BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25138_g4_i1 len=912 path=[2818:0-81 15402:82-737 10794:738-911]

Length=912
                                                                      Score     E

ref|YP_009049640.1|  hypothetical protein                               122   4e-29   
gb|AIG89869.1|  hypothetical protein                                    117   1e-28   



>ref|YP_009049640.1| hypothetical protein (mitochondrion) [Capsicum annuum]
 gb|AIG89998.1| hypothetical protein (mitochondrion) [Capsicum annuum]
Length=277

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 130/219 (59%), Gaps = 28/219 (13%)
 Frame = +3

Query  54   ISVSKNKSLFFFWGEQSSQRKVSKQMKVQKFRSLKWIYEQTLPLesscsasesscsvsaa  233
            +S   N S+FFF       R  S + K  K ++L  IY +T P+  S S           
Sbjct  31   VSKVANGSIFFF-------RMYSNKKK--KMKTLAEIYSRTTPMHESPSL----------  71

Query  234  eRNSFEEESVSPLLRDVECPPLSPSPPKTAEIPSSYHNIGVPsspdsdsssemssiystl  413
                  EE +SPL   +  PPLSPSPP T  IPS   N  +P+ P S SSS MSSI   L
Sbjct  72   ---GVAEEGLSPLYNSISFPPLSPSPPNTLGIPS---NSIIPAPPHSPSSSGMSSINEIL  125

Query  414  sPYTEREVCSAQGRIEEKVASIAEETGFQLDGEARYVLGQWVHGESSDPSTLRAILKDLN  593
            SPYTER+VC AQGRIEE+V+SIA   G  LD EA +VLGQWVHGESS+ + L +IL DL 
Sbjct  126  SPYTERKVCEAQGRIEEEVSSIANANGITLDEEAPFVLGQWVHGESSNLNYLTSILSDLR  185

Query  594  QKKEQSEWFEEAIDAWSRQFVNSDVPSPLEGLDIHPPAL  710
              KE+S+WFE A D WS++F    VPSP+E   ++PP +
Sbjct  186  TMKEKSQWFESATDVWSKKFF---VPSPVEQFHMNPPLV  221



>gb|AIG89869.1| hypothetical protein (mitochondrion) [Capsicum annuum]
Length=132

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 73/101 (72%), Gaps = 4/101 (4%)
 Frame = +3

Query  417  PYTEREVCSAQGRIEEKVASIAEETGFQLDGEARYVLGQWVHGESSDPSTLRAILKDLNQ  596
            PYTER+VC AQGRIEE+V+SIA   G  LD EA +VLGQWVHGESS+ + L +IL DL  
Sbjct  10   PYTERKVCEAQGRIEEEVSSIANANGITLDEEAPFVLGQWVHGESSNLNYLTSILSDLRT  69

Query  597  KKEQSEWFEEAIDAWSRQFVNSDVPSPLEGLDIHPPALGDL  719
             KE+S+WFE A D WS++F    VPSP+E   ++ PAL D 
Sbjct  70   MKEKSQWFESATDVWSKKFF---VPSPVEQFHMN-PALVDF  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1899776125104