGIADFVRLKAGY PS W KPG+G+ W  GY VTARF
Sbjct  121  VLYHEVTHVWQWNGNNAAPGWLIEGIADFVRLKAGYVPSDWAKPGDGNSWKEGYSVTARF  180

Query  557  LDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            LDYCN LK GFV +LNAKM++GYSD +F ++LGK VDQLW DYKA+Y +
Sbjct  181  LDYCNGLKGGFVTQLNAKMRDGYSDDFFVELLGKPVDQLWNDYKAQYGS  229



>ref|XP_004496933.1| PREDICTED: uncharacterized protein LOC101507183 [Cicer arietinum]
Length=227

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 167/226 (74%), Gaps = 2/226 (1%)
 Frame = +2

Query  29   MDRITLS--LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAAN  202
            MD+  L   +  L+  AA +   A++Y V+N A  + G  RF++ IG +Y+KQ L +AA 
Sbjct  1    MDQENLKHVMFFLLTLAAANFTTAIDYAVSNNAGASNGATRFDKEIGADYAKQTLSSAAE  60

Query  203  FIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVL  382
            FI ++FQQN+  D K VQ+VS+ ++++DG+A+ASNN I++SA YI  Y GD+K EITG++
Sbjct  61   FIQKLFQQNNNADTKSVQEVSVAIENIDGIAFASNNVIYISAGYIEKYWGDIKKEITGLI  120

Query  383  YHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLD  562
            YHE  HI QW+GNG A  GL +G+ADFVR+KA YA   W   G G++WD GY++TA FL 
Sbjct  121  YHEMAHILQWDGNGKAPSGLTKGMADFVRMKARYASDQWSPAGLGNQWDQGYEITAHFLH  180

Query  563  YCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            YC+++KNGFVA+LNAK+K GY++SYF+D+LGK + QLW+DYKA YN
Sbjct  181  YCDNIKNGFVADLNAKLKIGYNESYFNDLLGKPISQLWSDYKAMYN  226



>ref|XP_003574107.1| PREDICTED: uncharacterized protein LOC100829117 [Brachypodium 
distachyon]
Length=230

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 147/202 (73%), Gaps = 2/202 (1%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDD  280
            + V+NTA++T GG RF+Q  G +YSKQVL  A+ FIW +F Q S  DR+ V  V++ V+D
Sbjct  27   FEVSNTASSTAGGQRFDQAFGLDYSKQVLSDASTFIWAIFNQPSEADRRPVDTVTLVVED  86

Query  281  M-DGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLI-EGI  454
            + + +A+   N IH+ A+Y+ G SGDVK E++GVLYHE+ H+WQW          I EGI
Sbjct  87   IGERIAFTIGNGIHLGAQYVGGISGDVKTEVSGVLYHEAVHVWQWGLQDYDVHPWIFEGI  146

Query  455  ADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDS  634
            AD+VRLKA Y P HW   G GD+WD GYDVTARFLDYC+ LK GFVAE+N K+++GYSD 
Sbjct  147  ADYVRLKADYVPGHWVAAGGGDKWDKGYDVTARFLDYCDSLKAGFVAEMNGKLRDGYSDD  206

Query  635  YFSDILGKTVDQLWTDYKAKYN  700
            YF  ILGK+V+QLW DYKAKY+
Sbjct  207  YFVQILGKSVEQLWNDYKAKYS  228



>ref|XP_006300143.1| hypothetical protein CARUB_v10016373mg [Capsella rubella]
 gb|EOA33041.1| hypothetical protein CARUB_v10016373mg [Capsella rubella]
Length=225

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 154/218 (71%), Gaps = 1/218 (0%)
 Frame = +2

Query  47   SLCILILGAAIHGCRAVEYTVTNTAANTPGGARF-NQVIGEEYSKQVLDAAANFIWRVFQ  223
            +  ++ L   +    AVE++V +   ++PGG  F  Q+ G  Y +Q + +A +F WR+FQ
Sbjct  6    TFLVISLMLVVSLVNAVEFSVIDNTGDSPGGKIFREQIGGASYGEQAMRSATDFTWRLFQ  65

Query  224  QNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            Q++P DR+D   +++ +++   +AY+S ++IH +A  +    GDVK   TGV+YHE  H 
Sbjct  66   QDNPSDRRDTPMITLIMENSKDLAYSSQDKIHYNAGALVNDGGDVKRGFTGVIYHEVVHS  125

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNG   A  GLIEGIADFVRLKAGYA SHW  PG GDRWD GYDVT RFLDYCN+L+N
Sbjct  126  WQWNGANLAPVGLIEGIADFVRLKAGYAASHWVSPGGGDRWDQGYDVTMRFLDYCNELRN  185

Query  584  GFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GFVAELN KM+ GY+D +F D+LGK V+QLWT+YKA+Y
Sbjct  186  GFVAELNKKMRTGYNDGFFVDLLGKDVNQLWTEYKARY  223



>gb|AAG13529.1|AC023240_2 putative secretory protein [Oryza sativa Japonica Group]
Length=260

 Score =   240 bits (612),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 152/192 (79%), Gaps = 5/192 (3%)
 Frame = +2

Query  140  ARFNQVIGEEYSKQVLDAAANFIWRVFQQ-NSPGDRKDVQKVSMFVDDMDGVAYASNNEI  316
            A  ++ +G +Y+KQ+L  A++FIW  F+Q    GDRK V  V++ V+D+DGVA+ S + I
Sbjct  68   AAVDREVGVDYAKQMLADASSFIWDTFEQPGDGGDRKPVDAVTLTVEDIDGVAFTSGDGI  127

Query  317  HVSARYINGYS--GDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAP  490
            H+SARY+ GYS  GDV+ E+TGVLYHE+TH+WQW+G G A+GGLIEGIADFVRL+AGYAP
Sbjct  128  HLSARYVGGYSAAGDVRAEVTGVLYHEATHVWQWDGRGGADGGLIEGIADFVRLRAGYAP  187

Query  491  SHWRKPGEGDRWDAGYDVTARFLDYCND--LKNGFVAELNAKMKNGYSDSYFSDILGKTV  664
             HW +PG+GDRWD GYDVTARFLDYC+   +  GFVA+LN KMK+GYSD +F  I GKT+
Sbjct  188  PHWVQPGQGDRWDQGYDVTARFLDYCDSPAVVQGFVAQLNGKMKDGYSDDFFVQISGKTI  247

Query  665  DQLWTDYKAKYN  700
            DQLW DYKAKY 
Sbjct  248  DQLWQDYKAKYG  259



>ref|XP_008236461.1| PREDICTED: uncharacterized protein LOC103335229 [Prunus mume]
Length=233

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 156/230 (68%), Gaps = 7/230 (3%)
 Frame = +2

Query  29   MDRITLSLCILILGAA-IHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANF  205
            M R    LC + L A  +HG   +EY V +  A      RF Q IG  Y  Q L +A  F
Sbjct  1    MVRSIYVLCFITLAAGLVHGAYDMEYFVNDVTAGIHNQDRFEQEIGVNYCMQTLISATEF  60

Query  206  IWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYA--SNNEIHVSARYINGY-SGDVKG---E  367
            IW +FQQ++P DRK V  +++ ++DM G AY   SNNEIHVSA YI  Y + DV+G   E
Sbjct  61   IWDLFQQSTPEDRKSVHNITLTIEDMKGEAYTNTSNNEIHVSAGYILSYLAADVEGQRNE  120

Query  368  ITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVT  547
            + GV+YH+STH+WQW+GNG A  GL+EGIAD+VR+K+G+ PS W +PG GDRWD GYDVT
Sbjct  121  MNGVIYHQSTHVWQWDGNGQAPRGLVEGIADYVRMKSGFMPSQWAQPGVGDRWDQGYDVT  180

Query  548  ARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            ARFL+Y    +NGFV ELN KM+ GYSD YF  +LGK V QLWT+YK +Y
Sbjct  181  ARFLEYLESSRNGFVTELNKKMRLGYSDDYFVQLLGKNVGQLWTEYKLRY  230



>ref|XP_006840580.1| hypothetical protein AMTR_s00045p00230850 [Amborella trichopoda]
 gb|ERN02255.1| hypothetical protein AMTR_s00045p00230850 [Amborella trichopoda]
Length=224

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 158/223 (71%), Gaps = 1/223 (0%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M  +T+ +  L+  A +    A+E+   N A  TPGG RF+   G EY+ Q +++A+ FI
Sbjct  1    MKNLTILITSLLALALLDPTHALEFVAANNAIGTPGGNRFDSEFGLEYTLQTMNSASEFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            WR FQQ+    R+ V +++  +++ DGVAY S + I VSA+YI  ++GDV+ EI G+LYH
Sbjct  61   WRAFQQDE-ATRRPVSRITTTIENEDGVAYTSGDHIRVSAQYIANFNGDVRREIVGLLYH  119

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E  H WQ+NG G A  GLIEG+AD++RL +GYA  +W KPG GDRWD GYDVTA FL YC
Sbjct  120  EVAHSWQYNGQGHAPSGLIEGVADYLRLTSGYAAPYWIKPGGGDRWDQGYDVTAYFLQYC  179

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
              L+ GFVA+LNAKMK+GY+  +F D++GK+VDQLW+DYKA+Y
Sbjct  180  EGLRQGFVADLNAKMKDGYNVGFFQDLVGKSVDQLWSDYKARY  222



>ref|XP_007042547.1| Plant basic secretory protein (BSP) family protein, putative 
[Theobroma cacao]
 gb|EOX98378.1| Plant basic secretory protein (BSP) family protein, putative 
[Theobroma cacao]
Length=234

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 150/222 (68%), Gaps = 9/222 (4%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            L  L+  A +HG  AV+Y VTN AA T GG  FN  +G EY++Q + +A+ FIW +FQQ 
Sbjct  8    LVSLLALATLHGMDAVDYAVTNQAATTAGGIIFNNQLGVEYTRQQMQSASEFIWNLFQQT  67

Query  230  SP--GDRKDVQKVSMFVDDM---DGVAYASNNEIHVSARYINGYSGD-VKGEITGVLYHE  391
             P  G R  +  VS+FV D       A  SN++I VS ++I  +SGD +K E  GVLYHE
Sbjct  68   DPQDGKRNSISTVSLFVVDTLPPQIPASTSNDKIQVSDKHIEAFSGDKLKPEFNGVLYHE  127

Query  392  STHIWQWn---gngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLD  562
             TH+WQWN         G LIEGIADFVRLKAGY P+ W +PG+GD+W  GY VTARFLD
Sbjct  128  MTHVWQWNGNGQQDETLGKLIEGIADFVRLKAGYVPAGWAQPGQGDKWYDGYSVTARFLD  187

Query  563  YCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYK  688
            YC  L+ GFVAELN KM++GYS  +FS +LGKTVDQLW DYK
Sbjct  188  YCEGLRPGFVAELNRKMRDGYSTDFFSQLLGKTVDQLWADYK  229



>gb|EAY79023.1| hypothetical protein OsI_34132 [Oryza sativa Indica Group]
Length=228

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 152/207 (73%), Gaps = 5/207 (2%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ-NSPGDRKDVQKVSM  268
            AV +  TNTA++T GG RF++ +G +Y+KQVL  A++FIW  F+Q    GDRK V  V++
Sbjct  20   AVTFDATNTASSTAGGQRFDREVGVDYAKQVLADASSFIWDAFEQPGDGGDRKPVDAVTL  79

Query  269  FVDDMDGVAYASNNEIHVSARYINGYS---GDVKGEITGVLYHESTHIWQWngngaangg  439
             V+D+DGVA+ S + IH+SARY+ GYS   GDV+ E+TGVLYHE+TH+WQW     A   
Sbjct  80   TVEDIDGVAFTSGDAIHLSARYVGGYSSSSGDVRTEVTGVLYHEATHVWQWGLQDYAAHS  139

Query  440  LI-EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMK  616
             + EGIADFVRL+AGY  + W +PG+G+ W+  Y VTARF DYC+ +K GFVA+LNAK+K
Sbjct  140  WVYEGIADFVRLRAGYVAAGWVQPGQGNSWEDSYSVTARFFDYCDSVKPGFVADLNAKLK  199

Query  617  NGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +GY+  YF  I GKTV QLW DYKAKY
Sbjct  200  DGYNVDYFVQITGKTVQQLWQDYKAKY  226



>ref|XP_004304056.1| PREDICTED: uncharacterized protein LOC101291846 [Fragaria vesca 
subsp. vesca]
Length=229

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 161/227 (71%), Gaps = 4/227 (2%)
 Frame = +2

Query  29   MDRITLSLCI--LILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAAN  202
            M R  LS+    L+  AA+H  +A+EY V N A NTPGG RF   +G +Y+KQ +  A +
Sbjct  1    MARFLLSIIFASLLALAAVHETQAIEYIVENRALNTPGGIRFRDELGVDYTKQKMRDATD  60

Query  203  FIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGD-VKGEITGV  379
            FIW +F++ +  +R+D  ++S+FV+D+DG+A +S + IH SA+YI G + D +K +  G+
Sbjct  61   FIWNLFKETTAAERRDTPRISLFVEDIDGIAASSEDIIHFSAKYIEGLAADKLKNDFNGI  120

Query  380  LYHESTHIWQWngngaanggLIEGIADFVR-LKAGYAPSHWRKPGEGDRWDAGYDVTARF  556
            LYHE TH  Q NG G A  GL+EGIADFV  LKAG+    +  PG+G+ WD GY VTARF
Sbjct  121  LYHEITHSLQRNGKGQAPLGLVEGIADFVSFLKAGFIYDGYLNPGDGNSWDEGYGVTARF  180

Query  557  LDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            L+YC  LK+GFVAELN KM +GYSD +F+ +LGKTV+QLWTDYKAKY
Sbjct  181  LEYCEGLKDGFVAELNKKMIDGYSDDFFNQLLGKTVNQLWTDYKAKY  227



>ref|XP_010253329.1| PREDICTED: uncharacterized protein LOC104594638 [Nelumbo nucifera]
Length=229

 Score =   233 bits (595),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 144/203 (71%), Gaps = 2/203 (1%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFV  274
            V+Y V N A  TPGG RF + I  + S   + +A+ FIW+  QQ S  DRK+V+KV++ V
Sbjct  25   VQYAVMNKAVGTPGGDRFAREIDTQLSISTMTSASEFIWKTLQQ-SEADRKNVEKVTLIV  83

Query  275  DDMD-GVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEG  451
            + MD  +AY  NNEIH+S  +I  Y GD+K    G++YHE TH+WQWNGNG    GL+EG
Sbjct  84   EVMDVALAYEFNNEIHLSEDFIAKYEGDLKTMFIGIIYHEMTHVWQWNGNGQTPPGLVEG  143

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            I D+VR  AGYA   W KPG+G +WD GY VTARFL+YCN L NGFVA+LNA MK  YSD
Sbjct  144  IGDYVRFAAGYAAPQWAKPGDGQKWDEGYSVTARFLEYCNTLSNGFVAKLNAMMKTNYSD  203

Query  632  SYFSDILGKTVDQLWTDYKAKYN  700
             +F D+LGKTVDQLW DYK+KY+
Sbjct  204  HFFVDLLGKTVDQLWNDYKSKYH  226



>ref|NP_001064924.1| Os10g0490800 [Oryza sativa Japonica Group]
 gb|AAP54392.2| secretory protein, putative [Oryza sativa Japonica Group]
 dbj|BAF26838.1| Os10g0490800 [Oryza sativa Japonica Group]
 gb|EAZ16513.1| hypothetical protein OsJ_31985 [Oryza sativa Japonica Group]
Length=228

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 152/207 (73%), Gaps = 5/207 (2%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ-NSPGDRKDVQKVSM  268
            AV +  TNTA++T GG RF++ +G +Y+KQVL  A++FIW  F+Q    GDRK V  V++
Sbjct  20   AVTFDATNTASSTAGGQRFDREVGVDYAKQVLADASSFIWDAFEQPGDGGDRKPVDAVTL  79

Query  269  FVDDMDGVAYASNNEIHVSARYINGYS---GDVKGEITGVLYHESTHIWQWngngaangg  439
             V+D+DGVA+ S + IH+SARY+ GYS   GDV+ E+TGVLYHE+TH+WQW     A   
Sbjct  80   TVEDIDGVAFTSGDGIHLSARYVGGYSSSSGDVRTEVTGVLYHEATHVWQWGLQDYAAHS  139

Query  440  LI-EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMK  616
             + EGIADFVRL+AGY  + W +PG+G+ W+  Y VTARF DYC+ +K GFVA++NAK+K
Sbjct  140  WVYEGIADFVRLRAGYVAAGWVQPGQGNSWEDSYSVTARFFDYCDSVKPGFVADINAKLK  199

Query  617  NGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +GY+  YF  I GKTV QLW DYKAKY
Sbjct  200  DGYNVDYFVQITGKTVQQLWQDYKAKY  226



>ref|XP_002983435.1| hypothetical protein SELMODRAFT_118266 [Selaginella moellendorffii]
 gb|EFJ15336.1| hypothetical protein SELMODRAFT_118266 [Selaginella moellendorffii]
Length=223

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 151/222 (68%), Gaps = 7/222 (3%)
 Frame = +2

Query  38   ITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRV  217
            + LSLC      A      +     N A  T GG RF+ V+G + +  VL  A  F+   
Sbjct  8    LILSLC------ATSAHAQITLVFANNAQGTAGGRRFDSVVGAQGAFTVLSNAITFVQST  61

Query  218  FQQNSPG-DRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            F  ++P   +K V +++  VDD+ GVAY SN++IH+SA Y+  YSGDV  EI GV++HE 
Sbjct  62   FDYSNPSTPKKSVSRITFTVDDIGGVAYTSNDQIHLSASYVGNYSGDVAREIRGVMFHEM  121

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            TH+WQWNG G+A GGLIEGIADFVRLKA  APSHW KPG G+RWD GYDVTARFLDY N 
Sbjct  122  THVWQWNGRGSAPGGLIEGIADFVRLKANLAPSHWVKPGAGNRWDQGYDVTARFLDYVNS  181

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            L  GFVA+LNAK+  G+S+SYF D+ GK+V  LW+DYK KY+
Sbjct  182  LSAGFVAKLNAKLATGWSESYFQDLTGKSVGTLWSDYKKKYS  223



>gb|AAG13532.1|AC023240_5 putative secretory protein [Oryza sativa Japonica Group]
Length=233

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 152/207 (73%), Gaps = 5/207 (2%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ-NSPGDRKDVQKVSM  268
            AV +  TNTA++T GG RF++ +G +Y+KQVL  A++FIW  F+Q    GDRK V  V++
Sbjct  25   AVTFDATNTASSTAGGQRFDREVGVDYAKQVLADASSFIWDAFEQPGDGGDRKPVDAVTL  84

Query  269  FVDDMDGVAYASNNEIHVSARYINGYS---GDVKGEITGVLYHESTHIWQWngngaangg  439
             V+D+DGVA+ S + IH+SARY+ GYS   GDV+ E+TGVLYHE+TH+WQW     A   
Sbjct  85   TVEDIDGVAFTSGDGIHLSARYVGGYSSSSGDVRTEVTGVLYHEATHVWQWGLQDYAAHS  144

Query  440  LI-EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMK  616
             + EGIADFVRL+AGY  + W +PG+G+ W+  Y VTARF DYC+ +K GFVA++NAK+K
Sbjct  145  WVYEGIADFVRLRAGYVAAGWVQPGQGNSWEDSYSVTARFFDYCDSVKPGFVADINAKLK  204

Query  617  NGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +GY+  YF  I GKTV QLW DYKAKY
Sbjct  205  DGYNVDYFVQITGKTVQQLWQDYKAKY  231



>ref|XP_002313878.2| hypothetical protein POPTR_0009s09770g [Populus trichocarpa]
 gb|EEE87833.2| hypothetical protein POPTR_0009s09770g [Populus trichocarpa]
Length=195

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 139/202 (69%), Gaps = 16/202 (8%)
 Frame = +2

Query  89   RAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSM  268
            R + YTVTN A+ T GGARF + IG +YSKQ+L     F WR F Q  P D ++VQ+V+ 
Sbjct  4    RLLLYTVTNNASATAGGARFTRDIGVDYSKQILARVTAFTWRNFHQTDPADGENVQRVAF  63

Query  269  FVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIE  448
            F+ DMDG+ YA NN IHV                 GVLYHE   IWQW+GNG    GLIE
Sbjct  64   FIIDMDGIGYADNNRIHVG----------------GVLYHEMKPIWQWDGNGRNPVGLIE  107

Query  449  GIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYS  628
            GIADFVRLKA YAPSHW +PG+GDR D GYD+TARFLDYC DL+NGFVA+LN  M+  +S
Sbjct  108  GIADFVRLKANYAPSHWVQPGQGDRCDQGYDITARFLDYCTDLRNGFVADLNKMMRTSFS  167

Query  629  DSYFSDILGKTVDQLWTDYKAK  694
              Y  D+LGKTVD+LW DY+A+
Sbjct  168  ALYLVDLLGKTVDELWIDYRAR  189



>ref|XP_002974055.1| hypothetical protein SELMODRAFT_100588 [Selaginella moellendorffii]
 gb|EFJ25010.1| hypothetical protein SELMODRAFT_100588 [Selaginella moellendorffii]
Length=236

 Score =   231 bits (590),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 151/222 (68%), Gaps = 7/222 (3%)
 Frame = +2

Query  38   ITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRV  217
            + LSLC     A I           N A  T GG RF+ V+G + +  +L  A  F+   
Sbjct  8    LILSLCATSTHAQI------TLVFANNAQGTAGGRRFDSVVGAQGAFTILSDAITFVQST  61

Query  218  FQQNSPG-DRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            F  ++P   +K V +++  VDD+ GVAY SN++IH+SA Y+  YSGDV  EI GV++HE 
Sbjct  62   FDYSNPSTPKKSVSRITFTVDDIGGVAYTSNDQIHLSASYVGNYSGDVAREIRGVMFHEM  121

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            TH+WQWNG G+A GGLIEGIADFVRLKA  APSHW KPG G+RWD GYDVTARFLDY N 
Sbjct  122  THVWQWNGRGSAPGGLIEGIADFVRLKANLAPSHWVKPGAGNRWDQGYDVTARFLDYVNS  181

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            L  GFVA+LNAK+  G+S+SYF D+ GK+V  LW+DYK KY+
Sbjct  182  LSAGFVAKLNAKLATGWSESYFQDLTGKSVGTLWSDYKKKYS  223



>gb|EMS45729.1| hypothetical protein TRIUR3_05356 [Triticum urartu]
Length=227

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 151/203 (74%), Gaps = 6/203 (3%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSM-F  271
            V +  TNT  ++ GG RF+Q +G +Y+KQVL  A++FIW  F Q +P DR+D   V++  
Sbjct  24   VTFDATNTVPDSAGGQRFDQDVGVDYAKQVLSEASSFIWTTFNQPNPEDRRDYDSVTLAV  83

Query  272  VDDMDGVAYASNNEIHVSARYINGY-SGDVKGEITGVLYHESTHIWQWngngaanggLIE  448
            VD+++ VA  S N I + A+Y+ G+  GDVK E+ GVLYHE+TH+WQWNG G ANGGLIE
Sbjct  84   VDNIEPVAQTSGNAIQLRAQYVAGFDEGDVKKEVKGVLYHEATHVWQWNGQGRANGGLIE  143

Query  449  GIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYS  628
            GIA +VRLKA  AP+HWR  G GDRWD GYDVTA+FLDYC+ LK GFVAE+N+K+K+GYS
Sbjct  144  GIAHYVRLKADLAPTHWRPQGSGDRWDEGYDVTAKFLDYCDSLKAGFVAEMNSKLKDGYS  203

Query  629  DSYFSDILGKTVDQLWTDYKAKY  697
            D YF  IL    DQLW DYKAKY
Sbjct  204  DDYFVLIL----DQLWNDYKAKY  222



>ref|NP_001064925.2| Os10g0490900 [Oryza sativa Japonica Group]
 gb|AAP54393.2| secretory protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26839.2| Os10g0490900 [Oryza sativa Japonica Group]
Length=179

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = +2

Query  182  VLDAAANFIWRVFQQ-NSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYS--G  352
            +L  A++FIW  F+Q    GDRK V  V++ V+D+DGVA+ S + IH+SARY+ GYS  G
Sbjct  1    MLADASSFIWDTFEQPGDGGDRKPVDAVTLTVEDIDGVAFTSGDGIHLSARYVGGYSAAG  60

Query  353  DVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDA  532
            DV+ E+TGVLYHE+TH+WQW+G G A+GGLIEGIADFVRL+AGYAP HW +PG+GDRWD 
Sbjct  61   DVRAEVTGVLYHEATHVWQWDGRGGADGGLIEGIADFVRLRAGYAPPHWVQPGQGDRWDQ  120

Query  533  GYDVTARFLDYCND--LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            GYDVTARFLDYC+   +  GFVA+LN KMK+GYSD +F  I GKT+DQLW DYKAKY 
Sbjct  121  GYDVTARFLDYCDSPAVVQGFVAQLNGKMKDGYSDDFFVQISGKTIDQLWQDYKAKYG  178



>ref|XP_010253341.1| PREDICTED: uncharacterized protein LOC104594644 [Nelumbo nucifera]
Length=230

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 145/203 (71%), Gaps = 2/203 (1%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFV  274
            V+Y V N A  T GG RF + IG + S + + +A  FIW+ F++ S  DRKD++KV++ V
Sbjct  26   VQYAVENKAVGTAGGDRFAKEIGTQLSVRAMSSATKFIWKTFEETSKADRKDIEKVTLIV  85

Query  275  DDMD-GVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEG  451
            +  D  +AYA +  IH+S  +I  Y GD+K    G++YHE TH+WQW G GA  G LIEG
Sbjct  86   EVTDVALAYAIDGAIHLSEDFIAKYDGDLKTMFIGIIYHEMTHLWQWYGEGAPGG-LIEG  144

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            IAD+VR  AGY    W KPG+GD+WD GY VTARFL+YCN L +GFVA+LNAKMKNGYSD
Sbjct  145  IADYVRYVAGYPAPDWAKPGQGDKWDEGYSVTARFLEYCNSLSDGFVAKLNAKMKNGYSD  204

Query  632  SYFSDILGKTVDQLWTDYKAKYN  700
              F ++LGKTVDQLW DYK+KY+
Sbjct  205  HLFVELLGKTVDQLWNDYKSKYS  227



>ref|XP_002973860.1| hypothetical protein SELMODRAFT_232195 [Selaginella moellendorffii]
 gb|EFJ24815.1| hypothetical protein SELMODRAFT_232195 [Selaginella moellendorffii]
Length=223

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 149/222 (67%), Gaps = 7/222 (3%)
 Frame = +2

Query  38   ITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRV  217
            + LSLC      A            N A  T GG RF+ V+G + +  +L  A  F+   
Sbjct  8    LILSLC------ATSAHAQTTLVFANNAQGTAGGRRFDSVVGAQGAFTILSDAIAFVQST  61

Query  218  FQQNSPG-DRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHES  394
            F  ++P   +K V +++  VDD+ GVAY SN++IH+SA Y+  YSGDV  EI GV++HE 
Sbjct  62   FDYSNPSTPKKSVARITFTVDDIGGVAYTSNDQIHLSASYVGDYSGDVAREIRGVMFHEM  121

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            TH+WQWNG G A GGLIEGIADFVRLKA  APSHW KPG G+RWD GYDVTARFLDY N 
Sbjct  122  THVWQWNGRGGAPGGLIEGIADFVRLKANLAPSHWVKPGAGNRWDEGYDVTARFLDYVNS  181

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            L  GFVA+LNAK+  G+S+SYF D+ GK+V  LW+DYK KY+
Sbjct  182  LSAGFVAKLNAKLATGWSESYFQDLTGKSVGTLWSDYKKKYS  223



>ref|XP_010065955.1| PREDICTED: uncharacterized protein LOC104453132 [Eucalyptus grandis]
 gb|KCW63681.1| hypothetical protein EUGRSUZ_G01327 [Eucalyptus grandis]
Length=229

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 153/217 (71%), Gaps = 2/217 (1%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            L  +++ A+++   AV+YTV+N   NT GGA F   IG+ Y++Q + AA NFIW+VFQQ 
Sbjct  9    LSSVLIVASLNKIWAVDYTVSNAVPNTEGGAIFANRIGDAYARQTMMAATNFIWKVFQQA  68

Query  230  SPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQ  409
            +  DRKDV +V + +D++  VA    +EIH SA Y++   GD KGE TGV+YHE TH+WQ
Sbjct  69   TAADRKDVPRVGLIIDNLYDVAATVGSEIHFSANYLSKIQGD-KGEFTGVMYHEMTHVWQ  127

Query  410  Wngngaang-gLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNG  586
            WNG G  +   +IEGIADFVRL+A  AP+ W + G G+ W  GY VTA FLDYC   +NG
Sbjct  128  WNGRGNPSAGKVIEGIADFVRLRANLAPATWPRRGSGNSWGEGYAVTAYFLDYCESQRNG  187

Query  587  FVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            FVAELN KM++GYSD +F  +LG++ DQL+ +YKA+Y
Sbjct  188  FVAELNRKMRDGYSDDFFMQLLGRSADQLFREYKARY  224



>gb|KGN43891.1| NtPRp27-like protein [Cucumis sativus]
Length=260

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 154/235 (66%), Gaps = 6/235 (3%)
 Frame = +2

Query  11   EIAKTSMDRITLSLCILILGAA----IHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSK  178
             I  TS   I  S  I+    A    +H   AVEY +T+ A  TPGG RF+  IG +Y +
Sbjct  22   SIPSTSQASIMASNTIIFFFIASLFLLHTVSAVEYIITSNAGGTPGGNRFDTQIGADYCR  81

Query  179  QVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVD-DMDGV-AYASNNEIHVSARYINGYSG  352
            Q +  A+ FIW +F+QN+P DR++VQ V + +D D+    A+ASNN IHVSA YI  Y+G
Sbjct  82   QTMIEASGFIWSIFRQNTPADRRNVQSVILLIDRDLHQYPAFASNNRIHVSASYIARYNG  141

Query  353  DVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDA  532
            DV+  +TG+LYHE  H+WQWNGNGAA G LIEG AD+VRLKAGY P HW  PG G  W  
Sbjct  142  DVRMAVTGILYHEMVHVWQWNGNGAAPGWLIEGYADYVRLKAGYIPGHWVAPGGGSSWME  201

Query  533  GYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GYD TARF+DY    ++GFV+ LN  ++ GYS  YF  + GKTV +LW +YKA +
Sbjct  202  GYDKTARFMDYLEGRRSGFVSALNRMLRVGYSPEYFVQLQGKTVAELWAEYKAAF  256



>ref|XP_004982765.1| PREDICTED: uncharacterized protein LOC101755936 [Setaria italica]
Length=226

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 147/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  95   VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFV  274
            V   VTNTA+NT GG RF++ +G ++ +Q++  A+ FIW  F Q +P DRK V  +++ V
Sbjct  24   VTIDVTNTASNTLGGQRFDREVGLDFPRQIISEASMFIWMTFNQTNPADRKPVDAIALVV  83

Query  275  DDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGI  454
             D+ GVA+ SN+ I +SA+YI  YSG+V+ E+  VL+HE+TH+WQW+G G A+ GLIEGI
Sbjct  84   ADVGGVAFTSNDVITLSAQYIGNYSGNVRIEVASVLFHETTHVWQWDGQGQASRGLIEGI  143

Query  455  ADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDS  634
            AD++   AGY P++W + G+G+RWD GY VTA FL YC+ L+ GFVA LNAKM+ GY+D 
Sbjct  144  ADYIVYTAGYRPAYWVQQGQGERWDEGYSVTAMFLVYCDTLRPGFVALLNAKMRYGYTDD  203

Query  635  YFSDILGKTVDQLWTDYKAKY  697
             F+ ILGK V QLW DYKA Y
Sbjct  204  LFAQILGKDVQQLWQDYKAMY  224



>ref|XP_004137101.1| PREDICTED: uncharacterized protein LOC101216297 [Cucumis sativus]
 ref|XP_004159931.1| PREDICTED: uncharacterized LOC101216297 [Cucumis sativus]
Length=229

 Score =   226 bits (576),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 146/209 (70%), Gaps = 2/209 (1%)
 Frame = +2

Query  77   IHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQ  256
            +H   AVEY +T+ A  TPGG RF+  IG +Y +Q +  A+ FIW +F+QN+P DR++VQ
Sbjct  17   LHTVSAVEYIITSNAGGTPGGNRFDTQIGADYCRQTMIEASGFIWSIFRQNTPADRRNVQ  76

Query  257  KVSMFVD-DMDGV-AYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaa  430
             V + +D D+    A+ASNN IHVSA YI  Y+GDV+  +TG+LYHE  H+WQWNGNGAA
Sbjct  77   SVILLIDRDLHQYPAFASNNRIHVSASYIARYNGDVRMAVTGILYHEMVHVWQWNGNGAA  136

Query  431  nggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAK  610
             G LIEG AD+VRLKAGY P HW  PG G  W  GYD TARF+DY    ++GFV+ LN  
Sbjct  137  PGWLIEGYADYVRLKAGYIPGHWVAPGGGSSWMEGYDKTARFMDYLEGRRSGFVSALNRM  196

Query  611  MKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            ++ GYS  YF  + GKTV +LW +YKA +
Sbjct  197  LRVGYSPEYFVQLQGKTVAELWAEYKAAF  225



>ref|XP_002883880.1| hypothetical protein ARALYDRAFT_899730 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60139.1| hypothetical protein ARALYDRAFT_899730 [Arabidopsis lyrata subsp. 
lyrata]
Length=199

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 144/197 (73%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIG-EEYSKQVLDAAANFIWRVFQQ  226
              ++ L  AI    AV+++V +T  ++PGG +F + IG   Y +Q L +A +F+W + QQ
Sbjct  7    FLVISLMLAISLVNAVDFSVVDTTGDSPGGRKFREEIGGASYGEQTLRSATDFVWGLLQQ  66

Query  227  NSPGDRKDVQKVSMFVDDMDGVAYASN--NEIHVSARYINGYSGDVKGEITGVLYHESTH  400
             +P DR+D++ +++F+++ +GVAY SN  NEIH +A Y+ G SGDVK E TGV+YHE  H
Sbjct  67   TNPSDRRDIKMITLFMENGNGVAYNSNLGNEIHFNAGYLAGVSGDVKREFTGVVYHEVVH  126

Query  401  IWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLK  580
             WQW+G G     LIEGIA +VRLKAGYAPSHW  PG GDRWD GYD TARFLDYCNDL+
Sbjct  127  SWQWDGPGG----LIEGIAYYVRLKAGYAPSHWVGPGRGDRWDQGYDFTARFLDYCNDLR  182

Query  581  NGFVAELNAKMKNGYSD  631
            NGFVAELN KM+NGYS+
Sbjct  183  NGFVAELNKKMRNGYSE  199



>ref|XP_007199606.1| hypothetical protein PRUPE_ppa024467mg, partial [Prunus persica]
 gb|EMJ00805.1| hypothetical protein PRUPE_ppa024467mg, partial [Prunus persica]
Length=218

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 146/213 (69%), Gaps = 6/213 (3%)
 Frame = +2

Query  77   IHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQ  256
            +HG   +EY V +         RF Q IG  Y  + L +A  FIW +FQQ++P DRK V 
Sbjct  3    VHGAYDMEYFVNDVTVGIHNQDRFEQEIGVNYCMKTLISATEFIWDLFQQSTPEDRKSVH  62

Query  257  KVSMFVDDMDGVAYA--SNNEIHVSARYINGY-SGDVKG---EITGVLYHESTHIWQWng  418
             +++ ++DM G AY   SNNEIHVSA YI  Y + D +G   E+ GV+YH+ TH+WQWNG
Sbjct  63   NITLTIEDMKGEAYTNTSNNEIHVSAGYILSYPAADAEGQRNEMNGVIYHQLTHVWQWNG  122

Query  419  ngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAE  598
            NG A  GL+EGIAD+VR+K+G+ PS W +PG GDRWD GYDVTARFL+Y   L+NGFV E
Sbjct  123  NGQAPRGLVEGIADYVRMKSGFIPSQWAQPGVGDRWDQGYDVTARFLEYLESLRNGFVTE  182

Query  599  LNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            LN KM+ GYSD  F  +LGK V QLWT+YK +Y
Sbjct  183  LNKKMRLGYSDDDFVQLLGKNVGQLWTEYKLRY  215



>gb|KEH44067.1| peptidase M [Medicago truncatula]
Length=216

 Score =   220 bits (561),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 147/208 (71%), Gaps = 11/208 (5%)
 Frame = +2

Query  80   HGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQK  259
            H  +A+ Y V+N A  + G ARF++ I           AA FI ++FQQN+  D K V++
Sbjct  20   HCAKAINYVVSNNAEASTGAARFDKEI-----------AAEFIQKLFQQNNSADIKTVEE  68

Query  260  VSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaangg  439
            V + ++++DG+A+ASN+ IH+SA YI  Y  DVK EI G++YHE  HI QW+GNG A  G
Sbjct  69   VGVIIENIDGLAFASNDIIHISAGYIEKYREDVKKEIAGLIYHEMAHILQWDGNGKAPSG  128

Query  440  LIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKN  619
            L EGIADF+R+KAGYA   W   G GD+WD GY+VTA FL YC++LKNGFVA+LN K+K 
Sbjct  129  LTEGIADFMRMKAGYASDLWSPAGVGDQWDQGYEVTAHFLHYCDNLKNGFVADLNKKLKT  188

Query  620  GYSDSYFSDILGKTVDQLWTDYKAKYNT  703
             YS+SYF+D+LGK V QLW+DYKA YN 
Sbjct  189  DYSESYFNDLLGKPVAQLWSDYKAMYNN  216



>ref|XP_004986458.1| PREDICTED: uncharacterized protein LOC101768140 [Setaria italica]
Length=230

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 148/228 (65%), Gaps = 5/228 (2%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M     ++  L+L  A  G  AV + VTN A+ TPGG RF++  G  Y+ +VL  A+ F 
Sbjct  1    MKLAVAAVVSLLLAVAATGGAAVTFQVTNNASTTPGGQRFDRDYGAGYAARVLSDASRFT  60

Query  209  WRVFQQNSPGDRKD-VQKVSMFVD---DMDGVAYASNNEIHVSARYINGYSGDVKGEITG  376
            W VF Q SP +R+  V  V++ V+   D   +AY   + I + A Y+  Y+GDV+ E+TG
Sbjct  61   WAVFNQTSPAERRPGVDTVALVVNAATDDGAIAYTDGSTIVLGAGYVLNYTGDVRAEVTG  120

Query  377  VLYHESTHIWQWngngaangg-LIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTAR  553
            VLYHE+ H+WQW          + EGIADFVRL+AGYAP+HW  PG+G  WD GYDVTAR
Sbjct  121  VLYHETVHVWQWGLQDYNAHWWVFEGIADFVRLRAGYAPAHWVLPGQGSGWDKGYDVTAR  180

Query  554  FLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            F DYC+ L+ GFVA LNAK+K+ YSD YF  ILGK V +LW +YKAKY
Sbjct  181  FFDYCDSLRPGFVAVLNAKLKDSYSDDYFVQILGKNVQELWMEYKAKY  228



>gb|EAY79025.1| hypothetical protein OsI_34134 [Oryza sativa Indica Group]
Length=229

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 143/211 (68%), Gaps = 2/211 (1%)
 Frame = +2

Query  71   AAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKD  250
            +++    AV Y V+N AA+T GG RF++  G  Y+KQVL AA++F W +F Q S  DR+ 
Sbjct  17   SSLPPAAAVTYEVSNEAASTAGGQRFDREYGAGYAKQVLAAASSFTWSIFSQPSAADRRP  76

Query  251  VQKVSMFVDDMDGVAYASNNEIHVSARYINGYSG-DVKGEITGVLYHESTHIWQWngnga  427
            V  V + V D+DG+A  S N I + A Y+ G +G D K ++TGVLYHE  H+WQW     
Sbjct  77   VDAVVLAVRDVDGIASTSGNTITLGAGYVAGVTGNDFKTQVTGVLYHEVVHVWQWGLQDY  136

Query  428  anggLI-EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELN  604
            A    + EGIADFVRL+AGY  + W +PG+G+ W+  Y VTARF DYC+ +K GFVA+LN
Sbjct  137  AAHSWVYEGIADFVRLRAGYVAAGWVQPGQGNSWEDSYSVTARFFDYCDSVKPGFVADLN  196

Query  605  AKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            AK+K+GY+  YF  I GKTV QLW DYKAKY
Sbjct  197  AKLKDGYNVDYFVQITGKTVQQLWQDYKAKY  227



>ref|NP_001064926.1| Os10g0491000 [Oryza sativa Japonica Group]
 gb|AAG13552.1|AC023240_25 putative basic secretory protein [Oryza sativa Japonica Group]
 gb|AAP54394.1| secretory protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26840.1| Os10g0491000 [Oryza sativa Japonica Group]
 gb|EAZ16515.1| hypothetical protein OsJ_31987 [Oryza sativa Japonica Group]
 dbj|BAG94778.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87049.1| unnamed protein product [Oryza sativa Japonica Group]
Length=229

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 137/201 (68%), Gaps = 2/201 (1%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVDD  280
            Y V+N AA+T GG RF++  G  Y+KQVL AA++F W +F Q S  DR+ V  V + V D
Sbjct  27   YEVSNEAASTAGGQRFDREYGAGYAKQVLAAASSFTWSIFSQPSAADRRPVDAVVLAVRD  86

Query  281  MDGVAYASNNEIHVSARYINGYSG-DVKGEITGVLYHESTHIWQWngngaanggLI-EGI  454
            +DG+A  S N I + A Y+ G +G D K ++TGVLYHE  H+WQW          + EGI
Sbjct  87   VDGIASTSGNTITLGAGYVAGVTGNDFKTQVTGVLYHEVVHVWQWGLQDYGAHSWVYEGI  146

Query  455  ADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDS  634
            ADFVRL+AGY  + W +PG+G+ W+  Y VTARF DYC+ +K GFVA+LNAK+KNGY+  
Sbjct  147  ADFVRLRAGYPAAGWVQPGQGNSWEDSYSVTARFFDYCDSVKPGFVADLNAKLKNGYNVD  206

Query  635  YFSDILGKTVDQLWTDYKAKY  697
            YF  I GKTV QLW DYKAKY
Sbjct  207  YFVQITGKTVQQLWQDYKAKY  227



>gb|KCW55147.1| hypothetical protein EUGRSUZ_I01097 [Eucalyptus grandis]
Length=143

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 115/141 (82%), Gaps = 2/141 (1%)
 Frame = +2

Query  281  MDGVAYA--SNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGI  454
            M+GVAYA    NEIHVS+ YI  YSGDVK EITGVLYHE THIWQW  N  A  GL EGI
Sbjct  1    MEGVAYALIDTNEIHVSSEYIGNYSGDVKNEITGVLYHEMTHIWQWFANREAPTGLTEGI  60

Query  455  ADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDS  634
            ADFVRLKAGYAPSHW KPG+G+RWD GYDVTA FLDYC+ L +GFVA++N KMK GYS  
Sbjct  61   ADFVRLKAGYAPSHWVKPGQGNRWDQGYDVTAHFLDYCDGLLSGFVADMNKKMKTGYSPE  120

Query  635  YFSDILGKTVDQLWTDYKAKY  697
            YF ++LGKTVDQLW+DYKAKY
Sbjct  121  YFVELLGKTVDQLWSDYKAKY  141



>emb|CAA74593.1| hypothetical protein [Hordeum vulgare]
 dbj|BAJ89886.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   213 bits (543),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 141/204 (69%), Gaps = 4/204 (2%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRK--DVQKVSMFV  274
            + VTN A++T GG RF++  G  Y+KQVL  A++F W +F Q  P DR+  D   V++ V
Sbjct  24   FDVTNEASSTAGGQRFDREYGAAYAKQVLSDASSFTWGIFNQPDPSDRRPADGDTVTLAV  83

Query  275  DDMDGVAYASNNEIHVSARYINGYSGD-VKGEITGVLYHESTHIWQWngng-aanggLIE  448
             D +G+A  S + I +SAR + G +GD +K ++ GVLYHE  H+WQW       + G+ E
Sbjct  84   RDTNGIASTSGSTIELSARSVGGITGDNLKEQVDGVLYHEVVHVWQWGLQDYHEHHGIFE  143

Query  449  GIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYS  628
            GIAD+VRLKAGY  ++W K G G RWD GYDVTARFLDYC+  K GFVAE+N K+K+GY+
Sbjct  144  GIADYVRLKAGYVAANWVKEGGGSRWDEGYDVTARFLDYCDSRKPGFVAEMNGKLKDGYN  203

Query  629  DSYFSDILGKTVDQLWTDYKAKYN  700
            D YF  ILG + DQLW DYKAKY+
Sbjct  204  DDYFVQILGTSADQLWNDYKAKYS  227



>gb|EMS51254.1| hypothetical protein TRIUR3_34420 [Triticum urartu]
Length=146

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +2

Query  266  MFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLI  445
            M + D+ G A+ S N IH+SA+Y+ G SGDVK E TGVLYHE+TH+WQWNG G ANGGLI
Sbjct  1    MKLQDISGGAFTSANGIHLSAQYVGGISGDVKKEGTGVLYHEATHVWQWNGQGRANGGLI  60

Query  446  EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGY  625
            EGIAD+VRLKAG+AP HW KPG+GDRWD GYDVTARFLDYC+ LK GFVA+LNAKMK+GY
Sbjct  61   EGIADYVRLKAGFAPGHWVKPGQGDRWDQGYDVTARFLDYCDSLKPGFVAQLNAKMKSGY  120

Query  626  SDSYFSDILGKTVDQLWTDYKAKY  697
            +D +F+ ILGK V QLW DYKAK+
Sbjct  121  TDDFFAQILGKNVQQLWKDYKAKF  144



>ref|XP_010026882.1| PREDICTED: uncharacterized protein LOC104417274 [Eucalyptus grandis]
Length=220

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  305  NNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGY  484
            N+EIHVSA Y+ G+SGDVK E TGVLYHE TH+WQWNG G A GGLIEGIADFVRLK+GY
Sbjct  88   NDEIHVSATYLGGFSGDVKREFTGVLYHEMTHVWQWNGAGQAPGGLIEGIADFVRLKSGY  147

Query  485  APSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTV  664
            AP HW KPG+G+RWD GYDVTARFLDYCN  K GFVA LN KM+ GYSD+YF D+LGK+V
Sbjct  148  APGHWVKPGQGNRWDQGYDVTARFLDYCNGRKKGFVAALNKKMRTGYSDNYFVDLLGKSV  207

Query  665  DQLWTDYKAKYNT  703
            DQLW DYKAKY T
Sbjct  208  DQLWKDYKAKYAT  220



>ref|XP_011088738.1| PREDICTED: uncharacterized protein LOC105169882 [Sesamum indicum]
Length=249

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 151/224 (67%), Gaps = 3/224 (1%)
 Frame = +2

Query  35   RITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWR  214
             I L+  +L+  + + G  AV+YTVTNTA+NTPGG RF+  IG  ++ Q +    NFIW+
Sbjct  6    HIFLTYALLLSSSLLQGIVAVQYTVTNTASNTPGGMRFDTEIGVPFTLQTMGTINNFIWK  65

Query  215  VFQQNSPGDRKDVQKVSMFVDDM-DGVAYASNNEIHVSARYINGYS-GDVKGEITGVLYH  388
            +FQQ S   RK+V  +++++ D  D   Y + + I++SA  +  +  G  K E T ++YH
Sbjct  66   LFQQPSDSQRKNVPILNVYISDFNDAFGYTNGDNINISAIGLASFPPGRAKFEFTSLMYH  125

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYA-PSHWRKPGEGDRWDAGYDVTARFLDY  565
            E THI+QW+G G A GGL EGIAD+V +K+ Y  P  + KPGEG RWD GY VTARFL+Y
Sbjct  126  EMTHIFQWSGKGTAPGGLTEGIADYVMIKSTYYDPEGYTKPGEGGRWDEGYGVTARFLEY  185

Query  566  CNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            C+ L++GF  ELN KM+  Y D YF ++LGK + Q+W++YKAKY
Sbjct  186  CDSLRSGFTPELNNKMREVYKDEYFQELLGKPLPQVWSEYKAKY  229



>gb|EMS62515.1| hypothetical protein TRIUR3_15559 [Triticum urartu]
Length=234

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 150/232 (65%), Gaps = 9/232 (4%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRA-VEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANF  205
            M   T  L  L++ A +    A V +T  N A+ TPGG RF++  G  Y+ QV+  A+ F
Sbjct  1    MKHFTPVLASLLVVAGLATTAAGVRFTAMNNASTTPGGQRFDEEYGVGYAVQVMSEASFF  60

Query  206  IWRVFQQNSPGDRKDVQ--KVSMFVD--DMDGVAYASNNE--IHVSARYINGYSGDVKGE  367
             W++F Q +P DR+     +V + V+  + + +A+  ++E  I ++A Y+N  +GDV+  
Sbjct  61   TWKIFNQTAPEDRRAAMDDRVKLVVNFINTNILAFERDSESSITLNAGYVNNITGDVRTL  120

Query  368  ITGVLYHESTHIWQWngngaangg--LIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYD  541
            +TG+LYHE TH+WQW           + EG+ADFVRL+AGYA  +W +PG+GD WD GYD
Sbjct  121  VTGLLYHEVTHVWQWGQQDTNQTHSWIYEGMADFVRLRAGYAAPYWLQPGQGDSWDTGYD  180

Query  542  VTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            VTA FLDYC+ L+ GF+A LN ++K+GYSD  F  I+GK+V +LW DYKAKY
Sbjct  181  VTAWFLDYCDQLRPGFMAVLNQRLKDGYSDDDFLQIMGKSVQELWRDYKAKY  232



>gb|KDO59826.1| hypothetical protein CISIN_1g041464mg [Citrus sinensis]
Length=198

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 136/226 (60%), Gaps = 36/226 (16%)
 Frame = +2

Query  32   DRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIW  211
            D     L  L+   A+ G  AV+YTV+N AA TPGG RF   IG EY+        NFIW
Sbjct  3    DHSAFFLISLLTLTAMQGIHAVDYTVSNRAATTPGGMRFANEIGAEYT-------PNFIW  55

Query  212  RVFQQNSPGDRKDVQKVSMFVDDMDG--VAYASNNEIHVSARYINGYSGD-VKGEITGVL  382
            R+FQQN+  DRK++ +V +F+DDM    +A+ SNN IH    +I     D +K E +GV+
Sbjct  56   RLFQQNTEADRKNIPQVDLFIDDMKPGEIAFTSNNGIHYGDDFIQNIPVDLIKQEFSGVM  115

Query  383  YHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYD-VTARFL  559
            YHE TH                         A Y P  W KPGEG  W+ G+  V ARFL
Sbjct  116  YHEMTH-------------------------ANYVPEGWAKPGEGTMWNQGHSSVAARFL  150

Query  560  DYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            DYCNDL+NGFVAELN KM++GY+D++F ++LGK++DQLW DYKAKY
Sbjct  151  DYCNDLRNGFVAELNKKMRDGYNDNFFMELLGKSIDQLWNDYKAKY  196



>gb|EYU42702.1| hypothetical protein MIMGU_mgv1a022130mg [Erythranthe guttata]
Length=237

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 155/235 (66%), Gaps = 9/235 (4%)
 Frame = +2

Query  14   IAKTSMDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDA  193
            +AKT++  I L  C L++ + +    AV+Y VTN   NTPGG  FNQ IG  ++ Q + A
Sbjct  1    MAKTTL--IILLPCFLLVASLLPAIHAVKYIVTNNVPNTPGGIFFNQQIGVNFTIQTMGA  58

Query  194  AANFIWRVFQQNSPGDRKDVQKVSMFVDDMDG--VAYASNNEIHVSARYINGYSGDV---  358
            A  FIW+VF++N+P +RKDV  +++++ +  G  +AY + + I++SA  +  +   +   
Sbjct  59   ANQFIWKVFKENTPAERKDVPVINVYISEFPGPALAYTNGDNINISAPSLKDFCMPLSKA  118

Query  359  KGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKA--GYAPSHWRKPGEGDRWDA  532
            K + +G++YHE TH++QW+GN  A GGL EG AD+V +K+   Y  + + KPG G +WD 
Sbjct  119  KFKFSGLMYHEMTHLFQWSGNRTAPGGLTEGTADYVMVKSTFNYDKNTYTKPGSGSKWDE  178

Query  533  GYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            GY VT RFL+YC+ LK GF A+LN  M+  YSD YF  +LGK ++QLW +YKAKY
Sbjct  179  GYGVTERFLEYCDSLKLGFTADLNKMMRYAYSDDYFMKLLGKPLNQLWKEYKAKY  233



>gb|EYU37621.1| hypothetical protein MIMGU_mgv1a026144mg [Erythranthe guttata]
Length=232

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 140/205 (68%), Gaps = 1/205 (0%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AV+Y   N A  TPGG+RF   IG  Y++ ++     FIW +F+Q S  DRK V+ V +F
Sbjct  27   AVKYQAINAAKTTPGGSRFESEIGIPYTQSIMRTINFFIWDMFKQYSGADRKKVETVKVF  86

Query  272  VDDMDGV-AYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIE  448
            +   DG  A    + I+VS+ Y+ GY GD+K E T +L+HE TH++QW+G G A  GL E
Sbjct  87   IHQYDGAEAIMYGDTINVSSIYLQGYQGDLKWEFTSLLHHEMTHVFQWDGEGRAPIGLSE  146

Query  449  GIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYS  628
            G+AD++ LK+ Y P+ + KPG GD+WD GYD TARFL+YC + K+GFVA+LN  M+  YS
Sbjct  147  GMADYMILKSNYYPAGFAKPGTGDKWDQGYDFTARFLEYCEETKSGFVAQLNKMMRFNYS  206

Query  629  DSYFSDILGKTVDQLWTDYKAKYNT  703
            D YF ++ GK V QLW++YKAKY++
Sbjct  207  DDYFFELTGKPVGQLWSEYKAKYSS  231



>ref|XP_006661892.1| PREDICTED: uncharacterized protein LOC102706968 [Oryza brachyantha]
Length=227

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 132/206 (64%), Gaps = 3/206 (1%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AV Y V N A++T GG RF++  G +Y+KQVL  A++F W +F Q SP DR  V  V + 
Sbjct  21   AVTYEVNNAASSTAGGQRFDREYGGDYAKQVLAGASSFTWSIFNQPSPADRSPVDAVILT  80

Query  272  VDDMDGVAYASNNEIHVSARYINGYSG-DVKGEITGVLYHESTHIWQWngngaanggLI-  445
            V D+ G+A    N I + A Y+ G +G D K ++TGVLYHE  H+WQ       +   + 
Sbjct  81   VGDVGGIASTDRNNITLGAGYVAGITGNDFKDQVTGVLYHEVVHVWQAGLQDYGSHPWVY  140

Query  446  EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCN-DLKNGFVAELNAKMKNG  622
            EGIADFVRLKAGY  + W +PG+G  W+ GY VTARF DYC+  +K GFVA LNAK+K G
Sbjct  141  EGIADFVRLKAGYIAAGWAQPGQGGSWEEGYSVTARFFDYCDGSVKPGFVAGLNAKLKGG  200

Query  623  YSDSYFSDILGKTVDQLWTDYKAKYN  700
            Y   YF  I GKT+ QLW DYKA Y 
Sbjct  201  YDADYFVQITGKTLQQLWQDYKAMYG  226



>gb|EPS57342.1| hypothetical protein M569_17476, partial [Genlisea aurea]
Length=123

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +2

Query  329  RYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKP  508
            RYI GYSGDV+ E TGV++HE+THIWQWNGNG   GGLIEGIADFVRL+AGYAP HW +P
Sbjct  1    RYIGGYSGDVRTEFTGVIFHETTHIWQWNGNGQTPGGLIEGIADFVRLRAGYAPGHWVQP  60

Query  509  GEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYK  688
            G+G+RWD GYDVTARFLDYCN L+NGFVAELNAKM+ GYSDSYF D+LGK  DQL+ DYK
Sbjct  61   GQGNRWDQGYDVTARFLDYCNGLRNGFVAELNAKMRGGYSDSYFVDLLGKLPDQLFRDYK  120

Query  689  AKY  697
            A Y
Sbjct  121  ASY  123



>gb|EMT28762.1| hypothetical protein F775_43050 [Aegilops tauschii]
Length=245

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 138/202 (68%), Gaps = 8/202 (4%)
 Frame = +2

Query  110  TNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQ--KVSMFVD--  277
            TN A+ TPGG RF++  G  Y+ QV+  A+ F+W++F Q +P DR+     +V + V+  
Sbjct  5    TNNASTTPGGQRFDEEYGVGYAVQVMSEASFFVWKIFNQTAPEDRRAAMDDRVKLVVNFI  64

Query  278  DMDGVAYASNNE--IHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaangg--LI  445
            + + +A+  ++E  I ++A Y+N  +GDV+  +TG+LYHE TH+WQW           + 
Sbjct  65   NTNILAFERDSESSITLNAGYVNNITGDVRTLVTGLLYHEVTHVWQWGQQDTNQTHSWIY  124

Query  446  EGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGY  625
            EG+ADFVRL+AGYA  +W +PG+GD WD GYDVTA FLDYC+ L+ GFVA LN ++K+GY
Sbjct  125  EGVADFVRLRAGYAAPYWLQPGQGDSWDTGYDVTAWFLDYCDQLRPGFVAVLNQRLKDGY  184

Query  626  SDSYFSDILGKTVDQLWTDYKA  691
            SD  F  I+GK+V +LW DYKA
Sbjct  185  SDDDFLQIMGKSVQELWRDYKA  206



>ref|XP_002467028.1| hypothetical protein SORBIDRAFT_01g018500 [Sorghum bicolor]
 gb|EER94026.1| hypothetical protein SORBIDRAFT_01g018500 [Sorghum bicolor]
Length=195

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 121/163 (74%), Gaps = 4/163 (2%)
 Frame = +2

Query  218  FQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHEST  397
            F Q S  DR+ V  V++ V+D+ GVA+  +++IH+SA+Y+ GY   V G++TGVLYHE  
Sbjct  36   FNQPSACDRRPVDAVTLVVEDIGGVAFTVSSDIHLSAQYVGGY---VSGDVTGVLYHEVV  92

Query  398  HIWQWngn-gaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
             +WQW      A+ G+ EGIADFVRLKAG+AP HW + G+G+RWD GYDVTARFLDYC+ 
Sbjct  93   DVWQWGLQDYGAHPGIFEGIADFVRLKAGFAPGHWVQQGQGNRWDQGYDVTARFLDYCDS  152

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYNT  703
            LK GFVA LNAK+K+GY + YF  ILGK V QLW DYKAKY +
Sbjct  153  LKPGFVALLNAKLKDGYDEDYFLQILGKNVQQLWQDYKAKYGS  195



>ref|XP_002973863.1| hypothetical protein SELMODRAFT_100635 [Selaginella moellendorffii]
 gb|EFJ24818.1| hypothetical protein SELMODRAFT_100635 [Selaginella moellendorffii]
Length=222

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 139/222 (63%), Gaps = 3/222 (1%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            +++ +LI+ A     +    T  NT   +PGG RF+ V+G + +  +L  A  F+   F+
Sbjct  1    MAIFLLIILATFQVTQGTSITGANTTPESPGGQRFDSVMGVDGALSILADAMAFVQLGFE  60

Query  224  QNSP-GDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTH  400
              SP   +K++  +   VDDM GVAYA   EIH+SA+++  ++GD+  E+ GVLYHE TH
Sbjct  61   YMSPDTPKKEIDTIHFTVDDMPGVAYAIGVEIHLSAQFVATFTGDLVFELRGVLYHEMTH  120

Query  401  IWQW--ngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            IWQW       A  GLIEGIADF+RLKA    S     G G  WD GY VTA FL+Y ND
Sbjct  121  IWQWFGKEGSRAPQGLIEGIADFMRLKAKLGVSSNGFVGSGSHWDEGYTVTALFLNYVND  180

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            L   FVAELN K+ +G+S+SYF D+ GK+VDQLW+DYK K+ 
Sbjct  181  LHPSFVAELNKKLYDGWSESYFQDLTGKSVDQLWSDYKQKFQ  222



>ref|XP_002974051.1| hypothetical protein SELMODRAFT_100633 [Selaginella moellendorffii]
 gb|EFJ25006.1| hypothetical protein SELMODRAFT_100633 [Selaginella moellendorffii]
Length=222

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 140/222 (63%), Gaps = 3/222 (1%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            +++ +LI+ A     +    T  NT   +PGG RFN V+G + +  +L  A  F+   F+
Sbjct  1    MAIFLLIILATFQVTQGTSITGANTTPESPGGQRFNSVMGVDGALSILADAMAFVQLGFE  60

Query  224  QNSP-GDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTH  400
              SP   +K++  +   VDDM GVAYA   EIH+SA+++  ++GD+  E+ GVLYHE TH
Sbjct  61   YRSPDTPKKEIDTIHFTVDDMAGVAYAIGVEIHLSAQFVATFTGDLVFELRGVLYHEMTH  120

Query  401  IWQWngn--gaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            IWQW G     A  GLIEGIADF+RLKA    S     G G  WD GY VTA FL+Y ND
Sbjct  121  IWQWFGKDGSRAPQGLIEGIADFMRLKAKLGVSTNGFVGSGSHWDEGYTVTALFLNYVND  180

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            L   FVAELN K+ +G+S++YF D+ GK+VDQLW+DYK K+ 
Sbjct  181  LHPSFVAELNKKLYDGWSENYFQDLTGKSVDQLWSDYKQKFQ  222



>ref|XP_002973864.1| hypothetical protein SELMODRAFT_100667 [Selaginella moellendorffii]
 gb|EFJ24819.1| hypothetical protein SELMODRAFT_100667 [Selaginella moellendorffii]
Length=232

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 142/227 (63%), Gaps = 3/227 (1%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M R    L ILI  A     +A   T TNT   +PGG RF+ ++G   +  +L  A  F+
Sbjct  1    MARFLRFLIILIRLATSQVTQATSITGTNTTPESPGGQRFDSIMGVNGALSILYDAMAFV  60

Query  209  WRVFQQNSPG-DRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLY  385
               F+  +P   +K+V  +   VDD  GVAYA+  EIH+SA+Y+   +G++  E+TG+LY
Sbjct  61   QLGFEYENPDMPKKEVDAIHFTVDDKPGVAYATGVEIHLSAQYVATLTGNMVRELTGILY  120

Query  386  HESTHIWQWngngaa--nggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFL  559
            HE THIWQW+G   +    GLIEGIADF+RLKA    S     G G+ WD GY VTA FL
Sbjct  121  HEMTHIWQWHGKEGSWPPQGLIEGIADFMRLKAKLGVSGNGFVGSGNHWDEGYAVTALFL  180

Query  560  DYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            +Y NDL   FVAELN K+ +G+S+SYF D+ GK+VDQLW DYK K++
Sbjct  181  NYVNDLHPSFVAELNKKLYDGWSESYFQDLTGKSVDQLWNDYKQKFH  227



>ref|XP_006409600.1| hypothetical protein EUTSA_v10023033mg, partial [Eutrema salsugineum]
 gb|ESQ51053.1| hypothetical protein EUTSA_v10023033mg, partial [Eutrema salsugineum]
Length=154

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = +2

Query  242  RKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngn  421
            R+   K+SM +++ +GVAY+S +EIH +  ++ G +GDV+ E TGV+YHE  H WQWNG 
Sbjct  1    RRSTPKISMVMENGNGVAYSSQDEIHFNVGHLAGVAGDVRREFTGVVYHEVVHSWQWNGA  60

Query  422  gaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAEL  601
            G A  GL+EGIA+FVRLKAGYAP +W  PG G+RWD  Y+VT RFLDYCNDL+NG VAEL
Sbjct  61   GQAPSGLVEGIAEFVRLKAGYAPGYWVGPGRGNRWDECYEVTMRFLDYCNDLRNGLVAEL  120

Query  602  NAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            N  M +GYS+ +F D+LGK V+QLW +Y+AKY
Sbjct  121  NKMMWSGYSNGFFVDLLGKDVNQLWREYEAKY  152



>ref|XP_002983439.1| hypothetical protein SELMODRAFT_118325 [Selaginella moellendorffii]
 gb|EFJ15340.1| hypothetical protein SELMODRAFT_118325 [Selaginella moellendorffii]
Length=222

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 138/222 (62%), Gaps = 3/222 (1%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            +++ +L + A     +    T  NT   +PGG RF+ V+G + +  +L  A  F+   F+
Sbjct  1    MAIFLLSILATFQVTQGTSITGANTTPESPGGQRFDSVMGVDGALSILADAMAFVQLGFE  60

Query  224  QNSP-GDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTH  400
              SP   +K++  +   VDDM GVAYA   EIH+SA+++  ++GD+  E+ GVLYHE TH
Sbjct  61   YMSPDTPKKEIDTIHFTVDDMPGVAYAIGVEIHLSAQFVATFTGDLVFELRGVLYHEMTH  120

Query  401  IWQWngn--gaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            IWQW G     A  GLIEGIADF+RLKA    S     G G  WD GY VTA FL+Y ND
Sbjct  121  IWQWFGKDGSRAPQGLIEGIADFMRLKAKLGVSTNGFVGSGSHWDEGYTVTALFLNYVND  180

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            L   FVAELN K+ +G+S+ YF D+ GK+VDQLW+DYK K+ 
Sbjct  181  LHPSFVAELNKKLYDGWSEGYFQDLTGKSVDQLWSDYKQKFQ  222



>ref|XP_002983536.1| hypothetical protein SELMODRAFT_118618 [Selaginella moellendorffii]
 gb|EFJ15437.1| hypothetical protein SELMODRAFT_118618 [Selaginella moellendorffii]
Length=222

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 139/222 (63%), Gaps = 3/222 (1%)
 Frame = +2

Query  44   LSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQ  223
            +++ +LI+ A     +    T  NT   +PGG RF+ V+G + +  +L  A  F+   F+
Sbjct  1    MAIFLLIILATFQVTQGTSITGANTTPESPGGQRFDSVMGVDGALSILADAMAFVQLGFE  60

Query  224  QNSP-GDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTH  400
              SP   +K++  +   VD M GVAYA   EIH+SA+++  ++GD+  E+ GVLYHE TH
Sbjct  61   YMSPDTPKKEIDTIHFTVDGMPGVAYAIGVEIHLSAQFVATFTGDLVFELRGVLYHEMTH  120

Query  401  IWQWngn--gaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            IWQW G     A  GLIEGIADF+RLKA    S     G G  WD GY VTA FL+Y ND
Sbjct  121  IWQWFGKDGSRAPQGLIEGIADFMRLKAKLGVSTNGFVGLGSHWDEGYTVTALFLNYVND  180

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            L   FVAELN K+ +G+S+SYF D++ K+VDQLW+D+K K+ 
Sbjct  181  LHPSFVAELNKKLYDGWSESYFQDLIRKSVDQLWSDFKQKFQ  222



>gb|EMS65358.1| hypothetical protein TRIUR3_33397 [Triticum urartu]
Length=313

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 121/172 (70%), Gaps = 4/172 (2%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRK--DVQKVS  265
            AV + VTN A++T GG RF+Q  G +Y+KQVL  A++F W +F Q  P DR+  D   V+
Sbjct  18   AVTFDVTNEASSTAGGQRFDQEYGADYAKQVLSDASSFTWGIFNQPDPSDRRPADGDTVT  77

Query  266  MFVDDMDGVAYASNNEIHVSARYINGYSGD-VKGEITGVLYHESTHIWQWngng-aangg  439
            + V D DG+A  S + + +SARY+ G +GD +K ++TGVLYHE  H+WQW      A+ G
Sbjct  78   LAVRDTDGIAATSGSTVELSARYVGGITGDDLKEQVTGVLYHEVAHVWQWGLQDYGAHSG  137

Query  440  LIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVA  595
            + EGIAD+VRLKAGY P HW K G GDRWD GYDVTARFLDYC+ LK GFVA
Sbjct  138  VFEGIADYVRLKAGYVPGHWVKEGGGDRWDQGYDVTARFLDYCDSLKPGFVA  189



>gb|EYU42703.1| hypothetical protein MIMGU_mgv1a026133mg [Erythranthe guttata]
Length=231

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 140/208 (67%), Gaps = 6/208 (3%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AV+Y VTN   NTPGG  F+Q IG +++ Q + AA  FIWRVF+Q +P + K V  V+++
Sbjct  20   AVKYIVTNNVQNTPGGIFFDQQIGVDFTIQTMGAANQFIWRVFKQRTPDEIKYVPVVNVY  79

Query  272  VDDMDG--VAYASNNEIHVSARYINGYSGDV---KGEITGVLYHESTHIWQWngngaang  436
            + +  G  +AY + + I++SA  +  +   +   K + +G++YHE TH++QW+GN  A G
Sbjct  80   ISEFPGPALAYTNGDNINISASSLKDFCMPLEKAKFKFSGLMYHEMTHLFQWSGNRTAPG  139

Query  437  gLIEGIADFVRLKAG-YAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
            GL EG AD+V +++  Y    + KPG G+RWD GY VT RFL+YC+ L+ GF A+LN  M
Sbjct  140  GLTEGTADYVMVRSNFYDKDTYTKPGTGNRWDEGYGVTERFLEYCDSLRLGFTADLNKMM  199

Query  614  KNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +  YSD+YF  +LGKTVDQLW +YKA Y
Sbjct  200  RYEYSDNYFVQLLGKTVDQLWGEYKAMY  227



>ref|XP_002983442.1| hypothetical protein SELMODRAFT_118519, partial [Selaginella 
moellendorffii]
 gb|EFJ15343.1| hypothetical protein SELMODRAFT_118519, partial [Selaginella 
moellendorffii]
Length=215

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 129/201 (64%), Gaps = 3/201 (1%)
 Frame = +2

Query  104  TVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSP-GDRKDVQKVSMFVDD  280
            T  NT   +PGG RF+ V+G + +  +L  A  F+   F+  SP   +K++  +   VD 
Sbjct  1    TGANTTPESPGGQRFDSVMGVDGALSILADAMAFVQLGFEYMSPDTPKKEIDTIHFTVDG  60

Query  281  MDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngn--gaanggLIEGI  454
            M GVAYA   EIH+SA+++  ++GD+  E+ GVLYHE THIWQW G     A  GLIEGI
Sbjct  61   MPGVAYAIGVEIHLSAQFVATFTGDLVFELRGVLYHEMTHIWQWFGKDGSRAPQGLIEGI  120

Query  455  ADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDS  634
            ADF+RLKA    S     G G  WD GY VTA FL+Y NDL   FVAELN K+ +G+S++
Sbjct  121  ADFMRLKAKLGVSTNGFVGSGSHWDEGYTVTALFLNYVNDLYPSFVAELNKKLYDGWSEN  180

Query  635  YFSDILGKTVDQLWTDYKAKY  697
            YF D+ GK+VDQLW+DYK  +
Sbjct  181  YFQDLTGKSVDQLWSDYKLNF  201



>ref|XP_011088737.1| PREDICTED: uncharacterized protein LOC105169881 [Sesamum indicum]
Length=175

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = +2

Query  203  FIWRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNE-IHVSARYINGYSGDVKGEITGV  379
            FIW + QQ S  +RK+V+ V +F+   DG    +  E I+VSA Y+ GY G++K E T +
Sbjct  7    FIWDILQQYSGSNRKNVRVVKLFIHQFDGAEGITYGEMINVSAIYLAGYKGNLKWEFTSL  66

Query  380  LYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFL  559
            L+HE TH++QWNG G    GL+EGIAD++ LK+GY P  + KPG+G+RWD GYD TARFL
Sbjct  67   LHHEMTHVFQWNGEGHTPVGLVEGIADYMILKSGYYPPGFAKPGQGERWDQGYDFTARFL  126

Query  560  DYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +YC+ LK+GFVAELN  M++ YS+ YF ++ GK V QLW DYKA Y
Sbjct  127  EYCDGLKSGFVAELNKMMRHNYSEDYFVELTGKPVGQLWADYKAMY  172



>ref|NP_001118322.1| basic secretory protein family protein [Arabidopsis thaliana]
 gb|AAP21676.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06372.1| basic secretory protein family protein [Arabidopsis thaliana]
Length=144

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +2

Query  272  VDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEG  451
            +++ +G+AY+S +EIH +A  +    G V+   TGV+YHE  H WQWNG G A GGLIEG
Sbjct  1    MENSNGIAYSSQDEIHYNAGSLVDDKGYVRRGFTGVVYHEVVHSWQWNGAGRAPGGLIEG  60

Query  452  IADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSD  631
            IAD+VRLKAGY  SHW +PG GDRWD GYDVTARFL+YCNDL+NGFVAELN KM++ Y+D
Sbjct  61   IADYVRLKAGYVASHWVRPGGGDRWDQGYDVTARFLEYCNDLRNGFVAELNKKMRSDYND  120

Query  632  SYFSDILGKTVDQLWTDYKAKY  697
             +F D+LGK V+QLW +YKA Y
Sbjct  121  GFFVDLLGKDVNQLWREYKANY  142



>gb|EMS45730.1| hypothetical protein TRIUR3_05357 [Triticum urartu]
Length=409

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 116/170 (68%), Gaps = 4/170 (2%)
 Frame = +2

Query  143  RFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRK--DVQKVSMFVDDMDGVAYASNNEI  316
            RF++  G  Y+KQVL  A++F W +F Q  P DR+  D   V++ V D DG+A  S + I
Sbjct  75   RFDREYGAAYAKQVLSDASSFTWGIFNQPDPSDRRPADGDTVTLAVRDTDGIASTSGSTI  134

Query  317  HVSARYINGYSGD-VKGEITGVLYHESTHIWQWngngaangg-LIEGIADFVRLKAGYAP  490
             +SAR + G +GD +K ++ GVLYHE  H+WQW          + EGIAD+VRLKAGY  
Sbjct  135  QLSARSVGGITGDNLKEQVDGVLYHEVAHVWQWGLQEYGAHSGIFEGIADYVRLKAGYVA  194

Query  491  SHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYF  640
            ++W K G GDRWD GYDVTARFLDYC+ LK GFVAE+N K+K+GYSD YF
Sbjct  195  ANWVKEGGGDRWDQGYDVTARFLDYCDSLKAGFVAEMNGKLKDGYSDDYF  244



>ref|XP_007214050.1| hypothetical protein PRUPE_ppa017454mg, partial [Prunus persica]
 gb|EMJ15249.1| hypothetical protein PRUPE_ppa017454mg, partial [Prunus persica]
Length=118

 Score =   165 bits (418),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  350  GDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWD  529
            GD+K +  GV  HE TH WQWNG G A  GLIEGIA FVRLKA Y P+ W K GEG RWD
Sbjct  1    GDIKTDFIGVFCHEMTHTWQWNGQGQAPVGLIEGIAHFVRLKADYVPNGWVKSGEGQRWD  60

Query  530  AGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
             GY VTARFLDYCNDL+ GFVAELN KM++GYSD++F ++LGKTVDQLWTDYKA++
Sbjct  61   EGYLVTARFLDYCNDLQQGFVAELNKKMRDGYSDNFFQELLGKTVDQLWTDYKARF  116



>gb|EEE51183.1| hypothetical protein OsJ_31986 [Oryza sativa Japonica Group]
Length=172

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 117/202 (58%), Gaps = 47/202 (23%)
 Frame = +2

Query  101  YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ-NSPGDRKDVQKVSMFVD  277
            +  TNTA+NT GG R    +G +Y+KQ+L  A++FIW  F+Q    GDRK V  V++ V+
Sbjct  13   FDATNTASNTAGGQRSTGRVGVDYAKQMLADASSFIWDTFEQPGDGGDRKPVDAVTLTVE  72

Query  278  DMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIA  457
            D+DGVA+ S + IH+SARY+ GYS                                   A
Sbjct  73   DIDGVAFTSGDGIHLSARYVGGYS----------------------------------AA  98

Query  458  DFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND--LKNGFVAELNAKMKNGYSD  631
              VR K          PG+GDRWD GYDVTARFLDYC+   +  GFVA+LN KMK+GYSD
Sbjct  99   GNVRAK----------PGQGDRWDQGYDVTARFLDYCDSPAVVQGFVAQLNGKMKDGYSD  148

Query  632  SYFSDILGKTVDQLWTDYKAKY  697
             +F  I GKT+DQLW DYKAKY
Sbjct  149  DFFVQISGKTIDQLWQDYKAKY  170



>ref|XP_002990552.1| hypothetical protein SELMODRAFT_131787 [Selaginella moellendorffii]
 gb|EFJ08429.1| hypothetical protein SELMODRAFT_131787 [Selaginella moellendorffii]
Length=161

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 105/155 (68%), Gaps = 2/155 (1%)
 Frame = +2

Query  242  RKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW--n  415
            +K++  +   VDDM GVAYA   EIH+SA+++  ++GD+  E+  VLYHE THIWQW   
Sbjct  7    KKEIDTIHFTVDDMPGVAYAIGVEIHLSAQFVATFTGDLVFELLSVLYHEMTHIWQWFGK  66

Query  416  gngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVA  595
                A  GLIEGIADF+RLKA    S     G G  WD GY VTA FL+Y NDL   FVA
Sbjct  67   EGSRAPQGLIEGIADFMRLKAKLGVSTNGFVGSGSHWDEGYTVTALFLNYVNDLHPSFVA  126

Query  596  ELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            ELN K+ +G+S+SYF D+ GK+VDQLW+DYK K+ 
Sbjct  127  ELNKKLYDGWSESYFQDLTGKSVDQLWSDYKQKFQ  161



>emb|CBI22517.3| unnamed protein product [Vitis vinifera]
Length=104

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            THIWQWNGNG A GGLIEGIADFVRLKA YAPSHW +PG+GDRWD GYDVTARFLDYCN 
Sbjct  2    THIWQWNGNGQAPGGLIEGIADFVRLKANYAPSHWVQPGQGDRWDQGYDVTARFLDYCNS  61

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            L+NGFVAELN KM++GYS  +F ++L   VDQLWTDYKAKY
Sbjct  62   LRNGFVAELNKKMRSGYSADFFVELLRNNVDQLWTDYKAKY  102



>ref|XP_002976187.1| hypothetical protein SELMODRAFT_104167 [Selaginella moellendorffii]
 gb|EFJ23092.1| hypothetical protein SELMODRAFT_104167 [Selaginella moellendorffii]
Length=238

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 122/206 (59%), Gaps = 17/206 (8%)
 Frame = +2

Query  113  NTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPG-DRKDVQKVSMFVDDMD-  286
            N A +T GG RFN V+G   + +VL  A NFI  +      G   K V KV   V+    
Sbjct  37   NNAEDTDGGKRFNSVMGISGAFKVLGDAINFIPSLLHYGLDGVPTKLVTKVVFTVEKQLQ  96

Query  287  --------GVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggL  442
                    G       +I  +A   + Y G     I GV+YHE  H+WQ+ G G  +G +
Sbjct  97   QGAVAITFGTGSPGEFQIQFNAPSADNYEG-----IKGVIYHEMAHVWQYFGQGTPSG-V  150

Query  443  IEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNG  622
             EG+AD+VRLKAG APSHW KPG GDRWD GYDVTA F DYCN L+  FV ++NA++ NG
Sbjct  151  TEGVADYVRLKAGLAPSHWVKPGGGDRWDQGYDVTAYFFDYCNSLRGDFVWQINARLANG  210

Query  623  -YSDSYFSDILGKTVDQLWTDYKAKY  697
             +S+S FSD+LGK+V  LWTDYK KY
Sbjct  211  AWSESVFSDLLGKSVQDLWTDYKNKY  236



>ref|XP_002968192.1| hypothetical protein SELMODRAFT_89504 [Selaginella moellendorffii]
 gb|EFJ30446.1| hypothetical protein SELMODRAFT_89504 [Selaginella moellendorffii]
Length=238

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 122/206 (59%), Gaps = 17/206 (8%)
 Frame = +2

Query  113  NTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPG-DRKDVQKVSMFVDDMD-  286
            N A +T GG RFN V+G   + +VL  A NFI  +      G   K V KV   V+    
Sbjct  37   NNAEDTDGGKRFNSVMGISGAFKVLGDAINFIPPLLHYGLDGVPTKLVTKVVFTVEKQLQ  96

Query  287  --------GVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggL  442
                    G       +I  +A   + Y G     I GV+YHE  H+WQ+ G G  +G +
Sbjct  97   QGAVAITFGTGSPGEFQIQFNAPSADNYEG-----IKGVIYHEMAHVWQYFGQGTPSG-V  150

Query  443  IEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNG  622
             EG+AD+VRLKAG APSHW KPG GDRWD GYDVTA F DYCN L+  FV ++NA++ NG
Sbjct  151  TEGVADYVRLKAGLAPSHWVKPGGGDRWDQGYDVTAYFFDYCNSLRGDFVWQMNARLANG  210

Query  623  -YSDSYFSDILGKTVDQLWTDYKAKY  697
             +S+S FSD+LGK+V  LWTDYK KY
Sbjct  211  AWSESVFSDLLGKSVQDLWTDYKNKY  236



>gb|KCW45368.1| hypothetical protein EUGRSUZ_L00955 [Eucalyptus grandis]
Length=207

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 125/222 (56%), Gaps = 26/222 (12%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M R       L+   A     AV+Y V +      G  RF   IG  Y++Q++ AA++FI
Sbjct  1    MSRTHFLGVALLFLVAFPPAHAVKYRVVDRTGYITGCNRFKTEIGSFYTRQLMRAASSFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            W  F + S G+RKD  +V++                      I+G+    +     +L+H
Sbjct  61   WLTFNE-SIGERKDHDQVTLV---------------------IHGFQWSFRK----ILFH  94

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E TH+WQ  GNG A  GL+ GIAD++RL+AG AP  W + G G RWD  Y V A FLD+C
Sbjct  95   EMTHVWQQYGNGKAPRGLVNGIADYMRLRAGLAPKKWAQRGSGLRWDESYAVMAYFLDHC  154

Query  569  NDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAK  694
            N LKNGFVAELN+ M++ YSD +FS +LGKTVD+ W DYK +
Sbjct  155  NGLKNGFVAELNSLMEDDYSDEFFSVMLGKTVDEFWMDYKTE  196



>ref|XP_010058923.1| PREDICTED: uncharacterized protein LOC104446815 [Eucalyptus grandis]
Length=230

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 131/227 (58%), Gaps = 9/227 (4%)
 Frame = +2

Query  29   MDRITLSLCILILGAAI---HGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAA  199
            M  + L L  + +  A+      R     V +  +NTP   RF   IG E++ + L  A+
Sbjct  1    MRPLKLFLLFIFVFVALKPTQEARDFICVVLDNTSNTPCN-RFKDEIGSEFAVETLSTAS  59

Query  200  NFIWRVFQQNSPGDR---KDVQKVSMFVDDMDGVAYASNN--EIHVSARYINGYSGDVKG  364
            +F+   F Q++ G R     +  +  FV +      A+NN  +  V A Y+  Y GDVK 
Sbjct  60   DFVLETFNQSNGGGRGYSTVLVIIESFVANGYPPTIATNNGNQFRVDADYLQAYVGDVKA  119

Query  365  EITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDV  544
            E  G++YHES  +WQW G+  A  GLI GIAD++RL AG+   +W   G G RWD GY V
Sbjct  120  EFMGIVYHESARVWQWTGSDTAPIGLITGIADYIRLNAGWPSKYWPPRGSGSRWDDGYAV  179

Query  545  TARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDY  685
            TA FL++C+  + GFV++LNA M++ +SD++F  +LG++VD+LW +Y
Sbjct  180  TAYFLEFCSGKRRGFVSDLNAMMESLHSDAFFVILLGQSVDELWEEY  226



>ref|XP_007042550.1| Plant basic secretory protein (BSP) family protein [Theobroma 
cacao]
 gb|EOX98381.1| Plant basic secretory protein (BSP) family protein [Theobroma 
cacao]
Length=280

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 109/167 (65%), Gaps = 9/167 (5%)
 Frame = +2

Query  221  QQNSP-GDRKD-VQKVSMFVDDM---DGVAYASNNEIHVSARYINGYSGD-VKGEITGVL  382
            QQN P  D+K+ +  VS+ V D       A  S N I V+ ++I  +SGD +K E  GVL
Sbjct  111  QQNDPRADKKNNILIVSLNVVDTLPPQIPAVTSGNMIQVTDKHIEAFSGDQLKPEFNGVL  170

Query  383  YHESTHIWQWn---gngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTAR  553
            YHE  H+WQW+          GLIEGIADFV+LKA Y P+ W +PG+GD+W  GY VTAR
Sbjct  171  YHEMNHVWQWDGNGQQDKTLRGLIEGIADFVKLKANYVPAGWVQPGKGDKWYDGYSVTAR  230

Query  554  FLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAK  694
            FLD C  L+ GFVAELN  MK+GYS  +F  +L KTVDQLW+DYK +
Sbjct  231  FLDNCEGLRTGFVAELNRMMKDGYSTDFFFQLLDKTVDQLWSDYKNQ  277



>gb|KCW73984.1| hypothetical protein EUGRSUZ_E02597, partial [Eucalyptus grandis]
Length=217

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 116/186 (62%), Gaps = 5/186 (3%)
 Frame = +2

Query  143  RFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDR---KDVQKVSMFVDDMDGVAYASNN-  310
            RF   IG  ++ + L  A++F+   F Q + G R     +  +  FV +      A+NN 
Sbjct  12   RFKNEIGSIFALETLSTASDFVLETFNQTNGGGRGYSTVLAIIESFVANGYPPTIATNNG  71

Query  311  -EIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYA  487
             +  V+A Y+  Y GDVK E TG++YHES  +WQW G+  A  GLI GIAD++RL AG+ 
Sbjct  72   NQFRVNADYLQAYVGDVKAEFTGIVYHESARVWQWTGSDTAPIGLITGIADYIRLNAGWP  131

Query  488  PSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVD  667
              +W   G G RWD GY VTA FL++C+  + GFV+ LNA M++ YSD++F+ +LG++VD
Sbjct  132  SKYWPPRGSGSRWDDGYAVTAYFLEFCSGKRRGFVSGLNAMMESLYSDAFFAILLGQSVD  191

Query  668  QLWTDY  685
            +LW +Y
Sbjct  192  ELWEEY  197



>gb|AFV29735.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29737.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29739.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29741.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29743.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29747.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29749.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29751.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29755.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29757.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29759.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29761.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29763.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29765.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29767.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29770.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29771.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29773.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29775.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29781.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29783.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29787.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29790.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29791.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29793.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29795.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29799.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29802.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
Length=203

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 122/195 (63%), Gaps = 8/195 (4%)
 Frame = +2

Query  98   EYTVTNTAANTPGGARFNQVIG-EEYSKQVLDAAANFI-WRVFQQNSPGDRK--DVQKVS  265
            +Y V N    +PGG +F+++IG   Y+K++L     F+   +FQQ +P +++  +   V 
Sbjct  8    KYDVVNVDPKSPGGIKFDKIIGGVPYTKELLGKINKFVVLTLFQQTNPEEQRKHESDTVH  67

Query  266  MFVDDMDGVAYAS--NNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW--ngngaan  433
            + + D  G    S  NN+I+VSA Y++GY GD+K E T ++YHE TH+  W  N    + 
Sbjct  68   ISIKDFIGTEAVSYMNNKINVSAVYLDGYRGDLKWEFTSLMYHEFTHLLSWYGNQASPSP  127

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
              + EGIAD+  LKA Y P  + KPG GD+WD GYD TARF +YC+ +  GFVA+LN KM
Sbjct  128  SAVQEGIADYAILKANYFPPAFAKPGSGDKWDQGYDFTARFFEYCDSITPGFVAKLNKKM  187

Query  614  KNGYSDSYFSDILGK  658
            K+ ++ ++F +I GK
Sbjct  188  KDTFNVNFFKEITGK  202



>gb|AFV29754.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29777.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29780.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29786.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29797.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
Length=203

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 122/195 (63%), Gaps = 8/195 (4%)
 Frame = +2

Query  98   EYTVTNTAANTPGGARFNQVIG-EEYSKQVLDAAANFI-WRVFQQNSPGDRK--DVQKVS  265
            +Y V N    +PGG +F+++IG   Y+K++L     F+   +FQQ +P +++  +   V 
Sbjct  8    KYDVVNVDPKSPGGIKFDKIIGGVPYTKELLGKINKFVVLTLFQQTNPEEQRKHESDTVH  67

Query  266  MFVDDMDGVAYAS--NNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW--ngngaan  433
            + + D  G    S  NN+I+VSA Y++GY GD+K E T ++YHE TH+  W  N    + 
Sbjct  68   ISIKDFIGTEAVSYMNNKINVSAVYLDGYRGDLKWEFTSLMYHEFTHLLAWYGNQASPSP  127

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
              + EGIAD+  LKA Y P  + KPG GD+WD GYD TARF +YC+ +  GFVA+LN KM
Sbjct  128  SAVQEGIADYAILKANYFPPAFAKPGSGDKWDQGYDFTARFFEYCDSITPGFVAKLNKKM  187

Query  614  KNGYSDSYFSDILGK  658
            K+ ++ ++F +I GK
Sbjct  188  KDTFNVNFFKEITGK  202



>ref|XP_002976188.1| hypothetical protein SELMODRAFT_104190 [Selaginella moellendorffii]
 gb|EFJ23093.1| hypothetical protein SELMODRAFT_104190 [Selaginella moellendorffii]
Length=233

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 121/201 (60%), Gaps = 12/201 (6%)
 Frame = +2

Query  113  NTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPG-DRKDVQKVSMFVD---D  280
            N A +T GG RFN V+G   + +VL  A NFI  +          K V KV   V+    
Sbjct  37   NNAEDTDGGKRFNSVMGISGAFKVLGDAINFIPPLLHNGLDSVPTKLVTKVVFTVEKQLQ  96

Query  281  MDGVAYASNN-EIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIA  457
               VA      +I  +A   + Y G     ITGV+YHE  H+WQ+ G G  +G + EG+A
Sbjct  97   QGAVAITFGTFQIQFNAPSADNYEG-----ITGVIYHEMAHVWQYFGQGTPSG-VTEGVA  150

Query  458  DFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKN-GYSDS  634
            D+VRLKAG APSHW KPG GDRWD GYDVTA F DYCN L   FV ++NA++ N  +S+S
Sbjct  151  DYVRLKAGLAPSHWVKPGGGDRWDQGYDVTAYFFDYCNSLWGDFVWQMNARLANDAWSES  210

Query  635  YFSDILGKTVDQLWTDYKAKY  697
             FSD+LGK++  LWTDYK K+
Sbjct  211  VFSDLLGKSLQDLWTDYKNKF  231



>gb|KHN30423.1| hypothetical protein glysoja_033161 [Glycine soja]
Length=171

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 122/193 (63%), Gaps = 32/193 (17%)
 Frame = +2

Query  50   LCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQN  229
            LC+++         AVEY ++N A ++ GG  F + +G +Y+KQ LD+AA+F  ++F Q+
Sbjct  9    LCLVL-------TLAVEYVLSNNAGSSTGGKMFEKQVGADYAKQTLDSAADFTLKLFHQS  61

Query  230  SPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQ  409
            +  DRK+VQ+V++ V++MDG+                         + G+L     ++  
Sbjct  62   TVADRKNVQQVNLIVENMDGL------------------------HLYGLLMAYWINL-P  96

Query  410  WngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGF  589
            W+GNG A  GLIEGIAD+VRLKAGYA  +W +PG G  W+ GYDVTARFLDYCN +KNGF
Sbjct  97   WDGNGQALSGLIEGIADYVRLKAGYAADYWGQPGHGGDWNQGYDVTARFLDYCNGIKNGF  156

Query  590  VAELNAKMKNGYS  628
            VA+LN+ MK+ +S
Sbjct  157  VADLNSMMKSQFS  169



>gb|AFV29745.1| NtPRp27-like, partial [Senecio aethnensis]
Length=203

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 121/195 (62%), Gaps = 8/195 (4%)
 Frame = +2

Query  98   EYTVTNTAANTPGGARFNQVIG-EEYSKQVLDAAANFI-WRVFQQNSPGDRK--DVQKVS  265
            +Y V N    +PGG +F+++IG   Y+K++L     F+   +FQQ +P +++  +   V 
Sbjct  8    KYDVVNVDPKSPGGIKFDKIIGGVPYTKELLGKINKFVVLTLFQQTNPEEQRKHESDTVH  67

Query  266  MFVDDMDGVAYAS--NNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW--ngngaan  433
            + + D  G    S  NN+I+VSA Y++GY GD+K E T ++YHE TH+  W  N    + 
Sbjct  68   ISIKDFIGTEAVSYMNNKINVSAVYLDGYRGDLKWEFTSLMYHEFTHLLSWYGNQASPSP  127

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
              + EGIAD+  LKA Y P  + KPG GD+WD GYD TARF +YC+ +  GFVA+LN KM
Sbjct  128  SAVQEGIADYAILKANYFPPAFAKPGSGDKWDQGYDFTARFFEYCDSITPGFVAKLNKKM  187

Query  614  KNGYSDSYFSDILGK  658
            K+ ++ + F +I GK
Sbjct  188  KDTFNVNSFKEITGK  202



>gb|AFV29736.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29738.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29740.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29742.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29746.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29748.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29750.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29752.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29758.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29760.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29778.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29782.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29784.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29788.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29789.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29794.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29798.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
Length=203

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 121/195 (62%), Gaps = 8/195 (4%)
 Frame = +2

Query  98   EYTVTNTAANTPGGARFNQVIG-EEYSKQVLDAAANFI-WRVFQQNSPGDRKDVQK--VS  265
            +Y V N    +PGG +F+++IG   Y+K++L     F+   +FQQ +P +++  +K  V 
Sbjct  8    KYDVVNVDPKSPGGIKFDKIIGGVPYTKELLGKINKFVVLTLFQQTNPEEQRKHEKDTVH  67

Query  266  MFVDDMDGVAYAS--NNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW--ngngaan  433
            + + D  G    S  NN+I+VSA Y++GY GD+K E T ++YHE TH+  W  N    + 
Sbjct  68   ISIKDFIGAEAVSYMNNKINVSAVYLDGYRGDLKWEFTSLMYHEFTHLLSWYGNQASPSP  127

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
              + EGIAD+  LKA Y P  + KPG GD+WD GYD TARF +YC+ +  GFVA+ N KM
Sbjct  128  SAVQEGIADYAILKANYFPPAFAKPGSGDKWDQGYDFTARFYEYCDSITPGFVAKFNKKM  187

Query  614  KNGYSDSYFSDILGK  658
            K+ ++ + F +I GK
Sbjct  188  KDTFNVNSFKEITGK  202



>gb|AFV29764.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29774.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
Length=203

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 121/195 (62%), Gaps = 8/195 (4%)
 Frame = +2

Query  98   EYTVTNTAANTPGGARFNQVIG-EEYSKQVLDAAANFI-WRVFQQNSPGDRKDVQK--VS  265
            +Y V N    +PGG +F+++IG   Y+K++L     F+   +FQQ +P +++  +K  V 
Sbjct  8    KYDVVNVDPKSPGGIKFDKIIGGVPYTKELLGKINKFVVLTLFQQTNPEEQRKHEKDTVH  67

Query  266  MFVDDMDGVAYAS--NNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW--ngngaan  433
            + + D  G    S  NN+I+VSA Y++GY GD+K E T ++YHE TH+  W  N    + 
Sbjct  68   ISIKDFIGTEAVSYMNNKINVSAVYLDGYRGDLKWEFTSLMYHEFTHLLAWYGNQASPSP  127

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
              + EGIAD+  LKA Y P  + KPG GD+WD GYD TARF +YC+ +  GFVA+ N KM
Sbjct  128  SAVQEGIADYAILKANYFPPAFAKPGSGDKWDQGYDFTARFYEYCDSITPGFVAKFNKKM  187

Query  614  KNGYSDSYFSDILGK  658
            K+ ++ + F +I GK
Sbjct  188  KDTFNVNSFKEITGK  202



>gb|AFV29744.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29756.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29762.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29766.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29768.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29772.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29776.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29792.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29796.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29800.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
Length=203

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 121/195 (62%), Gaps = 8/195 (4%)
 Frame = +2

Query  98   EYTVTNTAANTPGGARFNQVIG-EEYSKQVLDAAANFI-WRVFQQNSPGDRKDVQK--VS  265
            +Y V N    +PGG +F+++IG   Y+K++L     F+   +FQQ +P +++  +K  V 
Sbjct  8    KYDVVNVDPKSPGGIKFDKIIGGVPYTKELLGKINKFVVLTLFQQTNPEEQRKHEKDTVH  67

Query  266  MFVDDMDGVAYAS--NNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW--ngngaan  433
            + + D  G    S  NN+I+VSA Y++GY GD+K E T ++YHE TH+  W  N    + 
Sbjct  68   ISIKDFIGAEAVSYMNNKINVSAVYLDGYRGDLKWEFTSLMYHEFTHLLAWYGNQASPSP  127

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
              + EGIAD+  LKA Y P  + KPG GD+WD GYD TARF +YC+ +  GFVA+ N KM
Sbjct  128  SAVQEGIADYAILKANYFPPAFAKPGSGDKWDQGYDFTARFYEYCDSITPGFVAKFNKKM  187

Query  614  KNGYSDSYFSDILGK  658
            K+ ++ + F +I GK
Sbjct  188  KDTFNVNSFKEITGK  202



>emb|CDX71203.1| BnaC07g04820D [Brassica napus]
Length=160

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 102/147 (69%), Gaps = 2/147 (1%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGE-EYSKQVLDAAANFIWRVFQQ-NSPGDRKDVQKVS  265
            AV+++V +   ++ GG RF + IG+  Y+ + L AA  F WR+FQQ N P DR+   K+S
Sbjct  9    AVDFSVVDNTGDSAGGRRFRKEIGDVNYTTKSLRAATAFTWRLFQQANKPSDRRSTPKIS  68

Query  266  MFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLI  445
            M +++ DGVAY+S  EIH +A Y+ G  GDV+ E TGV+YH+  H WQWNG G A  GL+
Sbjct  69   MVMENGDGVAYSSQGEIHFNAGYLLGVLGDVRREFTGVVYHKVVHSWQWNGAGQAPSGLV  128

Query  446  EGIADFVRLKAGYAPSHWRKPGEGDRW  526
            E IAD+VR+K GYA SHW  PG+GDRW
Sbjct  129  EEIADYVRMKEGYAASHWVGPGQGDRW  155



>gb|AFV29753.1| NtPRp27-like, partial [Senecio aethnensis]
 gb|AFV29769.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29779.1| NtPRp27-like, partial [Senecio chrysanthemifolius]
 gb|AFV29785.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV29801.1| NtPRp27-like, partial [Senecio aethnensis x Senecio chrysanthemifolius]
Length=203

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 120/195 (62%), Gaps = 8/195 (4%)
 Frame = +2

Query  98   EYTVTNTAANTPGGARFNQVIG-EEYSKQVLDAAANFI-WRVFQQNSPGDRK--DVQKVS  265
            +Y V N    +PGG +F+++IG   Y+K++L     F+   +FQQ +P +++  +   V 
Sbjct  8    KYDVVNVDPKSPGGIKFDKIIGGVPYTKELLGKINKFVVLTLFQQTNPEEQRKHESDTVH  67

Query  266  MFVDDMDGVAYAS--NNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW--ngngaan  433
            + + D  G    S  NN+I+VSA Y++GY GD+K E T ++YHE TH+  W  N    + 
Sbjct  68   ISIKDFIGAEAVSYMNNKINVSAVYLDGYRGDLKWEFTSLMYHEFTHLLSWYGNQASPSP  127

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
              + EGIAD+  LKA Y P  + KPG GD+WD GYD TARF +YC+ +  GFVA+ N KM
Sbjct  128  SAVQEGIADYAILKANYFPPAFAKPGSGDKWDQGYDFTARFYEYCDSITPGFVAKFNKKM  187

Query  614  KNGYSDSYFSDILGK  658
            K+ ++ + F +I GK
Sbjct  188  KDTFNVNSFKEITGK  202



>ref|XP_010058770.1| PREDICTED: uncharacterized protein LOC104446635 [Eucalyptus grandis]
Length=246

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/226 (37%), Positives = 126/226 (56%), Gaps = 7/226 (3%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGA--RFNQVIGEEYSKQVLDAAAN  202
            M  + L L  + +   +   +A    +     NT      RF   IG  ++ + L  A++
Sbjct  1    MRPLKLFLLFIFVFVPLKPTQAARDFICEVLDNTSNTTDNRFKNEIGSIFALETLSTASD  60

Query  203  FIWRVFQQNSPGDR---KDVQKVSMFVDDMDGVAYASNN--EIHVSARYINGYSGDVKGE  367
            F+   F Q++ G R     +  +  FV +      A+NN  +  V A  +  Y GDVK E
Sbjct  61   FVLETFNQSNGGGRGYSTVLAIIESFVANGYPPTIATNNGNQFRVDADNLQAYVGDVKAE  120

Query  368  ITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVT  547
             TG++YHES  +WQW G+  A  GLI GIAD++RL A +   +W   G G RWD GY VT
Sbjct  121  FTGIVYHESARVWQWTGSDTAPIGLITGIADYIRLNARWPSKYWPPRGSGSRWDDGYAVT  180

Query  548  ARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDY  685
            A FL++C+  + GFV++LNA M++ YSD++F  +LG++VD+LW +Y
Sbjct  181  AYFLEFCSGKRRGFVSDLNAMMESLYSDAFFVILLGQSVDELWEEY  226



>gb|AFV29803.1| NtPRp27-like, partial [Senecio vulgaris]
Length=203

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 120/195 (62%), Gaps = 8/195 (4%)
 Frame = +2

Query  98   EYTVTNTAANTPGGARFNQVIG-EEYSKQVLDAAANFI-WRVFQQNSPGDRK--DVQKVS  265
            +Y V N    +PGG +F+++IG   Y+K++L     F+   +FQQ +P +++  +   V 
Sbjct  8    KYDVVNVDPKSPGGIKFDKIIGGVPYTKELLGKINKFVVLTLFQQTNPEEQRKHESDTVH  67

Query  266  MFVDDMDGVAYAS--NNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQW--ngngaan  433
            + + D  G    S  NN+I VSA Y++GY GD+K E T ++YHE TH+  W  N    + 
Sbjct  68   ISIKDFIGAEAVSYMNNKIDVSAVYLDGYRGDLKWEFTSLMYHEFTHLLAWYGNQASPSP  127

Query  434  ggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKM  613
             G+ EGIAD+  LKA Y P  + KPG GD+WD GYD TARF +YC+ +  GFVA+ N KM
Sbjct  128  TGVREGIADYAILKANYFPPAFAKPGSGDKWDQGYDFTARFFEYCDSITPGFVAKFNKKM  187

Query  614  KNGYSDSYFSDILGK  658
            K+ ++ + F +I GK
Sbjct  188  KDTFNVNSFKEITGK  202



>ref|XP_010059095.1| PREDICTED: uncharacterized protein LOC104447008 [Eucalyptus grandis]
Length=246

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 113/186 (61%), Gaps = 5/186 (3%)
 Frame = +2

Query  143  RFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDR---KDVQKVSMFVDDMDGVAYASNN-  310
            RF   IG  ++ + L  A++F+   F Q++ G R     +  +  FV +      A+NN 
Sbjct  41   RFKNEIGSIFALETLSTASDFVLETFNQSNGGGRGYFAVLVIIESFVANGYPPTVATNNG  100

Query  311  -EIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYA  487
             +  V A Y+  + GDVK E  G++YHES  +WQW  +  A  GLI GIAD++R  AG+ 
Sbjct  101  NQFRVDADYLQAHVGDVKAEFMGIVYHESARVWQWTSSDTAPIGLITGIADYIRFNAGWP  160

Query  488  PSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVD  667
              +W   G G RWD GY VTA FL++C+  + GFV++LNA M++ YSD++F  +LG++VD
Sbjct  161  SKYWPPRGSGSRWDDGYAVTAYFLEFCSGKRRGFVSDLNAMMESLYSDAFFVILLGQSVD  220

Query  668  QLWTDY  685
            +LW +Y
Sbjct  221  ELWKEY  226



>ref|XP_007206698.1| hypothetical protein PRUPE_ppa023753mg [Prunus persica]
 gb|EMJ07897.1| hypothetical protein PRUPE_ppa023753mg [Prunus persica]
Length=104

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            TH+WQWNGNG A  GLIEGIADFVRLKAGY P HW K GE +RWD GYDVTARFLDYC +
Sbjct  2    THVWQWNGNGGAPSGLIEGIADFVRLKAGYTPDHWVKNGEDNRWDQGYDVTARFLDYCEN  61

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            +K  FVA LN KM+ GYS ++F DI G+TVDQLW DYKAK+
Sbjct  62   VKTEFVANLNRKMRFGYSVNFFKDITGRTVDQLWRDYKAKF  102



>ref|XP_010058921.1| PREDICTED: uncharacterized protein LOC104446812 [Eucalyptus grandis]
Length=277

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/226 (37%), Positives = 127/226 (56%), Gaps = 7/226 (3%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGA--RFNQVIGEEYSKQVLDAAAN  202
            M  + L L  + +   +   +A    +     NT   +  RF   IG  ++ + L  A++
Sbjct  28   MRPLKLFLLFIFVFVPLKPTQAARDFICEVLDNTSNTSDNRFKNEIGSIFALETLSTASD  87

Query  203  FIWRVFQQNSPGDR---KDVQKVSMFVDDMDGVAYASNN--EIHVSARYINGYSGDVKGE  367
            F+   F Q++ G R     +  +  FV +      A+NN  +  V+A Y+  Y GDVK E
Sbjct  88   FVLETFNQSNGGGRGYSTVLAIIESFVANGYPPTIATNNGNQFRVNADYLQAYVGDVKAE  147

Query  368  ITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVT  547
             TG+++HE  HIWQW G+  A  GLI GIAD++RL A +   +W   G G RWD GY VT
Sbjct  148  FTGIVFHERAHIWQWTGSDTAPIGLITGIADYIRLNARWPSKYWPPRGSGSRWDDGYAVT  207

Query  548  ARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDY  685
            A FL +C+  + GFV++LNA M++ YS ++F  +LG++VD+LW +Y
Sbjct  208  AYFLVFCSWKRRGFVSDLNAMMESLYSYAFFVILLGQSVDELWEEY  253



>ref|XP_010068304.1| PREDICTED: uncharacterized protein LOC104455165 [Eucalyptus grandis]
Length=240

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 93/143 (65%), Gaps = 0/143 (0%)
 Frame = +2

Query  275  DDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGI  454
            +D   V     N I ++  Y+  Y GD++ E  GV+YHE T + QW GNG A  GLI GI
Sbjct  71   NDPLAVVRTKGNLIRLNVDYLQHYRGDIQEEFAGVMYHEMTRVLQWTGNGTAPRGLINGI  130

Query  455  ADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDS  634
            AD+VRLK G+A   W   G G RWD G+ +TA FL+YCNDLK GFVA LNA MK  YS++
Sbjct  131  ADYVRLKGGHASKSWPMKGSGSRWDDGFAITAYFLEYCNDLKPGFVANLNALMKYSYSEA  190

Query  635  YFSDILGKTVDQLWTDYKAKYNT  703
            +F  +LGK+V QLW DYK  Y T
Sbjct  191  FFVQLLGKSVHQLWGDYKLAYAT  213



>gb|AFG58755.1| hypothetical protein 0_6799_01, partial [Pinus taeda]
Length=138

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  86   CRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVS  265
              A+   V N+A  + GG RF++ IG   ++Q++  A  FIW+ F + S  D K+VQ V+
Sbjct  9    SHALHIVVHNSAKGSDGGTRFDKEIGSAKARQIIGRATQFIWQSFNEKSSADGKNVQTVT  68

Query  266  MFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLI  445
            +FV+ MDGVAY S +EIH+SA Y+  Y GDVK EITGVLYHE TH+WQW+G G A  GLI
Sbjct  69   LFVESMDGVAYTSGDEIHLSAEYVASYQGDVKNEITGVLYHEVTHVWQWDGMGGAPSGLI  128

Query  446  EGIADFVRL  472
            EGIAD++RL
Sbjct  129  EGIADYIRL  137



>ref|XP_002983524.1| hypothetical protein SELMODRAFT_118420 [Selaginella moellendorffii]
 gb|EFJ15425.1| hypothetical protein SELMODRAFT_118420 [Selaginella moellendorffii]
Length=144

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +2

Query  311  EIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaa--nggLIEGIADFVRLKAGY  484
            EIH+SA+Y+   +G++  E+TG+LYHE  HIWQW+G   +    GLIEGIADF+RLKA  
Sbjct  8    EIHLSAQYVATLTGNMVRELTGILYHEMAHIWQWHGKEGSWPPQGLIEGIADFMRLKAKL  67

Query  485  APSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTV  664
              S     G G+ WD GY VTA FL+Y NDL   FVAELN K+ +G+S+SYF D+ GK+V
Sbjct  68   GVSGNGFVGLGNHWDEGYAVTALFLNYVNDLHPSFVAELNKKLYDGWSESYFQDLTGKSV  127

Query  665  DQLWTDYKAKYN  700
            DQLW DYK K++
Sbjct  128  DQLWNDYKQKFH  139



>gb|AEW07608.1| hypothetical protein 0_6799_01, partial [Pinus radiata]
Length=138

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +2

Query  86   CRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVS  265
              A+   V N+A  + GG RF++ IG   ++ ++  A  FIW+ F + S  D K+VQ V+
Sbjct  9    SHALHIVVHNSAKGSDGGTRFDKEIGSAKARLIIGRATQFIWQSFNEKSSADGKNVQTVT  68

Query  266  MFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLI  445
            +FV+ MDGVAY S +EIH+SA Y+  Y GDVK EITGVLYHE TH+WQW+G G A  GLI
Sbjct  69   LFVESMDGVAYTSGDEIHLSAEYVASYQGDVKNEITGVLYHEVTHVWQWDGMGGAPSGLI  128

Query  446  EGIADFVRL  472
            EGIAD++RL
Sbjct  129  EGIADYIRL  137



>gb|KCW63680.1| hypothetical protein EUGRSUZ_G01326 [Eucalyptus grandis]
Length=184

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 110/205 (54%), Gaps = 26/205 (13%)
 Frame = +2

Query  29   MDRITLSLCILILGAAIHGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFI  208
            M R   S   L+   A     AV+Y V +      G  RF   IG  Y++Q++ AA++FI
Sbjct  1    MSRTHFSGLALLFLVAFPPAHAVKYQVVDRTGYITGCNRFQTEIGSFYTRQLMRAASSFI  60

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYH  388
            W  F + S G+RKD   V++ +                            +     +L+H
Sbjct  61   WLTFNE-SMGERKDHDPVTLVIHRF-------------------------QWSFRKILFH  94

Query  389  ESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYC  568
            E TH+WQ  GNG A  GL+ GIAD++RL+AG AP  W + G G RWD  Y VTA FLD+C
Sbjct  95   EMTHVWQQYGNGKAPRGLVNGIADYMRLRAGLAPKKWAQRGSGLRWDESYAVTAYFLDHC  154

Query  569  NDLKNGFVAELNAKMKNGYSDSYFS  643
            N LKNGFVAELN+ M++ YSD +FS
Sbjct  155  NGLKNGFVAELNSLMEDDYSDEFFS  179



>ref|XP_010096295.1| hypothetical protein L484_027034 [Morus notabilis]
 gb|EXB63690.1| hypothetical protein L484_027034 [Morus notabilis]
Length=156

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 100/152 (66%), Gaps = 6/152 (4%)
 Frame = +2

Query  83   GCRAVE-YTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQK  259
            G  A+  Y   N   ++ G ARF + IG  Y++Q L  A   IWR F+Q S   RKD+ +
Sbjct  2    GTHAINVYDFVNRVGSSAGYARFTREIGVSYARQTLITATYDIWRWFEQYSAAQRKDINR  61

Query  260  VSM----FVDDMDGV-AYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngng  424
            + +    F D    V AYA+ NEIH++ RYI  YSGDVK EITGVLYHE TH+ QWNGNG
Sbjct  62   LVLTLENFPDSQVQVPAYATTNEIHLNGRYIARYSGDVKREITGVLYHELTHVLQWNGNG  121

Query  425  aanggLIEGIADFVRLKAGYAPSHWRKPGEGD  520
             A G LIEGIAD+VRL++GY PS+W KPG GD
Sbjct  122  QAPGWLIEGIADYVRLRSGYIPSNWAKPGGGD  153



>ref|XP_010040231.1| PREDICTED: uncharacterized protein LOC104429024 [Eucalyptus grandis]
Length=218

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 97/155 (63%), Gaps = 6/155 (4%)
 Frame = +2

Query  170  YSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMFVD-----DMDGVAYASNNEIHVSARY  334
            Y+KQ+L AA++FIW  F +    + KD  +V++ V       +  V+   NN I ++  Y
Sbjct  64   YTKQLLKAASSFIWLTFNETQ-AEGKDYDQVTLIVQRFPPAPLTIVSSTINNTIVMNTNY  122

Query  335  INGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGE  514
            I  YS D + E TG+L+H++T +WQW G+G A   LI G+AD+VRLKAG A   W K G 
Sbjct  123  IQNYSSDARPEFTGILFHKATRVWQWKGSGKALVELINGVADYVRLKAGLATKEWPKKGL  182

Query  515  GDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKN  619
            G RW  G+ +TA FLDYCN L+ GFVAEL+  M N
Sbjct  183  GGRWGKGFVITAYFLDYCNGLETGFVAELSGLMAN  217



>ref|XP_002974056.1| hypothetical protein SELMODRAFT_100569 [Selaginella moellendorffii]
 gb|EFJ25011.1| hypothetical protein SELMODRAFT_100569 [Selaginella moellendorffii]
Length=189

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 115/212 (54%), Gaps = 33/212 (16%)
 Frame = +2

Query  50   LCILILGAAI-HGCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQ  226
            L IL L  AI H   A+E   +N +  +PGG RF+  +G   +  ++  A ++I   F  
Sbjct  7    LSILALVVAIPHTTLALELVASNASPASPGGQRFDAELGINGALSMMVDAIHYIQMAFAY  66

Query  227  NSPG-DRKDVQKVSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHI  403
            +SP   RK V  ++  ++DM GVAY   ++ H+SA Y+ GY+G+ + E+  ++YHE TH+
Sbjct  67   SSPATPRKTVDTITFTLEDMPGVAYTYGSQFHLSASYVAGYTGEFQREMRSIVYHEMTHV  126

Query  404  WQW--ngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDL  577
            WQW       A  GLIEGIA F+ L                              Y NDL
Sbjct  127  WQWDGKDGNRAPSGLIEGIASFITLS-----------------------------YVNDL  157

Query  578  KNGFVAELNAKMKNGYSDSYFSDILGKTVDQL  673
            + GFV ELN+K+  G+S+S+FSD+ GK+V+QL
Sbjct  158  RPGFVTELNSKLATGWSESFFSDLTGKSVEQL  189



>ref|XP_010058831.1| PREDICTED: uncharacterized protein LOC104446708 [Eucalyptus grandis]
Length=254

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +2

Query  290  VAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADFVR  469
            +A  + N+  V A Y+  Y GDVK E TG++YHES  +WQW G+  A  GLI GIAD++R
Sbjct  103  IATNNGNQFRVDADYLQAYVGDVKAEFTGIVYHESARVWQWTGSDTAPIGLITGIADYIR  162

Query  470  LKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDI  649
            L A +   +W   G G RWD G+ VTA FL++C+  + GFV++LNA  ++ YSD++F  I
Sbjct  163  LNARWPSKYWPPRGSGSRWDDGHAVTAYFLEFCSGKRRGFVSDLNAMRESLYSDAFFVII  222

Query  650  LGKTVDQLWTDY  685
            LG++VD+LW +Y
Sbjct  223  LGQSVDELWEEY  234



>ref|XP_004137102.1| PREDICTED: uncharacterized protein LOC101216547, partial [Cucumis 
sativus]
Length=113

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  371  TGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTA  550
            +G+LYHE THIWQWNG GAA G LIEG AD++RL++GY PSHW  PG G  +   YD TA
Sbjct  1    SGILYHEMTHIWQWNGKGAAPGWLIEGFADYIRLQSGYIPSHWVPPGGGSNYTDSYDKTA  60

Query  551  RFLDYCNDLKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
            RF+DY     +GFV++LN K+++G+S  YF ++ GKTVD+LW +YKA +
Sbjct  61   RFMDYLEKRTSGFVSKLNQKLRDGFSLDYFVELQGKTVDELWAEYKAAF  109



>ref|XP_009603712.1| PREDICTED: uncharacterized protein LOC104098630, partial [Nicotiana 
tomentosiformis]
Length=74

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  404  WQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKN  583
            WQWNGNG A GGLIEGIAD+VRLKAG+APSHW KPG+GDRWD GYDVTARFLDYCN L+N
Sbjct  1    WQWNGNGRAPGGLIEGIADYVRLKAGFAPSHWVKPGQGDRWDQGYDVTARFLDYCNSLRN  60

Query  584  GFVAELNAKMKNGY  625
            GFVA+LN KM+NGY
Sbjct  61   GFVAQLNKKMRNGY  74



>ref|XP_010040232.1| PREDICTED: uncharacterized protein LOC104429025 [Eucalyptus grandis]
Length=112

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +2

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            TH+WQ  GNG A  GL+ GIAD++RL+AG AP  W + G G RWD  Y V A FLD+CN 
Sbjct  2    THVWQQYGNGKAPRGLVNGIADYMRLRAGLAPKKWAQRGSGLRWDESYAVMAYFLDHCNG  61

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKYN  700
            LKNGFVAELN+ M++ YSD +FS +LGKTVD+ W DYK + +
Sbjct  62   LKNGFVAELNSLMEDDYSDEFFSVMLGKTVDEFWMDYKTELD  103



>ref|XP_007265342.1| plant basic secretory protein [Fomitiporia mediterranea MF3/22]
 gb|EJD03741.1| plant basic secretory protein [Fomitiporia mediterranea MF3/22]
Length=248

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 108/198 (55%), Gaps = 19/198 (10%)
 Frame = +2

Query  131  PGGARFNQVIGEEYSKQVLDAAANFI--WRVFQQNSPGDRKDVQKVSMFVDDMDGVAYAS  304
            PG   F Q I      + L+ A   +  W    Q  P   + V+ V++ +DDMDGVAY  
Sbjct  55   PGAILFFQHIN---PSECLNIAVTTVLEWLYTVQTCP---RHVRSVTLHLDDMDGVAYTK  108

Query  305  -------NNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaanggLIEGIADF  463
                   + EIH+S R+I         E  GVL HE  H +Q NG G   GGLIEGIAD+
Sbjct  109  GSELDEDHKEIHLSVRHIVNNKQRAHDETFGVLVHEMVHCFQCNGKGTCPGGLIEGIADY  168

Query  464  VRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLK-NGFVAELNAKMKNG-YSDSY  637
            VRLKAG  P HWRK   G++WD GY +T  FL++  +   N FV  LN +M++  Y +  
Sbjct  169  VRLKAGLPPPHWRK--GGNKWDEGYQITGYFLEWIENTNGNDFVRRLNGRMRDHEYDEGV  226

Query  638  FSDILGKTVDQLWTDYKA  691
            F+++ G+ V+ LW  YKA
Sbjct  227  FAELTGQDVNSLWKAYKA  244



>emb|CDX71206.1| BnaC07g04850D [Brassica napus]
Length=139

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = +2

Query  260  VSMFVDDMDGVAYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQWngngaangg  439
            + + ++ +DGVAY + +EIH +  Y+   S D + E +GV+YHE  H    NG G A   
Sbjct  2    IKLLMEMVDGVAYNNIDEIHFNKGYLVDLSKDARREFSGVVYHEVVHSLLSNGMGQAPVC  61

Query  440  LIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCNDLKNGFVAELNAKMKN  619
            +I+ IAD+VRLK  +AP HW   G GD+WD GYDVT+RFL+YCN+L + FV EL+ KM +
Sbjct  62   IIKRIADYVRLKEDHAPDHWVGSGGGDKWDKGYDVTSRFLEYCNELMDVFVVELHKKMND  121

Query  620  GYSDS  634
            GYS++
Sbjct  122  GYSEN  126



>gb|EPS60839.1| hypothetical protein M569_13962, partial [Genlisea aurea]
Length=83

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   AVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKVSMF  271
            AV+Y VTN AA+TPGGAR+  VIG+ Y+ Q L AA +F+WRVFQQNS  DRK V +V +F
Sbjct  2    AVDYAVTNNAASTPGGARYATVIGDAYALQTLGAATDFVWRVFQQNSDADRKQVSRVGLF  61

Query  272  VDDMDGVAYASNNEIHVSARYI  337
            +DDM GVAYA N EIH SARY+
Sbjct  62   IDDMGGVAYAVNGEIHFSARYV  83



>ref|XP_001772715.1| predicted protein [Physcomitrella patens]
 gb|EDQ62429.1| predicted protein [Physcomitrella patens]
Length=206

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 117/208 (56%), Gaps = 14/208 (7%)
 Frame = +2

Query  83   GCRAVEYTVTNTAANTPGGARFNQVIGEEYSKQVLDAAANFIWRVFQQNSPGDRKDVQKV  262
            G  +  +TV N  +NT  G  F++  G +Y +++L  A  F    F     G+ KD   V
Sbjct  4    GGTSTIFTVKNDGSNTAVGKVFDE-FGTKYWEELLRDAKKFCKEKF-----GEVKDHSTV  57

Query  263  SMFVDDMD-GV-AYASNNEIHVSARYINGYSGDVKGEITGVLYHESTHIWQ---Wngnga  427
            ++ V ++  G+ A    ++I +SA YI     D K EI GV+YHES H+WQ    N   A
Sbjct  58   TLVVVELQRGIPAVTVGDKIELSAHYIVEKKND-KKEIKGVIYHESVHVWQNNEGNYRDA  116

Query  428  anggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDY-CNDLKNGFVAELN  604
               G+IEG+AD++RL+A  AP HW+K      W  GY+ TA FLD+ C      FV +LN
Sbjct  117  KFRGVIEGVADWIRLRADLAPPHWKKAPSA-HWYDGYETTAYFLDWICYRYDENFVKKLN  175

Query  605  AKMKNGYSDSYFSDILGKTVDQLWTDYK  688
             KMKN +S+ +F  I+ K V++LW +YK
Sbjct  176  KKMKNSWSEDFFQQIVHKEVEELWNEYK  203



>gb|KGQ04395.1| hypothetical protein BBAD15_g10344 [Beauveria bassiana D1-5]
Length=243

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 105/190 (55%), Gaps = 13/190 (7%)
 Frame = +2

Query  170  YSKQVLDAAANFIWRVFQQNS--PGDRKDVQKVSMFVDDMDGVAYAS-------NNEIHV  322
            + + V   A N +  ++   S  P      + V++ V DMDGVAY +       + EIH+
Sbjct  54   FGECVRSCAHNVLRLLYTHPSRAPCPLPTTRSVTLIVRDMDGVAYTTGSELDGDHKEIHL  113

Query  323  SARYINGYSGD-VKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHW  499
            S R+I+  S + +  E+ GV+ HE  H +Q++G     GGLIEGIAD+VRL+ G+ P HW
Sbjct  114  STRHIDNQSPERICDELYGVITHELVHCFQYDGQHTCKGGLIEGIADWVRLRCGHVPPHW  173

Query  500  RKPGEGDRWDAGYDVTARFLDYC-NDLKNGFVAELNAKMKNGY--SDSYFSDILGKTVDQ  670
            +   EG  WDAGY+ T  FLDY       G V  +N+K+++     + ++ D+ G T+ +
Sbjct  174  KPRAEGCSWDAGYETTGYFLDYLERQCGEGTVRRINSKLQSERYEEEKFWPDLFGSTIGE  233

Query  671  LWTDYKAKYN  700
            LW  Y A  N
Sbjct  234  LWETYAASLN  243



>ref|XP_006667644.1| PBSP domain protein [Cordyceps militaris CM01]
 gb|EGX94158.1| PBSP domain protein [Cordyceps militaris CM01]
Length=292

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 110/190 (58%), Gaps = 13/190 (7%)
 Frame = +2

Query  170  YSKQVLDAAANFIWRVFQQ--NSPGDRKDVQKVSMFVDDMDGVAYAS-------NNEIHV  322
            + + V   A + + +++Q   N+P      + V++ + DMDGVAY +       + EIH+
Sbjct  103  FGECVRACAQDVLRQLYQHPGNAPCPLPTTRSVTLILRDMDGVAYTAGTELDPDHKEIHL  162

Query  323  SARYINGYSGD-VKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHW  499
            S R+I+  S + ++ E+ GV+ HE  H +Q++G     GGLIEGIAD+VRL+ G+ P HW
Sbjct  163  STRHIDNQSPERIRDELYGVVTHELVHCFQYDGRHTCKGGLIEGIADWVRLRCGHVPPHW  222

Query  500  RKPGEGDRWDAGYDVTARFLDYC-NDLKNGFVAELNAKMK-NGYSDSYF-SDILGKTVDQ  670
            +   EG  WDAGY+ T  FLD+       G V  +NAK++ + Y +  F  ++ G T+D+
Sbjct  223  KPRAEGCGWDAGYETTGYFLDWLETQCGEGTVRRINAKLQADKYEEEKFWPELFGSTIDE  282

Query  671  LWTDYKAKYN  700
            LW  Y A  N
Sbjct  283  LWETYAASIN  292



>ref|XP_008602581.1| plant Basic Secretory protein [Beauveria bassiana ARSEF 2860]
 gb|EJP61771.1| plant Basic Secretory protein [Beauveria bassiana ARSEF 2860]
Length=244

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 105/190 (55%), Gaps = 13/190 (7%)
 Frame = +2

Query  170  YSKQVLDAAANFIWRVFQQNS--PGDRKDVQKVSMFVDDMDGVAYAS-------NNEIHV  322
            + + V   A N +  ++   S  P      + V++ V DMDGVAY +       + EIH+
Sbjct  55   FGECVRSCAHNVLRLLYTHPSRAPCPLPTTRSVTLIVRDMDGVAYTTGSELDGDHKEIHL  114

Query  323  SARYINGYSGD-VKGEITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHW  499
            S R+I+  S + +  E+ GV+ HE  H +Q++G     GGLIEGIAD+VRL+ G+ P HW
Sbjct  115  STRHIDNQSPERICDELYGVITHELVHCFQYDGQHTCKGGLIEGIADWVRLRCGHVPPHW  174

Query  500  RKPGEGDRWDAGYDVTARFLDYCN-DLKNGFVAELNAKMKNGY--SDSYFSDILGKTVDQ  670
            +   EG  WDAGY+ T  FLDY       G V  +N+K+++     + ++ D+ G T+ +
Sbjct  175  KPRAEGCNWDAGYETTGYFLDYLERQCGEGTVRRINSKLQSERYEEEKFWPDLFGSTIGE  234

Query  671  LWTDYKAKYN  700
            LW  Y A  N
Sbjct  235  LWETYAASLN  244



>ref|XP_007360623.1| plant basic secretory protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF67210.1| plant basic secretory protein [Dichomitus squalens LYAD-421 SS1]
Length=221

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 98/172 (57%), Gaps = 10/172 (6%)
 Frame = +2

Query  209  WRVFQQNSPGDRKDVQKVSMFVDDMDGVAY----ASNNEIHVSARYINGYSGDVKGEITG  376
            W   +Q  P   ++VQ +++ +  M GVA+     +  EIH S  +I       K EI G
Sbjct  53   WLYTEQTVP---RNVQLITLVLRPMPGVAHTFGSPTTKEIHFSLDHIRNSQSRAKDEILG  109

Query  377  VLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARF  556
            VL HE  H +Q+NG G   GGLIEGIAD+VRL AGYAP HW+K  +GD WD GY  TA F
Sbjct  110  VLTHEMVHCYQYNGEGKTPGGLIEGIADWVRLNAGYAPPHWKKDADGD-WDGGYQKTAYF  168

Query  557  LDYCN-DLKNGFVAELNAKMKN-GYSDSYFSDILGKTVDQLWTDYKAKYNTN  706
            LD+      +G + ELN  MK+  Y +  F D+ G+ V +LWT YK     N
Sbjct  169  LDWIEGRYGDGSIRELNEGMKDVEYDEHIFKDVTGRKVSKLWTLYKEHLEEN  220



>gb|KGN43892.1| hypothetical protein Csa_7G072790 [Cucumis sativus]
Length=106

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  395  THIWQWngngaanggLIEGIADFVRLKAGYAPSHWRKPGEGDRWDAGYDVTARFLDYCND  574
            THIWQWNG GAA G LIEG AD++RL++GY PSHW  PG G  +   YD TARF+DY   
Sbjct  2    THIWQWNGKGAAPGWLIEGFADYIRLQSGYIPSHWVPPGGGSNYTDSYDKTARFMDYLEK  61

Query  575  LKNGFVAELNAKMKNGYSDSYFSDILGKTVDQLWTDYKAKY  697
              +GFV++LN K+++G+S  YF ++ GKTVD+LW +YKA +
Sbjct  62   RTSGFVSKLNQKLRDGFSLDYFVELQGKTVDELWAEYKAAF  102



>gb|EKG14227.1| hypothetical protein MPH_08602 [Macrophomina phaseolina MS6]
Length=271

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 106/182 (58%), Gaps = 14/182 (8%)
 Frame = +2

Query  173  SKQVLDAAANFIWRVFQQNSP-GDRKDVQKVSMFVDDMDGVAYAS-------NNEIHVSA  328
            + QVL+ A + + ++    SP  D   V+ +++ +  M GVAY +       + EIH S 
Sbjct  52   ASQVLEEAVSGVLQLLY--SPHADIPAVRSITLILRSMGGVAYTTGKDIDSDHKEIHFSL  109

Query  329  RYINGYSGDVKGE-ITGVLYHESTHIWQWngngaanggLIEGIADFVRLKAGYAPSHWRK  505
             YI+  S D K E I GVL HE  H WQW+ +G A GGLIEGIAD+VRL++G+ P HW++
Sbjct  110  EYISHISKDRKKEEILGVLRHEMVHCWQWDAHGTAPGGLIEGIADYVRLRSGFVPPHWKQ  169

Query  506  PGEGDRWDAGYDVTARFLDYCNDL-KNGFVAELNAKM-KNGYSDSYFSDILGKTVDQLWT  679
              +GD WDAGY  T  FLDY      +G V  +N  + +  Y +  + D+ GK+V  LW 
Sbjct  170  EADGD-WDAGYQHTGYFLDYLEKTYGHGSVMAINETLRRKDYDEKLWKDLFGKSVKHLWN  228

Query  680  DY  685
            DY
Sbjct  229  DY  230



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2096794778882