BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25142_g5_i7 len=841 path=[1:0-36 102:37-64 130:65-120 186:121-148
214:149-198 7308:199-201 407:202-287 493:288-314 520:315-318
524:319-396 602:397-502 708:503-708 914:709-744 950:745-840]

Length=841
                                                                      Score     E

ref|XP_009772565.1|  PREDICTED: RNA-binding protein 48 isoform X1       108   1e-24   
ref|XP_009606401.1|  PREDICTED: RNA-binding protein 48 isoform X2       106   4e-24   
gb|EYU22506.1|  hypothetical protein MIMGU_mgv1a022373mg                107   5e-24   
ref|XP_009394906.1|  PREDICTED: RNA-binding protein 48 isoform X1       107   7e-24   
ref|XP_009606400.1|  PREDICTED: RNA-binding protein 48 isoform X1       106   8e-24   
ref|XP_008794789.1|  PREDICTED: RNA-binding protein 48-like isofo...    106   9e-24   
emb|CDP12133.1|  unnamed protein product                                105   1e-23   
ref|XP_008794788.1|  PREDICTED: RNA-binding protein 48-like isofo...    106   1e-23   
ref|XP_006356616.1|  PREDICTED: RNA-binding protein 48-like             106   1e-23   
ref|XP_011071098.1|  PREDICTED: RNA-binding protein 48 isoform X1       105   2e-23   
ref|XP_010510724.1|  PREDICTED: RNA-binding protein 48-like             104   4e-23   
ref|XP_010417928.1|  PREDICTED: RNA-binding protein 48-like             104   4e-23   
ref|XP_002263764.1|  PREDICTED: RNA-binding protein 48                  103   7e-23   Vitis vinifera
ref|XP_004245239.1|  PREDICTED: RNA-binding protein 48 isoform X1       103   8e-23   
ref|XP_010325151.1|  PREDICTED: RNA-binding protein 48 isoform X2       103   9e-23   
gb|AFK37542.1|  unknown                                                 103   1e-22   
ref|XP_006409787.1|  hypothetical protein EUTSA_v10017205mg             103   1e-22   
ref|XP_006294958.1|  hypothetical protein CARUB_v10024014mg             103   1e-22   
gb|ACJ85604.1|  unknown                                                 102   2e-22   Medicago truncatula
gb|KEH28235.1|  RNA recognition motif protein                           102   2e-22   
ref|XP_003616248.1|  hypothetical protein MTR_5g077780                  102   2e-22   
ref|XP_004509295.1|  PREDICTED: RNA-binding protein 48-like             102   2e-22   
ref|XP_010682529.1|  PREDICTED: RNA-binding protein 48                  102   2e-22   
ref|XP_002879135.1|  nucleic acid binding protein                       102   2e-22   
ref|XP_002313579.1|  hypothetical protein POPTR_0009s16880g             102   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010473176.1|  PREDICTED: RNA-binding protein 48-like isofo...    102   3e-22   
gb|KHG22348.1|  RNA-binding 48                                          102   3e-22   
emb|CDX71417.1|  BnaC04g16520D                                          102   3e-22   
ref|XP_009103621.1|  PREDICTED: RNA-binding protein 48-like             101   4e-22   
ref|XP_007044689.1|  RNA-binding (RRM/RBD/RNP motifs) family protein    102   4e-22   
ref|XP_003541147.1|  PREDICTED: RNA-binding protein 48 isoform X1       102   4e-22   
gb|ACU17018.1|  unknown                                                 101   4e-22   Glycine max [soybeans]
gb|AAQ65149.1|  At2g27790                                               102   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180347.2|  RNA recognition motif-containing protein              102   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473177.1|  PREDICTED: RNA-binding protein 48-like isofo...    101   5e-22   
emb|CDY04512.1|  BnaA07g13380D                                          101   5e-22   
emb|CAN63941.1|  hypothetical protein VITISV_032503                     102   5e-22   Vitis vinifera
ref|XP_006483891.1|  PREDICTED: RNA-binding protein 48-like isofo...    101   6e-22   
gb|KDO82364.1|  hypothetical protein CISIN_1g026963mg                   100   6e-22   
ref|XP_006438335.1|  hypothetical protein CICLE_v10032655mg             101   6e-22   
gb|KDO82363.1|  hypothetical protein CISIN_1g026963mg                   101   6e-22   
ref|XP_004490832.1|  PREDICTED: RNA-binding protein 48-like isofo...    100   1e-21   
ref|XP_004951201.1|  PREDICTED: RNA-binding protein 48-like             100   1e-21   
gb|KCW76232.1|  hypothetical protein EUGRSUZ_D00612                   99.4    1e-21   
ref|XP_004294413.1|  PREDICTED: RNA-binding protein 48-like             100   1e-21   
ref|XP_002451350.1|  hypothetical protein SORBIDRAFT_04g000550          100   1e-21   Sorghum bicolor [broomcorn]
ref|XP_006659776.1|  PREDICTED: RNA-binding protein 48-like             100   2e-21   
ref|XP_007131931.1|  hypothetical protein PHAVU_011G052800g             100   2e-21   
ref|XP_008226987.1|  PREDICTED: RNA-binding protein 48                99.8    3e-21   
ref|XP_008385850.1|  PREDICTED: RNA-binding protein 48                99.8    3e-21   
ref|XP_007211983.1|  hypothetical protein PRUPE_ppa010927mg           99.4    3e-21   
ref|NP_198082.4|  pentatricopeptide (PPR) repeat-containing protein     102   5e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AFW66820.1|  putative RNA-recognition domain family protein        97.1    6e-21   
ref|NP_001154742.1|  pentatricopeptide (PPR) repeat-containing pr...    102   6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473178.1|  PREDICTED: RNA-binding protein 48-like isofo...  97.8    9e-21   
ref|XP_010248509.1|  PREDICTED: RNA-binding protein 48-like isofo...  98.2    1e-20   
ref|XP_011000881.1|  PREDICTED: uncharacterized protein LOC105108315  98.2    1e-20   
ref|XP_010248511.1|  PREDICTED: RNA-binding protein 48-like isofo...  98.2    1e-20   
ref|NP_001146882.1|  nucleic acid binding protein                     97.8    1e-20   Zea mays [maize]
ref|NP_001045616.1|  Os02g0105000                                     97.4    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72303.1|  hypothetical protein OsI_05486                        97.4    2e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_010038349.1|  PREDICTED: RNA-binding protein 48                97.4    2e-20   
gb|KCW50162.1|  hypothetical protein EUGRSUZ_K03598                   97.8    2e-20   
gb|EPS71983.1|  hypothetical protein M569_02780                       94.4    2e-20   
ref|XP_010242599.1|  PREDICTED: RNA-binding protein 48-like isofo...  95.5    8e-20   
ref|XP_010242592.1|  PREDICTED: RNA-binding protein 48-like isofo...  95.5    9e-20   
ref|XP_010553737.1|  PREDICTED: RNA-binding protein 48                95.1    1e-19   
gb|KDP42233.1|  hypothetical protein JCGZ_02963                       94.4    2e-19   
ref|XP_002525357.1|  nucleic acid binding protein, putative           94.4    2e-19   Ricinus communis
ref|XP_004142975.1|  PREDICTED: RNA-binding protein 48-like           95.1    2e-19   
ref|XP_004161064.1|  PREDICTED: RNA-binding protein 48-like           95.1    2e-19   
ref|XP_008444339.1|  PREDICTED: RNA-binding protein 48 isoform X1     94.4    2e-19   
ref|XP_003570574.1|  PREDICTED: RNA-binding protein 48-like isofo...  92.0    1e-18   
ref|XP_011071101.1|  PREDICTED: uncharacterized protein LOC105156...  88.6    8e-18   
ref|XP_001754907.1|  predicted protein                                81.6    1e-15   
ref|XP_008444344.1|  PREDICTED: RNA-binding protein 48 isoform X2     82.0    2e-15   
ref|XP_006483892.1|  PREDICTED: RNA-binding protein 48-like isofo...  79.7    1e-14   
ref|XP_006840686.1|  hypothetical protein AMTR_s00096p00065500        79.7    2e-14   
ref|XP_009772566.1|  PREDICTED: RNA-binding protein 48 isoform X2     78.6    5e-14   
gb|KDP26611.1|  hypothetical protein JCGZ_17769                       77.4    6e-14   
ref|XP_008447649.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  75.5    2e-13   
ref|XP_002962994.1|  hypothetical protein SELMODRAFT_78456            70.1    4e-12   
ref|XP_010100438.1|  hypothetical protein L484_027749                 70.9    2e-11   
ref|XP_010233663.1|  PREDICTED: RNA-binding protein 48-like isofo...  70.1    3e-11   
ref|XP_009394915.1|  PREDICTED: uncharacterized protein LOC103980...  69.7    5e-11   
ref|XP_006591560.1|  PREDICTED: uncharacterized protein LOC102659846  67.8    8e-11   
ref|XP_003387780.1|  PREDICTED: hypothetical protein LOC100632124     70.9    2e-10   
gb|EMS49084.1|  hypothetical protein TRIUR3_01800                     67.4    2e-10   
gb|EMT04055.1|  hypothetical protein F775_06824                       67.8    7e-10   
gb|ESA19383.1|  hypothetical protein GLOINDRAFT_136191                65.5    7e-10   
ref|XP_008794792.1|  PREDICTED: RNA-binding protein 48-like isofo...  65.1    2e-09   
ref|XP_008794790.1|  PREDICTED: RNA-binding protein 48-like isofo...  65.5    2e-09   
ref|XP_008794791.1|  PREDICTED: RNA-binding protein 48-like isofo...  65.5    2e-09   
gb|EMT12306.1|  hypothetical protein F775_04241                       64.7    3e-09   
gb|EXX76017.1|  hypothetical protein RirG_036860                      65.9    3e-09   
ref|XP_009123439.1|  PREDICTED: uncharacterized protein LOC103848237  63.2    8e-09   
ref|XP_004343650.1|  hypothetical protein ACA1_098970                 59.7    9e-08   
ref|XP_006270202.1|  PREDICTED: RNA-binding protein 48 isoform X4     59.7    6e-07   
gb|AAH91857.1|  Dkfzp564o0523 protein                                 59.3    1e-06   Danio rerio [leopard danio]
ref|NP_991167.1|  RNA-binding protein 48                              58.9    1e-06   Danio rerio [leopard danio]
sp|A4FVJ7.1|RBM48_DANRE  RecName: Full=RNA-binding protein 48         58.9    1e-06   Danio rerio [leopard danio]
ref|XP_006270200.1|  PREDICTED: RNA-binding protein 48 isoform X2     58.9    1e-06   
ref|XP_006270199.1|  PREDICTED: RNA-binding protein 48 isoform X1     58.9    1e-06   
ref|XP_007259854.1|  PREDICTED: RNA-binding protein 48 isoform X2     58.5    2e-06   
ref|XP_001625251.1|  predicted protein                                56.2    2e-06   Nematostella vectensis
ref|XP_007259853.1|  PREDICTED: RNA-binding protein 48 isoform X1     58.5    2e-06   
ref|XP_007440856.1|  PREDICTED: RNA-binding protein 48                58.2    2e-06   
emb|CAG10029.1|  unnamed protein product                              55.8    2e-06   Tetraodon nigroviridis
gb|AAC73021.1|  hypothetical protein                                  57.0    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006002691.1|  PREDICTED: RNA-binding protein 48                58.2    2e-06   
ref|XP_005797466.1|  PREDICTED: RNA-binding protein 48-like           56.6    3e-06   
ref|XP_007259855.1|  PREDICTED: RNA-binding protein 48 isoform X3     57.8    3e-06   
gb|ETE68581.1|  hypothetical protein L345_05617                       57.4    4e-06   
ref|XP_006035020.1|  PREDICTED: RNA-binding protein 48                57.4    4e-06   
gb|ELU06368.1|  hypothetical protein CAPTEDRAFT_77168                 54.7    4e-06   
ref|XP_002600684.1|  hypothetical protein BRAFLDRAFT_67748            57.8    5e-06   Branchiostoma floridae
ref|XP_003222153.1|  PREDICTED: RNA-binding protein 48 isoform X1     57.0    5e-06   
ref|XP_007547652.1|  PREDICTED: RNA-binding protein 48                56.6    6e-06   
ref|XP_002934632.1|  PREDICTED: RNA-binding protein 48                56.6    7e-06   
ref|XP_008420044.1|  PREDICTED: RNA-binding protein 48                56.6    7e-06   
gb|AAI59329.1|  LOC100145247 protein                                  56.6    7e-06   Xenopus tropicalis [western clawed frog]
ref|XP_006787794.1|  PREDICTED: RNA-binding protein 48-like           56.6    8e-06   
ref|XP_008288690.1|  PREDICTED: RNA-binding protein 48                56.6    8e-06   
ref|XP_005478693.1|  PREDICTED: RNA-binding protein 48-like           56.6    8e-06   
ref|XP_005728352.1|  PREDICTED: RNA-binding protein 48-like           56.2    9e-06   
ref|XP_004548050.1|  PREDICTED: RNA-binding protein 48-like           56.2    9e-06   
ref|XP_006381996.1|  hypothetical protein POPTR_0006s23790g           53.1    9e-06   
ref|XP_006636220.1|  PREDICTED: RNA-binding protein 48-like           55.8    1e-05   
ref|XP_010733147.1|  PREDICTED: RNA-binding protein 48                56.2    1e-05   
ref|XP_004074393.1|  PREDICTED: RNA-binding protein 48-like           55.5    2e-05   
ref|XP_006114537.1|  PREDICTED: RNA-binding protein 48                55.1    2e-05   
ref|XP_008329807.1|  PREDICTED: RNA-binding protein 48 isoform X1     55.1    2e-05   
ref|XP_009708761.1|  PREDICTED: RNA-binding protein 48                55.1    2e-05   
gb|KFP56389.1|  RNA-binding protein 48                                55.1    2e-05   
ref|XP_005308590.1|  PREDICTED: RNA-binding protein 48 isoform X1     55.1    2e-05   
ref|XP_008605748.1|  hypothetical protein SDRG_01969                  52.8    3e-05   
ref|XP_008329808.1|  PREDICTED: RNA-binding protein 48 isoform X2     54.7    3e-05   
ref|XP_005308589.1|  PREDICTED: RNA-binding protein 48 isoform X2     54.7    3e-05   
ref|XP_003968928.1|  PREDICTED: RNA-binding protein 48-like           54.3    3e-05   
ref|XP_010889825.1|  PREDICTED: RNA-binding protein 48                54.7    4e-05   
gb|EOB07627.1|  Uncharacterized protein DKFZP564O0523-like protein    53.9    5e-05   
ref|XP_007901284.1|  PREDICTED: RNA-binding protein 48                54.3    5e-05   
gb|KGL74274.1|  RNA-binding protein 48                                53.9    5e-05   
ref|XP_005011017.1|  PREDICTED: RNA-binding protein 48                53.9    5e-05   
ref|XP_010226484.1|  PREDICTED: RNA-binding protein 48                53.5    6e-05   
gb|KFP85219.1|  RNA-binding protein 48                                53.5    7e-05   
ref|XP_009077729.1|  PREDICTED: RNA-binding protein 48                53.5    7e-05   
ref|XP_009914558.1|  PREDICTED: RNA-binding protein 48                53.5    7e-05   
gb|KFQ87296.1|  RNA-binding protein 48                                53.5    8e-05   
gb|KFV39293.1|  RNA-binding protein 48                                53.5    8e-05   
ref|XP_009962099.1|  PREDICTED: RNA-binding protein 48                53.5    8e-05   
ref|XP_010289565.1|  PREDICTED: RNA-binding protein 48                53.5    8e-05   
ref|XP_009807324.1|  PREDICTED: RNA-binding protein 48                53.1    8e-05   
ref|XP_005152987.1|  PREDICTED: RNA-binding protein 48                53.5    8e-05   
ref|XP_009870257.1|  PREDICTED: RNA-binding protein 48                53.1    8e-05   
gb|KFP77288.1|  RNA-binding protein 48                                53.1    8e-05   
gb|KFZ60951.1|  RNA-binding protein 48                                53.1    8e-05   
ref|XP_005505024.1|  PREDICTED: RNA-binding protein 48                53.5    9e-05   
ref|XP_007654332.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  53.1    9e-05   
gb|KFV08742.1|  RNA-binding protein 48                                53.1    9e-05   
gb|KFO88797.1|  RNA-binding protein 48                                53.1    9e-05   
gb|KFQ01835.1|  RNA-binding protein 48                                53.1    9e-05   
ref|XP_006732719.1|  PREDICTED: RNA-binding protein 48                53.1    9e-05   
ref|XP_004394152.1|  PREDICTED: RNA-binding protein 48                53.1    9e-05   
gb|KFP36379.1|  RNA-binding protein 48                                53.1    9e-05   
ref|XP_009273992.1|  PREDICTED: RNA-binding protein 48                53.1    9e-05   
ref|XP_004175555.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  53.1    1e-04   
ref|XP_004806290.1|  PREDICTED: RNA-binding protein 48                53.1    1e-04   
emb|CEG74620.1|  hypothetical protein RMATCC62417_09798               51.2    1e-04   
gb|KFQ51355.1|  RNA-binding protein 48                                53.1    1e-04   
ref|XP_010120184.1|  PREDICTED: RNA-binding protein 48                53.1    1e-04   
gb|EMC87748.1|  UPF0712 protein C7orf64 like protein                  53.1    1e-04   
gb|KFQ79091.1|  RNA-binding protein 48                                53.1    1e-04   
ref|XP_004776489.1|  PREDICTED: RNA-binding protein 48                53.1    1e-04   
gb|KDO30977.1|  hypothetical protein SPRG_04165                       53.1    1e-04   
ref|XP_009480562.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
ref|XP_010776395.1|  PREDICTED: RNA-binding protein 48                53.1    1e-04   
gb|KGL95654.1|  RNA-binding protein 48                                53.1    1e-04   
ref|XP_007938006.1|  PREDICTED: RNA-binding protein 48                53.1    1e-04   
gb|KFH62681.1|  hypothetical protein MVEG_12073                       51.2    1e-04   
gb|KFP47272.1|  RNA-binding protein 48                                53.1    1e-04   
ref|XP_010188085.1|  PREDICTED: RNA-binding protein 48                53.1    1e-04   
ref|XP_010132908.1|  PREDICTED: RNA-binding protein 48                53.1    1e-04   
ref|XP_004646315.1|  PREDICTED: RNA-binding protein 48                51.6    1e-04   
gb|KFR11954.1|  RNA-binding protein 48                                52.8    1e-04   
ref|XP_010073950.1|  PREDICTED: RNA-binding protein 48                53.1    1e-04   
ref|XP_009571047.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
gb|KFV74458.1|  RNA-binding protein 48                                52.8    1e-04   
gb|KFW00304.1|  RNA-binding protein 48                                52.8    1e-04   
gb|KFM05096.1|  RNA-binding protein 48                                52.8    1e-04   
ref|XP_007522550.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
ref|XP_003475148.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
ref|XP_009328858.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
ref|XP_010569696.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
ref|XP_009464882.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
gb|KFU92586.1|  RNA-binding protein 48                                52.8    1e-04   
gb|KFW71712.1|  RNA-binding protein 48                                52.8    1e-04   
ref|XP_007060372.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
ref|XP_009557185.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
gb|KFO12951.1|  RNA-binding protein 48                                52.8    1e-04   
gb|ELW56947.1|  hypothetical protein TREES_T100019553                 53.1    1e-04   
ref|XP_010304944.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
gb|KFO74657.1|  RNA-binding protein 48                                52.8    1e-04   
ref|XP_009501017.1|  PREDICTED: RNA-binding protein 48                52.4    1e-04   
gb|KFW96341.1|  RNA-binding protein 48                                52.4    1e-04   
ref|XP_009956536.1|  PREDICTED: RNA-binding protein 48                52.4    1e-04   
gb|KFQ01048.1|  RNA-binding protein 48                                52.4    1e-04   
ref|XP_009886218.1|  PREDICTED: RNA-binding protein 48                52.8    1e-04   
ref|XP_002998328.1|  conserved hypothetical protein                   51.6    1e-04   
ref|XP_006155600.1|  PREDICTED: RNA-binding protein 48                52.8    2e-04   
ref|XP_009934472.1|  PREDICTED: RNA-binding protein 48                52.8    2e-04   
ref|XP_009999889.1|  PREDICTED: RNA-binding protein 48                52.4    2e-04   
gb|KFP09669.1|  RNA-binding protein 48                                52.4    2e-04   
ref|XP_009906318.1|  PREDICTED: RNA-binding protein 48                52.4    2e-04   
ref|XP_006160651.1|  PREDICTED: RNA-binding protein 48-like           52.4    2e-04   
ref|XP_010020846.1|  PREDICTED: RNA-binding protein 48                52.4    2e-04   
gb|KFQ44766.1|  RNA-binding protein 48                                52.4    2e-04   
ref|XP_009639681.1|  PREDICTED: RNA-binding protein 48                52.4    2e-04   
ref|XP_009977199.1|  PREDICTED: RNA-binding protein 48                52.0    2e-04   
gb|KFW75767.1|  RNA-binding protein 48                                52.0    3e-04   
ref|NP_001026145.1|  RNA-binding protein 48                           52.0    3e-04   Gallus gallus [bantam]
ref|XP_004656287.1|  PREDICTED: RNA-binding protein 48                52.0    3e-04   
emb|CDQ86166.1|  unnamed protein product                              52.0    3e-04   
dbj|BAC31089.1|  unnamed protein product                              49.3    3e-04   Mus musculus [mouse]
gb|KFZ66366.1|  RNA-binding protein 48                                51.6    3e-04   
ref|XP_010710988.1|  PREDICTED: RNA-binding protein 48                51.6    3e-04   
ref|XP_010174507.1|  PREDICTED: RNA-binding protein 48                51.6    3e-04   
gb|KFV90167.1|  RNA-binding protein 48                                51.6    3e-04   
gb|AAH20919.1|  C7orf64 protein                                       49.7    3e-04   Homo sapiens [man]
ref|XP_010153913.1|  PREDICTED: RNA-binding protein 48                51.6    3e-04   
gb|AAF28982.1|AF161422_1  HSPC304                                     49.3    3e-04   Homo sapiens [man]
ref|XP_005518854.1|  PREDICTED: RNA-binding protein 48                51.6    3e-04   
ref|XP_009672621.1|  PREDICTED: RNA-binding protein 48                51.6    3e-04   
ref|XP_004702714.1|  PREDICTED: RNA-binding protein 48                51.6    3e-04   
gb|KFV80942.1|  RNA-binding protein 48                                51.2    4e-04   
ref|XP_005041157.1|  PREDICTED: RNA-binding protein 48                51.2    4e-04   
ref|XP_005228874.1|  PREDICTED: RNA-binding protein 48                51.2    4e-04   
ref|XP_005432237.1|  PREDICTED: RNA-binding protein 48                51.2    4e-04   
ref|XP_004908823.1|  PREDICTED: RNA-binding protein 48                51.2    4e-04   
ref|XP_008931559.1|  PREDICTED: RNA-binding protein 48                51.2    4e-04   
ref|XP_011019354.1|  PREDICTED: uncharacterized protein LOC105122127  48.5    5e-04   
ref|XP_008259956.1|  PREDICTED: RNA-binding protein 48-like           51.2    5e-04   
ref|XP_003771970.1|  PREDICTED: RNA-binding protein 48                50.8    5e-04   
dbj|BAG57807.1|  unnamed protein product                              49.3    5e-04   Homo sapiens [man]
ref|XP_539419.3|  PREDICTED: RNA-binding protein 48 isoform X2        50.8    6e-04   Canis lupus familiaris [dogs]
ref|XP_008259964.1|  PREDICTED: RNA-binding protein 48-like           50.8    6e-04   
ref|XP_008570478.1|  PREDICTED: RNA-binding protein 48 isoform X1     50.8    6e-04   
ref|XP_008570485.1|  PREDICTED: RNA-binding protein 48 isoform X2     50.8    6e-04   
gb|KFQ18039.1|  RNA-binding protein 48                                50.4    6e-04   
gb|EFB29063.1|  hypothetical protein PANDA_021537                     50.8    6e-04   Ailuropoda melanoleuca
ref|XP_008935901.1|  PREDICTED: RNA-binding protein 48                50.4    6e-04   
ref|XP_005418693.1|  PREDICTED: RNA-binding protein 48                50.4    6e-04   
ref|XP_002930905.1|  PREDICTED: UPF0712 protein C7orf64-like          50.4    7e-04   
ref|XP_009084196.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  50.4    7e-04   
ref|XP_005480311.1|  PREDICTED: RNA-binding protein 48                50.4    8e-04   
ref|XP_008684458.1|  PREDICTED: RNA-binding protein 48                50.4    8e-04   
ref|XP_007076768.1|  PREDICTED: RNA-binding protein 48                50.4    8e-04   
ref|XP_003982794.1|  PREDICTED: RNA-binding protein 48                50.4    8e-04   
emb|CAH91725.1|  hypothetical protein                                 50.1    0.001   Pongo abelii [orang utan]
ref|XP_004475763.1|  PREDICTED: RNA-binding protein 48 isoform 1      50.1    0.001   
ref|XP_004602343.1|  PREDICTED: RNA-binding protein 48                50.1    0.001   
ref|XP_008628211.1|  PREDICTED: RNA-binding protein 48                50.1    0.001   



>ref|XP_009772565.1| PREDICTED: RNA-binding protein 48 isoform X1 [Nicotiana sylvestris]
Length=231

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVP+LGCGD L+KLF+TYGE+EECKPMD EDCEPFTDV+WIKF RVDNA
Sbjct  21   KYLIVRNVPALGCGDQLSKLFSTYGEIEECKPMDGEDCEPFTDVFWIKFYRVDNA  75


 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  352  RDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            + S +T+VSS+KEYF S+SMNQTV+LVREKL KIQSS +H E   SK+ RVDNRRRI
Sbjct  175  KGSPVTMVSSDKEYFPSQSMNQTVKLVREKLKKIQSSVDHLEGEPSKRKRVDNRRRI  231



>ref|XP_009606401.1| PREDICTED: RNA-binding protein 48 isoform X2 [Nicotiana tomentosiformis]
Length=188

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVP+LGCGD L+KLF+TYGE+EECKPMDAEDCE FTDV+WIKF RVDNA
Sbjct  21   KYLIVRNVPALGCGDQLSKLFSTYGEIEECKPMDAEDCEQFTDVFWIKFYRVDNA  75



>gb|EYU22506.1| hypothetical protein MIMGU_mgv1a022373mg [Erythranthe guttata]
Length=224

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  33   PRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
             +FLIVRNVPSLGCGD LA+LF+TYG+VEECKPMDAEDCE +TDVYWIKF +V+NA
Sbjct  20   SKFLIVRNVPSLGCGDQLAQLFSTYGQVEECKPMDAEDCEQYTDVYWIKFHQVNNA  75


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = +1

Query  388  EYFSSESMNQTVRLVREKLNKIQS-SAEHSEAGASKKVRVDNRRRI  522
            EYF SESMN+TV LVR+KLNKIQS S+EH+EAG+SKK RVDNRRRI
Sbjct  179  EYFPSESMNRTVHLVRDKLNKIQSTSSEHTEAGSSKKARVDNRRRI  224



>ref|XP_009394906.1| PREDICTED: RNA-binding protein 48 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=236

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL++LF +YGE+EECKPMDAEDC+PFTDVYWIKF +V NA
Sbjct  21   RYLIVRNVPALGCGDDLSRLFGSYGEIEECKPMDAEDCDPFTDVYWIKFSQVSNA  75


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +1

Query  301  LEINQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSE-  477
            L+  Q +F    + ++  ++ ++ VSSNKEYF + SMN+TVRLVREKL+KIQS + +++ 
Sbjct  162  LQGRQREFARGGQISHVGNAPLSHVSSNKEYFPTPSMNETVRLVREKLDKIQSRSGNTDT  221

Query  478  AGASKKVRVDNRRRI  522
            A ASK+ +VDNRRRI
Sbjct  222  ASASKRAKVDNRRRI  236



>ref|XP_009606400.1| PREDICTED: RNA-binding protein 48 isoform X1 [Nicotiana tomentosiformis]
Length=227

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVP+LGCGD L+KLF+TYGE+EECKPMDAEDCE FTDV+WIKF RVDNA
Sbjct  21   KYLIVRNVPALGCGDQLSKLFSTYGEIEECKPMDAEDCEQFTDVFWIKFYRVDNA  75


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  358  SSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            S  T +SS+KEYF S+SMNQTV+LVREKL+KI+SS +H E   SK+ RVDNRRRI
Sbjct  173  SPATTISSDKEYFPSQSMNQTVKLVREKLDKIKSSVDHLEGEPSKRKRVDNRRRI  227



>ref|XP_008794789.1| PREDICTED: RNA-binding protein 48-like isoform X2 [Phoenix dactylifera]
Length=235

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGD+L KLF +YGE+EECKPMDAEDCEPFTDVYWIKF +V NA
Sbjct  21   RYLIVRNVPALGCGDELLKLFGSYGEIEECKPMDAEDCEPFTDVYWIKFSQVGNA  75


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +1

Query  355  DSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            D  ++ VSSNKEYF+S SMN+TVRLVR KL+KI S++E   A ASK+ R DNRRRI
Sbjct  182  DDFISHVSSNKEYFASASMNETVRLVRGKLDKIHSTSE--VAPASKRTRPDNRRRI  235



>emb|CDP12133.1| unnamed protein product [Coffea canephora]
Length=217

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++L+V+NVP+LGCGD+L +LF+TYG++EECKPMDAEDCEPFTDVYWIKF +VDNA
Sbjct  21   KYLVVKNVPALGCGDELLRLFSTYGQIEECKPMDAEDCEPFTDVYWIKFHQVDNA  75


 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 66/105 (63%), Gaps = 14/105 (13%)
 Frame = +1

Query  211  SKSSAIPGPGPDAAsksiitstsshitskPLEINQSQFMEPQETANNRDS-SMTIVSSNK  387
            S +SA  G GP A               + L + Q +F +   TA +  S SMT VSS+K
Sbjct  126  SNASAAYGHGPSA-------------RDQSLGLQQREFGDSHYTARSGGSASMTHVSSDK  172

Query  388  EYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            EYF  ESMNQTVRLVREKLN+IQSS ++SE  +SK+ RVDNRRRI
Sbjct  173  EYFPLESMNQTVRLVREKLNEIQSSTDNSEVQSSKRPRVDNRRRI  217



>ref|XP_008794788.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Phoenix dactylifera]
Length=244

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGD+L KLF +YGE+EECKPMDAEDCEPFTDVYWIKF +V NA
Sbjct  21   RYLIVRNVPALGCGDELLKLFGSYGEIEECKPMDAEDCEPFTDVYWIKFSQVGNA  75


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +1

Query  355  DSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            D  ++ VSSNKEYF+S SMN+TVRLVR KL+KI S++E   A ASK+ R DNRRRI
Sbjct  191  DDFISHVSSNKEYFASASMNETVRLVRGKLDKIHSTSE--VAPASKRTRPDNRRRI  244



>ref|XP_006356616.1| PREDICTED: RNA-binding protein 48-like [Solanum tuberosum]
Length=230

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++L+VRNVP+LGCGD L++LF+TYGE+EECKPMDAEDCEPFTDV+WI+F RVDNA
Sbjct  21   KYLVVRNVPALGCGDQLSQLFSTYGEIEECKPMDAEDCEPFTDVFWIRFCRVDNA  75


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  358  SSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            S +T+VSS+KEYF S+SMNQTV+LVR+KLNKIQSSA+H E   SK+ RVDNRRRI
Sbjct  177  SPITMVSSDKEYFPSQSMNQTVKLVRDKLNKIQSSADHLEE-PSKRKRVDNRRRI  230



>ref|XP_011071098.1| PREDICTED: RNA-binding protein 48 isoform X1 [Sesamum indicum]
 ref|XP_011071100.1| PREDICTED: RNA-binding protein 48 isoform X1 [Sesamum indicum]
Length=224

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVPSLGCGD+L KLF+TYG+VEECKPMDAE+CEP+TDVYWIKF  V NA
Sbjct  21   KYLIVRNVPSLGCGDELLKLFSTYGQVEECKPMDAEECEPYTDVYWIKFHLVSNA  75


 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  307  INQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGA  486
            + QSQ  + Q       SSM   SS+KEYF  ESMN+TV+LVR+KLNKIQSS  H+EAG+
Sbjct  153  VAQSQMSKSQAAPGGHKSSMLSASSDKEYFPVESMNRTVQLVRDKLNKIQSSTNHTEAGS  212

Query  487  SKKVRVDNRRRI  522
            SK+ RVDNRRRI
Sbjct  213  SKRARVDNRRRI  224



>ref|XP_010510724.1| PREDICTED: RNA-binding protein 48-like [Camelina sativa]
 ref|XP_010510725.1| PREDICTED: RNA-binding protein 48-like [Camelina sativa]
Length=224

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGD+L KLF TYGEVEECKPMDAEDCE FTDVYWIKF+ V NA
Sbjct  21   RYLIVRNVPALGCGDELMKLFMTYGEVEECKPMDAEDCEEFTDVYWIKFRLVTNA  75


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 8/65 (12%)
 Frame = +1

Query  352  RDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS--------KKVRVD  507
            R++ ++ VSSN+EYF+S SMNQTV  VREKLNKI+ S        S        K+ RVD
Sbjct  160  RNAPVSRVSSNQEYFASSSMNQTVNAVREKLNKIEESGNQKRLQPSSQTPQPDLKRTRVD  219

Query  508  NRRRI  522
            NRRRI
Sbjct  220  NRRRI  224



>ref|XP_010417928.1| PREDICTED: RNA-binding protein 48-like [Camelina sativa]
Length=224

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL +LF TYGEVEECKPMDAEDCE FTDVYWIKF+ + NA
Sbjct  21   RYLIVRNVPALGCGDDLMRLFMTYGEVEECKPMDAEDCEEFTDVYWIKFRLITNA  75


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 8/65 (12%)
 Frame = +1

Query  352  RDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS--------KKVRVD  507
            R++ ++ VSSN+EYF+S SMNQTV  VREKLNKI+ S        S        K+ RVD
Sbjct  160  RNAPVSRVSSNQEYFASSSMNQTVNTVREKLNKIEESGNQKRLQPSSQTPQPDLKRTRVD  219

Query  508  NRRRI  522
            NRRRI
Sbjct  220  NRRRI  224



>ref|XP_002263764.1| PREDICTED: RNA-binding protein 48 [Vitis vinifera]
 emb|CBI28556.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL  LF +YG++EECKPMDAEDCEPFTDVYWIKF+ V NA
Sbjct  21   RYLIVRNVPALGCGDDLLNLFASYGDIEECKPMDAEDCEPFTDVYWIKFRLVSNA  75


 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +1

Query  301  LEINQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEA  480
            +  NQ    E    +  +DSS+T VSSN++YF S SMNQTVRLVREKL+KIQSS++H EA
Sbjct  156  MSFNQRISGESDHVSRIKDSSITTVSSNQDYFGSPSMNQTVRLVREKLDKIQSSSQHLEA  215

Query  481  G-ASKKVRVDNRRRI  522
            G A KK RVDNRRRI
Sbjct  216  GPAFKKTRVDNRRRI  230



>ref|XP_004245239.1| PREDICTED: RNA-binding protein 48 isoform X1 [Solanum lycopersicum]
Length=230

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVP+LGCGD L++LF+TYGE+EECKPMD EDCEPFTDV+WI+F RVDNA
Sbjct  21   KYLIVRNVPALGCGDQLSQLFSTYGEIEECKPMDDEDCEPFTDVFWIRFCRVDNA  75


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +1

Query  358  SSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            S MT+ SS+KEYF S+SMNQTV+LVR+KLNKIQSS +H E   SK+ RVDNRRRI
Sbjct  177  SPMTMGSSDKEYFPSQSMNQTVKLVRDKLNKIQSSTDHLEE-PSKRKRVDNRRRI  230



>ref|XP_010325151.1| PREDICTED: RNA-binding protein 48 isoform X2 [Solanum lycopersicum]
Length=210

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVP+LGCGD L++LF+TYGE+EECKPMD EDCEPFTDV+WI+F RVDNA
Sbjct  21   KYLIVRNVPALGCGDQLSQLFSTYGEIEECKPMDDEDCEPFTDVFWIRFCRVDNA  75



>gb|AFK37542.1| unknown [Lotus japonicus]
Length=222

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL +LF++YGE+EEC PMDAEDCEPFTDVYWIKF+  +NA
Sbjct  21   RYLIVRNVPALGCGDDLRQLFSSYGEIEECHPMDAEDCEPFTDVYWIKFRLFNNA  75


 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +1

Query  373  VSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            VSSN++YF+S SMNQTV++VR+KL+KIQSS EH + G  SKK RVDNRRRI
Sbjct  172  VSSNEDYFASHSMNQTVKVVRDKLDKIQSSGEHLQDGPVSKKSRVDNRRRI  222



>ref|XP_006409787.1| hypothetical protein EUTSA_v10017205mg [Eutrema salsugineum]
 gb|ESQ51240.1| hypothetical protein EUTSA_v10017205mg [Eutrema salsugineum]
Length=227

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+L+VRNVP+LGCG+DL +LFTTYGEVEECKPMDAEDCE FTDVYWIKF+ + N+
Sbjct  21   RYLVVRNVPALGCGEDLMRLFTTYGEVEECKPMDAEDCEDFTDVYWIKFRLITNS  75


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 12/76 (16%)
 Frame = +1

Query  325  MEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS-----  489
            ME Q   + R++ ++ VSS++EYF+S SMNQTV  VREKLNKIQ S        S     
Sbjct  154  MEYQ--FHRRNAPISRVSSDQEYFASSSMNQTVHTVREKLNKIQESGNQKRLQPSSQHLQ  211

Query  490  -----KKVRVDNRRRI  522
                 K+ RVDNRRRI
Sbjct  212  TEPDFKRTRVDNRRRI  227



>ref|XP_006294958.1| hypothetical protein CARUB_v10024014mg [Capsella rubella]
 gb|EOA27856.1| hypothetical protein CARUB_v10024014mg [Capsella rubella]
Length=223

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL +LF TYG+VEECKPMDAEDCE FTDVYWIKF+ + NA
Sbjct  21   RYLIVRNVPALGCGDDLMRLFMTYGDVEECKPMDAEDCEEFTDVYWIKFRLITNA  75


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 9/77 (12%)
 Frame = +1

Query  313  QSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS-  489
            Q + ME Q   + R++ +  VSSN+EYF+S SMNQTV+ VREKLNKI+ S        S 
Sbjct  149  QRRVMEYQ--FHRRNAPIPRVSSNQEYFASSSMNQTVKTVREKLNKIEESGNQKRLQPSS  206

Query  490  ------KKVRVDNRRRI  522
                  K+ R+DNRRRI
Sbjct  207  QTQPDLKRTRIDNRRRI  223



>gb|ACJ85604.1| unknown [Medicago truncatula]
 gb|AFK34153.1| unknown [Medicago truncatula]
 gb|AFK46077.1| unknown [Medicago truncatula]
Length=222

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCG+DL +LF+TYGEVEECKPMDAEDCE FTDVYWIKF    NA
Sbjct  21   RYLIVRNVPALGCGNDLMQLFSTYGEVEECKPMDAEDCEQFTDVYWIKFHLFSNA  75


 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 8/78 (10%)
 Frame = +1

Query  313  QSQFMEPQETA-------NNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEH  471
            QS+ ++P +++       NN +     VSSN++YFSS SMNQTVR+VR KL+KIQSS EH
Sbjct  145  QSEHLDPNQSSQEFEVRSNNSNLPKRTVSSNEDYFSSHSMNQTVRVVRAKLDKIQSSGEH  204

Query  472  SEAGA-SKKVRVDNRRRI  522
             +AG+ SKK RVDNRRRI
Sbjct  205  LQAGSTSKKARVDNRRRI  222



>gb|KEH28235.1| RNA recognition motif protein [Medicago truncatula]
Length=221

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCG+DL +LF+TYGEVEECKPMDAEDCE FTDVYWIKF    NA
Sbjct  21   RYLIVRNVPALGCGNDLMQLFSTYGEVEECKPMDAEDCEQFTDVYWIKFHLFSNA  75


 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 3/75 (4%)
 Frame = +1

Query  301  LEINQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEA  480
            L+ NQSQ  E +  +NN +     VSSN++YFSS SMNQTVR+VR+KL+KIQSS EH +A
Sbjct  149  LDPNQSQEFEVR--SNNSNLPKRTVSSNEDYFSSHSMNQTVRVVRDKLDKIQSSGEHLQA  206

Query  481  GA-SKKVRVDNRRRI  522
            G+ SKK RVDNRRRI
Sbjct  207  GSTSKKARVDNRRRI  221



>ref|XP_003616248.1| hypothetical protein MTR_5g077780 [Medicago truncatula]
 gb|AES99206.1| RNA recognition motif protein [Medicago truncatula]
Length=222

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCG+DL +LF+TYGEVEECKPMDAEDCE FTDVYWIKF    NA
Sbjct  21   RYLIVRNVPALGCGNDLMQLFSTYGEVEECKPMDAEDCEQFTDVYWIKFHLFSNA  75


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 8/78 (10%)
 Frame = +1

Query  313  QSQFMEPQETA-------NNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEH  471
            QS+ ++P +++       NN +     VSSN++YFSS SMNQTVR+VR+KL+KIQSS EH
Sbjct  145  QSEHLDPNQSSQEFEVRSNNSNLPKRTVSSNEDYFSSHSMNQTVRVVRDKLDKIQSSGEH  204

Query  472  SEAGA-SKKVRVDNRRRI  522
             +AG+ SKK RVDNRRRI
Sbjct  205  LQAGSTSKKARVDNRRRI  222



>ref|XP_004509295.1| PREDICTED: RNA-binding protein 48-like [Cicer arietinum]
Length=231

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL +LF++YGEVEECKPMDAEDCE FTDVYWIKF+   NA
Sbjct  30   RYLIVRNVPALGCGDDLLQLFSSYGEVEECKPMDAEDCEQFTDVYWIKFRLFSNA  84


 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = +1

Query  370  IVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGA-SKKVRVDNRRRI  522
            +VSSN++YF S SMNQTVR VR+KL+KIQSS EH +AG+ SKK RVDNRRRI
Sbjct  180  MVSSNEDYFPSRSMNQTVRFVRDKLDKIQSSGEHLQAGSTSKKARVDNRRRI  231



>ref|XP_010682529.1| PREDICTED: RNA-binding protein 48 [Beta vulgaris subsp. vulgaris]
Length=228

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVP+LGCGD+L +LF TYGEVEECKPMDAE+CE FTDVYWIKFQ + NA
Sbjct  21   KYLIVRNVPALGCGDELRQLFATYGEVEECKPMDAEECEAFTDVYWIKFQLISNA  75


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +1

Query  301  LEINQSQFM-EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSE  477
            L+I Q  +  E  + +    SS T VSS+++YF S SMN+TV+ VREKL+KI+SS+ + +
Sbjct  153  LDIKQGWYTKEMNQISKVHHSSTTRVSSDQDYFPSHSMNETVKRVREKLDKIESSSSNVQ  212

Query  478  AG-ASKKVRVDNRRRI  522
            +G ASKK RVDNRRRI
Sbjct  213  SGPASKKTRVDNRRRI  228



>ref|XP_002879135.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55394.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=223

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL +LF TYGEVEECKPMDAEDC  FTDVYWIKF+ + NA
Sbjct  21   RYLIVRNVPALGCGDDLMRLFMTYGEVEECKPMDAEDCAEFTDVYWIKFRLITNA  75


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 7/60 (12%)
 Frame = +1

Query  364  MTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS-------KKVRVDNRRRI  522
            +T VSS++EYF+S SMNQTV+ VREKLNKI+ S        S       K+ RVDNRRRI
Sbjct  164  VTRVSSDQEYFASSSMNQTVKTVREKLNKIEESGNQKRLQPSSQTQPDLKRTRVDNRRRI  223



>ref|XP_002313579.1| hypothetical protein POPTR_0009s16880g [Populus trichocarpa]
 gb|EEE87534.1| hypothetical protein POPTR_0009s16880g [Populus trichocarpa]
Length=234

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL KLF +YG+VEECKPMDAEDCE FTDVYWIKF+ V NA
Sbjct  26   RYLIVRNVPALGCGDDLFKLFASYGDVEECKPMDAEDCEQFTDVYWIKFRLVSNA  80


 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRV  504
            E Q      D  +T VSS+++YF S+SMNQTVRLVREKLNKIQSS+EH +AG  SKK RV
Sbjct  169  ESQNVHQIGDPPITRVSSDQDYFPSQSMNQTVRLVREKLNKIQSSSEHLQAGPVSKKARV  228

Query  505  DNRRRI  522
            DNRRRI
Sbjct  229  DNRRRI  234



>ref|XP_010473176.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Camelina sativa]
Length=227

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL +LF TYGEVEE KPMDAEDCE FTDVYWIKF+ + NA
Sbjct  21   RYLIVRNVPALGCGDDLMRLFMTYGEVEESKPMDAEDCEEFTDVYWIKFRLITNA  75


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 8/65 (12%)
 Frame = +1

Query  352  RDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS--------KKVRVD  507
            R++ ++ VSSN+EYF+S SMNQTV  VREKLNKI+ S        S        K+ RVD
Sbjct  163  RNAPVSRVSSNQEYFASSSMNQTVNTVREKLNKIEESGNQKRLQPSSQTPQPDLKRTRVD  222

Query  508  NRRRI  522
            NRRRI
Sbjct  223  NRRRI  227



>gb|KHG22348.1| RNA-binding 48 [Gossypium arboreum]
Length=228

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 3/65 (5%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDN---ASS  206
            R+LIVRNVP+LGCGDDL KLF  YG+VEECKPMDAEDCE FTDVYWIKF+ V N   A  
Sbjct  21   RYLIVRNVPALGCGDDLLKLFANYGDVEECKPMDAEDCEQFTDVYWIKFRLVSNCRFAKR  80

Query  207  KIQKF  221
            K+ +F
Sbjct  81   KLDEF  85


 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = +1

Query  358  SSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS-KKVRVDNRRRI  522
            + +T VSS+K+YF S+SMNQTV+ VR+KLNKIQSS EH +AG + KK RVDNRRRI
Sbjct  173  AQITRVSSDKDYFPSQSMNQTVKTVRDKLNKIQSSTEHLQAGPTPKKTRVDNRRRI  228



>emb|CDX71417.1| BnaC04g16520D [Brassica napus]
Length=216

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+L+VR VP+LGCGDDL +LF TYGEVEECKPMDAEDCE FTDVYWIKF+ + NA
Sbjct  21   RYLVVRKVPALGCGDDLMRLFATYGEVEECKPMDAEDCEEFTDVYWIKFRLIANA  75


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 10/69 (14%)
 Frame = +1

Query  346  NNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS----------KK  495
            + R++ +T VSS++EYF S SMNQTV+ VREKLNKI+ S +   + AS          K+
Sbjct  148  HRRNAPITRVSSDQEYFGSSSMNQTVKTVREKLNKIEESGKQKRSEASSQNLQTEPDLKR  207

Query  496  VRVDNRRRI  522
             RVDNRRRI
Sbjct  208  TRVDNRRRI  216



>ref|XP_009103621.1| PREDICTED: RNA-binding protein 48-like [Brassica rapa]
Length=216

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+L+VR VP+LGCGDDL +LF TYGEVEECKPMDAEDCE FTDVYWIKF+ + NA
Sbjct  21   RYLVVRKVPALGCGDDLMRLFATYGEVEECKPMDAEDCEEFTDVYWIKFRLIANA  75


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 13/82 (16%)
 Frame = +1

Query  307  INQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGA  486
            +NQS   E     + R++ +T VSS++EYF S SMNQTV+ VREKLNKI+ S +   + A
Sbjct  138  LNQS---ETDYQFHRRNAPITRVSSDQEYFGSSSMNQTVKTVREKLNKIEESGKQKRSEA  194

Query  487  S----------KKVRVDNRRRI  522
            S          K+ RVDNRRRI
Sbjct  195  SSENLQTEPDLKRTRVDNRRRI  216



>ref|XP_007044689.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Theobroma cacao]
 gb|EOY00521.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Theobroma cacao]
Length=228

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRN+P+LGCGD+L KLF TYG+VEECKPMDAEDCE FTDVYWIKF+ + NA
Sbjct  21   RYLIVRNIPALGCGDELLKLFATYGDVEECKPMDAEDCEQFTDVYWIKFRLISNA  75


 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +1

Query  364  MTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            +T VSS+K+YF S+SMNQTV++VR+KLNKIQSS EH +A  ASKK RVDNRRRI
Sbjct  175  ITRVSSDKDYFPSQSMNQTVKMVRDKLNKIQSSTEHLQAEPASKKTRVDNRRRI  228



>ref|XP_003541147.1| PREDICTED: RNA-binding protein 48 isoform X1 [Glycine max]
 ref|XP_006592132.1| PREDICTED: RNA-binding protein 48 isoform X2 [Glycine max]
 ref|XP_006592133.1| PREDICTED: RNA-binding protein 48 isoform X3 [Glycine max]
 gb|KHN25311.1| RNA-binding protein 48 [Glycine soja]
Length=221

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP LGCGD+L KLF++YGEVEECKPMDAEDCE +TDV+WIKF+ V+NA
Sbjct  21   RYLIVRNVPELGCGDELLKLFSSYGEVEECKPMDAEDCEKYTDVFWIKFRLVNNA  75


 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 48/54 (89%), Gaps = 1/54 (2%)
 Frame = +1

Query  364  MTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            + +VSSN++YF+S SMNQTV LVR+KL+KIQSS E+++AG ASKK RVDNR+RI
Sbjct  168  IRMVSSNEDYFASNSMNQTVSLVRDKLDKIQSSGENTKAGSASKKQRVDNRKRI  221



>gb|ACU17018.1| unknown [Glycine max]
Length=216

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP LGCGD+L KLF++YGEVEECKPMDAEDCE +TDV+WIKF+ V+NA
Sbjct  21   RYLIVRNVPELGCGDELLKLFSSYGEVEECKPMDAEDCEKYTDVFWIKFRLVNNA  75


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = +1

Query  364  MTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVD  507
            + +VSSN++YF+S SMNQTV LVR+KL+KIQSS E+++AG ASKK RVD
Sbjct  168  IRMVSSNEDYFASNSMNQTVSLVRDKLDKIQSSGENTKAGSASKKQRVD  216



>gb|AAQ65149.1| At2g27790 [Arabidopsis thaliana]
 dbj|BAF02200.1| hypothetical protein [Arabidopsis thaliana]
Length=240

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R++IVRNVP+LGCGDDL +LF TYGEVEECKPMDAEDC  FTDVYWIKF+ + NA
Sbjct  21   RYMIVRNVPALGCGDDLMRLFMTYGEVEECKPMDAEDCAEFTDVYWIKFRLITNA  75


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (56%), Gaps = 24/77 (31%)
 Frame = +1

Query  364  MTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEH-----------SEAGASKKV----  498
            +T VSS++EYF+S SMNQTV+ VREKLNKI+ S               E+G  K++    
Sbjct  164  VTRVSSDQEYFASSSMNQTVKTVREKLNKIEESGNQKRLQPSSQTQPEESGNQKRLQPSS  223

Query  499  ---------RVDNRRRI  522
                     RVDNRRRI
Sbjct  224  QIQPDLKRTRVDNRRRI  240



>ref|NP_180347.2| RNA recognition motif-containing protein [Arabidopsis thaliana]
 ref|NP_001189622.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEC08044.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEC08045.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=240

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R++IVRNVP+LGCGDDL +LF TYGEVEECKPMDAEDC  FTDVYWIKF+ + NA
Sbjct  21   RYMIVRNVPALGCGDDLMRLFMTYGEVEECKPMDAEDCAEFTDVYWIKFRLITNA  75


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (56%), Gaps = 24/77 (31%)
 Frame = +1

Query  364  MTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEH-----------SEAGASKKV----  498
            +T VSS++EYF+S SMNQTV+ VREKLNKI+ S               E+G  K++    
Sbjct  164  VTRVSSDQEYFASSSMNQTVKTVREKLNKIEESGNQKRLQPSSQTQPEESGNQKRLQPSS  223

Query  499  ---------RVDNRRRI  522
                     RVDNRRRI
Sbjct  224  QIQPDLKRTRVDNRRRI  240



>ref|XP_010473177.1| PREDICTED: RNA-binding protein 48-like isoform X2 [Camelina sativa]
Length=224

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL +LF TYGEVEE KPMDAEDCE FTDVYWIKF+ + NA
Sbjct  21   RYLIVRNVPALGCGDDLMRLFMTYGEVEESKPMDAEDCEEFTDVYWIKFRLITNA  75


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 8/65 (12%)
 Frame = +1

Query  352  RDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS--------KKVRVD  507
            R++ ++ VSSN+EYF+S SMNQTV  VREKLNKI+ S        S        K+ RVD
Sbjct  160  RNAPVSRVSSNQEYFASSSMNQTVNTVREKLNKIEESGNQKRLQPSSQTPQPDLKRTRVD  219

Query  508  NRRRI  522
            NRRRI
Sbjct  220  NRRRI  224



>emb|CDY04512.1| BnaA07g13380D [Brassica napus]
Length=217

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+L+VR VP+LGCGDDL +LF TYGEVEECKPMDAEDCE FTDVYWIKF+ + NA
Sbjct  21   RYLVVRKVPALGCGDDLMRLFATYGEVEECKPMDAEDCEEFTDVYWIKFRLIANA  75


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 10/69 (14%)
 Frame = +1

Query  346  NNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS----------KK  495
            + R++ +T VSS++EYF S SMNQTV+ VREKLNKI+ S +     AS          K+
Sbjct  149  HRRNAPITRVSSDQEYFGSSSMNQTVKTVREKLNKIEESGKQKRPEASSQNLQTEPDLKR  208

Query  496  VRVDNRRRI  522
             RVDNRRRI
Sbjct  209  TRVDNRRRI  217



>emb|CAN63941.1| hypothetical protein VITISV_032503 [Vitis vinifera]
Length=230

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL  LF +YG++EECKPMDAEDCEPFTDVYW KF+ V NA
Sbjct  21   RYLIVRNVPALGCGDDLLNLFASYGDIEECKPMDAEDCEPFTDVYWXKFRLVSNA  75


 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +1

Query  301  LEINQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEA  480
            +  NQ    E    +  +DSS+T VSSN++YF S SMNQTVRLVREKL+KIQSS++H EA
Sbjct  156  MSFNQRISGESDHVSRIKDSSITTVSSNQDYFGSPSMNQTVRLVREKLDKIQSSSQHLEA  215

Query  481  G-ASKKVRVDNRRRI  522
            G A KK RVDNRRRI
Sbjct  216  GPAFKKTRVDNRRRI  230



>ref|XP_006483891.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Citrus sinensis]
Length=230

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVPSLGCGDDL KLF TYG++EECKPMDAEDC+PFTDVY+IKF+   NA
Sbjct  21   RYLIVRNVPSLGCGDDLLKLFATYGDIEECKPMDAEDCDPFTDVYFIKFRLFSNA  75


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRV  504
            E Q  ++  +S +T VSS+K+YF+S+SMNQTVRLVREKLNKI+SS EH +A  ASKK R+
Sbjct  165  ESQRISHVNESPITRVSSDKDYFASQSMNQTVRLVREKLNKIESSTEHLQARPASKKPRI  224

Query  505  DNRRRI  522
            DNRRRI
Sbjct  225  DNRRRI  230



>gb|KDO82364.1| hypothetical protein CISIN_1g026963mg [Citrus sinensis]
Length=187

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVPSLGCGDDL KLF TYG++EECKPMDAEDC+PFTDVY+IKF+   NA
Sbjct  21   RYLIVRNVPSLGCGDDLLKLFATYGDIEECKPMDAEDCDPFTDVYFIKFRLFSNA  75



>ref|XP_006438335.1| hypothetical protein CICLE_v10032655mg [Citrus clementina]
 gb|ESR51575.1| hypothetical protein CICLE_v10032655mg [Citrus clementina]
Length=230

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVPSLGCGDDL KLF TYG++EECKPMDAEDC+PFTDVY+IKF+   NA
Sbjct  21   RYLIVRNVPSLGCGDDLLKLFATYGDIEECKPMDAEDCDPFTDVYFIKFRLFSNA  75


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +1

Query  313  QSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-AS  489
            Q  F E Q  ++  +S +T VSS+K+YF+S+SMNQTVRLVREKLNKI+SS EH +A  AS
Sbjct  160  QRAFSESQRISHVNESPITRVSSDKDYFASQSMNQTVRLVREKLNKIESSTEHLQARPAS  219

Query  490  KKVRVDNRRRI  522
            KK R+DNRRRI
Sbjct  220  KKPRIDNRRRI  230



>gb|KDO82363.1| hypothetical protein CISIN_1g026963mg [Citrus sinensis]
Length=230

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVPSLGCGDDL KLF TYG++EECKPMDAEDC+PFTDVY+IKF+   NA
Sbjct  21   RYLIVRNVPSLGCGDDLLKLFATYGDIEECKPMDAEDCDPFTDVYFIKFRLFSNA  75


 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRV  504
            E Q  ++  +S +T VSS+K+YF+S+SMNQTVRLVREKLNKI+SS EH +AG ASKK R+
Sbjct  165  ESQRISHVNESPITRVSSDKDYFASQSMNQTVRLVREKLNKIESSTEHLQAGPASKKPRI  224

Query  505  DNRRRI  522
            DNRRRI
Sbjct  225  DNRRRI  230



>ref|XP_004490832.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Cicer arietinum]
 ref|XP_004490833.1| PREDICTED: RNA-binding protein 48-like isoform X2 [Cicer arietinum]
 ref|XP_004490834.1| PREDICTED: RNA-binding protein 48-like isoform X3 [Cicer arietinum]
 ref|XP_004490835.1| PREDICTED: RNA-binding protein 48-like isoform X4 [Cicer arietinum]
 ref|XP_004490836.1| PREDICTED: RNA-binding protein 48-like isoform X5 [Cicer arietinum]
 ref|XP_004490837.1| PREDICTED: RNA-binding protein 48-like isoform X6 [Cicer arietinum]
Length=222

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL +LF++YGEVEECKPMDAEDCE FTDVYWIKF    NA
Sbjct  21   RYLIVRNVPALGCGDDLLQLFSSYGEVEECKPMDAEDCEQFTDVYWIKFGLFSNA  75


 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = +1

Query  370  IVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGA-SKKVRVDNRRRI  522
            +VSSN++YF S +MNQTVR VR+KL+KIQSS EH +AG+ SKK RVDNRRRI
Sbjct  171  MVSSNEDYFPSRTMNQTVRFVRDKLDKIQSSGEHLQAGSTSKKARVDNRRRI  222



>ref|XP_004951201.1| PREDICTED: RNA-binding protein 48-like [Setaria italica]
Length=222

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++L+VRNVPSLGCGDDLA LF TYG VEECKPMDAEDCEP+TDV++IKF +V NA
Sbjct  21   KYLVVRNVPSLGCGDDLANLFGTYGPVEECKPMDAEDCEPYTDVFFIKFSQVSNA  75


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  301  LEINQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSE-  477
            +  N+ ++++    ++  D   + V SNK+YF SESMN TV+LVREKL+KIQS  ++S  
Sbjct  148  MNFNKREYLKTNHASHIEDPRFSHVPSNKDYFPSESMNATVKLVREKLDKIQSGDDNSNA  207

Query  478  AGASKKVRVDNRRRI  522
            A ASKK RVDNRRRI
Sbjct  208  AAASKKPRVDNRRRI  222



>gb|KCW76232.1| hypothetical protein EUGRSUZ_D00612 [Eucalyptus grandis]
Length=180

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASSKIQ  215
            R+LIVRNVP+LGCGD+L KLF TYG+VEECKPMD EDCEP+TDVYWIKF+   NA+ ++ 
Sbjct  21   RYLIVRNVPALGCGDELLKLFATYGDVEECKPMDEEDCEPYTDVYWIKFRLDCNATLQVS  80



>ref|XP_004294413.1| PREDICTED: RNA-binding protein 48-like [Fragaria vesca subsp. 
vesca]
Length=230

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+L+VRNVPSLGCGD+L KLF++YG+VEECKPMDAE+CE FTDVYWIKF+ V NA
Sbjct  21   RYLMVRNVPSLGCGDELLKLFSSYGDVEECKPMDAEECEQFTDVYWIKFRLVRNA  75


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = +1

Query  298  PLEINQSQ--FMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEH  471
            P  +N SQ  + + Q T+      +T VSS KEYF+S SMNQTV++VREKL+KIQSS EH
Sbjct  153  PQLVNYSQRDYGQSQLTSRVNKPPITRVSSEKEYFASPSMNQTVQMVREKLDKIQSSTEH  212

Query  472  -SEAGASKKVRVDNRRRI  522
              E   SKK RVDNRRRI
Sbjct  213  LLEEHKSKKARVDNRRRI  230



>ref|XP_002451350.1| hypothetical protein SORBIDRAFT_04g000550 [Sorghum bicolor]
 gb|EES04326.1| hypothetical protein SORBIDRAFT_04g000550 [Sorghum bicolor]
Length=205

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVPSLGCGDDLA LF TYG VEEC PMDAEDCEP+TDV+++KF +V+NA
Sbjct  21   RYLIVRNVPSLGCGDDLANLFGTYGPVEECTPMDAEDCEPYTDVFFVKFSQVNNA  75



>ref|XP_006659776.1| PREDICTED: RNA-binding protein 48-like [Oryza brachyantha]
Length=212

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+VRNVPSLGCGD+LA LF TYG VEEC PMDAEDCEP+TDV++IKF  V NA
Sbjct  7    LARRYLVVRNVPSLGCGDELANLFATYGPVEECTPMDAEDCEPYTDVFFIKFSHVSNA  64


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +1

Query  310  NQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGA-  486
            N+ ++ +   ++   D   + VSSNK+YF S+SMN TV+LVREKL+KIQSS+++S A   
Sbjct  141  NKREYTKTLHSSQIDDPRFSHVSSNKDYFPSKSMNATVKLVREKLDKIQSSSDNSNAVVT  200

Query  487  SKKVRVDNRRRI  522
            SKK R+DNRRRI
Sbjct  201  SKKPRIDNRRRI  212



>ref|XP_007131931.1| hypothetical protein PHAVU_011G052800g [Phaseolus vulgaris]
 gb|ESW03925.1| hypothetical protein PHAVU_011G052800g [Phaseolus vulgaris]
Length=220

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  33   PRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
             R+LIVRN+P  GCGDDL +LF++YGEVEECKPMDAEDC+ +TDVYWIKF+ V NA
Sbjct  20   SRYLIVRNIPEFGCGDDLLQLFSSYGEVEECKPMDAEDCDKYTDVYWIKFRLVSNA  75


 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +1

Query  373  VSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            +SSN++YF+S SMNQTV +VR KL+KI+SS EH++AG ASKK RVDNRRRI
Sbjct  170  ISSNEDYFASHSMNQTVNIVRNKLDKIRSSGEHTQAGSASKKQRVDNRRRI  220



>ref|XP_008226987.1| PREDICTED: RNA-binding protein 48 [Prunus mume]
 ref|XP_008226988.1| PREDICTED: RNA-binding protein 48 [Prunus mume]
Length=230

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGC  +L KLF +YGEVEECKPMD EDCEPFTDVYWIKF+ V NA
Sbjct  21   RYLIVRNVPALGCSAELLKLFASYGEVEECKPMDEEDCEPFTDVYWIKFRLVSNA  75


 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRV  504
            E Q T++  +  ++ +SS+KEYF+S+SMNQTV++VREKLNKIQSS+EH + G ASKK RV
Sbjct  165  ESQLTSHVNNPPLSRISSDKEYFASQSMNQTVQMVREKLNKIQSSSEHLQDGHASKKPRV  224

Query  505  DNRRRI  522
            DNR+RI
Sbjct  225  DNRKRI  230



>ref|XP_008385850.1| PREDICTED: RNA-binding protein 48 [Malus domestica]
Length=230

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVPSLGCG+DL KLF +YGEVEECKPMD  DC+ FTDVYWIKF+ V NA
Sbjct  21   RYLIVRNVPSLGCGBDLLKLFASYGEVEECKPMDEADCDQFTDVYWIKFRLVTNA  75


 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +1

Query  364  MTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEH-SEAGASKKVRVDNRRRI  522
            ++ VSS++EYF S+SMNQTV++VREKLNK+QSS+EH  +  ASKK RVDNRRRI
Sbjct  177  LSRVSSDQEYFPSQSMNQTVKMVREKLNKVQSSSEHLQDERASKKXRVDNRRRI  230



>ref|XP_007211983.1| hypothetical protein PRUPE_ppa010927mg [Prunus persica]
 gb|EMJ13182.1| hypothetical protein PRUPE_ppa010927mg [Prunus persica]
Length=230

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGC  +L KLF +YGEVEECKPMD EDCEPFTDVYWIKF+ V NA
Sbjct  21   RYLIVRNVPALGCSAELLKLFASYGEVEECKPMDEEDCEPFTDVYWIKFRLVSNA  75


 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRV  504
            E Q T++  +  ++ +SS+KEYF+S+SMNQT ++VREKLNKIQSS+E+ + G ASKK RV
Sbjct  165  ESQLTSHVNNPPLSRISSDKEYFASQSMNQTAQMVREKLNKIQSSSEYLQDGHASKKPRV  224

Query  505  DNRRRI  522
            DNRRRI
Sbjct  225  DNRRRI  230



>ref|NP_198082.4| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
thaliana]
 gb|AED93669.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
thaliana]
Length=575

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R++IVRNVP+LGCGDDL +LF TYGEVEECKPMDAEDC  FTDVYWIKF+ + NA
Sbjct  377  RYMIVRNVPALGCGDDLMRLFMTYGEVEECKPMDAEDCAEFTDVYWIKFRLITNA  431


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 7/60 (12%)
 Frame = +1

Query  364  MTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS-------KKVRVDNRRRI  522
            +T VSS +EYF+S SMNQ V+ VREKLNKI+ S        S       K+ RVDNRRRI
Sbjct  516  VTRVSSYQEYFASSSMNQMVKTVREKLNKIEESGNQKRLQPSSQTQPDFKRTRVDNRRRI  575



>gb|AFW66820.1| putative RNA-recognition domain family protein [Zea mays]
Length=150

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVPSLGCGDDLA LF TYG VEEC PMDAED EP+TDV+++KF +V+NA
Sbjct  21   RYLIVRNVPSLGCGDDLASLFGTYGPVEECTPMDAEDSEPYTDVFFVKFSQVNNA  75



>ref|NP_001154742.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
thaliana]
 gb|AED93670.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
thaliana]
Length=550

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R++IVRNVP+LGCGDDL +LF TYGEVEECKPMDAEDC  FTDVYWIKF+ + NA
Sbjct  352  RYMIVRNVPALGCGDDLMRLFMTYGEVEECKPMDAEDCAEFTDVYWIKFRLITNA  406


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 7/60 (12%)
 Frame = +1

Query  364  MTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS-------KKVRVDNRRRI  522
            +T VSS +EYF+S SMNQ V+ VREKLNKI+ S        S       K+ RVDNRRRI
Sbjct  491  VTRVSSYQEYFASSSMNQMVKTVREKLNKIEESGNQKRLQPSSQTQPDFKRTRVDNRRRI  550



>ref|XP_010473178.1| PREDICTED: RNA-binding protein 48-like isoform X3 [Camelina sativa]
Length=216

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKF  182
            R+LIVRNVP+LGCGDDL +LF TYGEVEE KPMDAEDCE FTDVYWIKF
Sbjct  21   RYLIVRNVPALGCGDDLMRLFMTYGEVEESKPMDAEDCEEFTDVYWIKF  69


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 8/65 (12%)
 Frame = +1

Query  352  RDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS--------KKVRVD  507
            R++ ++ VSSN+EYF+S SMNQTV  VREKLNKI+ S        S        K+ RVD
Sbjct  152  RNAPVSRVSSNQEYFASSSMNQTVNTVREKLNKIEESGNQKRLQPSSQTPQPDLKRTRVD  211

Query  508  NRRRI  522
            NRRRI
Sbjct  212  NRRRI  216



>ref|XP_010248509.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Nelumbo nucifera]
 ref|XP_010248510.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Nelumbo nucifera]
Length=232

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGD+L KLF +YGE+EE KPMD EDCEPFTDVYWIKF  V NA
Sbjct  21   RYLIVRNVPALGCGDELLKLFGSYGEIEEFKPMDGEDCEPFTDVYWIKFLLVSNA  75


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRV  504
            E + T+  +D S+T V  N++YF S SMN+TVRLVREKL+KI+SS E  EA  A KK R 
Sbjct  167  EIEGTSEMKDPSITTVPFNQDYFPSPSMNETVRLVREKLDKIKSSGERIEAEPALKKKRA  226

Query  505  DNRRRI  522
            DNRRRI
Sbjct  227  DNRRRI  232



>ref|XP_011000881.1| PREDICTED: uncharacterized protein LOC105108315 [Populus euphratica]
Length=234

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LG GDDL KLF +YG+VEECKPMDAEDCE FTDVYWIKF+ V NA
Sbjct  26   RYLIVRNVPALGWGDDLFKLFASYGDVEECKPMDAEDCEQFTDVYWIKFRLVSNA  80


 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +1

Query  355  DSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            D  +T VSS+++YF S+SMNQTVRLVREKLNKIQSS+EH +AG  SKK RVDNRRRI
Sbjct  178  DPPITRVSSDQDYFPSQSMNQTVRLVREKLNKIQSSSEHLQAGPESKKARVDNRRRI  234



>ref|XP_010248511.1| PREDICTED: RNA-binding protein 48-like isoform X2 [Nelumbo nucifera]
Length=230

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGD+L KLF +YGE+EE KPMD EDCEPFTDVYWIKF  V NA
Sbjct  21   RYLIVRNVPALGCGDELLKLFGSYGEIEEFKPMDGEDCEPFTDVYWIKFLLVSNA  75


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRV  504
            E + T+  +D S+T V  N++YF S SMN+TVRLVREKL+KI+SS E  EA  A KK R 
Sbjct  165  EIEGTSEMKDPSITTVPFNQDYFPSPSMNETVRLVREKLDKIKSSGERIEAEPALKKKRA  224

Query  505  DNRRRI  522
            DNRRRI
Sbjct  225  DNRRRI  230



>ref|NP_001146882.1| nucleic acid binding protein [Zea mays]
 gb|ACG24159.1| nucleic acid binding protein [Zea mays]
 gb|AFW66819.1| putative RNA-recognition domain family protein [Zea mays]
Length=219

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVPSLGCGDDLA LF TYG VEEC PMDAED EP+TDV+++KF +V+NA
Sbjct  21   RYLIVRNVPSLGCGDDLASLFGTYGPVEECTPMDAEDSEPYTDVFFVKFSQVNNA  75


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +1

Query  310  NQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSE-AGA  486
            N+ ++M+    +   D   + VSS+K+YF SESMN TV+LVR KL+KIQS  ++S  + A
Sbjct  148  NKREYMKTIHASPIEDPRFSHVSSDKDYFPSESMNATVKLVRGKLDKIQSGGDNSSTSAA  207

Query  487  SKKVRVDNRRRI  522
            S+K  VD RRRI
Sbjct  208  SRKPGVDKRRRI  219



>ref|NP_001045616.1| Os02g0105000 [Oryza sativa Japonica Group]
 dbj|BAD06280.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAD07540.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAD28077.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAF07530.1| Os02g0105000 [Oryza sativa Japonica Group]
 dbj|BAG87298.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56140.1| hypothetical protein OsJ_05020 [Oryza sativa Japonica Group]
Length=220

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVPSLGCGDDLA LF TYG V+EC PMDAEDC+P+TDV++IKF +V NA
Sbjct  18   KYLIVRNVPSLGCGDDLANLFATYGPVDECTPMDAEDCDPYTDVFFIKFSQVSNA  72


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 10/73 (14%)
 Frame = +1

Query  307  INQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEA-G  483
            ++ SQF +P+          T VSSNK+YF SESMN TV LVREKL+KIQSS+++S A  
Sbjct  157  LHASQFEDPR---------FTHVSSNKDYFPSESMNATVNLVREKLDKIQSSSDNSSAIV  207

Query  484  ASKKVRVDNRRRI  522
            A KK R DNRRRI
Sbjct  208  APKKPRTDNRRRI  220



>gb|EEC72303.1| hypothetical protein OsI_05486 [Oryza sativa Indica Group]
Length=220

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVPSLGCGDDLA LF TYG V+EC PMDAEDC+P+TDV++IKF +V NA
Sbjct  18   KYLIVRNVPSLGCGDDLANLFATYGPVDECTPMDAEDCDPYTDVFFIKFSQVSNA  72


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 10/73 (14%)
 Frame = +1

Query  307  INQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEA-G  483
            ++ SQF +P+          T VSSNK+YF SESMN TV LVREKL+KIQSS+++S A  
Sbjct  157  LHASQFEDPR---------FTHVSSNKDYFPSESMNATVNLVREKLDKIQSSSDNSSAIV  207

Query  484  ASKKVRVDNRRRI  522
            A KK R DNRRRI
Sbjct  208  APKKPRTDNRRRI  220



>ref|XP_010038349.1| PREDICTED: RNA-binding protein 48 [Eucalyptus grandis]
 ref|XP_010038351.1| PREDICTED: RNA-binding protein 48 [Eucalyptus grandis]
Length=227

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKF  182
            R+LIVRNVP+LGCGD+L KLF TYG+VEECKPMD EDCEP+TDVYWIKF
Sbjct  21   RYLIVRNVPALGCGDELLKLFATYGDVEECKPMDEEDCEPYTDVYWIKF  69


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  373  VSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            VSS  +YF S SMNQTVRLVR+KLNKI+SS E  ++G A KK RVDNRRRI
Sbjct  177  VSSELDYFQSHSMNQTVRLVRDKLNKIESSGERPQSGPAVKKARVDNRRRI  227



>gb|KCW50162.1| hypothetical protein EUGRSUZ_K03598, partial [Eucalyptus grandis]
Length=266

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKF  182
            R+LIVRNVP+LGCGD+L KLF TYG+VEECKPMD EDCEP+TDVYWIKF
Sbjct  60   RYLIVRNVPALGCGDELLKLFATYGDVEECKPMDEEDCEPYTDVYWIKF  108


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  373  VSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            VSS  +YF S SMNQTVRLVR+KLNKI+SS E  ++G A KK RVDNRRRI
Sbjct  216  VSSELDYFQSHSMNQTVRLVRDKLNKIESSGERPQSGPAVKKARVDNRRRI  266



>gb|EPS71983.1| hypothetical protein M569_02780, partial [Genlisea aurea]
Length=122

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVPS GCGD L KLF++YG V ECKPMDAEDCE +TDV+W+KF ++DNA
Sbjct  21   KYLIVRNVPSFGCGDQLLKLFSSYGPVAECKPMDAEDCEEYTDVFWLKFHQIDNA  75



>ref|XP_010242599.1| PREDICTED: RNA-binding protein 48-like isoform X2 [Nelumbo nucifera]
Length=230

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCG++L KLF +YG++EE KPMD EDCEPFTDVYWIKF  V NA
Sbjct  21   RYLIVRNVPALGCGNELLKLFGSYGKIEEFKPMDGEDCEPFTDVYWIKFLLVSNA  75


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRV  504
            E + T+  +D  +T VS N++YF + SMN+TVRLVREKL+KI+SS E  EA  A KK RV
Sbjct  165  EIEGTSEMKDPLITKVSFNQDYFPTPSMNETVRLVREKLDKIKSSGERIEAEPALKKKRV  224

Query  505  DNRRRI  522
            DNRRRI
Sbjct  225  DNRRRI  230



>ref|XP_010242592.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Nelumbo nucifera]
 ref|XP_010242593.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Nelumbo nucifera]
 ref|XP_010242594.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Nelumbo nucifera]
 ref|XP_010242595.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Nelumbo nucifera]
 ref|XP_010242596.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Nelumbo nucifera]
 ref|XP_010242597.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Nelumbo nucifera]
 ref|XP_010242598.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Nelumbo nucifera]
Length=232

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCG++L KLF +YG++EE KPMD EDCEPFTDVYWIKF  V NA
Sbjct  21   RYLIVRNVPALGCGNELLKLFGSYGKIEEFKPMDGEDCEPFTDVYWIKFLLVSNA  75


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRV  504
            E + T+  +D  +T VS N++YF + SMN+TVRLVREKL+KI+SS E  EA  A KK RV
Sbjct  167  EIEGTSEMKDPLITKVSFNQDYFPTPSMNETVRLVREKLDKIKSSGERIEAEPALKKKRV  226

Query  505  DNRRRI  522
            DNRRRI
Sbjct  227  DNRRRI  232



>ref|XP_010553737.1| PREDICTED: RNA-binding protein 48 [Tarenaya hassleriana]
Length=234

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVPSLGCGDDL +LF TYG++EE KPMDAE+C  FTDVYWIKF+ + NA
Sbjct  21   RYLIVRNVPSLGCGDDLMRLFATYGDIEEFKPMDAEECVEFTDVYWIKFRLISNA  75


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 10/60 (17%)
 Frame = +1

Query  373  VSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGAS----------KKVRVDNRRRI  522
            VSSN++YF S SMNQTV  VREKLNKIQ + +      S          K+ R+DNRRRI
Sbjct  175  VSSNQDYFPSPSMNQTVHFVREKLNKIQETGDQKRVQTSNQYQQSEPVLKRARLDNRRRI  234



>gb|KDP42233.1| hypothetical protein JCGZ_02963 [Jatropha curcas]
Length=206

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGD+L KLF TYG++E+ KPMDAED EPFTDVYWIKF+ V  A
Sbjct  21   RYLIVRNVPALGCGDELLKLFATYGDIEDFKPMDAEDSEPFTDVYWIKFRLVSYA  75


 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +1

Query  373  VSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            VSS++EYF S+SMNQTV+LVREKLNKIQSS EH + G A KK R+DNRRRI
Sbjct  156  VSSDQEYFPSDSMNQTVKLVREKLNKIQSSTEHIQGGSAPKKTRIDNRRRI  206



>ref|XP_002525357.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF36995.1| nucleic acid binding protein, putative [Ricinus communis]
Length=216

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL KLF +YG+VE+ KPMDAEDC+ FTDVYWIKF  V NA
Sbjct  21   RYLIVRNVPALGCGDDLLKLFASYGDVEDFKPMDAEDCDQFTDVYWIKFSLVCNA  75


 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = +1

Query  355  DSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            D  +T VSSN+EYF S+SMNQTV LVREKLNKIQSS+EH +A  ASKK RVDNRRRI
Sbjct  160  DPPITRVSSNQEYFPSQSMNQTVSLVREKLNKIQSSSEHLQAVPASKKSRVDNRRRI  216



>ref|XP_004142975.1| PREDICTED: RNA-binding protein 48-like [Cucumis sativus]
 gb|KGN62296.1| hypothetical protein Csa_2G348830 [Cucumis sativus]
Length=258

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  33   PRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
             R+LIVRNVP+LGCGDDL KLF++YG +EECKPMDAE+C+ FTDVY++KF  V NA
Sbjct  52   SRYLIVRNVPALGCGDDLHKLFSSYGNLEECKPMDAEECDEFTDVYFVKFHLVTNA  107


 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = +1

Query  358  SSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            S +T VSS+++YF+SESMNQTV LVREKL+KIQSS+EH +AG ASKK R+DNRRRI
Sbjct  203  SQITRVSSDQDYFASESMNQTVHLVREKLDKIQSSSEHLQAGPASKKSRMDNRRRI  258



>ref|XP_004161064.1| PREDICTED: RNA-binding protein 48-like [Cucumis sativus]
Length=258

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGDDL KLF++YG +EECKPMDAE+C+ FTDVY++KF  V NA
Sbjct  53   RYLIVRNVPALGCGDDLHKLFSSYGNLEECKPMDAEECDEFTDVYFVKFHLVTNA  107


 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = +1

Query  358  SSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            S +T VSS+++YF+SESMNQTV LVREKL+KIQSS+EH +AG ASKK R+DNRRRI
Sbjct  203  SQITRVSSDQDYFASESMNQTVHLVREKLDKIQSSSEHLQAGPASKKSRMDNRRRI  258



>ref|XP_008444339.1| PREDICTED: RNA-binding protein 48 isoform X1 [Cucumis melo]
 ref|XP_008444341.1| PREDICTED: RNA-binding protein 48 isoform X1 [Cucumis melo]
 ref|XP_008444342.1| PREDICTED: RNA-binding protein 48 isoform X1 [Cucumis melo]
 ref|XP_008444343.1| PREDICTED: RNA-binding protein 48 isoform X1 [Cucumis melo]
Length=226

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGCGD L KLF++YG +EECKPMDAE+C+ FTDVY++KF  V NA
Sbjct  21   RYLIVRNVPALGCGDGLHKLFSSYGNLEECKPMDAEECDEFTDVYFVKFHSVTNA  75


 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = +1

Query  358  SSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            S MT VSS+++YF+SESMNQTV LVREKL+KIQSS+EH +AG ASKK R+DNRRRI
Sbjct  171  SQMTRVSSDQDYFASESMNQTVHLVREKLDKIQSSSEHLQAGPASKKSRLDNRRRI  226



>ref|XP_003570574.1| PREDICTED: RNA-binding protein 48-like isoform X1 [Brachypodium 
distachyon]
Length=224

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            ++LIVRNVPSLGCGD+L  LF+TYG +EEC PMD EDCE +TDV++IKF +V NA
Sbjct  21   KYLIVRNVPSLGCGDELGTLFSTYGPLEECTPMDGEDCEEYTDVFFIKFSQVSNA  75


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +1

Query  310  NQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEA-GA  486
            N+  + +    ++ +D+  + VSSNK+YF SESMN TV LVREKL++IQS +++S A  A
Sbjct  153  NKRDYTQAMHASHIKDARFSHVSSNKDYFPSESMNATVNLVREKLDQIQSGSDNSNAVTA  212

Query  487  SKKVRVDNRRRI  522
            SKK +VDNRRRI
Sbjct  213  SKKPKVDNRRRI  224



>ref|XP_011071101.1| PREDICTED: uncharacterized protein LOC105156617 isoform X2 [Sesamum 
indicum]
 ref|XP_011071102.1| PREDICTED: uncharacterized protein LOC105156617 isoform X2 [Sesamum 
indicum]
Length=168

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 85/168 (51%), Gaps = 29/168 (17%)
 Frame = +1

Query  106  MEKLKNVNPWMPKTVNHllmstgssskg*tmPAQRSKSSAIP------------------  231
            M K KNV+ WM K VNH+LM TGSS     MP  R + S  P                  
Sbjct  1    MAKWKNVSRWMLKNVNHILMFTGSSFIWSAMPGNRLQVSYAPAYESLSDTKEKLEGRRKE  60

Query  232  -----------GPGPDAAsksiitstsshitskPLEINQSQFMEPQETANNRDSSMTIVS  378
                       GP    +   + T    H  +    + QSQ  + Q       SSM   S
Sbjct  61   ILARLNPRRSKGPSESVSEPLVSTPLLKHAFTPTPIVAQSQMSKSQAAPGGHKSSMLSAS  120

Query  379  SNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            S+KEYF  ESMN+TV+LVR+KLNKIQSS  H+EAG+SK+ RVDNRRRI
Sbjct  121  SDKEYFPVESMNRTVQLVRDKLNKIQSSTNHTEAGSSKRARVDNRRRI  168



>ref|XP_001754907.1| predicted protein [Physcomitrella patens]
 gb|EDQ80361.1| predicted protein [Physcomitrella patens]
Length=139

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGC D+L KLF  YG +EE + MD E+CE FTDVYW+KF  + NA
Sbjct  25   RYLIVRNVPTLGCVDELVKLFALYGPIEEHRLMDEEECEEFTDVYWLKFSSIANA  79



>ref|XP_008444344.1| PREDICTED: RNA-binding protein 48 isoform X2 [Cucumis melo]
 ref|XP_008444345.1| PREDICTED: RNA-binding protein 48 isoform X2 [Cucumis melo]
Length=174

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = +1

Query  358  SSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            S MT VSS+++YF+SESMNQTV LVREKL+KIQSS+EH +AG ASKK R+DNRRRI
Sbjct  119  SQMTRVSSDQDYFASESMNQTVHLVREKLDKIQSSSEHLQAGPASKKSRLDNRRRI  174



>ref|XP_006483892.1| PREDICTED: RNA-binding protein 48-like isoform X2 [Citrus sinensis]
Length=188

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRV  504
            E Q  ++  +S +T VSS+K+YF+S+SMNQTVRLVREKLNKI+SS EH +A  ASKK R+
Sbjct  123  ESQRISHVNESPITRVSSDKDYFASQSMNQTVRLVREKLNKIESSTEHLQARPASKKPRI  182

Query  505  DNRRRI  522
            DNRRRI
Sbjct  183  DNRRRI  188


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  120  ECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            +CKPMDAEDC+PFTDVY+IKF+   NA
Sbjct  7    KCKPMDAEDCDPFTDVYFIKFRLFSNA  33



>ref|XP_006840686.1| hypothetical protein AMTR_s00096p00065500 [Amborella trichopoda]
 gb|ERN02361.1| hypothetical protein AMTR_s00096p00065500 [Amborella trichopoda]
Length=217

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+LIVRNVP+LGC D+L KLF +YG ++EC+ MD E+ EP+TDV WIK+ +V NA
Sbjct  22   RYLIVRNVPALGCIDELVKLFGSYGPIDECRYMDEEESEPYTDVCWIKYVQVSNA  76



>ref|XP_009772566.1| PREDICTED: RNA-binding protein 48 isoform X2 [Nicotiana sylvestris]
Length=204

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  352  RDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            + S +T+VSS+KEYF S+SMNQTV+LVREKL KIQSS +H E   SK+ RVDNRRRI
Sbjct  148  KGSPVTMVSSDKEYFPSQSMNQTVKLVREKLKKIQSSVDHLEGEPSKRKRVDNRRRI  204


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEE  122
            ++LIVRNVP+LGCGD L+KLF+TYGE+EE
Sbjct  21   KYLIVRNVPALGCGDQLSKLFSTYGEIEE  49



>gb|KDP26611.1| hypothetical protein JCGZ_17769 [Jatropha curcas]
Length=176

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +1

Query  373  VSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            VSS++EYF S+SMNQTV+LVREKLNKIQSS EH + G ASKK ++DNRRRI
Sbjct  126  VSSDQEYFLSDSMNQTVKLVREKLNKIQSSTEHIQGGPASKKTKIDNRRRI  176



>ref|XP_008447649.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 48-like, 
partial [Cucumis melo]
Length=166

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVY-WIKFQRVDNA  200
            R+LIVRNVPSLGC  DL KLF++Y  +EECKP D E+C+ FTDV+ ++K+  V NA
Sbjct  15   RYLIVRNVPSLGCRHDLHKLFSSYKNLEECKPXDTEECDEFTDVFSFVKYHLVTNA  70



>ref|XP_002962994.1| hypothetical protein SELMODRAFT_78456, partial [Selaginella moellendorffii]
 ref|XP_002980340.1| hypothetical protein SELMODRAFT_112525, partial [Selaginella 
moellendorffii]
 gb|EFJ18600.1| hypothetical protein SELMODRAFT_112525, partial [Selaginella 
moellendorffii]
 gb|EFJ36457.1| hypothetical protein SELMODRAFT_78456, partial [Selaginella moellendorffii]
Length=72

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+++V+NVP+LGC  +L +L  ++G +EE   +D E+CEP+TDVYWIKF  + +A
Sbjct  17   RYMLVKNVPALGCSSELLQLLGSFGHIEEYLLLDDEECEPYTDVYWIKFADIAHA  71



>ref|XP_010100438.1| hypothetical protein L484_027749 [Morus notabilis]
 gb|EXB82572.1| hypothetical protein L484_027749 [Morus notabilis]
Length=202

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +1

Query  352  RDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRR  519
            R + MT VSS+KEYF S+SMNQTV+ VREKLNK QSS EH + G ASKK R D+RRR
Sbjct  144  RHAPMTRVSSDKEYFPSQSMNQTVKSVREKLNKTQSSGEHIQHGSASKKPRFDDRRR  200


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  123  CKPMDAEDCEPFTDVYWIKFQRVDNA  200
            CKPMDAEDCE FTDVYWIKF+ V NA
Sbjct  22   CKPMDAEDCEKFTDVYWIKFRSVSNA  47



>ref|XP_010233663.1| PREDICTED: RNA-binding protein 48-like isoform X2 [Brachypodium 
distachyon]
Length=185

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +1

Query  310  NQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEA-GA  486
            N+  + +    ++ +D+  + VSSNK+YF SESMN TV LVREKL++IQS +++S A  A
Sbjct  114  NKRDYTQAMHASHIKDARFSHVSSNKDYFPSESMNATVNLVREKLDQIQSGSDNSNAVTA  173

Query  487  SKKVRVDNRRRI  522
            SKK +VDNRRRI
Sbjct  174  SKKPKVDNRRRI  185



>ref|XP_009394915.1| PREDICTED: uncharacterized protein LOC103980285 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=208

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +1

Query  301  LEINQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSE-  477
            L+  Q +F    + ++  ++ ++ VSSNKEYF + SMN+TVRLVREKL+KIQS + +++ 
Sbjct  134  LQGRQREFARGGQISHVGNAPLSHVSSNKEYFPTPSMNETVRLVREKLDKIQSRSGNTDT  193

Query  478  AGASKKVRVDNRRRI  522
            A ASK+ +VDNRRRI
Sbjct  194  ASASKRAKVDNRRRI  208


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  123  CKPMDAEDCEPFTDVYWIKFQRVDNA  200
            CKPMDAEDC+PFTDVYWIKF +V NA
Sbjct  22   CKPMDAEDCDPFTDVYWIKFSQVSNA  47



>ref|XP_006591560.1| PREDICTED: uncharacterized protein LOC102659846 [Glycine max]
Length=124

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +1

Query  385  KEYFSSESMNQTVRLVREKLNKIQSSAEHSEAG-ASKKVRVDNRRRI  522
            K+YF+S SMNQTV LVR+KL+KIQSS E+ +AG ASKK RVDNRRR+
Sbjct  78   KDYFASHSMNQTVSLVRDKLDKIQSSGENIQAGSASKKQRVDNRRRV  124



>ref|XP_003387780.1| PREDICTED: hypothetical protein LOC100632124 [Amphimedon queenslandica]
Length=486

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASSKIQ  215
            R+L+V NVPSLG   DL +LF+ YGE+EE + +D   CEP+TDVY IK++ +++A     
Sbjct  39   RYLLVLNVPSLGVVKDLMELFSLYGEIEEYRILDEYPCEPYTDVYLIKYREIESAKLAKN  98

Query  216  KFCN  227
            K  N
Sbjct  99   KLDN  102



>gb|EMS49084.1| hypothetical protein TRIUR3_01800 [Triticum urartu]
Length=186

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +1

Query  310  NQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEA-GA  486
            N+ ++ +    ++  D   + VSSNK+YF SESMN TV LVR+KL+KIQS ++ S A  A
Sbjct  115  NKREYTKTLHASHIEDVRFSHVSSNKDYFPSESMNATVNLVRQKLDKIQSGSDGSNAVAA  174

Query  487  SKKVRVDNRRRI  522
            SKK RVD+RRRI
Sbjct  175  SKKPRVDDRRRI  186



>gb|EMT04055.1| hypothetical protein F775_06824 [Aegilops tauschii]
Length=286

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +1

Query  310  NQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEA-GA  486
            N+ ++ +    ++  D   + VSSNK+YF SESMN TV LVR+KL+KIQS ++ S A  A
Sbjct  215  NKREYTKTLHASHIEDVRFSHVSSNKDYFPSESMNATVNLVRQKLDKIQSGSDGSNAVAA  274

Query  487  SKKVRVDNRRRI  522
            SKK RVD+RRRI
Sbjct  275  SKKPRVDDRRRI  286



>gb|ESA19383.1| hypothetical protein GLOINDRAFT_136191 [Rhizophagus irregularis 
DAOM 181602]
Length=149

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+L+V NVP+LG   +L +LF  YG +EE + +D   CE FTDVYWIKFQ +  A
Sbjct  32   RYLVVENVPALGLTKELLELFALYGTIEEYQYLDDYPCEEFTDVYWIKFQSLPQA  86



>ref|XP_008794792.1| PREDICTED: RNA-binding protein 48-like isoform X5 [Phoenix dactylifera]
Length=195

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +1

Query  355  DSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            D  ++ VSSNKEYF+S SMN+TVRLVR KL+KI S++E   A ASK+ R DNRRRI
Sbjct  142  DDFISHVSSNKEYFASASMNETVRLVRGKLDKIHSTSE--VAPASKRTRPDNRRRI  195



>ref|XP_008794790.1| PREDICTED: RNA-binding protein 48-like isoform X3 [Phoenix dactylifera]
Length=216

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +1

Query  355  DSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            D  ++ VSSNKEYF+S SMN+TVRLVR KL+KI S++E   A ASK+ R DNRRRI
Sbjct  163  DDFISHVSSNKEYFASASMNETVRLVRGKLDKIHSTSE--VAPASKRTRPDNRRRI  216


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  123  CKPMDAEDCEPFTDVYWIKFQRVDNA  200
            CKPMDAEDCEPFTDVYWIKF +V NA
Sbjct  22   CKPMDAEDCEPFTDVYWIKFSQVGNA  47



>ref|XP_008794791.1| PREDICTED: RNA-binding protein 48-like isoform X4 [Phoenix dactylifera]
Length=207

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +1

Query  355  DSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGASKKVRVDNRRRI  522
            D  ++ VSSNKEYF+S SMN+TVRLVR KL+KI S++E   A ASK+ R DNRRRI
Sbjct  154  DDFISHVSSNKEYFASASMNETVRLVRGKLDKIHSTSE--VAPASKRTRPDNRRRI  207


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  123  CKPMDAEDCEPFTDVYWIKFQRVDNA  200
            CKPMDAEDCEPFTDVYWIKF +V NA
Sbjct  22   CKPMDAEDCEPFTDVYWIKFSQVGNA  47



>gb|EMT12306.1| hypothetical protein F775_04241 [Aegilops tauschii]
Length=197

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +1

Query  310  NQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSE--AG  483
            N+ ++ +     +  D+  + V SNK+YF SESMN TV LVR+KL+KIQS  + S+  A 
Sbjct  125  NKREYAKTMHATHIEDARFSHVPSNKDYFPSESMNATVNLVRQKLDKIQSGGDTSDAAAA  184

Query  484  ASKKVRVDNRRRI  522
            ASKK RVDNRRRI
Sbjct  185  ASKKPRVDNRRRI  197


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  120  ECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            +CKPMDAEDCE +TDVY+IKF +V NA
Sbjct  21   KCKPMDAEDCEEYTDVYFIKFAQVSNA  47



>gb|EXX76017.1| hypothetical protein RirG_036860 [Rhizophagus irregularis DAOM 
197198w]
Length=269

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+L+V NVP+LG   +L +LF  YG +EE + +D   CE FTDVYWIKFQ +  A
Sbjct  32   RYLVVENVPALGLTKELLELFALYGTIEEYQYLDDYPCEEFTDVYWIKFQSLPQA  86



>ref|XP_009123439.1| PREDICTED: uncharacterized protein LOC103848237 [Brassica rapa]
Length=179

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 13/82 (16%)
 Frame = +1

Query  307  INQSQFMEPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSAEHSEAGA  486
            +NQS   E     + R++ +T VSS++EYF S SMNQTV+ VREKLNKI+ S +   + A
Sbjct  101  LNQS---ETDYQFHRRNAPITRVSSDQEYFGSSSMNQTVKTVREKLNKIEESGKQKRSEA  157

Query  487  S----------KKVRVDNRRRI  522
            S          K+ RVDNRRRI
Sbjct  158  SSENLQTEPDLKRTRVDNRRRI  179



>ref|XP_004343650.1| hypothetical protein ACA1_098970 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR20519.1| hypothetical protein ACA1_098970 [Acanthamoeba castellanii str. 
Neff]
Length=146

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 48/74 (65%), Gaps = 4/74 (5%)
 Frame = +3

Query  3    QAFSVVRPLRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDC--EPFTDVYWI  176
            +AFS+V+    R ++V+NVP++G  +DL  LF+ +G VEEC+ +  E+   E FT+VY I
Sbjct  27   KAFSIVKE--SRHVLVQNVPAVGVQEDLLALFSAHGHVEECRAIGEEELPREQFTEVYLI  84

Query  177  KFQRVDNASSKIQK  218
             F ++ +A    +K
Sbjct  85   TFAQLSDARRAKRK  98



>ref|XP_006270202.1| PREDICTED: RNA-binding protein 48 isoform X4 [Alligator mississippiensis]
Length=295

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ NA +
Sbjct  19   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYNALDEYPAEQFTEVYLIKFQKLQNARA  78

Query  207  KIQKF  221
              +K 
Sbjct  79   AKKKM  83



>gb|AAH91857.1| Dkfzp564o0523 protein, partial [Danio rerio]
Length=371

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L +LF  YG +EE +P+D    E FT+VY I+FQ++ +A
Sbjct  55   LESRYLLVQGVPAIGVMAELVQLFALYGVIEEYRPLDEYPAEQFTEVYLIQFQKLTSA  112



>ref|NP_991167.1| RNA-binding protein 48 [Danio rerio]
 gb|AAQ98007.1| hypothetical protein DKFZp564O0523 [Danio rerio]
Length=365

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L +LF  YG +EE +P+D    E FT+VY I+FQ++ +A
Sbjct  48   LESRYLLVQGVPAIGVMAELVQLFALYGVIEEYRPLDEYPAEQFTEVYLIQFQKLTSA  105



>sp|A4FVJ7.1|RBM48_DANRE RecName: Full=RNA-binding protein 48 [Danio rerio]
 gb|AAI34008.1| Dkfzp564o0523 protein [Danio rerio]
Length=364

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L +LF  YG +EE +P+D    E FT+VY I+FQ++ +A
Sbjct  48   LESRYLLVQGVPAIGVMAELVQLFALYGVIEEYRPLDEYPAEQFTEVYLIQFQKLTSA  105



>ref|XP_006270200.1| PREDICTED: RNA-binding protein 48 isoform X2 [Alligator mississippiensis]
Length=341

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ NA +
Sbjct  19   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYNALDEYPAEQFTEVYLIKFQKLQNARA  78

Query  207  KIQKF  221
              +K 
Sbjct  79   AKKKM  83



>ref|XP_006270199.1| PREDICTED: RNA-binding protein 48 isoform X1 [Alligator mississippiensis]
Length=366

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ NA +
Sbjct  44   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYNALDEYPAEQFTEVYLIKFQKLQNARA  103

Query  207  KIQKF  221
              +K 
Sbjct  104  AKKKM  108



>ref|XP_007259854.1| PREDICTED: RNA-binding protein 48 isoform X2 [Astyanax mexicanus]
Length=399

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  RFL+V+ VP++G   +L +LF  YG VEE + +D    E FT+VY IKFQ++ +A +
Sbjct  47   LESRFLLVQGVPAVGVMTELVQLFALYGVVEEYRVLDEYPAEQFTEVYLIKFQKLTSARA  106

Query  207  KIQK  218
              +K
Sbjct  107  AKRK  110



>ref|XP_001625251.1| predicted protein [Nematostella vectensis]
 gb|EDO33151.1| predicted protein [Nematostella vectensis]
Length=154

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  +FL+V+ VP++G   +L ++F  YG ++E + +     E FT+VYWIKF+++++A  
Sbjct  40   LESKFLLVQGVPTVGATKELLEMFALYGPIQEYQLLKDYPKEKFTEVYWIKFEKINSARY  99

Query  207  KIQKFCN  227
              +K  N
Sbjct  100  AKRKTDN  106



>ref|XP_007259853.1| PREDICTED: RNA-binding protein 48 isoform X1 [Astyanax mexicanus]
Length=403

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  RFL+V+ VP++G   +L +LF  YG VEE + +D    E FT+VY IKFQ++ +A +
Sbjct  47   LESRFLLVQGVPAVGVMTELVQLFALYGVVEEYRVLDEYPAEQFTEVYLIKFQKLTSARA  106

Query  207  KIQK  218
              +K
Sbjct  107  AKRK  110



>ref|XP_007440856.1| PREDICTED: RNA-binding protein 48 [Python bivittatus]
Length=368

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L +LF  YG +EE  P+D    E FT+VY IKF ++ +A
Sbjct  50   LESRYLLIQGVPALGVMKELIELFALYGTIEEYNPLDGYPAEEFTEVYLIKFLKIQSA  107



>emb|CAG10029.1| unnamed protein product [Tetraodon nigroviridis]
Length=166

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+++++ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A +
Sbjct  49   LESRYVMIQGVPAIGVMSELIQLCALYGAVEEYRPLDEYPAEEFTEVYLVKFQKLTSARA  108



>gb|AAC73021.1| hypothetical protein [Arabidopsis thaliana]
Length=227

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEE  122
            R++IVRNVP+LGCGDDL +LF TYGEVEE
Sbjct  21   RYMIVRNVPALGCGDDLMRLFMTYGEVEE  49



>ref|XP_006002691.1| PREDICTED: RNA-binding protein 48 [Latimeria chalumnae]
Length=351

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNAS  203
            L  R+L+V+ VP++G   +L +LF  YG +EE + +D    E FT+VY +KFQ++ +AS
Sbjct  43   LESRYLLVQGVPAVGVMKELVELFALYGTIEEYRALDEYPAEKFTEVYLMKFQKLQSAS  101



>ref|XP_005797466.1| PREDICTED: RNA-binding protein 48-like [Xiphophorus maculatus]
Length=202

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A
Sbjct  43   LESRYLMVQGVPAIGVMTELIQLCALYGVVEEYRPLDEYPAEEFTEVYLVKFQKLTSA  100



>ref|XP_007259855.1| PREDICTED: RNA-binding protein 48 isoform X3 [Astyanax mexicanus]
Length=373

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  RFL+V+ VP++G   +L +LF  YG VEE + +D    E FT+VY IKFQ++ +A +
Sbjct  47   LESRFLLVQGVPAVGVMTELVQLFALYGVVEEYRVLDEYPAEQFTEVYLIKFQKLTSARA  106

Query  207  KIQK  218
              +K
Sbjct  107  AKRK  110



>gb|ETE68581.1| hypothetical protein L345_05617, partial [Ophiophagus hannah]
Length=382

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP+LG   +L +LF  YG +EE  P+D    E FT+VY IKF ++ ++ +
Sbjct  53   LESRYLLIQGVPALGVMKELIELFALYGTIEEYNPLDGYPAEEFTEVYLIKFLKIPSSRA  112

Query  207  KIQKF  221
              +K 
Sbjct  113  AKRKL  117



>ref|XP_006035020.1| PREDICTED: RNA-binding protein 48 [Alligator sinensis]
Length=366

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ NA
Sbjct  44   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYNALDEYPAEQFTEVYLIKFQKLQNA  101



>gb|ELU06368.1| hypothetical protein CAPTEDRAFT_77168, partial [Capitella teleta]
Length=131

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  33   PRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
             + L+V  VP+LG  ++L K+F  YG V+E   ++   CE FT+ Y IKFQ +  A
Sbjct  32   SKHLLVLGVPALGAAEELVKMFALYGTVQEYNHLNQYPCEQFTEAYVIKFQNIQAA  87



>ref|XP_002600684.1| hypothetical protein BRAFLDRAFT_67748 [Branchiostoma floridae]
 gb|EEN56696.1| hypothetical protein BRAFLDRAFT_67748 [Branchiostoma floridae]
Length=630

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            R+L+V+ VP++G  +DL K F  YG V+E + +     E FT  YWIKF R+  A
Sbjct  275  RYLLVQGVPAIGVSEDLVKRFALYGAVQEYRILHEYPAEEFTQAYWIKFDRLQAA  329



>ref|XP_003222153.1| PREDICTED: RNA-binding protein 48 isoform X1 [Anolis carolinensis]
Length=369

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE  P+D    E FT+VY IKF+++ +A
Sbjct  48   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYNPLDDYPAEEFTEVYLIKFKKIQSA  105



>ref|XP_007547652.1| PREDICTED: RNA-binding protein 48 [Poecilia formosa]
Length=367

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A
Sbjct  55   LESRYLMVQGVPAIGVMTELIQLCALYGSVEEYRPLDEYPAEEFTEVYLVKFQKLTSA  112



>ref|XP_002934632.1| PREDICTED: RNA-binding protein 48 [Xenopus (Silurana) tropicalis]
Length=345

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L + F  YG +EE   +D    E FT+VY IKFQR+ +A
Sbjct  43   LESRYLLVQGVPAIGVMKELIEQFALYGTIEEYNALDEYPAEEFTEVYLIKFQRIQSA  100



>ref|XP_008420044.1| PREDICTED: RNA-binding protein 48 [Poecilia reticulata]
Length=367

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A
Sbjct  55   LESRYLMVQGVPAIGVMTELIQLCALYGSVEEYRPLDEYPAEEFTEVYLVKFQKLTSA  112



>gb|AAI59329.1| LOC100145247 protein [Xenopus (Silurana) tropicalis]
Length=341

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L + F  YG +EE   +D    E FT+VY IKFQR+ +A
Sbjct  39   LESRYLLVQGVPAIGVMKELIEQFALYGTIEEYNALDEYPAEEFTEVYLIKFQRIQSA  96



>ref|XP_006787794.1| PREDICTED: RNA-binding protein 48-like [Neolamprologus brichardi]
Length=352

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A
Sbjct  49   LESRYLMVQGVPAIGVMTELIQLCALYGAVEEYRPLDEYPAEEFTEVYLVKFQKLTSA  106



>ref|XP_008288690.1| PREDICTED: RNA-binding protein 48 [Stegastes partitus]
Length=360

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+V+ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A +
Sbjct  48   LESRYLMVQGVPAIGVMTELIQLCALYGAVEEYRPLDEYPAEEFTEVYLVKFQKLTSARA  107



>ref|XP_005478693.1| PREDICTED: RNA-binding protein 48-like [Oreochromis niloticus]
Length=352

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A
Sbjct  49   LESRYLMVQGVPAIGVMTELIQLCALYGAVEEYRPLDEYPAEEFTEVYLVKFQKLTSA  106



>ref|XP_005728352.1| PREDICTED: RNA-binding protein 48-like [Pundamilia nyererei]
 ref|XP_005933005.1| PREDICTED: RNA-binding protein 48-like [Haplochromis burtoni]
Length=352

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A
Sbjct  49   LESRYLMVQGVPAIGVMTELIQLCALYGAVEEYRPLDEYPAEEFTEVYLVKFQKLTSA  106



>ref|XP_004548050.1| PREDICTED: RNA-binding protein 48-like [Maylandia zebra]
Length=352

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+V+ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A +
Sbjct  49   LESRYLMVQGVPAIGVMTELIQLCALYGAVEEYRPLDEYPAEEFTEVYLVKFQKLTSARA  108

Query  207  KIQKFCNPG  233
              +     G
Sbjct  109  AKRHMDEKG  117



>ref|XP_006381996.1| hypothetical protein POPTR_0006s23790g [Populus trichocarpa]
 gb|ERP59793.1| hypothetical protein POPTR_0006s23790g [Populus trichocarpa]
Length=83

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEE  122
            R+LIVRN+P+LGCGDDL KLF +YG+VEE
Sbjct  25   RYLIVRNIPALGCGDDLFKLFASYGDVEE  53



>ref|XP_006636220.1| PREDICTED: RNA-binding protein 48-like [Lepisosteus oculatus]
Length=262

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R L+V+ VP+LG   +L +LF  YG +EE + +D    E FT+VY IKFQ++ +A
Sbjct  43   LESRCLLVQGVPALGVMSELVQLFALYGVIEEYRVLDEYPSEQFTEVYLIKFQKLQSA  100



>ref|XP_010733147.1| PREDICTED: RNA-binding protein 48 [Larimichthys crocea]
Length=362

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+V+ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A +
Sbjct  49   LESRYLMVQGVPAIGVMTELIQLCALYGAVEEYRPLDEYPAEEFTEVYLVKFQKLTSARA  108

Query  207  KIQKF  221
              ++ 
Sbjct  109  AKRRM  113



>ref|XP_004074393.1| PREDICTED: RNA-binding protein 48-like [Oryzias latipes]
Length=354

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+++++ VP++G  ++L +L   YG VEE +P+D    E FT+VY +KFQ++ +A
Sbjct  49   LESRYVMIQGVPAIGVMEELIQLCALYGTVEEYRPLDEYPAEEFTEVYLVKFQKLTSA  106



>ref|XP_006114537.1| PREDICTED: RNA-binding protein 48 [Pelodiscus sinensis]
Length=367

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ +A
Sbjct  43   LESRYLLIQGVPALGVMKELVQQFALYGAIEEYNALDEYPAEQFTEVYLIKFQKLQSA  100



>ref|XP_008329807.1| PREDICTED: RNA-binding protein 48 isoform X1 [Cynoglossus semilaevis]
Length=377

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+++V+ VP++G   +L +L   YG VEE +P+D    E FT+VY IKFQ++ +A
Sbjct  49   LESRYVMVQGVPAIGVMTELVQLCALYGVVEEYRPLDEYPAEEFTEVYLIKFQKLTSA  106



>ref|XP_009708761.1| PREDICTED: RNA-binding protein 48, partial [Cariama cristata]
Length=319

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ +A
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQSA  63



>gb|KFP56389.1| RNA-binding protein 48, partial [Cariama cristata]
Length=320

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ +A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQSA  64



>ref|XP_005308590.1| PREDICTED: RNA-binding protein 48 isoform X1 [Chrysemys picta 
bellii]
Length=370

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ +A
Sbjct  43   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYNALDEYPAEQFTEVYLIKFQKLQSA  100



>ref|XP_008605748.1| hypothetical protein SDRG_01969 [Saprolegnia diclina VS20]
 gb|EQC40904.1| hypothetical protein SDRG_01969 [Saprolegnia diclina VS20]
Length=170

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPM-DAEDCEPFTDVYWIKFQRVDNA  200
            ++LI+RNVP+LG  D+L   F  YG +EE + + D +D   F DV W+++   D A
Sbjct  30   KYLILRNVPALGASDELIARFGKYGTIEEHRMLDDHDDATEFLDVVWLRYATTDQA  85



>ref|XP_008329808.1| PREDICTED: RNA-binding protein 48 isoform X2 [Cynoglossus semilaevis]
Length=361

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+++V+ VP++G   +L +L   YG VEE +P+D    E FT+VY IKFQ++ +A
Sbjct  49   LESRYVMVQGVPAIGVMTELVQLCALYGVVEEYRPLDEYPAEEFTEVYLIKFQKLTSA  106



>ref|XP_005308589.1| PREDICTED: RNA-binding protein 48 isoform X2 [Chrysemys picta 
bellii]
Length=367

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ +A
Sbjct  43   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYNALDEYPAEQFTEVYLIKFQKLQSA  100



>ref|XP_003968928.1| PREDICTED: RNA-binding protein 48-like [Takifugu rubripes]
Length=258

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+++++ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A +
Sbjct  49   LESRYVMIQGVPAIGVMSELIQLCALYGVVEEYRPLDEYPAEEFTEVYLVKFQKLTSARA  108



>ref|XP_010889825.1| PREDICTED: RNA-binding protein 48 [Esox lucius]
Length=373

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L +L   YG VEE + MD    E FT+VY IKFQ++ +A
Sbjct  45   LESRYLMVQGVPAIGVMTELIQLSALYGVVEEYRVMDEYPAEEFTEVYLIKFQKLTSA  102



>gb|EOB07627.1| Uncharacterized protein DKFZP564O0523-like protein, partial [Anas 
platyrhynchos]
Length=290

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ+V  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKVQCA  64



>ref|XP_007901284.1| PREDICTED: RNA-binding protein 48 [Callorhinchus milii]
Length=378

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R L+++ VP++G   +L +LF  YG +EE   +D    E FT+VY IK+QR+ +A
Sbjct  40   LESRHLLIQGVPAIGVMKELVELFALYGTIEEYSVLDEYPAEEFTEVYKIKYQRLQSA  97



>gb|KGL74274.1| RNA-binding protein 48, partial [Tinamus guttatus]
Length=317

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+V+ VP+LG   +L + F  YG VEE   +D    EPFT+VY IK Q++
Sbjct  8    LESRYLLVQGVPALGVMRELVEQFALYGAVEEYHALDEYPAEPFTEVYLIKLQKL  62



>ref|XP_005011017.1| PREDICTED: RNA-binding protein 48, partial [Anas platyrhynchos]
Length=319

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ+V  A
Sbjct  9    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKVQCA  66



>ref|XP_010226484.1| PREDICTED: RNA-binding protein 48 [Tinamus guttatus]
Length=337

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+V+ VP+LG   +L + F  YG VEE   +D    EPFT+VY IK Q++
Sbjct  28   LESRYLLVQGVPALGVMRELVEQFALYGAVEEYHALDEYPAEPFTEVYLIKLQKL  82



>gb|KFP85219.1| RNA-binding protein 48, partial [Acanthisitta chloris]
Length=321

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  8    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  62



>ref|XP_009077729.1| PREDICTED: RNA-binding protein 48, partial [Acanthisitta chloris]
Length=319

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  60



>ref|XP_009914558.1| PREDICTED: RNA-binding protein 48, partial [Haliaeetus albicilla]
Length=349

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  37   LESRYLLIQGVPALGVMKELIEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  94



>gb|KFQ87296.1| RNA-binding protein 48, partial [Phoenicopterus ruber ruber]
Length=320

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVD  194
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ 
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQ  62



>gb|KFV39293.1| RNA-binding protein 48, partial [Tyto alba]
Length=319

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  61



>ref|XP_009962099.1| PREDICTED: RNA-binding protein 48, partial [Tyto alba]
Length=318

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  60



>ref|XP_010289565.1| PREDICTED: RNA-binding protein 48 [Phaethon lepturus]
Length=405

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  95   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  152



>ref|XP_009807324.1| PREDICTED: RNA-binding protein 48, partial [Gavia stellata]
 gb|KFV51478.1| RNA-binding protein 48, partial [Gavia stellata]
Length=319

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  63



>ref|XP_005152987.1| PREDICTED: RNA-binding protein 48 [Melopsittacus undulatus]
Length=360

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  47   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  104



>ref|XP_009870257.1| PREDICTED: RNA-binding protein 48, partial [Apaloderma vittatum]
Length=317

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  60



>gb|KFP77288.1| RNA-binding protein 48, partial [Apaloderma vittatum]
Length=318

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVD  194
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++ 
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQ  62



>gb|KFZ60951.1| RNA-binding protein 48, partial [Podiceps cristatus]
Length=322

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_005505024.1| PREDICTED: RNA-binding protein 48 [Columba livia]
Length=367

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  54   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  111



>ref|XP_007654332.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 48 [Ornithorhynchus 
anatinus]
Length=338

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+V+ VP+LG   +L + F  YG +E+   +D    E FT+VY IKFQ++ +A  
Sbjct  34   LESRYLLVQGVPALGVMKELVEHFALYGAIEQYNALDEYPAEEFTEVYLIKFQKLQSARV  93

Query  207  KIQKF  221
              +K 
Sbjct  94   AKRKL  98



>gb|KFV08742.1| RNA-binding protein 48, partial [Pterocles gutturalis]
Length=316

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  61



>gb|KFO88797.1| RNA-binding protein 48, partial [Buceros rhinoceros silvestris]
Length=316

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>gb|KFQ01835.1| RNA-binding protein 48, partial [Haliaeetus albicilla]
Length=319

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELIEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_006732719.1| PREDICTED: RNA-binding protein 48 [Leptonychotes weddellii]
Length=367

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+  P+D    E FT+VY IKF  + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGAIEQYNPLDEYPAEDFTEVYLIKFMNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKRKM  107



>ref|XP_004394152.1| PREDICTED: RNA-binding protein 48 [Odobenus rosmarus divergens]
Length=367

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+  P+D    E FT+VY IKF  + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGAIEQYNPLDEYPAEDFTEVYLIKFTNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKRKM  107



>gb|KFP36379.1| RNA-binding protein 48, partial [Chlamydotis macqueenii]
Length=320

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_009273992.1| PREDICTED: RNA-binding protein 48 [Aptenodytes forsteri]
Length=365

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  54   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  111



>ref|XP_004175555.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 48 [Taeniopygia 
guttata]
Length=360

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  45   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  102



>ref|XP_004806290.1| PREDICTED: RNA-binding protein 48 [Mustela putorius furo]
Length=367

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+  P+D    E FT+VY IKF  + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGAIEQYNPLDEYPAEDFTEVYLIKFMNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKRKM  107



>emb|CEG74620.1| hypothetical protein RMATCC62417_09798 [Rhizopus microsporus]
Length=168

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPF-TDVYWIKFQRVDNASSKI  212
            R+LI+ N+PSLG  ++L KL   YG++EE KP+D         DV WIK+  +  AS+++
Sbjct  25   RYLIIENIPSLGVINELIKLCQQYGDIEEYKPLDHYPTSTVEIDVVWIKYMNI--ASARM  82

Query  213  QK  218
             K
Sbjct  83   AK  84



>gb|KFQ51355.1| RNA-binding protein 48, partial [Pelecanus crispus]
Length=291

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_010120184.1| PREDICTED: RNA-binding protein 48, partial [Chlamydotis macqueenii]
Length=319

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  63



>gb|EMC87748.1| UPF0712 protein C7orf64 like protein, partial [Columba livia]
Length=320

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>gb|KFQ79091.1| RNA-binding protein 48, partial [Phaethon lepturus]
Length=317

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  61



>ref|XP_004776489.1| PREDICTED: RNA-binding protein 48 [Mustela putorius furo]
Length=367

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+  P+D    E FT+VY IKF  + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGAIEQYNPLDEYPAEDFTEVYLIKFMNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKRKM  107



>gb|KDO30977.1| hypothetical protein SPRG_04165 [Saprolegnia parasitica CBS 223.65]
Length=392

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPM-DAEDCEPFTDVYWIKFQRVDNA  200
            ++L++RNVP+LG  D+L   F+ YG +EE + + D +D   F DV W+++   D+A
Sbjct  252  KYLVLRNVPALGASDELIARFSKYGTIEEHRMLDDHDDATEFLDVVWLRYATTDHA  307



>ref|XP_009480562.1| PREDICTED: RNA-binding protein 48, partial [Pelecanus crispus]
Length=289

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  63



>ref|XP_010776395.1| PREDICTED: RNA-binding protein 48 [Notothenia coriiceps]
Length=363

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L   +L+++ VP++G   +L +L   YG VEE +P+D    E FT+VY +KFQ++ +A +
Sbjct  49   LESNYLMIQGVPAIGVMTELIQLCALYGAVEEYRPLDEYPAEEFTEVYLVKFQKLTSARA  108

Query  207  KIQKF  221
              ++ 
Sbjct  109  AKRRM  113



>gb|KGL95654.1| RNA-binding protein 48, partial [Charadrius vociferus]
Length=317

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  61



>ref|XP_007938006.1| PREDICTED: RNA-binding protein 48 [Orycteropus afer afer]
Length=363

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+   +DA   E FT+VY IKF  + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGAIEQYNALDAYPAEAFTEVYLIKFLNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKRKM  107



>gb|KFH62681.1| hypothetical protein MVEG_12073 [Mortierella verticillata NRRL 
6337]
Length=161

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (55%), Gaps = 0/62 (0%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASSKIQ  215
            R LI+ NVPS G  D+L  L   +GE+EE + +D    E FT  Y I +  + +A +  +
Sbjct  15   RHLIIENVPSYGVIDELVDLCGIHGEIEEYRRLDTYPSEQFTQAYLISYSHIQDARTSKR  74

Query  216  KF  221
            K 
Sbjct  75   KL  76



>gb|KFP47272.1| RNA-binding protein 48, partial [Cathartes aura]
Length=320

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_010188085.1| PREDICTED: RNA-binding protein 48 [Mesitornis unicolor]
 gb|KFQ39298.1| RNA-binding protein 48 [Mesitornis unicolor]
Length=358

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  47   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  104



>ref|XP_010132908.1| PREDICTED: RNA-binding protein 48 [Buceros rhinoceros silvestris]
Length=371

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  61   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  115



>ref|XP_004646315.1| PREDICTED: RNA-binding protein 48, partial [Octodon degus]
Length=179

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP++G   +L + F  YG +EE   +D    E FT+VY IKF  + +A
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGTIEEYNALDEYPAEDFTEVYLIKFMNLQSA  100



>gb|KFR11954.1| RNA-binding protein 48, partial [Opisthocomus hoazin]
Length=318

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_010073950.1| PREDICTED: RNA-binding protein 48 [Pterocles gutturalis]
Length=358

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A  
Sbjct  49   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCARV  108

Query  207  KIQKF  221
              +K 
Sbjct  109  AKKKM  113



>ref|XP_009571047.1| PREDICTED: RNA-binding protein 48, partial [Fulmarus glacialis]
Length=317

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  60



>gb|KFV74458.1| RNA-binding protein 48, partial [Picoides pubescens]
Length=298

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY +KFQ++  A
Sbjct  9    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLLKFQKLQCA  66



>gb|KFW00304.1| RNA-binding protein 48, partial [Fulmarus glacialis]
Length=318

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKL  61



>gb|KFM05096.1| RNA-binding protein 48, partial [Aptenodytes forsteri]
Length=318

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_007522550.1| PREDICTED: RNA-binding protein 48 [Erinaceus europaeus]
Length=363

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+  P+D    E FT+VY IKF  + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGAIEQYNPLDEYPAEDFTEVYLIKFVNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKRKM  107



>ref|XP_003475148.1| PREDICTED: RNA-binding protein 48 [Cavia porcellus]
Length=364

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+V+ VP++G   +L + F  YG +EE   +D    E FT+VY IKF  + NA
Sbjct  43   LESRYLLVQGVPAVGAMKELVERFALYGTIEEYNALDEYPAEDFTEVYLIKFMNLQNA  100



>ref|XP_009328858.1| PREDICTED: RNA-binding protein 48 [Pygoscelis adeliae]
Length=319

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  8    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  65



>ref|XP_010569696.1| PREDICTED: RNA-binding protein 48 [Haliaeetus leucocephalus]
Length=356

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  44   LESRYLLIQGVPALGVMKELIEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  101



>ref|XP_009464882.1| PREDICTED: RNA-binding protein 48 [Nipponia nippon]
 gb|KFQ98338.1| RNA-binding protein 48 [Nipponia nippon]
Length=357

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  46   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  103



>gb|KFU92586.1| RNA-binding protein 48, partial [Chaetura pelagica]
Length=318

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>gb|KFW71712.1| RNA-binding protein 48, partial [Pygoscelis adeliae]
Length=318

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_007060372.1| PREDICTED: RNA-binding protein 48 [Chelonia mydas]
Length=367

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E F +VY IKFQ++ +A
Sbjct  43   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYNALDEYPAEQFKEVYLIKFQKLQSA  100



>ref|XP_009557185.1| PREDICTED: RNA-binding protein 48 [Cuculus canorus]
Length=332

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  21   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  78



>gb|KFO12951.1| RNA-binding protein 48, partial [Balearica regulorum gibbericeps]
Length=320

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  9    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  66



>gb|ELW56947.1| hypothetical protein TREES_T100019553 [Tupaia chinensis]
Length=489

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+  P+D    E FT+VY IKF  + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGPIEQYNPLDEYPAEDFTEVYLIKFVNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKKKM  107



>ref|XP_010304944.1| PREDICTED: RNA-binding protein 48, partial [Balearica regulorum 
gibbericeps]
Length=327

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  16   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  73



>gb|KFO74657.1| RNA-binding protein 48, partial [Cuculus canorus]
Length=319

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  8    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  65



>ref|XP_009501017.1| PREDICTED: RNA-binding protein 48, partial [Phalacrocorax carbo]
Length=316

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  63



>gb|KFW96341.1| RNA-binding protein 48, partial [Phalacrocorax carbo]
Length=317

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_009956536.1| PREDICTED: RNA-binding protein 48, partial [Leptosomus discolor]
Length=318

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY +KFQ++
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLVKFQKL  60



>gb|KFQ01048.1| RNA-binding protein 48, partial [Leptosomus discolor]
Length=319

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY +KFQ++
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLVKFQKL  61



>ref|XP_009886218.1| PREDICTED: RNA-binding protein 48 [Charadrius vociferus]
Length=352

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A  
Sbjct  42   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCARV  101

Query  207  KIQKF  221
              +K 
Sbjct  102  AKKKM  106



>ref|XP_002998328.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY70674.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=199

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 14/69 (20%)
 Frame = +3

Query  36   RFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMD--------------AEDCEPFTDVYW  173
            RF++VRNVP+LG  DDL K  + YG++ E + +D              + D   FTD  W
Sbjct  16   RFVVVRNVPALGVIDDLLKRLSLYGKICEYRLLDHADDRETALQFEEPSNDDSEFTDTVW  75

Query  174  IKFQRVDNA  200
            +++Q V+NA
Sbjct  76   VQYQTVNNA  84



>ref|XP_006155600.1| PREDICTED: RNA-binding protein 48 [Tupaia chinensis]
Length=365

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+  P+D    E FT+VY IKF  + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGPIEQYNPLDEYPAEDFTEVYLIKFVNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKKKM  107



>ref|XP_009934472.1| PREDICTED: RNA-binding protein 48 [Opisthocomus hoazin]
Length=451

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A  
Sbjct  140  LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCARV  199

Query  207  KIQKF  221
              +K 
Sbjct  200  AKKKM  204



>ref|XP_009999889.1| PREDICTED: RNA-binding protein 48 [Chaetura pelagica]
Length=355

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A  
Sbjct  44   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCARV  103

Query  207  KIQKF  221
              +K 
Sbjct  104  AKKKM  108



>gb|KFP09669.1| RNA-binding protein 48, partial [Egretta garzetta]
Length=318

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_009906318.1| PREDICTED: RNA-binding protein 48 [Picoides pubescens]
Length=334

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY +KFQ++  A
Sbjct  43   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLLKFQKLQCA  100



>ref|XP_006160651.1| PREDICTED: RNA-binding protein 48-like [Tupaia chinensis]
Length=385

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+  P+D    E FT+VY IKF  + +A +
Sbjct  63   LESRYLLIQGVPAVGAMKELVERFALYGPIEQYNPLDEYPAEDFTEVYLIKFVNLQSART  122

Query  207  KIQKF  221
              +K 
Sbjct  123  AKKKM  127



>ref|XP_010020846.1| PREDICTED: RNA-binding protein 48, partial [Nestor notabilis]
Length=318

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +E+   +D    E FT+VY IKFQ++  A
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEQYHALDEYPAEQFTEVYLIKFQKLQCA  63



>gb|KFQ44766.1| RNA-binding protein 48, partial [Nestor notabilis]
Length=319

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +E+   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEQYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_009639681.1| PREDICTED: RNA-binding protein 48 [Egretta garzetta]
Length=397

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A  
Sbjct  86   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCARV  145

Query  207  KIQKF  221
              +K 
Sbjct  146  AKKKM  150



>ref|XP_009977199.1| PREDICTED: RNA-binding protein 48, partial [Tauraco erythrolophus]
 gb|KFV10057.1| RNA-binding protein 48, partial [Tauraco erythrolophus]
Length=317

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+++++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  6    LESRYILIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  63



>gb|KFW75767.1| RNA-binding protein 48, partial [Manacus vitellinus]
Length=317

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY +KFQ++
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLLKFQKL  61



>ref|NP_001026145.1| RNA-binding protein 48 [Gallus gallus]
 emb|CAH65206.1| hypothetical protein RCJMB04_7n4 [Gallus gallus]
Length=350

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ +  A
Sbjct  44   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQNLQCA  101



>ref|XP_004656287.1| PREDICTED: RNA-binding protein 48 [Jaculus jaculus]
Length=366

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP++G   DL + F  YG +E+   +D    E FT+VY IKF ++ +A
Sbjct  43   LESRYLLIQGVPAVGAMKDLVERFALYGAIEQYNALDEYPAEEFTEVYLIKFMKLQSA  100



>emb|CDQ86166.1| unnamed protein product [Oncorhynchus mykiss]
Length=378

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP++G   +L +L   YG VEE + +D    E FT+VY IKFQ++ +A
Sbjct  47   LESRYLMLQGVPAIGVMTELIELSALYGAVEEYRVLDEYPAEQFTEVYLIKFQKLTSA  104



>dbj|BAC31089.1| unnamed protein product [Mus musculus]
Length=101

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  ++L+++ VP++G   +L + F  YG +E+   +D    E FT+VY IKF ++ +A
Sbjct  43   LESQYLLIQGVPAVGAMKELVERFALYGAIEQYNALDEYPAEDFTEVYLIKFVKLQSA  100



>gb|KFZ66366.1| RNA-binding protein 48, partial [Caprimulgus carolinensis]
Length=318

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+ + VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  7    LESRYLLTQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  64



>ref|XP_010710988.1| PREDICTED: RNA-binding protein 48 [Meleagris gallopavo]
Length=366

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ +  A
Sbjct  59   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQNLQCA  116



>ref|XP_010174507.1| PREDICTED: RNA-binding protein 48 [Caprimulgus carolinensis]
Length=347

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+ + VP+LG   +L + F  YG +EE   +D    E FT+VY IKFQ++  A
Sbjct  36   LESRYLLTQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQKLQCA  93



>gb|KFV90167.1| RNA-binding protein 48, partial [Eurypyga helias]
Length=320

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    + FT+VY IKFQ++  A
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPADQFTEVYLIKFQKLQCA  64



>gb|AAH20919.1| C7orf64 protein, partial [Homo sapiens]
Length=163

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  ++L+++ VP++G   +L + F  YG +E+   +D    E FT+VY IKF  + +A +
Sbjct  43   LESQYLLIQGVPAVGVMKELVERFALYGAIEQYNALDEYPAEDFTEVYLIKFMNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKRKM  107



>ref|XP_010153913.1| PREDICTED: RNA-binding protein 48, partial [Eurypyga helias]
Length=319

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    + FT+VY IKFQ++  A
Sbjct  6    LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPADQFTEVYLIKFQKLQCA  63



>gb|AAF28982.1|AF161422_1 HSPC304 [Homo sapiens]
Length=131

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  ++L+++ VP++G   +L + F  YG +E+   +D    E FT+VY IKF  + +A +
Sbjct  45   LESQYLLIQGVPAVGVMKELVERFALYGAIEQYNALDEYPAEDFTEVYLIKFMNLQSART  104

Query  207  KIQKF  221
              +K 
Sbjct  105  AKRKM  109



>ref|XP_005518854.1| PREDICTED: RNA-binding protein 48 [Pseudopodoces humilis]
Length=356

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVD  194
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKF+++ 
Sbjct  44   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFKKLQ  99



>ref|XP_009672621.1| PREDICTED: RNA-binding protein 48 [Struthio camelus australis]
Length=338

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG ++E   +D    E FT+VY IKFQ++
Sbjct  24   LESRYLLIQGVPALGVMKELVEQFALYGAIDEYHALDEYPAEQFTEVYLIKFQKL  78



>ref|XP_004702714.1| PREDICTED: RNA-binding protein 48 [Echinops telfairi]
Length=365

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+   +D    E FT+VY IKF  + NA +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGAIEQYNALDEYPAEDFTEVYLIKFLNLQNART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKKKM  107



>gb|KFV80942.1| RNA-binding protein 48, partial [Struthio camelus australis]
Length=321

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG ++E   +D    E FT+VY IKFQ++
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIDEYHALDEYPAEQFTEVYLIKFQKL  61



>ref|XP_005041157.1| PREDICTED: RNA-binding protein 48 [Ficedula albicollis]
Length=357

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY IKF+++  A
Sbjct  45   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFKKLQCA  102



>ref|XP_005228874.1| PREDICTED: RNA-binding protein 48 [Falco peregrinus]
Length=367

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP+LG   +L + F  YG ++E   +D    E FT+VY IKFQ++  A
Sbjct  54   LESRYLLIQGVPALGVMKELVEQFALYGAIDEYHALDEYPAEQFTEVYLIKFQKLQCA  111



>ref|XP_005432237.1| PREDICTED: RNA-binding protein 48 [Falco cherrug]
Length=395

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP+LG   +L + F  YG ++E   +D    E FT+VY IKFQ++  A  
Sbjct  82   LESRYLLIQGVPALGVMKELVEQFALYGAIDEYHALDEYPAEQFTEVYLIKFQKLQCARV  141

Query  207  KIQKF  221
              +K 
Sbjct  142  AKKKM  146



>ref|XP_004908823.1| PREDICTED: RNA-binding protein 48 [Heterocephalus glaber]
 ref|XP_004862424.1| PREDICTED: RNA-binding protein 48 [Heterocephalus glaber]
 gb|EHB18208.1| hypothetical protein GW7_20508 [Heterocephalus glaber]
Length=382

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +EE   +D    E FT+VY IKF  +   SS
Sbjct  61   LESRYLLIQGVPAVGAMKELVERFALYGTIEEYNALDEYPAEDFTEVYLIKFMNLQ--SS  118

Query  207  KIQK  218
            +I K
Sbjct  119  RIAK  122



>ref|XP_008931559.1| PREDICTED: RNA-binding protein 48 [Manacus vitellinus]
Length=361

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG +EE   +D    E FT+VY +KFQ++
Sbjct  51   LESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLLKFQKL  105



>ref|XP_011019354.1| PREDICTED: uncharacterized protein LOC105122127 [Populus euphratica]
 ref|XP_011019355.1| PREDICTED: uncharacterized protein LOC105122127 [Populus euphratica]
 ref|XP_011019356.1| PREDICTED: uncharacterized protein LOC105122127 [Populus euphratica]
Length=101

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  328  EPQETANNRDSSMTIVSSNKEYFSSESMNQTVRLVREKLNKIQSSA  465
            E Q      D  +T VSS ++YF ++SMNQTVRL REK NKIQ S+
Sbjct  44   ESQNVHQIGDPPVTRVSSGQDYFPAQSMNQTVRLAREKFNKIQPSS  89



>ref|XP_008259956.1| PREDICTED: RNA-binding protein 48-like [Oryctolagus cuniculus]
Length=388

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+V+ VP+LG   +L + F  YG +E+   +D    E FT+VY IKF  + +A +
Sbjct  82   LESRYLLVQGVPALGAMRELVERFALYGAIEQYNALDEYPAEEFTEVYLIKFLHLHSART  141

Query  207  KIQKF  221
              +K 
Sbjct  142  AKRKM  146



>ref|XP_003771970.1| PREDICTED: RNA-binding protein 48 [Sarcophilus harrisii]
Length=369

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNA  200
            L  R+L+++ VP++G   +L + F  +G +E+   +D    E FT+VY IKFQ++ +A
Sbjct  43   LESRYLLIQGVPAVGVMKELIEQFALFGAIEQYNALDEYPAEEFTEVYLIKFQKLQSA  100



>dbj|BAG57807.1| unnamed protein product [Homo sapiens]
Length=174

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  ++L+++ VP++G   +L + F  YG +E+   +D    E FT+VY IKF  + +A +
Sbjct  43   LESQYLLIQGVPAVGVMKELVERFALYGAIEQYNALDEYPAEDFTEVYLIKFMNLQSART  102

Query  207  KIQK  218
              +K
Sbjct  103  AKRK  106



>ref|XP_539419.3| PREDICTED: RNA-binding protein 48 isoform X2 [Canis lupus familiaris]
Length=367

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+   +D    E FT+VY IKF  + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGAIEQYNALDEYPAEDFTEVYLIKFMNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKRKM  107



>ref|XP_008259964.1| PREDICTED: RNA-binding protein 48-like [Oryctolagus cuniculus]
Length=388

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+V+ VP+LG   +L + F  YG +E+   +D    E FT+VY IKF  + +A +
Sbjct  82   LESRYLLVQGVPALGAMRELVERFALYGAIEQYNALDEYPAEEFTEVYLIKFLHLHSART  141

Query  207  KIQKF  221
              +K 
Sbjct  142  AKRKM  146



>ref|XP_008570478.1| PREDICTED: RNA-binding protein 48 isoform X1 [Galeopterus variegatus]
Length=396

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG VE+   +D    E FT+VY IKF+ + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGAVEQYNALDEYPAEDFTEVYLIKFRNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKKKM  107



>ref|XP_008570485.1| PREDICTED: RNA-binding protein 48 isoform X2 [Galeopterus variegatus]
Length=373

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG VE+   +D    E FT+VY IKF+ + +A +
Sbjct  49   LESRYLLIQGVPAVGAMKELVERFALYGAVEQYNALDEYPAEDFTEVYLIKFRNLQSART  108

Query  207  KIQKF  221
              +K 
Sbjct  109  AKKKM  113



>gb|KFQ18039.1| RNA-binding protein 48, partial [Merops nubicus]
Length=314

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRV  191
            L  R+L+++ VP+LG   +L + F  YG ++E   +D    + FT+VY IKFQ++
Sbjct  7    LESRYLLIQGVPALGVMKELVEQFALYGAIQEYHALDEYPADQFTEVYLIKFQKL  61



>gb|EFB29063.1| hypothetical protein PANDA_021537 [Ailuropoda melanoleuca]
Length=341

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  27   LRPRFLIVRNVPSLGCGDDLAKLFTTYGEVEECKPMDAEDCEPFTDVYWIKFQRVDNASS  206
            L  R+L+++ VP++G   +L + F  YG +E+   +D    E FT+VY IKF  + +A +
Sbjct  43   LESRYLLIQGVPAVGAMKELVERFALYGAIEQYNALDEYPAEDFTEVYLIKFMNLQSART  102

Query  207  KIQKF  221
              +K 
Sbjct  103  AKRKM  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1627375116822