BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25137_g1_i1 len=1755 path=[2885:0-235 3576:236-275 3616:276-381
3722:382-655 388:656-750 4088:751-776 439:777-816 4153:817-850
4187:851-1103 512:1104-1137 4472:1138-1139 708:1140-1222
4555:1223-1293 573:1294-1349 4681:1350-1403 4735:1404-1453
4784:1454-1496 136:1497-1754]

Length=1755
                                                                      Score     E

ref|XP_011088043.1|  PREDICTED: F-box protein SKIP22-like               341   4e-106   
ref|XP_009631641.1|  PREDICTED: F-box protein SKIP22-like               337   1e-104   
ref|XP_006348453.1|  PREDICTED: F-box protein SKIP22-like               335   3e-104   
ref|XP_009803038.1|  PREDICTED: F-box protein SKIP22-like               333   1e-103   
ref|XP_004228659.1|  PREDICTED: F-box protein SKIP22-like               332   9e-103   
emb|CDO97303.1|  unnamed protein product                                319   1e-97    
ref|XP_010248340.1|  PREDICTED: F-box protein SKIP22-like               299   3e-90    
gb|EPS73205.1|  hypothetical protein M569_01560                         283   8e-85    
ref|XP_006383058.1|  hypothetical protein POPTR_0005s11160g             278   1e-81    
gb|EYU37554.1|  hypothetical protein MIMGU_mgv1a022377mg                274   2e-81    
ref|XP_007042687.1|  F-box family protein, putative                     273   3e-80    
ref|XP_011043138.1|  PREDICTED: F-box protein SKIP22-like               273   6e-80    
emb|CBI25128.3|  unnamed protein product                                267   6e-78    
ref|XP_008236258.1|  PREDICTED: F-box protein SKIP22-like               265   1e-77    
ref|XP_010029872.1|  PREDICTED: F-box protein SKIP22-like               263   2e-76    
ref|XP_009335347.1|  PREDICTED: F-box protein SKIP22-like               257   2e-74    
ref|XP_004289759.1|  PREDICTED: F-box protein SKIP22-like               255   2e-73    
ref|XP_008454420.1|  PREDICTED: F-box protein SKIP22-like               247   2e-70    
ref|XP_010551568.1|  PREDICTED: F-box protein SKIP22-like               247   2e-70    
ref|XP_004156873.1|  PREDICTED: F-box protein SKIP22-like               244   1e-69    
ref|XP_004150266.1|  PREDICTED: F-box protein SKIP22-like               243   3e-69    
ref|XP_010691539.1|  PREDICTED: putative F-box protein At1g23770        244   3e-69    
emb|CDY25801.1|  BnaA07g09810D                                          240   2e-68    
ref|XP_003555304.1|  PREDICTED: F-box protein SKIP22-like               239   3e-68    
ref|XP_007200991.1|  hypothetical protein PRUPE_ppa005011mg             239   7e-68    
ref|XP_009103155.1|  PREDICTED: F-box protein SKIP22-like               238   1e-67    
emb|CDY28475.1|  BnaC07g13030D                                          238   2e-67    
gb|AFK46566.1|  unknown                                                 237   3e-67    
ref|XP_004496864.1|  PREDICTED: F-box protein SKIP22-like isoform X2    234   4e-66    
ref|XP_004496863.1|  PREDICTED: F-box protein SKIP22-like isoform X1    234   4e-66    
ref|XP_003535677.1|  PREDICTED: F-box protein SKIP22-like isoform X1    234   6e-66    
ref|XP_002522106.1|  conserved hypothetical protein                     235   6e-66    Ricinus communis
gb|KCW62709.1|  hypothetical protein EUGRSUZ_G00280                     233   7e-66    
ref|XP_010095741.1|  F-box protein SKIP22                               233   1e-65    
ref|XP_006416056.1|  hypothetical protein EUTSA_v10009461mg             233   3e-65    
ref|XP_002276156.1|  PREDICTED: putative F-box protein At1g23770        233   9e-65    Vitis vinifera
ref|XP_006422751.1|  hypothetical protein CICLE_v10028208mg             232   1e-64    
ref|XP_006486882.1|  PREDICTED: F-box protein SKIP22-like               231   1e-64    
gb|KDO49537.1|  hypothetical protein CISIN_1g040442mg                   231   1e-64    
ref|XP_006304685.1|  hypothetical protein CARUB_v10011933mg             230   2e-64    
ref|XP_008372958.1|  PREDICTED: F-box protein SKIP22-like               229   4e-64    
gb|KFK44452.1|  hypothetical protein AALP_AA1G258700                    228   4e-64    
ref|XP_010477680.1|  PREDICTED: F-box protein SKIP22-like               227   2e-63    
ref|XP_010908979.1|  PREDICTED: F-box protein SKIP22-like               221   4e-61    
ref|XP_007143141.1|  hypothetical protein PHAVU_007G047200g             220   1e-60    
ref|XP_006857066.1|  hypothetical protein AMTR_s00065p00071220          218   8e-60    
ref|XP_010065288.1|  PREDICTED: F-box protein SKIP22-like isoform X1    209   7e-58    
ref|XP_009412285.1|  PREDICTED: F-box protein SKIP22-like               211   3e-57    
ref|XP_008793611.1|  PREDICTED: F-box protein SKIP22-like               209   2e-56    
ref|XP_010555093.1|  PREDICTED: F-box protein SKIP22-like               207   5e-56    
gb|KDP44550.1|  hypothetical protein JCGZ_16383                         203   5e-56    
ref|XP_010498884.1|  PREDICTED: F-box protein SKIP22-like               206   7e-56    
ref|XP_010026929.1|  PREDICTED: F-box protein SKIP22-like               203   8e-55    
ref|XP_010460152.1|  PREDICTED: F-box protein SKIP22-like               201   1e-53    
gb|KDP44549.1|  hypothetical protein JCGZ_16382                         201   2e-53    
ref|XP_002522107.1|  conserved hypothetical protein                     195   9e-53    Ricinus communis
gb|KCW60650.1|  hypothetical protein EUGRSUZ_H03378                     194   2e-52    
gb|KEH28962.1|  F-box SKIP22-like protein                               191   2e-52    
gb|EYU37548.1|  hypothetical protein MIMGU_mgv1a026068mg                193   2e-52    
ref|XP_010024195.1|  PREDICTED: F-box protein SKIP22-like               195   5e-52    
ref|XP_009412931.1|  PREDICTED: F-box protein SKIP22-like               196   6e-52    
ref|XP_010462864.1|  PREDICTED: LOW QUALITY PROTEIN: putative F-b...    193   2e-51    
ref|XP_002893306.1|  F-box family protein                               189   5e-49    
dbj|BAH57632.1|  F-box family protein                                   187   7e-49    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564203.1|  F-box protein SKIP22                                  187   1e-48    Arabidopsis thaliana [mouse-ear cress]
gb|KEH22785.1|  F-box SKIP22-like protein                               181   1e-48    
dbj|BAH57639.1|  F-box family protein                                   186   2e-48    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57630.1|  F-box family protein                                   186   3e-48    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57631.1|  F-box family protein                                   186   3e-48    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57650.1|  F-box family protein                                   186   3e-48    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57634.1|  F-box family protein                                   186   3e-48    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57647.1|  F-box family protein                                   185   6e-48    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57651.1|  F-box family protein                                   185   6e-48    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57648.1|  F-box family protein                                   184   8e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501564.1|  PREDICTED: putative F-box protein At1g23770        182   9e-48    
ref|XP_010109329.1|  Putative F-box protein                             180   1e-47    
ref|XP_007148963.1|  hypothetical protein PHAVU_005G029200g             183   4e-47    
gb|EYU37547.1|  hypothetical protein MIMGU_mgv1a017729mg                176   3e-46    
gb|KCW56829.1|  hypothetical protein EUGRSUZ_I02498                     181   3e-46    
ref|XP_010030889.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...    182   9e-46    
ref|XP_002893305.1|  F-box family protein                               172   8e-45    
gb|KHN01574.1|  F-box protein SKIP22                                    166   2e-43    
ref|XP_003558438.1|  PREDICTED: F-box protein SKIP22-like               169   2e-42    
ref|XP_007148961.1|  hypothetical protein PHAVU_005G029000g             167   3e-42    
dbj|BAK05875.1|  predicted protein                                      167   1e-41    
dbj|BAK08172.1|  predicted protein                                      167   1e-41    
ref|XP_009140225.1|  PREDICTED: F-box protein SKIP22-like               164   1e-41    
ref|XP_010471030.1|  PREDICTED: F-box protein SKIP22-like               164   3e-41    
emb|CDY15942.1|  BnaA04g11690D                                          161   1e-40    
ref|XP_010415712.1|  PREDICTED: F-box protein SKIP22-like               160   4e-40    
ref|XP_007149055.1|  hypothetical protein PHAVU_005G037100g             158   1e-39    
ref|NP_173789.1|  F-box family protein                                  154   2e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006422750.1|  hypothetical protein CICLE_v10028907mg             153   3e-38    
gb|KDO49536.1|  hypothetical protein CISIN_1g038588mg                   153   3e-38    
emb|CDX99652.1|  BnaC04g34090D                                          149   2e-37    
ref|XP_009335274.1|  PREDICTED: putative F-box protein At1g23770        147   1e-36    
ref|XP_010427808.1|  PREDICTED: F-box protein SKIP22                    149   4e-36    
ref|XP_008382804.1|  PREDICTED: putative F-box protein At1g23770        144   1e-35    
ref|XP_006304729.1|  hypothetical protein CARUB_v10012066mg             147   2e-35    
gb|EEE58649.1|  hypothetical protein OsJ_10030                          139   1e-32    Oryza sativa Japonica Group [Japonica rice]
gb|ABF94799.1|  Helix-loop-helix DNA-binding domain containing pr...    140   2e-32    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006486881.1|  PREDICTED: F-box protein SKIP22-like               136   2e-32    
ref|XP_004301718.1|  PREDICTED: putative F-box protein At1g23770-...    136   2e-32    
ref|NP_001049465.1|  Os03g0232000                                       139   2e-32    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006302363.1|  hypothetical protein CARUB_v10020430mg             137   4e-32    
gb|EMT20422.1|  Putative F-box protein                                  135   6e-32    
ref|XP_002887295.1|  predicted protein                                  129   5e-31    
gb|EEC74815.1|  hypothetical protein OsI_10635                          135   6e-31    Oryza sativa Indica Group [Indian rice]
ref|XP_010904578.1|  PREDICTED: putative F-box protein At1g23770        129   1e-29    
tpg|DAA44190.1|  TPA: hypothetical protein ZEAMMB73_495019              130   2e-29    
gb|AAO00689.1|  Hypothetical protein                                    133   2e-29    Oryza sativa Japonica Group [Japonica rice]
gb|ABF94800.1|  Helix-loop-helix DNA-binding domain containing pr...    133   3e-29    Oryza sativa Japonica Group [Japonica rice]
gb|ABF94798.1|  Helix-loop-helix DNA-binding domain containing pr...    133   3e-29    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001776852.1|  predicted protein                                  130   1e-28    
dbj|BAH20254.1|  AT1G23780                                              124   3e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011046013.1|  PREDICTED: F-box protein SKIP22-like               124   3e-28    
gb|EYU37549.1|  hypothetical protein MIMGU_mgv1a022435mg                123   4e-28    
ref|XP_011037604.1|  PREDICTED: F-box protein SKIP22-like               124   7e-28    
ref|XP_011037603.1|  PREDICTED: putative F-box protein At1g23770        122   2e-27    
ref|XP_002306104.2|  hypothetical protein POPTR_0004s16190g             120   1e-26    Populus trichocarpa [western balsam poplar]
dbj|BAH57583.1|  F-box family protein                                   119   2e-26    Arabidopsis lyrata [lyrate rockcress]
dbj|BAH57582.1|  F-box family protein                                   115   3e-26    Arabidopsis lyrata [lyrate rockcress]
ref|XP_002306233.2|  hypothetical protein POPTR_0004s16180g             119   4e-26    Populus trichocarpa [western balsam poplar]
ref|XP_002986189.1|  hypothetical protein SELMODRAFT_49052              112   5e-25    
ref|XP_002877958.1|  hypothetical protein ARALYDRAFT_906819             111   9e-25    
ref|XP_002522109.1|  hypothetical protein RCOM_1382970                  113   1e-24    Ricinus communis
ref|XP_002984999.1|  hypothetical protein SELMODRAFT_49051              110   2e-24    
ref|XP_002321452.2|  hypothetical protein POPTR_0015s02220g             113   8e-24    Populus trichocarpa [western balsam poplar]
ref|XP_002468225.1|  hypothetical protein SORBIDRAFT_01g042080          113   2e-23    Sorghum bicolor [broomcorn]
gb|EYU37551.1|  hypothetical protein MIMGU_mgv1a005787mg                112   4e-23    
gb|ADE77516.1|  unknown                                                 109   7e-23    
ref|XP_006372530.1|  hypothetical protein POPTR_0017s02510g             102   2e-21    
ref|NP_177193.1|  F-box protein                                         102   2e-21    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57622.1|  F-box family protein                                   100   8e-21    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57621.1|  F-box family protein                                   100   1e-20    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507315.1|  PREDICTED: F-box protein At1g70360-like          96.3    1e-19    
dbj|BAH57624.1|  F-box family protein                                 96.7    3e-19    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57626.1|  F-box family protein                                 96.3    4e-19    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57623.1|  F-box family protein                                 95.9    4e-19    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57608.1|  F-box family protein                                 95.9    4e-19    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57628.1|  F-box family protein                                 95.5    6e-19    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001183495.1|  uncharacterized protein LOC100501928             99.0    6e-19    
dbj|BAH57611.1|  F-box family protein                                 95.5    7e-19    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57627.1|  F-box family protein                                 95.1    7e-19    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57620.1|  F-box family protein                                 94.7    1e-18    Arabidopsis thaliana [mouse-ear cress]
gb|KHN19388.1|  F-box protein SKIP22                                  97.1    4e-18    
emb|CDX89734.1|  BnaC03g46480D                                        85.9    1e-15    
ref|XP_010065289.1|  PREDICTED: putative F-box protein At1g23770 ...  86.3    2e-15    
ref|XP_005846838.1|  hypothetical protein CHLNCDRAFT_134618           86.7    1e-14    
gb|KFK42245.1|  hypothetical protein AALP_AA2G230200                  79.3    4e-13    
gb|AFK48968.1|  unknown                                               77.8    4e-13    
gb|EYU37550.1|  hypothetical protein MIMGU_mgv1a010931mg              77.0    3e-12    
gb|EYU37546.1|  hypothetical protein MIMGU_mgv1a023168mg              74.7    8e-12    
ref|XP_004675769.1|  PREDICTED: F-box only protein 7 isoform X1       72.0    7e-10    
ref|XP_008578864.1|  PREDICTED: F-box only protein 7 isoform X1       71.2    1e-09    
ref|XP_005643974.1|  hypothetical protein COCSUDRAFT_48944            71.2    1e-09    
ref|XP_008053636.1|  PREDICTED: F-box only protein 7 isoform X2       70.1    2e-09    
ref|NP_001033148.1|  F-box only protein 7                             70.1    2e-09    Bos taurus [bovine]
ref|XP_008841330.1|  PREDICTED: F-box only protein 7 isoform X1       70.1    3e-09    
ref|NP_001165222.1|  F-box only protein 7                             69.3    5e-09    Sus scrofa [pigs]
ref|XP_003258173.1|  PREDICTED: F-box only protein 7 isoform 1        68.6    7e-09    
ref|XP_008973225.1|  PREDICTED: F-box only protein 7 isoform X2       68.2    1e-08    
ref|NP_036311.3|  F-box only protein 7 isoform 1                      67.8    1e-08    Homo sapiens [man]
gb|EAW60026.1|  F-box protein 7, isoform CRA_d                        67.8    1e-08    
gb|ADB19861.1|  F-box protein 7                                       67.8    1e-08    Sus scrofa [pigs]
ref|XP_003989263.1|  PREDICTED: F-box only protein 7                  67.4    2e-08    
gb|EFB18566.1|  hypothetical protein PANDA_010472                     67.0    2e-08    Ailuropoda melanoleuca
ref|XP_004418132.1|  PREDICTED: F-box only protein 7 isoform 1        67.0    2e-08    
ref|XP_005893759.1|  PREDICTED: F-box only protein 7                  67.0    2e-08    
dbj|BAF84661.1|  unnamed protein product                              67.0    2e-08    Homo sapiens [man]
gb|AAH08361.1|  F-box protein 7                                       67.0    3e-08    Homo sapiens [man]
ref|XP_002501684.1|  predicted protein                                67.0    3e-08    Micromonas commoda
ref|XP_009232566.1|  PREDICTED: F-box only protein 7 isoform X1       66.6    3e-08    
ref|XP_007946416.1|  PREDICTED: F-box only protein 7 isoform X1       66.6    3e-08    
ref|XP_009436518.1|  PREDICTED: F-box only protein 7 isoform X3       66.2    4e-08    
ref|NP_001162200.1|  F-box only protein 7                             66.2    4e-08    Papio anubis [baboon]
ref|XP_005655574.1|  PREDICTED: F-box only protein 7 isoform X1       66.2    4e-08    
ref|XP_006865302.1|  PREDICTED: F-box only protein 7                  66.2    5e-08    
ref|XP_001153721.2|  PREDICTED: F-box only protein 7 isoform X1       66.2    5e-08    Pan troglodytes
ref|XP_005655575.1|  PREDICTED: F-box only protein 7 isoform X2       66.2    5e-08    
ref|XP_006914760.1|  PREDICTED: LOW QUALITY PROTEIN: F-box only p...  66.2    5e-08    
ref|NP_001244387.1|  F-box only protein 7                             65.9    6e-08    
ref|XP_007973761.1|  PREDICTED: F-box only protein 7 isoform X1       65.5    8e-08    
ref|XP_007973764.1|  PREDICTED: F-box only protein 7 isoform X3       65.1    8e-08    
ref|XP_004006757.1|  PREDICTED: F-box only protein 7                  65.1    8e-08    
ref|XP_007198428.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protein 7  65.1    9e-08    
gb|ACB21205.1|  F-box only protein 7 isoform 1 (predicted)            65.1    9e-08    Plecturocebus moloch [Dusky titi]
ref|XP_007096560.1|  PREDICTED: F-box only protein 7                  65.1    9e-08    
ref|XP_010377442.1|  PREDICTED: F-box only protein 7 isoform X1       65.1    1e-07    
gb|EAY77609.1|  hypothetical protein OsI_32651                        64.3    1e-07    Oryza sativa Indica Group [Indian rice]
ref|XP_010377444.1|  PREDICTED: F-box only protein 7 isoform X3       64.3    1e-07    
ref|XP_003783315.1|  PREDICTED: F-box only protein 7                  64.7    1e-07    
ref|XP_010968782.1|  PREDICTED: F-box only protein 7                  64.7    1e-07    
ref|XP_006205918.1|  PREDICTED: F-box only protein 7 isoform X1       64.3    2e-07    
ref|XP_010992483.1|  PREDICTED: F-box only protein 7                  63.9    2e-07    
ref|XP_006069618.1|  PREDICTED: F-box only protein 7 isoform X2       63.9    3e-07    
ref|XP_008142926.1|  PREDICTED: F-box only protein 7 isoform X1       63.5    3e-07    
ref|XP_006205919.1|  PREDICTED: F-box only protein 7 isoform X2       63.5    3e-07    
ref|NP_001064095.2|  Os10g0130200                                     63.2    3e-07    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004063414.1|  PREDICTED: F-box only protein 7 isoform 1        63.5    3e-07    
ref|XP_006170430.1|  PREDICTED: F-box only protein 7                  63.5    3e-07    
gb|EAY73643.1|  hypothetical protein OsI_01532                        62.4    3e-07    Oryza sativa Indica Group [Indian rice]
gb|AAF04471.1|AF129537_1  F-box protein Fbx7                          63.2    4e-07    Homo sapiens [man]
ref|XP_009007985.1|  PREDICTED: F-box only protein 7 isoform X1       63.2    4e-07    
ref|XP_008142927.1|  PREDICTED: F-box only protein 7 isoform X2       63.2    4e-07    
gb|EHH65784.1|  hypothetical protein EGM_02621                        63.2    4e-07    
gb|ABZ10471.1|  F-box only protein 7 isoform 1 (predicted)            62.8    5e-07    Callithrix jacchus [common marmoset]
ref|XP_007449495.1|  PREDICTED: F-box only protein 7 isoform X1       62.4    6e-07    
ref|XP_006092813.1|  PREDICTED: F-box only protein 7                  62.4    6e-07    
ref|XP_004414246.1|  PREDICTED: F-box only protein 7 isoform 1        62.4    6e-07    
gb|EAZ15194.1|  hypothetical protein OsJ_30613                        61.6    7e-07    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662158.1|  PREDICTED: uncharacterized protein LOC102719619  62.4    9e-07    
ref|XP_007449496.1|  PREDICTED: F-box only protein 7 isoform X2       62.0    9e-07    
emb|CDY71474.1|  BnaCnng73090D                                        60.8    1e-06    
ref|XP_008703858.1|  PREDICTED: F-box only protein 7                  61.6    1e-06    
gb|EHH20175.1|  hypothetical protein EGK_02974                        61.2    2e-06    
gb|KFO61229.1|  F-box only protein 7                                  61.2    2e-06    
ref|XP_004318488.1|  PREDICTED: F-box only protein 7 isoform 1        60.5    3e-06    
gb|ACC68887.1|  F-box only protein 7 isoform 1 (predicted)            60.1    3e-06    Rhinolophus ferrumequinum
ref|XP_005680709.1|  PREDICTED: F-box only protein 7                  60.1    3e-06    
ref|XP_004269451.1|  PREDICTED: F-box only protein 7 isoform 1        59.7    5e-06    
ref|XP_004347188.1|  Fbox domain containing protein                   58.2    5e-06    
gb|KFW81213.1|  F-box only protein 7                                  59.7    5e-06    
ref|XP_006138033.1|  PREDICTED: F-box only protein 7                  58.5    8e-06    
ref|XP_005040029.1|  PREDICTED: F-box only protein 7                  58.9    9e-06    
gb|KFV86169.1|  F-box only protein 7                                  58.5    1e-05    
ref|XP_001366168.1|  PREDICTED: F-box only protein 7                  58.5    1e-05    Monodelphis domestica
ref|NP_001064110.1|  Os10g0133100                                     57.8    1e-05    Oryza sativa Japonica Group [Japonica rice]
gb|EOB07206.1|  F-box only protein 7                                  58.5    1e-05    
ref|XP_001508986.2|  PREDICTED: F-box only protein 7                  58.2    1e-05    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_003771163.1|  PREDICTED: F-box only protein 7                  57.4    2e-05    
gb|KFP60713.1|  F-box only protein 7                                  57.4    2e-05    
ref|XP_007102048.1|  PREDICTED: F-box only protein 7                  57.4    3e-05    
gb|KFV92036.1|  F-box only protein 7                                  57.4    3e-05    
gb|AAL01164.1|AC079843_4  Hypothetical protein                        56.6    3e-05    Oryza sativa Japonica Group [Japonica rice]
gb|KFO95410.1|  F-box only protein 7                                  57.0    3e-05    
ref|XP_004675770.1|  PREDICTED: F-box only protein 7 isoform X2       56.6    3e-05    
gb|KFW83418.1|  F-box only protein 7                                  56.2    5e-05    
gb|KFP84963.1|  F-box only protein 7                                  56.2    6e-05    
gb|KGL78403.1|  F-box only protein 7                                  56.2    6e-05    
gb|KFP42535.1|  F-box only protein 7                                  56.2    6e-05    
gb|KFQ00593.1|  F-box only protein 7                                  56.2    6e-05    
gb|KFP81590.1|  F-box only protein 7                                  56.2    6e-05    
ref|XP_010214657.1|  PREDICTED: F-box only protein 7                  55.8    7e-05    
ref|XP_007062736.1|  PREDICTED: F-box only protein 7                  55.8    7e-05    
gb|KFV05047.1|  F-box only protein 7                                  55.8    7e-05    
gb|KFQ79745.1|  F-box only protein 7                                  55.8    7e-05    
ref|XP_008841331.1|  PREDICTED: F-box only protein 7 isoform X2       55.8    7e-05    
ref|XP_009372161.1|  PREDICTED: F-box protein SKIP22-like             54.7    7e-05    
gb|KFW73487.1|  F-box only protein 7                                  55.8    8e-05    
gb|KFK33980.1|  hypothetical protein AALP_AA5G086400                  52.4    8e-05    
gb|KFK33981.1|  hypothetical protein AALP_AA5G086400                  52.0    8e-05    
gb|KGL90824.1|  F-box only protein 7                                  55.5    9e-05    
gb|KFO86676.1|  F-box only protein 7                                  55.5    9e-05    
gb|KFR07782.1|  F-box only protein 7                                  55.5    9e-05    
ref|XP_005314942.1|  PREDICTED: F-box only protein 7-like             55.1    9e-05    
ref|XP_005098884.1|  PREDICTED: F-box only protein 7-like             55.5    1e-04    
ref|XP_005655576.1|  PREDICTED: F-box only protein 7 isoform X3       55.1    1e-04    
ref|XP_006271729.1|  PREDICTED: F-box only protein 7                  55.1    1e-04    
gb|KFU95751.1|  F-box only protein 7                                  55.1    1e-04    
gb|KFM05986.1|  F-box only protein 7                                  55.1    1e-04    
ref|XP_004418133.1|  PREDICTED: F-box only protein 7 isoform 2        54.7    2e-04    
gb|KFW00739.1|  F-box only protein 7                                  54.7    2e-04    
gb|ACE77709.1|  F-box only protein 7 (predicted)                      54.7    2e-04    Sorex araneus [Eurasian shrew]
gb|KFO07820.1|  F-box only protein 7                                  54.7    2e-04    
ref|XP_008578865.1|  PREDICTED: F-box only protein 7 isoform X2       54.3    2e-04    
ref|XP_006028081.1|  PREDICTED: F-box only protein 7                  54.3    2e-04    
gb|EMT33680.1|  hypothetical protein F775_03456                       51.6    2e-04    
ref|XP_005206841.1|  PREDICTED: F-box only protein 7 isoform X1       53.9    2e-04    
gb|KFQ15773.1|  F-box only protein 7                                  53.9    3e-04    
ref|XP_007946417.1|  PREDICTED: F-box only protein 7 isoform X2       53.9    3e-04    
gb|KFQ58111.1|  F-box only protein 7                                  53.9    3e-04    
ref|XP_007449497.1|  PREDICTED: F-box only protein 7 isoform X3       53.9    3e-04    
ref|XP_006189730.1|  PREDICTED: F-box only protein 7                  53.9    3e-04    
ref|XP_005655577.1|  PREDICTED: F-box only protein 7 isoform X4       53.5    3e-04    
ref|XP_001628310.1|  predicted protein                                53.5    4e-04    Nematostella vectensis
ref|XP_006205920.1|  PREDICTED: F-box only protein 7 isoform X3       53.1    5e-04    
ref|XP_006069617.1|  PREDICTED: F-box only protein 7 isoform X1       53.1    5e-04    
emb|CEF97126.1|  F-box domain                                         53.1    5e-04    
ref|XP_003078179.1|  unnamed protein product                          53.1    5e-04    
ref|XP_005421967.1|  PREDICTED: F-box only protein 7                  53.1    6e-04    
gb|KFP10176.1|  F-box only protein 7                                  53.1    6e-04    
ref|XP_005322502.1|  PREDICTED: F-box only protein 7                  53.1    6e-04    
ref|XP_005861708.1|  PREDICTED: F-box only protein 7                  52.4    7e-04    
ref|XP_003258174.1|  PREDICTED: F-box only protein 7 isoform 2        52.8    7e-04    
ref|XP_008634815.1|  PREDICTED: F-box only protein 7                  52.8    8e-04    
ref|XP_010408799.1|  PREDICTED: F-box only protein 7                  52.0    8e-04    
ref|XP_003220944.1|  PREDICTED: F-box only protein 7 isoform X1       52.4    8e-04    
ref|XP_009682666.1|  PREDICTED: F-box only protein 7                  52.4    8e-04    
ref|XP_002921574.1|  PREDICTED: f-box only protein 7-like             52.4    8e-04    
ref|XP_009085171.1|  PREDICTED: F-box only protein 7                  52.4    9e-04    
ref|XP_008108814.1|  PREDICTED: F-box only protein 7 isoform X3       52.0    9e-04    
gb|KFV71507.1|  F-box only protein 7                                  52.4    0.001    
ref|XP_008922476.1|  PREDICTED: F-box only protein 7                  52.4    0.001    



>ref|XP_011088043.1| PREDICTED: F-box protein SKIP22-like [Sesamum indicum]
Length=511

 Score =   341 bits (874),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 208/439 (47%), Positives = 284/439 (65%), Gaps = 39/439 (9%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS E+KET+ ++ P S +LP+LK+     + + +  +  S  SIRLSLN+KDEL+
Sbjct  1     MKLRLRSFESKETLKIEAPNSCSLPQLKQ-----IVSQALPNSSSPASIRLSLNRKDELQ  55

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             S    E+L  LGI +GDLIF+++   V  +SE+ I     P   + S      S+ S  L
Sbjct  56    SDG-GESLHSLGIAAGDLIFYSIEEGVSSNSENSIP----PEADSNSEPGFKDSEGSTSL  110

Query  1363  SSNLPVESTNTSDF---NSLSDKAPelvdqgeeeevevmeidweEKD------ADVVGKS  1211
             ++   +    +SD    +S  +K  + V +      ++   D + ++      A+VVGKS
Sbjct  111   TAQNTLPEAQSSDCVIPDSQKEKILDRVSEMGVIVDDMEVDDEDNENSCDGLLAEVVGKS  170

Query  1210  FSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDP-----ILHKKVPNQW  1046
             FSVPGFLRKVF +EL D D GR+HKL++IAVHAV+LESGFV  D      +   +  N+W
Sbjct  171   FSVPGFLRKVFMEELGD-DCGRNHKLIVIAVHAVMLESGFVGFDKNANVVVRGFQFRNEW  229

Query  1045  ILTEPQVSILSYSLPE---IADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNS---S  884
                  +VS   Y+LP+   +A G+ ++      +V LKFQ+LGKF+ VYG+L   S    
Sbjct  230   PAGLFRVSFF-YTLPQSPSVAHGEVNK------SVVLKFQSLGKFINVYGTLGNGSEKRG  282

Query  883   VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLC-TSPEKEVFEFWRTVKDGLALPLL  707
              + VQL++D  VPFLNV W+NCG+++ I+GKDG +  TSPEKEVF+FWRTVKD LALPLL
Sbjct  283   TYWVQLNEDELVPFLNVVWANCGITDNISGKDGSISGTSPEKEVFKFWRTVKDQLALPLL  342

Query  706   IELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFE  527
             I+LCE+AG  LPPCFMRLPT+LKLKILE LP VD+AK+SC+CS+LRYL S+DDLWK KF 
Sbjct  343   IDLCEEAGLELPPCFMRLPTDLKLKILECLPGVDVAKVSCVCSELRYLGSSDDLWKLKFA  402

Query  526   EQFNADWFRNGGSWKQKFV  470
             E+F  +     G WK+ F 
Sbjct  403   EEFGNERKEAQGGWKKAFA  421



>ref|XP_009631641.1| PREDICTED: F-box protein SKIP22-like [Nicotiana tomentosiformis]
Length=501

 Score =   337 bits (864),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 223/465 (48%), Positives = 291/465 (63%), Gaps = 46/465 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R +ETKET+ +D+P S+ T+ ELK+R+S  +P+SS+ +      I LSLN KD+L
Sbjct  25    MKLRIRCLETKETLKIDIPSSSCTVHELKQRISQTIPSSSSSNS-----IHLSLNGKDDL  79

Query  1546  RSSSPDETLEMLGITSGDLIFFALNPN-VQESSESQITTGLSPNLPAESTDSINLSQKSL  1370
               S  +ETL+  GITSGDLIFF   PN    S+E+ I       L  +    +   +K  
Sbjct  80    SPS--EETLQSFGITSGDLIFFTFKPNGFPISTETHIPKSQPIKLDTQIIQKLETVKK--  135

Query  1369  ELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFL  1190
                    +++    +  +++        + E EE   ++      D ++  KSFSVPGFL
Sbjct  136   -------LDTQIIQEPETVNSIFEGEEAEAEAEEFMEVDYSDMTVDVNLT-KSFSVPGFL  187

Query  1189  RKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWIL-------TEP  1031
             RKVFT+ELSD DGGRDHKLL++A+HAV LESGFV LDP+   ++               P
Sbjct  188   RKVFTEELSD-DGGRDHKLLVVALHAVFLESGFVLLDPVSFTQLSGSQFWKCYWPWGASP  246

Query  1030  QVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHF  851
                 L Y+LPE         ++   TVELKF  LGKF I +GSLSG      V L++D  
Sbjct  247   SRMTLFYTLPE---------ASIHHTVELKFHCLGKFFIAHGSLSGGVFTRRVTLNEDQL  297

Query  850   VPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLP  671
             VPFLNV W+NCGL EE+          PE+EVF+FWR VKDGL LPLLI+LC+K+G  LP
Sbjct  298   VPFLNVVWANCGLHEEVNNG-----ACPEREVFQFWRNVKDGLVLPLLIDLCDKSGLELP  352

Query  670   PCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF---NADWFR  500
             PCFMRLPT+LKLKILELLP V++AK+SCL S+LRYLAS+DDLWK+K+ EQF   N     
Sbjct  353   PCFMRLPTDLKLKILELLPGVEIAKVSCLSSELRYLASSDDLWKKKYVEQFGDANTPGGG  412

Query  499   NGGSWKQKFVAAMEnrkqrknmrrrRVFDPLRYVNP--PFMGPWQ  371
              GG WK KFV + E+RK+RK + RRRV DPLR++    PF GPW+
Sbjct  413   EGGHWKDKFVKSWESRKRRKMISRRRVVDPLRFLGGPNPFPGPWR  457



>ref|XP_006348453.1| PREDICTED: F-box protein SKIP22-like [Solanum tuberosum]
Length=502

 Score =   335 bits (860),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 233/467 (50%), Positives = 295/467 (63%), Gaps = 34/467 (7%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R  ETKETI +DV  S+ TL ELK R+S ALP+SS  +      + LSLN+KDEL
Sbjct  1     MKLRIRCFETKETIKIDVQSSSCTLQELKNRISQALPSSSTPNS-----VHLSLNRKDEL  55

Query  1546  RSSSPDETLEMLGITSGDLIFFALNP-NVQESSESQITTGLSPNLPAESTDSINLSQKSL  1370
             +SS  D TL+ +GITSGDLIFF  NP     S+E+ I     P L    T  +  S+   
Sbjct  56    QSSEED-TLQSIGITSGDLIFFTQNPIGFSISTETHI-----PKLKKSDTQIVQESEIVK  109

Query  1369  ELSSNLPVESTNTSDFNSLSDKA-PelvdqgeeeevevmeidweEKD-----ADV-VGKS  1211
             +L + +  ES    + ++  D++ P                ++ E D     +DV   KS
Sbjct  110   KLDTQIVQESETVKEMDTQIDQSEPHETKTQNSIPGGEEMEEFMEVDDNGDYSDVNFTKS  169

Query  1210  FSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWIL---  1040
             FSVPGFLRKVFT+EL+D DG RDHKLL++AVHAV +ESGFV LDPI   +V     L   
Sbjct  170   FSVPGFLRKVFTEELNDDDGSRDHKLLVVAVHAVFVESGFVLLDPITFTEVSVSQFLKYW  229

Query  1039  TEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS--VQL  866
             +      L Y+LPE+ D     N N +  +ELK+Q+LGKF I +GSLSG  SV +  V L
Sbjct  230   SSGSRKTLFYTLPEVIDHVKGGNCNVIHCIELKYQSLGKFFIAHGSLSGGGSVSTFRVTL  289

Query  865   DKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKA  686
             ++D  VPFLNV W+NCGL+E + G  G      EKEVF FWR VKDGL LPLLI+LCEK+
Sbjct  290   NEDQLVPFLNVVWANCGLNEVVDGDFG------EKEVFVFWRNVKDGLVLPLLIDLCEKS  343

Query  685   GFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADW  506
             G  LPPCF RLPT+LKLKILE LP V++AK+SCL S+LRYL S+DDLWK+K+  QF    
Sbjct  344   GLVLPPCFTRLPTDLKLKILESLPGVEIAKVSCLSSELRYLGSSDDLWKKKYAGQFGDGA  403

Query  505   FRN-GGSWKQKFVAAMEnrkqrknmrrrRVFDPLRYVN--PPFMGPW  374
                 GG WK+KFV + E+RK+RK + RRRV D LR +    PF  PW
Sbjct  404   ISGEGGHWKEKFVKSWESRKRRKVINRRRVVDGLRILGGRHPFPVPW  450



>ref|XP_009803038.1| PREDICTED: F-box protein SKIP22-like [Nicotiana sylvestris]
Length=485

 Score =   333 bits (854),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 227/465 (49%), Positives = 292/465 (63%), Gaps = 45/465 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R  ETKET+ +D+P S+ TL ELK+R+S ++P+SS+ +         SLN KD+L
Sbjct  1     MKLRIRCFETKETLKIDIPSSSCTLHELKQRISQSIPSSSSSNSIHL-----SLNGKDDL  55

Query  1546  RSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLE  1367
               S  +ETL+  GITSGDLIFF   PN    S     T +  + P +    I    ++++
Sbjct  56    SPS--EETLQSFGITSGDLIFFTFKPNGFSVSTK---THIPKSQPIKLDTQIIQKPETMK  110

Query  1366  LSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADV-VGKSFSVPGFL  1190
                   ++ + T   NS+            EE  E ME+D+ +   DV + KSF VPGFL
Sbjct  111   KLDTQIIQESETKPVNSI---------LEGEEAEEFMEVDYSDMSVDVNMTKSFPVPGFL  161

Query  1189  RKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWIL-------TEP  1031
             RKVFT ELSD DGGRDHKLL++A+HAV +ESGFV LDP+   ++               P
Sbjct  162   RKVFTDELSD-DGGRDHKLLVVALHAVFVESGFVLLDPVSFTQLSGSQFWKCYWPSGASP  220

Query  1030  QVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHF  851
                 L Y+LPE A             VELKF  LGKF I +GSLSG  S   V L++D  
Sbjct  221   SRMTLFYTLPEAAIHHR---------VELKFHCLGKFFIAHGSLSGGVSTRRVTLNEDQL  271

Query  850   VPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLP  671
             VPFLNV W+NCGL EE+   +G   T PE+EVF+FWR VKDGL LPLLI+LC+K+G  LP
Sbjct  272   VPFLNVVWANCGLHEEV--NNGAFGTCPEREVFQFWRNVKDGLVLPLLIDLCDKSGLELP  329

Query  670   PCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF---NADWFR  500
             PCFMRLPT+LKLKILELLP V++AK+SCL S+LRYLA +DDLWK+K+ EQF   N     
Sbjct  330   PCFMRLPTDLKLKILELLPGVEIAKVSCLSSELRYLALSDDLWKKKYVEQFGDANTSGGG  389

Query  499   NGGSWKQKFVAAMEnrkqrknmrrrRVFDPLRYVNP--PFMGPWQ  371
             + G WK KFV + E+RK+RK + RRRV DPLR++    PF GPW+
Sbjct  390   DEGHWKDKFVKSWESRKRRKMISRRRVVDPLRFLGGPNPFPGPWR  434



>ref|XP_004228659.1| PREDICTED: F-box protein SKIP22-like [Solanum lycopersicum]
Length=501

 Score =   332 bits (850),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 233/471 (49%), Positives = 291/471 (62%), Gaps = 43/471 (9%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R  ETKETI +DV  S+ TL ELK R+S A P+SS  +      I LSLN+KDEL
Sbjct  1     MKLRIRCFETKETIKIDVESSSCTLQELKNRISQAFPSSSIPNS-----IHLSLNRKDEL  55

Query  1546  RSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLE  1367
             + S  D  L+ +GITSGDLIFF  NPN         +     ++P        + ++S  
Sbjct  56    QFSEED-MLQSIGITSGDLIFFTQNPN-------GFSISTETHIPKSKNSDTQIVKESET  107

Query  1366  LSSNLP-----VESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKD-----ADV-V  1220
             +  + P      E+   SD   +    P   +   +   E ME ++ E D     +DV  
Sbjct  108   VKKSDPQIVKEAETVKKSD-TQIDQLEPHETETKTQPGGEEMEEEFMEVDDNGDYSDVKF  166

Query  1219  GKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVP-----  1055
              KSFSVPGFLRKVFT+EL D DGGR+HKLL++AVHAV +ESGFV LDP    +V      
Sbjct  167   TKSFSVPGFLRKVFTEELKDDDGGREHKLLVVAVHAVFVESGFVLLDPNTLTEVNVSQCL  226

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS  875
             N W L   +   L Y+LPE+ D     N N +  +ELKFQ+LGKF I +GSLSG     +
Sbjct  227   NYWCLGYRKT--LFYTLPEVIDHVKGDNCNVIHCIELKFQSLGKFFIAHGSLSGGGKGST  284

Query  874   --VQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
               V L++D  VPFLNV W+NCGL+E + G  G      EKEVF FWR VKDGL LPLLI+
Sbjct  285   FRVTLNEDQLVPFLNVVWANCGLNEVVDGDFG------EKEVFVFWRNVKDGLVLPLLID  338

Query  700   LCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQ  521
             LCEK+GF LPPCF RLPTELKLKILE LP V++AK+SCL S+LRYL S+DDLWK+K  EQ
Sbjct  339   LCEKSGFVLPPCFTRLPTELKLKILESLPGVEIAKVSCLSSELRYLCSSDDLWKKKCGEQ  398

Query  520   FNADWFRNGGSWKQKFVAAMEnrkqrknmrrrRVFDPLRYVN--PPFMGPW  374
             F       GG WK+KFV + E+RK+RK + RRRV D LR +    PF  PW
Sbjct  399   FGDGEISAGGHWKEKFVKSWESRKRRKVINRRRVVDGLRILGGRHPFPIPW  449



>emb|CDO97303.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   319 bits (817),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 218/472 (46%), Positives = 284/472 (60%), Gaps = 65/472 (14%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhs-sdSIRLSLNKKDEL  1547
             MKLR+RS  TKET+ ++VP   +L +LK  +S  L  S++ S  + SDSI LSLN+K+E+
Sbjct  1     MKLRIRSFGTKETLRIEVPIPCSLQQLKDIISQTLRPSTSSSPLAPSDSIHLSLNRKEEI  60

Query  1546  RSSSPDE-TLEMLGITSGDLIFFALNPNVQESSES-------------------------  1445
             +SSSP+E TL+ LGITSGDLIF+ L+P+   SSES                         
Sbjct  61    QSSSPNEDTLQSLGITSGDLIFYTLDPSRFSSSESLIPNSQEPISSPLVQNYEIPLRIDL  120

Query  1444  --------QITTGLSPNLPAESTDS---INLSQKSLELSSNLPVE---STNTSDFNSLSD  1307
                     Q  + + P  P ++T+S     L Q     S+NL  +   ST+  +F+ + D
Sbjct  121   TLDSGKPLQKPSSMEPLDPPKNTNSDPSSQLKQAHQPGSANLNEQNEGSTDYMEFDGIDD  180

Query  1306  KAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRKVFTKELS--DSDGGRDHKL  1133
             +                       +A   GKSFSVPGFLRKVFT+EL   D DG R HKL
Sbjct  181   QEEGNDASAL--------------EAVGNGKSFSVPGFLRKVFTEELGGGDDDGSRSHKL  226

Query  1132  LLIAVHAVLLESGFVRLDPILH---KKVP--NQWILTEPQVSILSYSLPEIADGDTDQNS  968
             L+IA+HAVLLESGFV  D  L    K  P  N W  +  ++S+  Y+LPEI    +    
Sbjct  227   LVIAIHAVLLESGFVGFDMNLKTESKGFPFRNDWPSSGFRLSLF-YTLPEIVRDVSPSLD  285

Query  967   NAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIA-GK  791
                  V LKFQ +GKF++VYGSL+  S++HSV+L++D    FLNV W+NCGL ++I    
Sbjct  286   CHNCVVGLKFQNVGKFMMVYGSLNAGSAMHSVRLNEDELGSFLNVVWANCGLGDDIMISG  345

Query  790   DGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPA  611
             D +L  SPE EVF+FWR VKD LALPLLI+LCE  G  LPPCFMRLPT+LKLKILE LP 
Sbjct  346   DVVLGASPENEVFKFWRNVKDNLALPLLIDLCETVGLVLPPCFMRLPTDLKLKILESLPG  405

Query  610   VDLAKMSCLCSDLRYLASNDDLWKQKFEEQF-NADWFRNGGSWKQKFVAAME  458
             VD+AK+SC+ ++LRYLAS+DDLWKQK  EQF +A    + G WK+KF    E
Sbjct  406   VDIAKVSCVSAELRYLASSDDLWKQKCVEQFGHACKTEDKGHWKEKFARFWE  457



>ref|XP_010248340.1| PREDICTED: F-box protein SKIP22-like [Nelumbo nucifera]
Length=511

 Score =   299 bits (766),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 188/441 (43%), Positives = 267/441 (61%), Gaps = 35/441 (8%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+R +E+KET  ++ P   +L +LK        A S       +++ LSLN+KD++ 
Sbjct  1     MKLRVRCLESKETFKIETPSPFSLQDLK-------SAISGKVSSLPETLHLSLNRKDKID  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQI---TTGLSPNLPAESTDSINLSQKS  1373
              SSP  +L+ LGI SGDLIF+ +NPN   SSE+ +   TT  SP + A +   ++L +K+
Sbjct  54    DSSPQASLQSLGINSGDLIFYTINPN-DFSSETLVHTPTTRGSPQIQASTPSDVHLEEKT  112

Query  1372  LELSSNLP--VESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADV-----VGK  1214
             L+    L   +   N+ +  +L +  P+  +  +  E    +     +D DV      G 
Sbjct  113   LKHPEVLQXQIHDINSKETLTLPEDHPQQGEAMDICENFNEKPFDM-EDVDVDESVLXGN  171

Query  1213  SFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKV-----PNQ  1049
             S SVP FLRKV  +++S+++ GR  KLL++AVHAVLLESGFV       KK+     P  
Sbjct  172   SSSVPCFLRKVLKEDISNAESGR--KLLIMAVHAVLLESGFVCFGSASAKKIDGVHLPEG  229

Query  1048  WILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLS-GNSSVHSV  872
             W      V +  Y+LP++     D     + TV LKFQTLGKFV VYGSL+   S V+ +
Sbjct  230   WASMSTAVRV-HYTLPDLLVSGCD----VLETVILKFQTLGKFVNVYGSLTTKGSGVYGL  284

Query  871   QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCE  692
              LD+  FVP +N  W+ C     +  KDG   +S EKEVFEFW+ VKDGLALPLLI+LC+
Sbjct  285   SLDESRFVPSMNFVWTICNSQSGVIDKDGSSKSSHEKEVFEFWKLVKDGLALPLLIDLCD  344

Query  691   KAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF--  518
             K G   PPCFMRLPTELK ++LELLP VD+AK  C+CS+++YL+SN++LWKQKFE++   
Sbjct  345   KTGLDPPPCFMRLPTELKXRVLELLPGVDVAKFGCVCSEMKYLSSNNNLWKQKFEKELGL  404

Query  517   -NADWFRNGGSWKQKFVAAME  458
              + +  + GG+WK++F    E
Sbjct  405   GDMEGIQGGGNWKERFSICWE  425



>gb|EPS73205.1| hypothetical protein M569_01560, partial [Genlisea aurea]
Length=435

 Score =   283 bits (723),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 194/467 (42%), Positives = 263/467 (56%), Gaps = 80/467 (17%)
 Frame = -3

Query  1723  MKLRLRSV-ETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LRLR+V  ++ET+ +D P S +LP LKR     + A    +  S DSI LSLN+KDEL
Sbjct  1     MRLRLRNVVGSRETLKLDAPNSCSLPHLKR-----ILAQMLPNSPSPDSIHLSLNRKDEL  55

Query  1546  RSSSPDETLEMLGITSGDLIFFAL--------NPNVQESSESQITTGLSPNLPAESTDSI  1391
             +S    E+L+ LG+ SGDLIFF+L        +P + ES+ +Q     S   P  + D  
Sbjct  56    QSEG-QESLQSLGVASGDLIFFSLELAGFDSNSPILMESNVAQ-----SSEKPVTTVDDD  109

Query  1390  NLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKS  1211
             N +     + +++ +      D  SLS                          A ++ +S
Sbjct  110   NENHGGEAVVADMEI----VGDSESLS--------------------------AAIIDRS  139

Query  1210  FSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPI-------LHKKVPN  1052
             FSVPGFLRKV T+E+++ DG R HKLL+IAVHAV+LESGFV LD          H    N
Sbjct  140   FSVPGFLRKVLTEEMNNDDG-RGHKLLVIAVHAVMLESGFVELDKNSNALLTGFHHFRKN  198

Query  1051  QWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSS---V  881
              W +   ++S L Y+L          N+     V+LKFQ++G F+ +YG+L   S+   +
Sbjct  199   DWPVDLFKLS-LYYTL----------NTVRSKAVKLKFQSIGGFINIYGTLDDGSAKRDI  247

Query  880   HSVQLDKDHFVPFLNVAWSNCGLSE---EIAGKDGLLCTSPEKEVFEFWRTVKDGLALPL  710
             + VQL++D  VP LN+ W+NC   E   E+   D     SPEK+VFEFWR+VKD LALPL
Sbjct  248   YRVQLNEDRLVPRLNIVWANCCDMENLNEVGSAD-----SPEKQVFEFWRSVKDNLALPL  302

Query  709   LIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKF  530
              I+LC++AG  LPPCF+ LPT+LKLKILELL  +DLA++ C+CS+LRYL SNDDLWK KF
Sbjct  303   SIDLCQEAGLRLPPCFIGLPTDLKLKILELLSGIDLARVICVCSELRYLGSNDDLWKLKF  362

Query  529   EEQFNADWFRNGGSWKQKFVAAMEnrkqrknmrrrRVFDPLRYVNPP  389
              E+F+        SWK  FV A   RK+           P  Y   P
Sbjct  363   TEEFSNRRKDPEFSWKTAFVTAWNMRKKAAATSSTTAMWPAMYYGQP  409



>ref|XP_006383058.1| hypothetical protein POPTR_0005s11160g [Populus trichocarpa]
 ref|XP_006383059.1| F-box family protein [Populus trichocarpa]
 gb|ERP60855.1| hypothetical protein POPTR_0005s11160g [Populus trichocarpa]
 gb|ERP60856.1| F-box family protein [Populus trichocarpa]
Length=545

 Score =   278 bits (710),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 191/484 (39%), Positives = 271/484 (56%), Gaps = 78/484 (16%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRSV++KET+ + VP S TL +LK          S     S  S+ LSLN+KDEL 
Sbjct  1     MKLRLRSVQSKETVKIQVPDSCTLQQLKE-------TLSRAISSSGSSLYLSLNRKDELN  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPN---------------LPA  1409
             +S P+++L+ LGITSGDLI+F++NP    SS   +  G S +               +P 
Sbjct  54    TSLPEDSLQSLGITSGDLIYFSVNPKDFSSSGQPLCLGSSSSIQEQVQGHRGNVEEPMPD  113

Query  1408  ES--------TDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevme  1253
             +S        +D   L  + L +  ++ V++ +T+   ++S+ +P++   G++  +   +
Sbjct  114   QSMSFQESKCSDLNMLENQDLFVQGHVGVQANDTNSRETISEISPQMHLLGQKHGIAESD  173

Query  1252  idweEKDA--------------------------------DVVGKSFSVPGFLRKVFTKE  1169
             ++    +                                 DV  K FS P FLR++  KE
Sbjct  174   MNGAVTEGHGALGSKTRSRETLETQELTSVEAMDVDPGSVDVGNKRFSEPYFLRRLLRKE  233

Query  1168  LSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVS-----ILSYSL  1004
             L D   G ++KLL+IAVHAV +ESGFV  + I   +V + + L E Q S      L Y+L
Sbjct  234   LGDD--GSNYKLLVIAVHAVFIESGFVGFNSISGMRV-DGFHLPEEQSSRNLAVSLCYTL  290

Query  1003  PEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLS-GNSSVHSVQLDKDHFVPFLNVAW  827
             PE+ D           T+ LK Q+LG FV VYGSLS G S ++  +LD + FVP ++  W
Sbjct  291   PELLDSKV-----IAETIVLKLQSLGHFVNVYGSLSKGGSGLYHARLDINKFVPAIDFVW  345

Query  826   SNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPT  647
              N   ++ + G D      PE E+FEFW+ VKDGLALPLLI++CEKAG  LP C MRLPT
Sbjct  346   EN-DKNDGMNGSDRSSILYPENEIFEFWKIVKDGLALPLLIDICEKAGLVLPSCLMRLPT  404

Query  646   ELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG-SWKQKFV  470
             ELKLKI ELLPA+D+AKM C+CS++RYL+SN+DLWKQKF E+F      +G  +WK +F 
Sbjct  405   ELKLKIFELLPAIDIAKMECVCSEMRYLSSNNDLWKQKFVEEFGDGTAAHGTLNWKARFA  464

Query  469   AAME  458
             +  E
Sbjct  465   SYWE  468



>gb|EYU37554.1| hypothetical protein MIMGU_mgv1a022377mg, partial [Erythranthe 
guttata]
Length=439

 Score =   274 bits (701),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 185/436 (42%), Positives = 251/436 (58%), Gaps = 54/436 (12%)
 Frame = -3

Query  1729  VKMKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDE  1550
             V MKLRLRS ++KET+ ++V  S TL +L++     + + + F+     SIRLSLN+KD+
Sbjct  1     VAMKLRLRSFDSKETLKIEVQNSCTLSQLRQ-----ILSQTLFNSPPPASIRLSLNRKDD  55

Query  1549  LRSSSPDETLEMLGITSGDLIFFALNPNVQE----SSESQITTGLSPNLPAESTDSINLS  1382
             L S   D  L+ LGI SGDL+FF+L          S      + +  + P   + S N  
Sbjct  56    LESDGED-CLQSLGIASGDLVFFSLEHPPPPPELISHHQNPLSQVIDSTPKPGSTSFNTD  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSV  1202
                 E       E+ +     S+ D+              +   D   +   V  +SFSV
Sbjct  115   NTLAEGQ-----ETLDGGGGGSVMDE--------------MEVDDENLEGGYVARESFSV  155

Query  1201  PGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEP---  1031
             PGFLRKVF +EL++ D GR HKL++ A+HAV+L+SGFV  D   +  +    +  E    
Sbjct  156   PGFLRKVFMEELNE-DSGRHHKLIITAIHAVMLDSGFVGFDKKTNTVISGSHLRNELPSD  214

Query  1030  --QVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSV-----HSV  872
               +VS+  Y+LPE           +V  V LKFQ++GKF+ VYG+L   SSV     H V
Sbjct  215   LFRVSLF-YTLPETG-------GKSVKNVVLKFQSVGKFINVYGTLENGSSVKRASTHWV  266

Query  871   QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCE  692
             +L++D  VPFLNV W++CG  E++   D    TSPEKEVF FWR VKD LALPLLI+LCE
Sbjct  267   KLNEDQLVPFLNVVWADCG--EDVLMFD----TSPEKEVFAFWRIVKDNLALPLLIDLCE  320

Query  691   KAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNA  512
             ++G  LPPCF+RLPT+LKLKILE L   +LAK+SC+ S+LRYLAS+DDLWK K  E F  
Sbjct  321   ESGLELPPCFIRLPTDLKLKILESLSGAELAKVSCVSSELRYLASSDDLWKSKCVEVFGD  380

Query  511   DWFRNGGSWKQKFVAA  464
             +      SWK+ F  A
Sbjct  381   ERNEARLSWKRVFAMA  396



>ref|XP_007042687.1| F-box family protein, putative [Theobroma cacao]
 gb|EOX98518.1| F-box family protein, putative [Theobroma cacao]
Length=492

 Score =   273 bits (697),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 173/429 (40%), Positives = 242/429 (56%), Gaps = 29/429 (7%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR+ E+KET+ + VP   +  +L+        +          S+R SLN KD L 
Sbjct  1     MKLRLRNYESKETLRIQVPSPCSFLQLQE---TLSLSLPTPHPSPPSSLRFSLNAKDLLH  57

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             + SP  +L+ +G++SGDLI+F+LNP         + + +S N   ++   +  + +  E 
Sbjct  58    APSPHASLQSIGVSSGDLIYFSLNP--------MVFSPISSNQDLQTATLVEETNEIPES  109

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRK  1184
             S+N    +             P++  + E+ E           DA  V + FS P FLRK
Sbjct  110   STNQEASAQELPQLQEPMSTEPQVFQETEKTEGTEYMDI----DAFAVSERFSEPYFLRK  165

Query  1183  VFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKV-----PNQWILTEPQVSI  1019
             V  +EL+D   G +HKLL IAVHAVLLESGFV  DP+   ++     P++W    P    
Sbjct  166   VLKEELADD--GSNHKLLAIAVHAVLLESGFVGFDPVSGLQIDGFHFPDEW----PSPVS  219

Query  1018  LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL-SGNSSVHSVQLDKDHFVPF  842
             + YSLPE+   D +  SN      LKFQTLG FV VYGSL  G S ++ + LD+  F P 
Sbjct  220   ICYSLPELLINDDNSGSNLTDYAVLKFQTLGHFVQVYGSLVKGGSGLYKLSLDEYRFAPT  279

Query  841   LNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF  662
             L++ W+N     +    +    + PE EVFEFW+ VKDGLALPLLI+L  + G  LP C 
Sbjct  280   LDLVWANFD-KNDSTNDNNNNNSYPENEVFEFWKIVKDGLALPLLIDLSYRTGLSLPACL  338

Query  661   MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF-NADWFRNGGSW  485
             MRLPTELKL+ILE LP  D+A+M C+CS+++YLASN+DLWKQKF E+F +       G+W
Sbjct  339   MRLPTELKLRILESLPGADIARMGCVCSEMQYLASNNDLWKQKFREEFGDCPGTMEIGNW  398

Query  484   KQKFVAAME  458
             K+ F +  E
Sbjct  399   KEMFNSCWE  407



>ref|XP_011043138.1| PREDICTED: F-box protein SKIP22-like [Populus euphratica]
 ref|XP_011043139.1| PREDICTED: F-box protein SKIP22-like [Populus euphratica]
 ref|XP_011043140.1| PREDICTED: F-box protein SKIP22-like [Populus euphratica]
 ref|XP_011043141.1| PREDICTED: F-box protein SKIP22-like [Populus euphratica]
 ref|XP_011043143.1| PREDICTED: F-box protein SKIP22-like [Populus euphratica]
 ref|XP_011043144.1| PREDICTED: F-box protein SKIP22-like [Populus euphratica]
Length=545

 Score =   273 bits (698),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 188/484 (39%), Positives = 270/484 (56%), Gaps = 78/484 (16%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRSV++KET+ + VP S TL ++K          S     S  S+ LSLN+KDEL 
Sbjct  1     MKLRLRSVQSKETVKIQVPDSCTLQQVKE-------TLSGAISSSGSSLYLSLNRKDELN  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLP----------------  1412
             +S P+E+L+ LGITSGDLI+F++NP    SS   +  G S ++                 
Sbjct  54    TSLPEESLQSLGITSGDLIYFSVNPKDFSSSGQPLCLGSSSSIQEQVQGHRGNVQEPMPD  113

Query  1411  -------AESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevme  1253
                    ++S+D   L  + L +  ++ V++ +T    ++++ +P +   G++ E+   +
Sbjct  114   QSMSFQESKSSDLNMLENQDLFVQGHVGVQANDTDSRETITEISPHIHLLGQKHEIAESD  173

Query  1252  idweEKDA--------------------------------DVVGKSFSVPGFLRKVFTKE  1169
             ++    +                                 DV  K FS P FLR++  KE
Sbjct  174   MNGAVTEGHGALGSKTRSRETLETQEFTSVEAMDVDPGSLDVGNKRFSEPYFLRRLLRKE  233

Query  1168  LSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVS-----ILSYSL  1004
             + D   G ++KLL+IAVHAV +ESGFV  + I   +V + + L E Q S      L Y+L
Sbjct  234   MGDD--GSNYKLLVIAVHAVFIESGFVGFNSISGMRV-DGFHLPEEQSSRNLAVSLCYTL  290

Query  1003  PEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLS-GNSSVHSVQLDKDHFVPFLNVAW  827
             PE+ DG          T+ LK Q+LG FV VYGSLS G S ++  +LD + FVP ++  W
Sbjct  291   PELLDGKV-----IAETIVLKLQSLGHFVNVYGSLSKGGSGLYHARLDINKFVPAIDFVW  345

Query  826   SNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPT  647
              N   ++ + G D      PEKE+FEFW+ VKD LALPLLI++CEKAG  LP C M LPT
Sbjct  346   EN-DKNDGMNGSDKSSILYPEKEIFEFWKIVKDCLALPLLIDICEKAGLVLPSCLMCLPT  404

Query  646   ELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG-SWKQKFV  470
             ELKLKI ELLPA+D+AKM C+CS+++YL+SN+DLWKQKF E+F      +G  +WK +F 
Sbjct  405   ELKLKIFELLPAIDIAKMECVCSEMQYLSSNNDLWKQKFVEEFGDGTAAHGTLNWKARFA  464

Query  469   AAME  458
             +  E
Sbjct  465   SYWE  468



>emb|CBI25128.3| unnamed protein product [Vitis vinifera]
Length=508

 Score =   267 bits (682),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 202/432 (47%), Positives = 264/432 (61%), Gaps = 23/432 (5%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+RS+E+KET+ + VP   +L      + L   A S+ S  SS  I LSLN+KDEL+
Sbjct  1     MKLRVRSLESKETLKIQVPDPCSLQHF---IHLLSLAISSSSSSSSSIIYLSLNRKDELQ  57

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
              SS  +TL+ LG+TSGDLIF++ NP     +     T +S    +E  +++  SQ    L
Sbjct  58    VSSSLDTLQSLGVTSGDLIFYSFNPTAFSQTPIPSETLVSN---SERKETLLESQTLAPL  114

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDAD--VVGKSFSVPGFL  1190
             +   P E        S S K       G         +   ++D +  VV KSFS P FL
Sbjct  115   AQANPHEPKEYGSLVSDSKKNETQEFSGATSMDVEGGVAAADEDDEPIVVKKSFSEPCFL  174

Query  1189  RKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTE--PQVSI-  1019
             RKV  +E+ D   G +HKLL+IAVHAV+LESGFV  D +   +V +++ L+E  P  +I 
Sbjct  175   RKVLREEVGDD--GNEHKLLVIAVHAVMLESGFVGFDSVSGMRV-DRFHLSEEYPFAAIS  231

Query  1018  --LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN-SSVHSVQLDKDHFV  848
               L Y+LPE+ D   D +S A+ +V LKFQ LG+F+ +YGSLSGN S+VH V LD+  F 
Sbjct  232   MSLWYTLPELLDHGCD-DSPAIQSVALKFQHLGQFINIYGSLSGNRSTVHWVSLDEYRFA  290

Query  847   PFLNVAWSNCGLSEEIAGKD-GLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLP  671
             P L++ W++   +EE   KD G   + PE EVFEFW+ VKDGLALPLL +LCEK G   P
Sbjct  291   PTLDLMWTHSDSAEE---KDRGSSNSYPENEVFEFWKIVKDGLALPLLTDLCEKGGLLPP  347

Query  670   PCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG  491
             PC MRLPTELKLKILELLP VDL K+ C+CS+L YL+SN+DLWKQKF E+F       G 
Sbjct  348   PCLMRLPTELKLKILELLPGVDLGKVGCVCSELMYLSSNNDLWKQKFTEEFGNVRVGQGF  407

Query  490   S-WKQKFVAAME  458
             S WK KF    E
Sbjct  408   SLWKDKFATWWE  419



>ref|XP_008236258.1| PREDICTED: F-box protein SKIP22-like [Prunus mume]
Length=497

 Score =   265 bits (678),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 254/441 (58%), Gaps = 48/441 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+RS+ETKET+ V+VP   +L +LK          S     S  S+RLSLN++DEL 
Sbjct  1     MKLRVRSIETKETLRVEVPNLCSLHQLK-------LTISQLISASPSSLRLSLNRRDELH  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             +SSP ++L  LG+TSGDLIF+ ++P+ Q          L+P  P  S    ++   +  L
Sbjct  54    ASSPGDSLHSLGLTSGDLIFYTVDPSSQT---------LAP--PPHSISHSSVQSHNQNL  102

Query  1363  SSNLPVEST----------NTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVG-  1217
             ++ +P  S            ++  + ++++   LV   E       E    +  +D +G 
Sbjct  103   TTGVPQGSNFQNPETLIGEGSAAGDLIAEEQRSLVSNSETLVASGPESMEIDDGSDGIGL  162

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-----KVPN  1052
             K +SVP FL++V  +EL +     +HKLL+IAVHA +LESGFV  D +         + +
Sbjct  163   KKYSVPFFLKRVLREELGEDRS--NHKLLVIAVHAAVLESGFVGFDSVSGMGSNRFHLAD  220

Query  1051  QWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL-SGNSSVHS  875
             +W  T   +SI SY+LPEI   +   N N V  V LKFQ+LG+FV VYGSL SG +  + 
Sbjct  221   EWPRTAITMSI-SYTLPEILK-NRGNNGNGVEGVMLKFQSLGRFVNVYGSLASGGAGPYR  278

Query  874   VQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELC  695
             V LD+  F P +   W N  ++E    +DGL+    E+EVFEFW+ VKDG+ LPLLI+LC
Sbjct  279   VCLDERRFGPIIESVWENRNVNE----RDGLVS---EREVFEFWKIVKDGITLPLLIDLC  331

Query  694   EKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
              KAG   PP  MRLP ELK+K+LE L  VD+AK+  +C +LR LA+ND+LWK+K+ E+F 
Sbjct  332   AKAGLPTPPSLMRLPPELKMKVLEPLSGVDIAKVGGVCKELRNLANNDELWKKKYAEEFG  391

Query  514   ADWFRNGG--SWKQKFVAAME  458
             +     G   +WK KF    E
Sbjct  392   SGTGGEGTMINWKHKFARNWE  412



>ref|XP_010029872.1| PREDICTED: F-box protein SKIP22-like [Eucalyptus grandis]
 gb|KCW56827.1| hypothetical protein EUGRSUZ_I02495 [Eucalyptus grandis]
Length=504

 Score =   263 bits (671),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 178/438 (41%), Positives = 248/438 (57%), Gaps = 31/438 (7%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+K T+ +DVP   +LP+L+R     L    +       S RLSLN+ DELR
Sbjct  1     MKLRLRSLESKGTLKLDVPDPCSLPQLRR----ILAGRLSPPPPPGASFRLSLNRTDELR  56

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             S  P  +L+ LG+ SGDL++F+L P+   S ++   +  +    A ++  + L    ++ 
Sbjct  57    SPDPAASLQSLGLASGDLVYFSLAPDALASPQAGDGSSSA-ESSAGASGGVPLGHAEMDS  115

Query  1363  S---SNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidw---------eEKDADVV  1220
                    P E   +   +S+ D AP     G   +                    D+  V
Sbjct  116   EDPPGGRPREVAESEMVDSVPDDAPGADASGSAGDPGNSVSASFDFEGDGVVAADDSAGV  175

Query  1219  GKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPI----LHK-KVP  1055
                FS P FL++V  +EL   DGG DH+LL+IAVHAVLLESGFV +DP+     H+  + 
Sbjct  176   RSKFSEPCFLKRVLREELG-GDGG-DHRLLVIAVHAVLLESGFVAVDPVTGVPAHRFHLS  233

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNS-SVH  878
             +QW  T   ++ L YSLPE+      Q  N   +V LKF +LG F+ VYG L+    ++ 
Sbjct  234   DQWPSTAFMMT-LQYSLPELV--AKTQGRNVSESVVLKFVSLGHFISVYGRLAKTKLALR  290

Query  877   SVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIEL  698
              V L++  F P ++  W+      E     G L +S EKEVFEFW+ VKDGLALPLLI+L
Sbjct  291   RVCLNERRFAPIIDEMWAKGDDDVEGNEDGGSLNSSSEKEVFEFWKIVKDGLALPLLIDL  350

Query  697   CEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF  518
              E+AG  LP CF  LPTELKL+I ELLP +DLA++ C+ SDL+YLASN+DLWKQK+ E+F
Sbjct  351   TERAGLPLPSCFTCLPTELKLRIFELLPGIDLARVGCVSSDLQYLASNNDLWKQKYVEEF  410

Query  517   NADWFRNGG--SWKQKFV  470
               +   +G   +WKQ F 
Sbjct  411   -GERTESGEMINWKQIFT  427



>ref|XP_009335347.1| PREDICTED: F-box protein SKIP22-like [Pyrus x bretschneideri]
Length=493

 Score =   257 bits (657),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 183/436 (42%), Positives = 243/436 (56%), Gaps = 48/436 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+RS+ETKETI V+VP   +L  LK+         S     +  S RLSLN +DEL+
Sbjct  1     MKLRVRSIETKETIRVEVPDLCSLHHLKQ-------TVSQLISAAPSSFRLSLNHRDELQ  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNL--PAESTDSINLSQKSL  1370
             + SP ++L  LGITSGDL+F+ L+P+ Q      +     PNL   AES + I       
Sbjct  54    APSPHDSLRSLGITSGDLVFYTLDPSSQ-----TLALPSHPNLHSSAESPNRIEPQCSHF  108

Query  1369  ELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKD-ADVVG-KSFSVPG  1196
               S  L ++     D   L  + P       E  V       E  D +D +G + +SVP 
Sbjct  109   RNSETL-IDKGGVMD--DLIGEDPRSGGSNSETLVVSGARSMEIDDPSDGLGLERYSVPF  165

Query  1195  FLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSIL  1016
             FL++V  +EL + D    HKLLLI+VHAVLLESGFV  D  L   + NQ   T   +S L
Sbjct  166   FLKRVLREELGE-DRSNHHKLLLISVHAVLLESGFVGFDS-LSSMLANQ--RTGSTIS-L  220

Query  1015  SYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLS-GNSSVHSVQLDKDHFVPFL  839
             SY+LPE+   +   + N V  V  KFQ LG FV VYGSL+ G SS H + LDK+ F P +
Sbjct  221   SYTLPELLR-NRGSDRNGVEGVVFKFQNLGHFVNVYGSLAFGGSSPHQICLDKNRFAPMI  279

Query  838   NVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFM  659
                W N  + E    +DGL   +PE+EV EFW+ VKDG+  PLLI+LC       PP  M
Sbjct  280   EFIWENQNVHE----RDGL---APEREVLEFWKIVKDGITFPLLIDLCAMPVLPAPPSLM  332

Query  658   RLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN------------  515
             RLP ELK+KILE LP VD+AK+ C+C +L+  A+ND+LWKQK+ E+F             
Sbjct  333   RLPPELKMKILEPLPGVDVAKVGCVCKELQNHANNDELWKQKYAEEFGNGSKGEGTGGEG  392

Query  514   --ADW-FRNGGSWKQK  476
                +W FR  G+W+ +
Sbjct  393   TVTNWKFRFVGNWETR  408



>ref|XP_004289759.1| PREDICTED: F-box protein SKIP22-like [Fragaria vesca subsp. vesca]
Length=508

 Score =   255 bits (651),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 176/442 (40%), Positives = 246/442 (56%), Gaps = 41/442 (9%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+ETKET+ ++VP   +L  LK+        S + S   S S+RLSLN++DEL 
Sbjct  1     MKLRLRSLETKETLRLEVPNLCSLNHLKQ------SLSQSISAAPSSSLRLSLNRRDELL  54

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAEST----------DS  1394
             +SSPD +L  LG+TSGDLIF++    + + + +   T   P   +E+            S
Sbjct  55    ASSPDASLASLGVTSGDLIFYS-QTLIGDGASTGEATAEDPRSGSETVIGEDEALAEDPS  113

Query  1393  INLSQKSL--ELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVV  1220
              +   ++L  E +S         SD  +L D +                ++ +E+ + VV
Sbjct  114   FDSGMETLIGEGASIAGDARYAVSDTQTLMDGS--NSISETLIGEGSSGMEIDEESSGVV  171

Query  1219  GKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKK-----VP  1055
              K +SVP FLR+V  +EL++     DHKLL+IA+HAVL ES FVR D +   +     +P
Sbjct  172   RKKYSVPFFLRRVMREELAEDR--SDHKLLVIALHAVLSESRFVRFDSVSGARADRCHLP  229

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN---SS  884
              +W      +S LSY+LPEI   + D     V  V LK QTLG+FV VYGSL+G    S 
Sbjct  230   KEWPAVAYTLS-LSYTLPEILQ-NRDNGGGGVEAVVLKIQTLGRFVNVYGSLAGGGRGSG  287

Query  883   VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
              + V LD + F P L+  W +  +S+            PE E+FEFWR VKDG+  PLLI
Sbjct  288   PYRVSLDVERFAPMLDFVWGSRNVSDS-------EVFVPEIEIFEFWRIVKDGITYPLLI  340

Query  703   ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEE  524
             +LCEKAG   PP FM LP ++K+ ILE L   D+AK+ C C +L+ LA+ND+LWKQKF E
Sbjct  341   DLCEKAGLPEPPSFMCLPLDVKMNILERLSGADIAKVGCACKELQNLANNDELWKQKFLE  400

Query  523   QFNADWFRNGGSWKQKFVAAME  458
             +F +      G+WK +F    E
Sbjct  401   EFGSG-AGGTGNWKFRFAGKWE  421



>ref|XP_008454420.1| PREDICTED: F-box protein SKIP22-like [Cucumis melo]
 gb|ADN33816.1| F-box family protein [Cucumis melo subsp. melo]
Length=502

 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 182/449 (41%), Positives = 249/449 (55%), Gaps = 48/449 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+K+T+ ++VP  +TL  LK+         +  S  S+DS+ LSLN+KDEL+
Sbjct  1     MKLRLRSLESKQTLRIEVPDPSTLNHLKQ-----TLLQTLSSSFSADSLHLSLNRKDELQ  55

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLS------------------PN  1418
             +SSP+++L  LGITSGDL+FF   P+   S  ++ T   S                  P 
Sbjct  56    ASSPEDSLHSLGITSGDLVFFTFKPSEFSSLGARATPIQSFQPPPLSGSSSLVSSSSLPQ  115

Query  1417  LPAESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE  1238
             +  +    I+   K   L ++ P      S    L+  +       EE EVE       E
Sbjct  116   VKGKQLLGIDCDLKKPRLENSEPESMVPDSSGAELTTSSMIEESDCEEMEVEEEPTVVVE  175

Query  1237  KDADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILH---  1067
             K         S P FLR+V  +EL        HKLL+ AVHAVLLESGFV ++P L    
Sbjct  176   KKC-------SRPIFLRRVLKEELGYDRNA--HKLLVTAVHAVLLESGFVLINPNLGFED  226

Query  1066  --KKVPNQWILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL-  899
                ++P  W    P  ++ L Y+LPE+      +NS     V LKFQ+LG FV VYGSL 
Sbjct  227   SPFRMPEDW--PSPSFTMSLWYTLPELLT-KRGKNSTMTEVVLLKFQSLGYFVNVYGSLN  283

Query  898   -SGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGL  722
              S  SSV+ V LD+  F P L++ W +   +  +  K+G    +PEK+VFEFW+ VKD L
Sbjct  284   CSRGSSVYRVSLDERKFAPNLDLIWVDSVSNYIMDEKEG----NPEKQVFEFWKIVKDAL  339

Query  721   ALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLW  542
             ALPLLI++CEK G   P  FM LP ++KLKILE LP VD+A++ C+C++LRYLAS+++LW
Sbjct  340   ALPLLIDICEKTGLPPPASFMLLPADVKLKILEALPGVDIARVECVCTELRYLASSNELW  399

Query  541   KQKFEEQFN-ADWFRNGGSWKQKFVAAME  458
             K KF ++F   D       WK KFV   E
Sbjct  400   KMKFNQEFGLEDGVSGNRVWKTKFVEYYE  428



>ref|XP_010551568.1| PREDICTED: F-box protein SKIP22-like [Tarenaya hassleriana]
Length=512

 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 174/459 (38%), Positives = 243/459 (53%), Gaps = 63/459 (14%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR+ ET+ET+  +   + +L +L+RR+  + P+S          + +SLN+KDEL 
Sbjct  1     MKLRLRNHETRETLKCEFLETCSLHDLRRRIDASSPSS----------VHISLNRKDELV  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLE-  1367
             SSSPD+TL  LG+TSGDL+++AL P+V  +S   +    S             S   LE 
Sbjct  51    SSSPDDTLRSLGLTSGDLVYYALEPSVFHASSQDVELASSTEAQQSPVRGFEDSAGKLEE  110

Query  1366  -------------------------LSS-------NLPVESTNTSDFNSLSDKAPelvdq  1283
                                      LS        N+ ++    +D N   ++  E    
Sbjct  111   QETLFRDLGTKREIGSGSTGIGSGDLSGVPENPDMNIDIQKQANTDLNFGVEEPIEGSTG  170

Query  1282  geeeevevmeidweEKDADVV-GKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVL  1106
                       +D E   AD    K  S P FL+KV  +E +D     +  +L++AVHAV+
Sbjct  171   AISGTEGHELMDVEFDGADYADSKRLSEPFFLKKVLIEECTDKS---EAMILVMAVHAVM  227

Query  1105  LESGFVRLDPILHKKVPNQWILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTL  929
             LES FV LDP             E   SI L Y+LPE+    T  +SN   TV LKFQ+L
Sbjct  228   LESRFVLLDPTSRVWADKFTFFKETMSSISLIYTLPELI---TRNHSNE--TVSLKFQSL  282

Query  928   GKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFE  749
             G  ++VYGSL G SS H V LD   FVP +++        +E +       +S  +EVFE
Sbjct  283   GPMLVVYGSLGGTSS-HRVCLDSRRFVPTIDLVMDTMKSDKEGS-------SSMYREVFE  334

Query  748   FWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLR  569
             FWR VKDG+A+PLLI LC+  G  LPPC MRLPT++K+KILE LP VD+A+++C+CSD+R
Sbjct  335   FWRMVKDGVAMPLLIGLCDMCGLELPPCLMRLPTDIKIKILESLPGVDVARLACVCSDMR  394

Query  568   YLASNDDLWKQKFEEQFN--ADWFRNGGSWKQKFVAAME  458
             Y+ SN++LWKQK  E++    +   +  SWK KF A  E
Sbjct  395   YVTSNNNLWKQKCLEEYGDLVNKEEDAVSWKAKFAAYRE  433



>ref|XP_004156873.1| PREDICTED: F-box protein SKIP22-like [Cucumis sativus]
Length=499

 Score =   244 bits (623),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 177/441 (40%), Positives = 246/441 (56%), Gaps = 35/441 (8%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+ +++ ++VP  +TL  LK          +  S  S+DS+ LSLN+KDEL+
Sbjct  1     MKLRLRSLESNQSLRIEVPDPSTLDHLKH-----TLLQTLSSSFSADSLHLSLNRKDELQ  55

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             +SSP+++L  LGITSGDL+FF   P    S  +       P LP  S+   + S   +E 
Sbjct  56    ASSPEDSLHSLGITSGDLLFFTFKPPEFSSLGATSIQSFQPPLPGSSSQVSSSSLPQVEG  115

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSF--------  1208
                L ++         L +  PE V               EE D + +            
Sbjct  116   KQLLGIDCDLKKP--RLENSEPESVVPESSSAELTACSMIEESDCEEMEVEEEPTVVVEN  173

Query  1207  --SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPIL-----HKKVPNQ  1049
               S P FLR+V  +EL        HKLL+ AVHAVLLESGFV ++P L       ++P  
Sbjct  174   RCSRPIFLRRVLKEELGYDRNA--HKLLVTAVHAVLLESGFVLINPNLGFDDSSFRMPED  231

Query  1048  WILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SSVH  878
             W    P  ++ L Y+LPE+     ++NS     V LKFQ+LG FV VYGSLS +  SSV+
Sbjct  232   W--PSPSFTMSLWYTLPELLT-KREKNSTMTEVVLLKFQSLGYFVNVYGSLSYSRGSSVY  288

Query  877   SVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIEL  698
              V LD+  F P L++ W +   +  +  K+G    +PEK+VFEFW+ VKD LALPLLI++
Sbjct  289   RVSLDERKFAPNLDLIWVDSVSNYIMDEKEG----NPEKQVFEFWKIVKDALALPLLIDI  344

Query  697   CEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF  518
             CEK G   P  FM LP ++KLKILE L  VD+A++ C+C++LRYLAS+++LWK KF ++F
Sbjct  345   CEKTGLPPPASFMLLPADVKLKILEALTGVDIARVECVCTELRYLASSNELWKMKFNQEF  404

Query  517   N-ADWFRNGGSWKQKFVAAME  458
                D      +WK KFV   E
Sbjct  405   GLEDGVSGNRNWKAKFVEYYE  425



>ref|XP_004150266.1| PREDICTED: F-box protein SKIP22-like [Cucumis sativus]
 gb|KGN52738.1| hypothetical protein Csa_4G000590 [Cucumis sativus]
Length=499

 Score =   243 bits (621),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 176/441 (40%), Positives = 246/441 (56%), Gaps = 35/441 (8%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+ +++ ++VP  +TL  LK          +  S  S+DS+ LSLN+KDEL+
Sbjct  1     MKLRLRSLESNQSLRIEVPDPSTLDHLKH-----TLLQTLSSSFSADSLHLSLNRKDELQ  55

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             +SSP+++L  LGITSGDL+FF   P    S  +       P LP  S+   + S   +E 
Sbjct  56    ASSPEDSLHSLGITSGDLLFFTFKPPEFSSLGATSIQSFQPPLPGSSSQVSSSSLPQVEG  115

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSF--------  1208
                L ++         L +  PE V               EE D + +            
Sbjct  116   KQLLGIDCDLKKP--RLENSEPESVVPESSSAELTACSMIEESDCEEMEVEEEPTVVVEN  173

Query  1207  --SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-----KVPNQ  1049
               S P FLR+V  +EL        HKLL+ AVHAVLLESGFV ++P L       ++P  
Sbjct  174   RCSRPIFLRRVLKEELGYDRNA--HKLLVTAVHAVLLESGFVLINPNLGFDDSPFRMPED  231

Query  1048  WILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SSVH  878
             W    P  ++ L Y++PE+     ++NS     V LKFQ+LG FV VYGSLS +  SSV+
Sbjct  232   W--PSPSFTMSLWYTIPELLT-KREKNSTMTEVVLLKFQSLGYFVNVYGSLSYSRGSSVY  288

Query  877   SVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIEL  698
              V LD+  F P L++ W +   +  +  K+G    +PEK+VFEFW+ VKD LALPLLI++
Sbjct  289   RVSLDERKFAPNLDLIWVDSVSNYILDEKEG----NPEKQVFEFWKIVKDALALPLLIDI  344

Query  697   CEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF  518
             CEK G   P  FM LP ++KLKILE L  VD+A++ C+C++LRYLAS+++LWK KF ++F
Sbjct  345   CEKTGLPPPASFMLLPADVKLKILEALTGVDIARVECVCTELRYLASSNELWKMKFNQEF  404

Query  517   N-ADWFRNGGSWKQKFVAAME  458
                D      +WK KFV   E
Sbjct  405   GLEDGVSGNRNWKAKFVEYYE  425



>ref|XP_010691539.1| PREDICTED: putative F-box protein At1g23770 [Beta vulgaris subsp. 
vulgaris]
Length=535

 Score =   244 bits (624),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 184/472 (39%), Positives = 258/472 (55%), Gaps = 65/472 (14%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslal--passafsmhssdSIRLSLNKKDE  1550
             MKLRLR +E+KET  ++VP +  L +LK  + L L   +SS+       ++  SLN+K+E
Sbjct  1     MKLRLRCLESKETHRIEVPNTCNLQQLKEIIILQLFPSSSSSSISAVQHNLFFSLNRKEE  60

Query  1549  LRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQIT-------TGLSPN-------LP  1412
             L   S +++L  LG+TSGDLI+++ NPN   S    ++        G+S         + 
Sbjct  61    L---SGEQSLRFLGVTSGDLIYYSRNPNAFSSQNPNLSHVELDNSQGISTKRDEVVNLVN  117

Query  1411  AESTDSINLSQKS-------------LELSSNLPVESTNTSDFNS------------LSD  1307
              +   S+NL + S             +E SS L   S N+ +  +            +  
Sbjct  118   TQKVKSVNLDELSVPSAGIRDMMDAQMEGSSKLRTPSDNSGNLGNSQMLESSKIDELIGS  177

Query  1306  KAPelvdqgeeeevevmeidweEK-----DADVVGK-SFSVPGFLRKVFTKELSDSD-GG  1148
              AP     G  EE  +  ++  ++     +A+V G    SVP FL+KVF KE+ D+  GG
Sbjct  178   SAPFRESSGVNEEKSINLVEETDEMEVDDEAEVEGNYRLSVPSFLKKVFVKEVGDASIGG  237

Query  1147  RDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVS-----ILSYSLPEIADGD  983
              DH LL+IAVHAVLLESGFV  +P+   K  + + LTE   S      L Y+LP+I+   
Sbjct  238   EDHNLLVIAVHAVLLESGFVAYNPVSGTK-GDGFHLTEAWPSKAFGTTLHYTLPDISA--  294

Query  982   TDQNSNAVPTVELKFQTLGKFVIVYGSLSGNS-SVHSVQLDKDHFVPFLNVAWSNCGLSE  806
                 S  V TV LKF+ LGKFV VYG L      VH V LD+  F+P L+  W     + 
Sbjct  295   ----SEVVDTVVLKFRALGKFVNVYGLLPKKGFGVHRVCLDEPRFLPALSSIWKKSDYTG  350

Query  805   EIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKIL  626
                  DG     P +E+FEFW+ VKDGL+ PLLI+LCE+ G   P CFM LPTELK+KIL
Sbjct  351   SQNEIDGTRKLYPNQEIFEFWKMVKDGLSYPLLIDLCEQVGIVPPSCFMLLPTELKIKIL  410

Query  625   ELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN-ADWFRNGGSWKQKF  473
             E LPA+ +A++ CL S+LR+LASN+DLW+ K++E+F  A   +    WK KF
Sbjct  411   ESLPAIAVARVECLNSELRFLASNNDLWRLKYKEEFGYAPQSQREVQWKAKF  462



>emb|CDY25801.1| BnaA07g09810D [Brassica napus]
Length=468

 Score =   240 bits (613),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 161/423 (38%), Positives = 242/423 (57%), Gaps = 48/423 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++P S TL +L++R++   P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRRHETRETLKLELPDSITLHDLRQRINEPSPSS----------VHLSLNRKDELL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             + SPD TL  LG+TSGDLI+++L P+   +S  +I    S  + +++   I  +   ++L
Sbjct  51    APSPDHTLRSLGVTSGDLIYYSLVPSAFAASLEEIALASSSEVKSQNEMGIGFAASDVDL  110

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRK  1184
             +   P E +        S  AP+ +D  E +             A    K  + P FL+K
Sbjct  111   NIQDPEEVST----GEASGHAPDPMDVEELDVEL----------AAAGSKRLTEPFFLKK  156

Query  1183  VFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI-LSYS  1007
             V  ++  D+    +   + ++VHAV+LESGFV  +P       N++  ++  +++ L Y+
Sbjct  157   VLLEKSGDTS---ELTTVAMSVHAVMLESGFVLFNPDCSD---NKFSFSKELLTVSLKYT  210

Query  1006  LPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAW  827
             LPE+   D       V +V ++FQ+L   V+VYGSL G   +  + LDK  FVP +++  
Sbjct  211   LPELMTSD-----KGVESVTVRFQSLSDKVVVYGSLGGK--LQRLYLDKRRFVPVIDLVM  263

Query  826   SNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPT  647
                      + KDG   +S  KE+F FWR VKDGL +PLLI LC+K+G  LPPC MRLPT
Sbjct  264   DTLK-----SDKDG--SSSIYKEMFMFWRMVKDGLVIPLLIGLCDKSGLELPPCLMRLPT  316

Query  646   ELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN---ADWFRNGGSWKQK  476
             ELKLKILE LP   +AKM+C+C+++RYLA+++DLWKQK  E+      D   +  +WK K
Sbjct  317   ELKLKILESLPGASVAKMACVCTEIRYLATDNDLWKQKCLEEAKHLVVDGAGDSVNWKAK  376

Query  475   FVA  467
             F A
Sbjct  377   FAA  379



>ref|XP_003555304.1| PREDICTED: F-box protein SKIP22-like [Glycine max]
Length=460

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 187/475 (39%), Positives = 260/475 (55%), Gaps = 77/475 (16%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+KET+ ++VP S +L +LK          S     SS S+ LSLN+KDE+ 
Sbjct  1     MKLRLRSLESKETLKIEVPDSCSLLQLK-------DTVSRTISSSSSSLHLSLNRKDEIH  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNV----------QESSESQITTGLSPNLPAESTDS  1394
             + SP+E L  LG+ +GDLIF++LNP            + +S    +   SP   A  + S
Sbjct  54    APSPEEPLHSLGVAAGDLIFYSLNPIAFTLETLLHKPETASRDGPSIQDSPETLASDSPS  113

Query  1393  INLSQK--SLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVV  1220
             +  ++K  +L+ +   P+E  + SD                              +  VV
Sbjct  114   VPDAEKPPTLDAAELEPMEMIDGSD------------------------------EMVVV  143

Query  1219  GKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWIL  1040
             G + S P F+R+V  + L ++    D KLL+ AVH V+LESGFVR+D      V    +L
Sbjct  144   GTN-SEPFFVRRVLKEALGNNVN--DFKLLVFAVHGVVLESGFVRIDKDCGMAVTGSHLL  200

Query  1039  TEP-----QVSILSYSLPEI-ADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SS  884
              +       V  L Y+LPEI A+G       A  +V LKFQTLG FV V GSLS +  S 
Sbjct  201   DDSPPAFSSVISLRYALPEILANG-------ASHSVNLKFQTLGHFVNVCGSLSDDVGSR  253

Query  883   VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
             +H V LDK  +V  L +  +N      +   + +L  S   EVFE W+ VKD LALPLLI
Sbjct  254   LHFVCLDKRKYVRPLELMLANSEAKGSVNDGEDILFGS---EVFEMWKMVKDRLALPLLI  310

Query  703   ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEE  524
             +LCEKAGF LPPCF RLP ELKL ILE LP VDLAK++C CS+LRYL+++++LWK+K+EE
Sbjct  311   DLCEKAGFDLPPCFTRLPMELKLLILERLPGVDLAKVACTCSELRYLSTSNELWKKKYEE  370

Query  523   QFNADWFRNGGSWKQKFVAAMEnrk-------qrknmrrrRVFDPLRYVNPPFMG  380
             +F  +  R G  +K  F  + E +K       +R+ + R  +F P  +  PP  G
Sbjct  371   EFGKEGDRKGWLFKDLFAVSWETKKRWRAVPFRRRGISRNIIFSPNHFRMPPVWG  425



>ref|XP_007200991.1| hypothetical protein PRUPE_ppa005011mg [Prunus persica]
 gb|EMJ02190.1| hypothetical protein PRUPE_ppa005011mg [Prunus persica]
Length=481

 Score =   239 bits (610),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 171/441 (39%), Positives = 245/441 (56%), Gaps = 64/441 (15%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+RS+ETKET+ V+VP   +L +LK+         S     S  S+RLSLN++DEL 
Sbjct  1     MKLRVRSIETKETLRVEVPNLCSLHQLKQ-------TISQLISASPSSLRLSLNRRDELH  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             +SSPD++L  LG+TSGDLIF+ L+P+ Q          L+P  P  S    ++   +  L
Sbjct  54    ASSPDDSLHSLGLTSGDLIFYTLDPSSQT---------LAP--PPHSISHSSVQSHNQIL  102

Query  1363  SSNLPVEST----------NTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVG-  1217
             ++ +P  S            ++  +S++++   LV   E       E    +  +D +G 
Sbjct  103   TTGVPQGSNFQNPETLIGEGSAAGDSIAEEQRSLVSNSETLVASGAERMEIDDGSDGIGL  162

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILT  1037
             K +SVP FL++V  +EL +     +HKLL+IAVHA +LESGFV  D +      N++ L 
Sbjct  163   KKYSVPFFLKRVLREELGEDRS--NHKLLVIAVHAAVLESGFVGFDSVSGMGA-NRFHLA  219

Query  1036  E--PQVSI---LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL-SGNSSVHS  875
             +  P+ +I   LSY+LPEI   +   N N V  V LKFQ+LG+FV VYGSL SG +  + 
Sbjct  220   DEWPRTAITMSLSYTLPEILK-NRGNNGNGVEGVMLKFQSLGRFVNVYGSLASGGAGPYR  278

Query  874   VQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELC  695
             V LD+  F P +   W N  ++E    +DGL+    E+EVFEFW+               
Sbjct  279   VCLDEHRFAPIIESVWENKNVNE----RDGLVS---EREVFEFWKI--------------  317

Query  694   EKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
               AG   PP  MRLP ELK+KILE L  VD+AK+  +C +LR LA+ND+LWK+K+ E+F 
Sbjct  318   --AGLPAPPSLMRLPPELKMKILEPLSGVDIAKVGGVCKELRNLANNDELWKKKYAEEFG  375

Query  514   ADWFRNGG--SWKQKFVAAME  458
             +     G   +WK KF    E
Sbjct  376   SGTGGEGTMINWKHKFARNWE  396



>ref|XP_009103155.1| PREDICTED: F-box protein SKIP22-like [Brassica rapa]
Length=462

 Score =   238 bits (607),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 160/423 (38%), Positives = 241/423 (57%), Gaps = 53/423 (13%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++P S TL +L++R++   P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRRHETRETLKLELPDSITLHDLRQRINEPSPSS----------VHLSLNRKDELL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             + SPD TL  LG+TSGDLI+++L P+   +S  +I    S  + +++   I  +   +++
Sbjct  51    APSPDHTLRSLGVTSGDLIYYSLVPSAFAASLEEIALASSSEVKSQNEMGIGFAASDVDM  110

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRK  1184
                 P E+         S  AP+ +D  E +             A    K  + P FL+K
Sbjct  111   HIQDPGEA---------SGHAPDPMDVEELDVEL----------AAAGSKRLTEPFFLKK  151

Query  1183  VFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI-LSYS  1007
             V  ++  D+    +   + ++VHAV+LESGFV  +P       N++  ++  +++ L Y+
Sbjct  152   VLLEKSGDTS---ELTTVAMSVHAVMLESGFVLFNPDCSD---NKFSFSKELLTVSLKYT  205

Query  1006  LPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAW  827
             LPE+   D       V +V ++FQ+L   V+VYGSL G   +  + LDK  FVP +++  
Sbjct  206   LPELMTSD-----KGVESVTVRFQSLSDKVVVYGSLGGK--LQRLYLDKRRFVPVIDLVM  258

Query  826   SNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPT  647
                      + KDG   +S  KE+F FWR VKDGL +PLLI LC+K+G  LPPC MRLPT
Sbjct  259   DTLK-----SDKDG--SSSIYKEMFMFWRMVKDGLVIPLLIGLCDKSGLELPPCLMRLPT  311

Query  646   ELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN---ADWFRNGGSWKQK  476
             ELKLKILE LP   +AKM+C+C+++RYLA+++DLWKQK  E+      D   +  +WK K
Sbjct  312   ELKLKILESLPGASVAKMACVCTEIRYLATDNDLWKQKCLEEAKHLVVDGEGDSVNWKAK  371

Query  475   FVA  467
             F A
Sbjct  372   FAA  374



>emb|CDY28475.1| BnaC07g13030D [Brassica napus]
Length=471

 Score =   238 bits (606),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 161/429 (38%), Positives = 247/429 (58%), Gaps = 58/429 (14%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++P S+TL +L++R++   P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRCHETRETLKLELPDSSTLHDLRQRINEPSPSS----------VHLSLNRKDELL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAES----TDSINLSQK  1376
             + SPD+TL  LG+TSGDLI+++L P+   +S  +I    S    ++      DS+ +   
Sbjct  51    APSPDDTLRSLGVTSGDLIYYSLVPSAFAASVEEIALASSSEGKSQDKTIVQDSMGIGFA  110

Query  1375  SLELSSNL--PVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSV  1202
             + ++  N+  P E++   +    S  AP+ +D  E               A    K  + 
Sbjct  111   ATDVDMNIQDPEEASTGEE----SGHAPDPMDVEEL--------------AAAGSKRLTE  152

Query  1201  PGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVS  1022
             P FL+K+  ++  D+    +   + ++VHAV+LESGFV  +P+      N++  ++  ++
Sbjct  153   PFFLKKILLEKSGDTS---ELTTVAMSVHAVMLESGFVLFNPV---SSDNKFSFSKELLT  206

Query  1021  I-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVP  845
             + L Y+LPE+         + V +V ++FQ+L   V+VYGSL G   +  V LDK  FVP
Sbjct  207   VSLKYTLPELM-----TREDGVESVTVRFQSLSDKVVVYGSLGGK--LQRVYLDKRRFVP  259

Query  844   FLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPC  665
              +++           + KDG   +S  KE+F FWR VKDGL +PLLI LC+K+G  LPPC
Sbjct  260   VIDLVMDTLK-----SDKDG--SSSIYKEMFMFWRMVKDGLVIPLLIGLCDKSGLELPPC  312

Query  664   FMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN---ADWFRNG  494
              MRLPTELKLKILE LP   +AKM+C+C+++RYLA+++DLWKQK  E+      D   + 
Sbjct  313   LMRLPTELKLKILESLPGASVAKMACVCTEIRYLATDNDLWKQKCLEEAKHLVVDGAGDS  372

Query  493   GSWKQKFVA  467
              +WK KF A
Sbjct  373   VNWKAKFAA  381



>gb|AFK46566.1| unknown [Medicago truncatula]
 gb|KEH43999.1| F-box SKIP22-like protein [Medicago truncatula]
Length=462

 Score =   237 bits (604),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 172/418 (41%), Positives = 225/418 (54%), Gaps = 62/418 (15%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+KET+ ++VP S +  +LK         S      SS SI LSLN+KDE+ 
Sbjct  1     MKLRLRSLESKETLKIEVPDSCSSQQLK------FTISQTIPSSSSSSIHLSLNRKDEIN  54

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
              +SP ++L  +GI SGDLIF+  NPN    +E+       P+ P                
Sbjct  55    VASPSDSLHSIGIASGDLIFYTFNPNAFSHNETL------PHKP----------------  92

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRK  1184
              +N P+   N+ +   + +K+P L      +   V   D       +  K+   P F+++
Sbjct  93    -NNQPI-IQNSPEITPIDEKSPTLNTPEVNDTEMVDGSDEAATAMTMAVKNNPEPDFVKR  150

Query  1183  VFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI-----  1019
             V  + L D     D KLL+ AVHAV+LESGFVR+D +    +    ++ +   S      
Sbjct  151   VIKEALGDDVS--DLKLLVFAVHAVILESGFVRVDEVSGMAISCSNLVDDMSSSSSSSSS  208

Query  1018  ---------LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL--SGNSSVHSV  872
                      L Y+LPEI    T+ +S+AV    LK QTLG FV VYGSL     S VH V
Sbjct  209   SSSSSSMISLRYTLPEIL---TNGSSHAVI---LKIQTLGNFVNVYGSLCDDAGSRVHRV  262

Query  871   QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCE  692
              LDK  F   L +   N     E  G           +VFE W+ VKDGLALPLLI+LC+
Sbjct  263   YLDKSRFAKPLELMLEN----SEFNGN----FNDVGDKVFELWKIVKDGLALPLLIDLCD  314

Query  691   KAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF  518
             KAG  LPPCFMRLP ELKL I E LP  DLAK+ C CS+L+YLASNDDLWK+KFEE+F
Sbjct  315   KAGLELPPCFMRLPMELKLLIFEYLPGDDLAKVCCTCSELQYLASNDDLWKKKFEEEF  372



>ref|XP_004496864.1| PREDICTED: F-box protein SKIP22-like isoform X2 [Cicer arietinum]
Length=464

 Score =   234 bits (597),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 178/438 (41%), Positives = 236/438 (54%), Gaps = 67/438 (15%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS E+KET+ ++VP   +  +LK+     +  + + S  SS S+ LSLN+KDE+ 
Sbjct  1     MKLRLRSFESKETLKIEVPDPCSFHQLKQ----TISHAISSSSSSSSSLHLSLNRKDEID  56

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNV--------------QESSESQITTGLSPNLPAE  1406
             +SSP+++L  +GI +GDLIF+  NPN               +  S  +     SP   A 
Sbjct  57    ASSPEDSLHSIGIATGDLIFYTFNPNTFSRETLPHKPTPQQEPHSNHRPIIQDSPENNAG  116

Query  1405  STDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDAD  1226
              T SI + +KS  L+   P +S N  +   +SD                        +A 
Sbjct  117   DTHSIPIGEKSPALN---PADSENV-EMVDVSD------------------------EAV  148

Query  1225  VVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQW  1046
             VV K+ S P F+++V  + L D     D KLL+ AVHAV+LESGFVR+D +    +    
Sbjct  149   VVLKNNSEPEFVKRVLKEALGDDFS--DFKLLVFAVHAVILESGFVRVDQVSGMAISCSH  206

Query  1045  ILTEPQVSI---LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SSV  881
             +L +   S    L Y+LPEI    T+ +S+AV    LK Q LG FV V GSL  +  S V
Sbjct  207   LLDDCSSSSMISLRYTLPEIL---TNGSSHAV---NLKIQKLGNFVNVCGSLCDDVGSRV  260

Query  880   HSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
             H V LDK  F   L         S      DG        EVFE W+ VKD LALPLLI+
Sbjct  261   HRVYLDKCRFAKPLEFMMLESSESNASGVNDG------GDEVFELWKIVKDRLALPLLID  314

Query  700   LCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQ  521
             LC+K G  LPPCFMRLP ELKL I E LP  DLAK+ C CS+L+YLASND+LWK+KFEE+
Sbjct  315   LCDKVGLDLPPCFMRLPMELKLLIFEYLPGDDLAKVCCTCSELQYLASNDELWKKKFEEE  374

Query  520   FNADWFRNGGSWKQKFVA  467
             F      +GG + +   A
Sbjct  375   FGQRM--DGGKFFKNLFA  390



>ref|XP_004496863.1| PREDICTED: F-box protein SKIP22-like isoform X1 [Cicer arietinum]
Length=466

 Score =   234 bits (597),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 178/438 (41%), Positives = 236/438 (54%), Gaps = 67/438 (15%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS E+KET+ ++VP   +  +LK+     +  + + S  SS S+ LSLN+KDE+ 
Sbjct  1     MKLRLRSFESKETLKIEVPDPCSFHQLKQ----TISHAISSSSSSSSSLHLSLNRKDEID  56

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNV--------------QESSESQITTGLSPNLPAE  1406
             +SSP+++L  +GI +GDLIF+  NPN               +  S  +     SP   A 
Sbjct  57    ASSPEDSLHSIGIATGDLIFYTFNPNTFSRETLPHKPTPQQEPHSNHRPIIQDSPENNAG  116

Query  1405  STDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDAD  1226
              T SI + +KS  L+   P +S N  +   +SD+A                         
Sbjct  117   DTHSIPIGEKSPALN---PADSENV-EMVDVSDEAV------------------------  148

Query  1225  VVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQW  1046
             VV K+ S P F+++V  + L D     D KLL+ AVHAV+LESGFVR+D +    +    
Sbjct  149   VVLKNNSEPEFVKRVLKEALGDD--FSDFKLLVFAVHAVILESGFVRVDQVSGMAISCSH  206

Query  1045  ILTEPQVSI---LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SSV  881
             +L +   S    L Y+LPEI    T+ +S+AV    LK Q LG FV V GSL  +  S V
Sbjct  207   LLDDCSSSSMISLRYTLPEIL---TNGSSHAV---NLKIQKLGNFVNVCGSLCDDVGSRV  260

Query  880   HSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
             H V LDK  F   L         S      DG        EVFE W+ VKD LALPLLI+
Sbjct  261   HRVYLDKCRFAKPLEFMMLESSESNASGVNDG------GDEVFELWKIVKDRLALPLLID  314

Query  700   LCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQ  521
             LC+K G  LPPCFMRLP ELKL I E LP  DLAK+ C CS+L+YLASND+LWK+KFEE+
Sbjct  315   LCDKVGLDLPPCFMRLPMELKLLIFEYLPGDDLAKVCCTCSELQYLASNDELWKKKFEEE  374

Query  520   FNADWFRNGGSWKQKFVA  467
             F      +GG + +   A
Sbjct  375   FGQRM--DGGKFFKNLFA  390



>ref|XP_003535677.1| PREDICTED: F-box protein SKIP22-like isoform X1 [Glycine max]
 ref|XP_006589613.1| PREDICTED: F-box protein SKIP22-like isoform X2 [Glycine max]
Length=464

 Score =   234 bits (596),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 182/465 (39%), Positives = 256/465 (55%), Gaps = 53/465 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLRLRS+E+KET+ ++VP S  +L +LK      +  + + S  SS S+ LSLN+KDE+
Sbjct  1     MKLRLRSLESKETLKIEVPDSCCSLQQLK----DTVSHTISSSSSSSSSVHLSLNRKDEI  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAES-TDSINLSQKSL  1370
              + SPDE L+ LG+ +GDLIF++LNP       +  +    P+ P  +  D   +     
Sbjct  57    HAPSPDEPLQSLGVAAGDLIFYSLNP-------TAFSLETLPHKPETAPLDGPTIQDSPE  109

Query  1369  ELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFL  1190
              L+ + P  S  T++     D A                   +  D  VV  + S P F+
Sbjct  110   TLAGDAP--SVPTAEKPPTLDSA-----------EPEPAEMIDGSDGTVVVSTNSEPFFV  156

Query  1189  RKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEP-----QV  1025
             R+V  + L ++    D KLL+ AVH V+LESGFVR+D      V    +L +       V
Sbjct  157   RRVLKEALGNN--VTDFKLLVFAVHGVVLESGFVRIDKDSRMAVSCSDLLDDSPSAFSSV  214

Query  1024  SILSYSLPEI-ADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SSVHSVQLDKDH  854
               L Y+LPEI A+G       A  +V LKFQTLG FV V GSLS +  S +H V LD   
Sbjct  215   ISLRYTLPEILANG-------ASHSVNLKFQTLGHFVNVCGSLSDDVRSMLHFVCLDTRK  267

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             +V  L    +N      +   + ++  +   EVFE W+  KD LALPLLI+LCEKAG  L
Sbjct  268   YVRPLESMLANSETKGSLNDGEDIVFGN---EVFEMWKMGKDRLALPLLIDLCEKAGVDL  324

Query  673   PPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNG  494
             PPCFMRLP ELKL ILE LP VDLAK++C CS+LRYL+++++LWK+K+EE+F  +  R G
Sbjct  325   PPCFMRLPMELKLLILERLPGVDLAKVACTCSELRYLSTSNELWKKKYEEEFGKEGDRKG  384

Query  493   GSWKQKFVAAMEnrkqrknm-------rrrRVFDPLRYVNPPFMG  380
               +K  F  + E +K+R+ +        R  +F P  +  PP  G
Sbjct  385   WLFKDLFALSWETKKRRQAVPFRRQGISRNIIFSPNHFGMPPVWG  429



>ref|XP_002522106.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40306.1| conserved hypothetical protein [Ricinus communis]
Length=523

 Score =   235 bits (600),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 190/485 (39%), Positives = 268/485 (55%), Gaps = 51/485 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRSVE+KET+ ++VP    L +LK      L  + + S  SS S+  SLN+KDEL 
Sbjct  1     MKLRLRSVESKETVKLEVPNDCNLQQLKE----TLILALSSSSSSSSSLHFSLNRKDELL  56

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQI---TTGLSPNLPAESTDSINL---S  1382
             SSS  ++L+ LGITSGDLI+F   P+   S   Q    T   S +   E+   +N+   S
Sbjct  57    SSSLQDSLQSLGITSGDLIYFTQKPDGLFSPSQQTQQRTFQESESFAQENAAQLNIKEPS  116

Query  1381  QKSLELSSNLPVESTNTSD----FNSLSDK--------------APelvdqgeeeevevm  1256
              K +E+S  L V   N S+    F   S K                 L +       + M
Sbjct  117   SKEIEISEELEVIGLNCSNQETSFQDSSIKETRQGLPAVSNTQFGETLENDQGYARGDDM  176

Query  1255  eidweEKDADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDP  1076
             ++  E  D DV  K  S P FL++V  +E    D   D+KLL IA+HAV LESGFV  D 
Sbjct  177   DVGTESADVDVKSKRISEPCFLKRVLGEEDFAVDFS-DNKLLFIAIHAVFLESGFVGFDS  235

Query  1075  ILHKKVPNQWILTEPQV----SILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVY  908
             +   +V    +L E  +    + +SY+LPE+ D D     N + +V LKFQTLG+FV VY
Sbjct  236   VSGLRVDLFHLLQEQPLMNFTTSVSYTLPELLDND-----NVIDSVVLKFQTLGQFVNVY  290

Query  907   GSLSGNSS-VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVK  731
             GS++ + S V+   LDK  +VP +   W     S+     +    +  E  VFE W+ VK
Sbjct  291   GSVAKSRSLVYRSCLDKCRYVPAIGSIWITWDKSDTAYENN----SYTENVVFELWKIVK  346

Query  730   DGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASND  551
             D LALPLLI+LCEK G  LPPC MRLP ++K KILE LP + +A+M+C+C +++YL+S++
Sbjct  347   DHLALPLLIDLCEKTGLVLPPCLMRLPADIKHKILESLPGIAIARMACVCKEMQYLSSSN  406

Query  550   DLWKQKFEEQFNADWFRNGG-SWKQKFVAAMEnrkqrknmrrrR-------VFDPLRYVN  395
             DLWKQK+ E+F +   +    +WK KF ++ ENRK+R+     R         +P R++ 
Sbjct  407   DLWKQKYGEEFGSGTLQQEMVNWKVKFASSWENRKKRRKRSFVRPTPVNFIRSEPYRFMV  466

Query  394   PPFMG  380
             PP +G
Sbjct  467   PPQIG  471



>gb|KCW62709.1| hypothetical protein EUGRSUZ_G00280 [Eucalyptus grandis]
Length=446

 Score =   233 bits (594),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 217/399 (54%), Gaps = 47/399 (12%)
 Frame = -3

Query  1693  KETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELRSSSPDETLEM  1514
             ++T+ + VP   +LP+L+R     L    + S     S RLSLN+ DELRS  P  +L+ 
Sbjct  9     RDTLKLVVPDPCSLPQLRR----ILAGRLSPSPPPGVSFRLSLNRTDELRSPDPAASLQS  64

Query  1513  LGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLELSSNLPVESTN  1334
             LG+ SGDL++F+L P+   S   ++    S    +  T      +  L  +  +  +   
Sbjct  65    LGLASGDLVYFSLGPDALASP--RVGDSSSSAESSAGTSGRMRREPMLRGAPGIQGDGVV  122

Query  1333  TSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRKVFTKELSDSD  1154
              +D                              D+  V   FS P FLR+V  +EL   D
Sbjct  123   AAD------------------------------DSTGVRSKFSEPYFLRRVLREELG-GD  151

Query  1153  GGRDHKLLLIAVHAVLLESGFVRLDPILHK-----KVPNQWILTEPQVSILSYSLPEIAD  989
             GG DH+LL+IAV AVLLE GFV +DP+         + +QW  +      L YSLPE+  
Sbjct  152   GG-DHRLLVIAVQAVLLEPGFVAVDPVTGMPADRFHLSDQWP-SAAFTMTLQYSLPELVA  209

Query  988   GDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVH-SVQLDKDHFVPFLNVAWSNCGL  812
                 Q  N   ++ LKF++LG F+ VYG L+   SV   V L++  F P ++V W     
Sbjct  210   --RTQGLNVTESLVLKFESLGHFISVYGRLAKAKSVLIRVCLNERRFAPIIDVMWVKGDD  267

Query  811   SEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLK  632
             + E+    G L  S EK+VFEFW+ VKDGLALPLLI+L E+ G  LP CF  LPTELKL+
Sbjct  268   NVEVNEDGGSLNLSSEKQVFEFWKIVKDGLALPLLIDLTERVGLPLPSCFTCLPTELKLR  327

Query  631   ILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
             I ELLP +DLA++ C+ S+LRYLAS++DLWKQK++E+F 
Sbjct  328   IFELLPGIDLARVGCVSSELRYLASDNDLWKQKYDEEFG  366



>ref|XP_010095741.1| F-box protein SKIP22 [Morus notabilis]
 gb|EXB62124.1| F-box protein SKIP22 [Morus notabilis]
Length=457

 Score =   233 bits (593),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 175/470 (37%), Positives = 242/470 (51%), Gaps = 72/470 (15%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+RS ++KE + +D+   ++L +LK         + A       S+RLSLN+ DELR
Sbjct  1     MKLRVRSFDSKEILRIDITNDSSLQQLKE------AIAQAIPSSYPSSLRLSLNRTDELR  54

Query  1543  SSSPDETLEMLGITSGDLIFFA---LNPNVQESSESQITTGLSPNLPAESTDSINLSQKS  1373
             SSS D++L  LGI +GDLIF++   L    +E+  SQ    L    P +S   INL  + 
Sbjct  55    SSSSDDSLLSLGIAAGDLIFYSVETLASQDRETLASQDRETLGDPPPPDSAQVINLDPR-  113

Query  1372  LELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGF  1193
               + S L VE +         D                          D VG  F    F
Sbjct  114   --VDSELIVEDSGGKSMEIDGDCV------------------------DFVGVKFPETCF  147

Query  1192  LRKVFTKELSDSDG--GRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI  1019
             LR+V  + +S+  G  GR+HKL++IAVH+V LESGFV  D       PN+W  +      
Sbjct  148   LRRV-RRMVSEEFGEDGRNHKLMVIAVHSVFLESGFVEFDEF---HFPNEWSPSMAFTMS  203

Query  1018  LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL-SGNSSVHSVQLDKDHFVPF  842
               Y+LPEI  GD D   N   +V LK+Q LG+FV V G+L SG S  + V LD+  + P 
Sbjct  204   FRYTLPEIL-GDQDCTLNLRESVVLKYQILGRFVNVLGALTSGGSVTYRVCLDEKKYAPA  262

Query  841   LNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF  662
             +    S C   +E            E+EV+  W+ V+DGL LPLLI+LC KAG   PPCF
Sbjct  263   IG---SLCAKGDEF-----------EREVYGLWKVVRDGLGLPLLIDLCAKAGLPSPPCF  308

Query  661   MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN---------AD  509
             MRLP+EL++KILE LP  D+AK+ C+C +L+YL+ N+DLW++KF E+F          + 
Sbjct  309   MRLPSELQMKILEFLPGADIAKVGCVCKELQYLSCNNDLWRRKFVEEFEMGMVGSQAVSH  368

Query  508   W---FRNGGSW--KQKFVAAMEnrkqrknmrrrRVFDPLRYVNPPFMGPW  374
             W   F N   W  K+K   A    ++R       +F P+R    P   PW
Sbjct  369   WKTAFANSAYWQRKRKEEEAAAIGRRRLPHYGWPMFGPIRRDPNPLEVPW  418



>ref|XP_006416056.1| hypothetical protein EUTSA_v10009461mg [Eutrema salsugineum]
 gb|ESQ34409.1| hypothetical protein EUTSA_v10009461mg [Eutrema salsugineum]
Length=502

 Score =   233 bits (594),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 158/450 (35%), Positives = 248/450 (55%), Gaps = 60/450 (13%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR+  + P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRRHETRETLKLELADTATLHDLRRRIISSAPSS----------VHLSLNRKDELL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNV-----------------------QESSESQITT  1433
             + SP++TL  LG+TSGDL++++L+ +                         ESS+ ++  
Sbjct  51    APSPEDTLRSLGVTSGDLVYYSLDRSAFVTSVEEIGLASSAEADQVLAPSGESSDGKLGD  110

Query  1432  GLSPNLPAESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevme  1253
               +   P       ++  +  E+  ++ + +   +D NS+ +   E              
Sbjct  111   SATSRGPQSERSHDSMGIEFAEVDVDMNIHNQARTDPNSVVEDPAEGSIGENPGMEGPEP  170

Query  1252  idweEKDADVVGKS---FSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRL  1082
             +D E+ D ++        S P FL+K+  ++  D+    +   L ++VHAV+LESGFV L
Sbjct  171   MDVEQLDVELAAAGSIRLSEPFFLKKILLEKSGDTS---ELTTLALSVHAVMLESGFVLL  227

Query  1081  DPILHKKVPNQWILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYG  905
             D        +++  ++  +S+ L Y+LPE+    T + SN +  V ++FQ+LG  V+VYG
Sbjct  228   D-----HGSDKFSFSKELLSVSLRYTLPELI---TSKESNTIEFVTVRFQSLGYMVVVYG  279

Query  904   SLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDG  725
             +LSG      V L+K  FVP +++       S+E +       +S  +E+F FWR VKDG
Sbjct  280   NLSGYKG-QKVNLEKRRFVPVIDLVMDTLKSSKEGS-------SSIYREMFMFWRMVKDG  331

Query  724   LALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDL  545
             L +PLLI LC+KAG  LPPC MRLPTELKLKILE LP   +AKM+C+C+++RYLAS++DL
Sbjct  332   LVIPLLIGLCDKAGLELPPCLMRLPTELKLKILESLPGASVAKMACVCTEMRYLASDNDL  391

Query  544   WKQKFEEQFNADWFRNGG----SWKQKFVA  467
             WKQK  E+       +G     +W+ KF A
Sbjct  392   WKQKCVEEAEHLVVVHGSGVNVNWQAKFAA  421



>ref|XP_002276156.1| PREDICTED: putative F-box protein At1g23770 [Vitis vinifera]
 emb|CAN73524.1| hypothetical protein VITISV_010705 [Vitis vinifera]
Length=563

 Score =   233 bits (594),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 202/491 (41%), Positives = 268/491 (55%), Gaps = 79/491 (16%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+RS+E+KET+ + VP   +L   +  + L   A S+ S  SS  I LSLN+KDEL+
Sbjct  1     MKLRVRSLESKETLKIQVPDPCSL---QHFIHLLSLAISSSSSSSSSIIYLSLNRKDELQ  57

Query  1543  SSS---------------------------------------------PDETL---EMLG  1508
              SS                                             P +TL   + LG
Sbjct  58    VSSSLDTLQSLGVTSGDLIFYSFNPTAFSRQTHAPPIPETLVNEGTPIPSQTLVPSQALG  117

Query  1507  ITSGDLIFFA--LNPNVQESSESQITTGLSPNLPAESTDSINLSQKS---LELSSNLPVE  1343
               SG+ +  +  L+PN  E+    +T  +    P  S   ++ S++    LE  +  P+ 
Sbjct  118   PNSGETLIQSQTLDPNSGEAQTLPMTKRVMEETPIPSETLVSNSERKETLLESQTLAPLA  177

Query  1342  STNTSD---FNSL-SDKAPelvdqgeeeevevmeidweEKDAD----VVGKSFSVPGFLR  1187
               N  +   + SL SD       +        +E      D D    VV KSFS P FLR
Sbjct  178   QANPHEPKEYGSLVSDSKKNETQEFSGATSMDVEGGVAAADEDDEPIVVKKSFSEPCFLR  237

Query  1186  KVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTE--PQVSI--  1019
             KV  +E+ D   G +HKLL+IAVHAV+LESGFV  D +   +V +++ L+E  P  +I  
Sbjct  238   KVLREEVGDD--GNEHKLLVIAVHAVMLESGFVGFDSVSGMRV-DRFHLSEEYPFAAISM  294

Query  1018  -LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN-SSVHSVQLDKDHFVP  845
              L Y+LPE+ D   D +S A+ +V LKFQ LG+F+ +YGSLSGN S+VH V LD+  F P
Sbjct  295   SLWYTLPELLDHGCD-DSPAIQSVALKFQHLGQFINIYGSLSGNRSTVHWVSLDEYRFAP  353

Query  844   FLNVAWSNCGLSEEIAGKD-GLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
              L++ W++   +EE   KD G   + PE EVFEFW+ VKDGLALPLL +LCEK G   PP
Sbjct  354   TLDLMWTHSDSAEE---KDRGSSNSYPENEVFEFWKIVKDGLALPLLTDLCEKGGLLPPP  410

Query  667   CFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGGS  488
             C MRLPTELKLKILELLP VDL K+ C+CS+L YL+SN+DLWKQKF E+F       G S
Sbjct  411   CLMRLPTELKLKILELLPGVDLGKVGCVCSELMYLSSNNDLWKQKFTEEFGNVRVGQGFS  470

Query  487   -WKQKFVAAME  458
              WK KF    E
Sbjct  471   LWKDKFATWWE  481



>ref|XP_006422751.1| hypothetical protein CICLE_v10028208mg [Citrus clementina]
 gb|ESR35991.1| hypothetical protein CICLE_v10028208mg [Citrus clementina]
Length=522

 Score =   232 bits (591),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 179/456 (39%), Positives = 255/456 (56%), Gaps = 57/456 (13%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E KET+ ++VP S TL EL           S     S  S+R SLN+KDEL 
Sbjct  1     MKLRLRSLENKETLRLEVPSSCTLHELGE-------TLSQLISSSPSSLRFSLNRKDELH  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPN--VQESSESQITTGLSPNLPAESTDSINLSQ---  1379
             +SSP E+L  LG+T+GDLIF++ +P   V ++ ES+ T  ++    +   D I   +   
Sbjct  54    ASSPPESLHSLGVTAGDLIFYSRDPYAFVSQTLESE-TQSVNKACTSRDNDEIPDGKLDK  112

Query  1378  ------KSLELSSNL-------PVESTNTSDFNSLSDKA--Pelvdqgeeeevevmeidw  1244
                   +S+E+  NL        V S +    +++ DK   P    +  E      +   
Sbjct  113   QEIPVLESVEIGVNLQESKSEEAVISQDCGIPDAMLDKQQYPVQESEKIEVSSVDSKEHM  172

Query  1243  eEKDA-----------DVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLES  1097
              +K+            D        P FLR+V  ++L D  G   H L+++AVH +LLES
Sbjct  173   SKKETLEFLNTDTMEIDEGSVVMPEPYFLRRVLGEKLGDRLG--PHGLVIVAVHEILLES  230

Query  1096  GFVRLDP-----ILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQT  932
             GFV  D      I    +P+  +L    VS +SY+LPEI +   D +++   +V LK+Q 
Sbjct  231   GFVGFDSESGMRIDQFDLPDHLLLK--GVS-MSYTLPEILN---DSSNDVTESVALKYQI  284

Query  931   LGKFVIVYGSLS-GNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEV  755
             LG FV +YGSL+ G+S +H + L+  +F P L++ W+N   +  +       C    KEV
Sbjct  285   LGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCG---KEV  341

Query  754   FEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSD  575
             FEFW+ VKDGLALPLLI+LC+KAG  LP C+  LPTELKLK+LE LP VD+AKM C+  D
Sbjct  342   FEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRD  401

Query  574   LRYLASNDDLWKQKFEEQFNADWFRNGGS-WKQKFV  470
             +RYLASN++LW+QKF E+F       G + WK++FV
Sbjct  402   MRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFV  437



>ref|XP_006486882.1| PREDICTED: F-box protein SKIP22-like [Citrus sinensis]
Length=522

 Score =   231 bits (590),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 179/456 (39%), Positives = 254/456 (56%), Gaps = 57/456 (13%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E KET+ ++VP S TL EL           S     S  S+R SLN+KDEL 
Sbjct  1     MKLRLRSLENKETLRLEVPSSCTLHELGE-------TLSQLISSSPSSLRFSLNRKDELH  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPN--VQESSESQITTGLSPNLPAESTDSINLSQ---  1379
             +SSP E+L  LG+T+GDLIF++ +P   V ++ ES+ T  ++    +   D I   +   
Sbjct  54    ASSPPESLHSLGVTAGDLIFYSRDPYAFVSQTLESE-TQSVNKACTSRDNDEIPDGKLDK  112

Query  1378  ------KSLELSSNL-------PVESTNTSDFNSLSDKA--Pelvdqgeeeevevmeidw  1244
                   +S+E+  NL        V S +    +++ DK   P    +  E      +   
Sbjct  113   QEIPVLESVEIGVNLQESKSEEAVISQDCGIPDAMLDKQHYPVQESEKIEVSSVDSKEHM  172

Query  1243  eEKDA-----------DVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLES  1097
              +K+            D        P FLR+V  ++L D  G   H L+++AVH +LLES
Sbjct  173   SKKETLEFPNTDTMEIDEGSVVMPEPYFLRRVLGEKLGDRLG--PHGLVIVAVHEILLES  230

Query  1096  GFVRLDP-----ILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQT  932
             GFV  D      I    +P+  +L    VS +SY+LPEI +   D + +   +V LK+Q 
Sbjct  231   GFVGFDSESGMRIDQFDLPDHLLLK--GVS-MSYTLPEILN---DSSKDVTESVALKYQI  284

Query  931   LGKFVIVYGSLS-GNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEV  755
             LG FV +YGSL+ G+S +H + L+  +F P L++ W+N   +  +       C    KEV
Sbjct  285   LGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCG---KEV  341

Query  754   FEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSD  575
             FEFW+ VKDGLALPLLI+LC+KAG  LP C+  LPTELKLK+LE LP VD+AKM C+  D
Sbjct  342   FEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRD  401

Query  574   LRYLASNDDLWKQKFEEQFNADWFRNGGS-WKQKFV  470
             +RYLASN++LW+QKF E+F       G + WK++FV
Sbjct  402   MRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFV  437



>gb|KDO49537.1| hypothetical protein CISIN_1g040442mg [Citrus sinensis]
Length=522

 Score =   231 bits (590),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 179/456 (39%), Positives = 254/456 (56%), Gaps = 57/456 (13%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E KET+ ++VP S TL EL           S     S  S+R SLN+KDEL 
Sbjct  1     MKLRLRSLENKETLRLEVPSSCTLHELGE-------TLSQLISSSPSSLRFSLNRKDELH  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPN--VQESSESQITTGLSPNLPAESTDSINLSQ---  1379
             +SSP E+L  LG+T+GDLIF++ +P   V ++ ES+ T  ++    +   D I   +   
Sbjct  54    ASSPPESLHSLGVTAGDLIFYSRDPYAFVSQTLESE-TQSVNKACTSRDNDEIPDGKLDK  112

Query  1378  ------KSLELSSNL-------PVESTNTSDFNSLSDKA--Pelvdqgeeeevevmeidw  1244
                   +S+E+  NL        V S +    +++ DK   P    +  E      +   
Sbjct  113   QEIPVLESVEIGVNLQESKSEEAVISQDCGIPDAMLDKQHYPVQESEKIEVSSVDSKEHM  172

Query  1243  eEKDA-----------DVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLES  1097
              +K+            D        P FLR+V  ++L D  G   H L+++AVH +LLES
Sbjct  173   SKKETLEFLNTDTMEIDEGSVVMPEPYFLRRVLGEKLGDRLG--PHGLVIVAVHEILLES  230

Query  1096  GFVRLDP-----ILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQT  932
             GFV  D      I    +P+  +L    VS +SY+LPEI +   D + +   +V LK+Q 
Sbjct  231   GFVGFDSESGMRIDQFDLPDHLLLK--GVS-MSYTLPEILN---DSSKDVTESVALKYQI  284

Query  931   LGKFVIVYGSLS-GNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEV  755
             LG FV +YGSL+ G+S +H + L+  +F P L++ W+N   +  +       C    KEV
Sbjct  285   LGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCG---KEV  341

Query  754   FEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSD  575
             FEFW+ VKDGLALPLLI+LC+KAG  LP C+  LPTELKLK+LE LP VD+AKM C+  D
Sbjct  342   FEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRD  401

Query  574   LRYLASNDDLWKQKFEEQFNADWFRNGGS-WKQKFV  470
             +RYLASN++LW+QKF E+F       G + WK++FV
Sbjct  402   MRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFV  437



>ref|XP_006304685.1| hypothetical protein CARUB_v10011933mg [Capsella rubella]
 gb|EOA37583.1| hypothetical protein CARUB_v10011933mg [Capsella rubella]
Length=481

 Score =   230 bits (586),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 160/431 (37%), Positives = 247/431 (57%), Gaps = 45/431 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRLHETRETLKLELADTGTLHDLQRRINPTEPSS----------VHLSLNRKDELL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPN-------VQESSESQITTGLSPNLPAESTDSINL  1385
             +SSP++TL  LG+TSGDLI+++L+ +       V ESS  +     S +  A   DS+ +
Sbjct  51    ASSPEDTLRSLGVTSGDLIYYSLDQSAFTSSVQVGESSNCESGASQSESNQAAVHDSMGM  110

Query  1384  SQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVG---K  1214
                 +++   +P ++    +F  + +   E              +D E+ D ++     K
Sbjct  111   GYGEVDV---VPDQAKPNPNF--IVEDPAEGSKGENSGMEGPEPMDVEQLDMELPAAESK  165

Query  1213  SFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTE  1034
               S P FLRK+  ++  D+    +   L  +VHAV+LESGFV  D    K   ++ +LT 
Sbjct  166   RLSEPFFLRKILLEKSGDTS---ELTTLASSVHAVMLESGFVLFDSGSDKFSFSEMLLT-  221

Query  1033  PQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDH  854
                + L Y+LPE+      +++N + +V +KFQ LG +V+VYG++ G+S    + LDK  
Sbjct  222   ---ASLKYTLPELIK---SKDANTIESVTVKFQNLGPWVVVYGTVGGSSVRVHMNLDKRR  275

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             FVP +++        +E +       +S  +EVF FW +VKDGL +PLLI +C+KAG   
Sbjct  276   FVPVIDLVMDTLKSDKEGS-------SSIYREVFMFWSSVKDGLVIPLLIGICDKAGLEP  328

Query  673   PPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNG  494
             PPC MRLPTELKLKILE LP V +AKM+C+C+++RYLAS++DLWKQK  E+  +      
Sbjct  329   PPCLMRLPTELKLKILESLPGVSIAKMACVCTEMRYLASDNDLWKQKCLEEAKSFLGTEV  388

Query  493   G---SWKQKFV  470
             G   +WK +F 
Sbjct  389   GDLVNWKARFA  399



>ref|XP_008372958.1| PREDICTED: F-box protein SKIP22-like [Malus domestica]
Length=485

 Score =   229 bits (585),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 172/437 (39%), Positives = 235/437 (54%), Gaps = 56/437 (13%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR +ETKETI V+VP   +L  LK+         S     +  S+RLSLN+++EL 
Sbjct  1     MKLRLRLIETKETIRVEVPDLCSLHHLKQ-------TVSQLISAAPSSLRLSLNRRNELH  53

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             + SP + L  LGITSGDL+F+ L+P+ Q      + + L P +   S +S N ++     
Sbjct  54    APSPHDPLRSLGITSGDLVFYTLDPSSQ-----ALASPLHP-ISHSSAESPNRTEPQ---  104

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKD----ADVVG-KSFSVP  1199
              SN     T   +   L+D   E    G      ++    E  D    +D +G K +SVP
Sbjct  105   CSNFLNSETLIDEGAVLADLIAEEQRSGGSNSETLVVSGAECMDIDDPSDGLGLKKYSVP  164

Query  1198  GFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI  1019
              FL++V  +EL D     +HKLL+IAVHAVLLESGFV  D I       +   T   +S 
Sbjct  165   FFLKRVLREELGDDHS--NHKLLVIAVHAVLLESGFVGFDSISGMLADQR---TGSTIS-  218

Query  1018  LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLS-GNSSVHSVQLDKDHFVPF  842
             LSY+LPEI   +       V  V LKFQ LG FV VYGSL+ G SS + V LDK+ F P 
Sbjct  219   LSYTLPEILR-NRGNTGKEVERVVLKFQNLGHFVNVYGSLANGGSSPYQVCLDKNRFAPT  277

Query  841   LNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF  662
             +   +     ++ +  +DG         V E  + VKDG+  PLLI+LC KAG   PP  
Sbjct  278   IEFVYG----TQNVNDRDGF--------VLELSKIVKDGITFPLLIDLCAKAGLPAPPSL  325

Query  661   MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN-----------  515
             MRLP ELK+KILE L  VD+AK+ C+  +L+ L +ND+LWKQK+ E+F            
Sbjct  326   MRLPPELKMKILEPLAGVDIAKVGCVSKELQNLGNNDELWKQKYTEEFGNGSGGEGTGGE  385

Query  514   ---ADW-FRNGGSWKQK  476
                 +W FR  G+W+ +
Sbjct  386   GTVTNWKFRFVGNWETR  402



>gb|KFK44452.1| hypothetical protein AALP_AA1G258700 [Arabis alpina]
Length=454

 Score =   228 bits (582),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 162/430 (38%), Positives = 250/430 (58%), Gaps = 57/430 (13%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ ++   + TL +L+RR+S++ P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRCHETRETLKLEFADTGTLHDLRRRISVSDPSS----------VHLSLNRKDELL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQI----TTGLSPNLPAESTDSINLSQK  1376
             S S D+TL  LG+TSGDLI+++L+ +   +S+  I    ++G +    A S DS++ S  
Sbjct  51    SPSVDDTLRSLGVTSGDLIYYSLDHSAFVASDHDIGLASSSGEAHQGLAPSGDSLHDSMG  110

Query  1375  SLELSSNLP---VESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFS  1205
                + ++L     E +   D  ++                     + + + A    K  S
Sbjct  111   IGFVEADLNPDLAEGSGMEDAEAMD------------------VQEIDVEIAAAGKKRLS  152

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQV  1025
              P FL+    ++  D+    +  LL ++VHAV+LESGF+    +L+    +++  ++  +
Sbjct  153   EPLFLKNTLLEKSGDTS---ELTLLAMSVHAVMLESGFL----LLNSGSDDKFSFSKELL  205

Query  1024  SI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNS-SVHSVQLDKDHF  851
             S+ L Y+L E+ +    + S+ V +V ++FQ+LG+ V+VYGSLSG+S SV  V LDK  F
Sbjct  206   SVSLKYTLLELVN---PKGSSTVESVTVQFQSLGRVVVVYGSLSGSSQSVPWVYLDKHRF  262

Query  850   VPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLP  671
             VP +++        +E +       +   +EVF FWR VKDGLA+PLLI LC+KAG   P
Sbjct  263   VPVIDLVMDTLKFEKEGS-------SVFYREVFMFWRMVKDGLAIPLLIRLCDKAGLEPP  315

Query  670   PCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKF-EEQFNADWFRNG  494
             PC M +PTELK+KILE LP V +AKM+C+C+++RYLAS++DLWKQK+ +E  N      G
Sbjct  316   PCLMVIPTELKMKILESLPGVSVAKMACVCTEMRYLASDNDLWKQKYLKESKNLFGMEAG  375

Query  493   GS--WKQKFV  470
              S  WK+KF 
Sbjct  376   ESVNWKEKFA  385



>ref|XP_010477680.1| PREDICTED: F-box protein SKIP22-like [Camelina sativa]
Length=484

 Score =   227 bits (579),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 170/432 (39%), Positives = 247/432 (57%), Gaps = 44/432 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L RR++   P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRLHETRETLKLELADTGTLNDLLRRINPTAPSS----------VHLSLNRKDELL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLSQ  1379
             +SSP++TL  LG+TSGDLI ++L+      +V+ +  S +  G   N  A   DS+ +  
Sbjct  51    ASSPEDTLRSLGVTSGDLIHYSLDQSAFIASVEVAESSNLELGSESNQAATVHDSMGIGF  110

Query  1378  KSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVG---KSF  1208
                E+   +P +    +  +++ D A       E  E   +E   + +D ++     K  
Sbjct  111   A--EVDDVVP-DQAKPNPTSTVEDPAEGSKTGIESPEPMDVEELDDMEDMELAAAESKRL  167

Query  1207  SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQ  1028
             S P FLR +  ++  D+    +   L  +VHAV+LESGFV  D    K   ++ +LT   
Sbjct  168   SEPFFLRNILLEKSGDTS---ELTTLASSVHAVMLESGFVLFDSGSDKFSFSEKLLT---  221

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSS--VHSVQLDKDH  854
             VS L Y+LPEI      +++  + +V LKFQ LG +V+VYG++ G+SS  VH + LDK  
Sbjct  222   VS-LKYTLPEII---KSKDTKTIESVTLKFQNLGSWVVVYGTVGGSSSGGVH-MNLDKRR  276

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             FVP +++        +E + +         +EVF FWR VKDGL +PLLI LC+KAG   
Sbjct  277   FVPVIDMVMDTLKSDKEGSSR-------IYREVFMFWRMVKDGLVIPLLIGLCDKAGLEP  329

Query  673   PPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FEEQFNADWFRN  497
             PPC MRLPT+LKLKILELLP V +AKM CLC+++RYLAS++DLWKQK  EE  N      
Sbjct  330   PPCLMRLPTDLKLKILELLPGVSIAKMCCLCTEMRYLASDNDLWKQKCLEEAKNVVGTGE  389

Query  496   GG--SWKQKFVA  467
             G   +WK +F  
Sbjct  390   GDLVNWKARFAG  401



>ref|XP_010908979.1| PREDICTED: F-box protein SKIP22-like [Elaeis guineensis]
Length=494

 Score =   221 bits (564),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 168/439 (38%), Positives = 235/439 (54%), Gaps = 52/439 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+RS  TKET+ V+ P + +L +LK     +L A+        DSIRLSLN+ DEL 
Sbjct  1     MKLRVRSTATKETLRVEAPDAYSLHDLK-----SLIAAKLSPSVPPDSIRLSLNRTDELL  55

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQK----  1376
             S SP ++L  LG+TSGDL+F +L P  Q      +T   +P  P ES DS   SQK    
Sbjct  56    SPSPGDSLSSLGLTSGDLLFLSLAPGPQ-----TLTPDPAPIPPTESPDSDAPSQKDAIL  110

Query  1375  --SLELSSNLPVES-------TNTSDFNSLSDKAPe--lvdqgeeeevevmeidweEKDA  1229
               +  L SN P E        T +S  +++S  +         E       +    E+++
Sbjct  111   KTAATLDSNRPREIVAENPNFTVSSVQHAVSGPSLTLDSNRPQEMAAEYAEDHMEVEEES  170

Query  1228  DVVGKSFSVPGFLRKVFTKELSDSDG--GRDHKLLLIAVHAVLLESGFVRLDPILHK-KV  1058
              V  KS SVPGFL++V  +E  +     GR    L+I VHAV LESGF+  D   H  ++
Sbjct  171   PVAKKSVSVPGFLKRVMEEEKGEVKCILGR----LVIVVHAVFLESGFLVYDG--HGFRL  224

Query  1057  PNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNS-SV  881
             P  W  +      + Y+LP +     D+    V    LKF  +G +V VYG +SG+   V
Sbjct  225   PEGWASSATSAVSVQYTLPGLVGLGNDEKD--VKIAILKFAVMGNYVTVYGYVSGDRPDV  282

Query  880   HSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
             + V  D     P LN+   +    EE             KE+F+ W+ VKDGL+L LLI+
Sbjct  283   YRVCFDGSKLEPLLNLDMDSMDPKEE-------------KEIFQHWKAVKDGLSLHLLID  329

Query  700   LCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQ  521
             +C+K G  LP CFM LP +LK+K+L L+P VD+AK++  CS+LRYL+S+D+LWK KF E+
Sbjct  330   ICQKNGLPLPACFMLLPVDLKIKVLGLIPGVDIAKVASTCSELRYLSSDDELWKHKFVEE  389

Query  520   FNADWFRN--GGSWKQKFV  470
             F     R   G SWK+K+ 
Sbjct  390   FGLLDERQVAGRSWKEKYA  408



>ref|XP_007143141.1| hypothetical protein PHAVU_007G047200g [Phaseolus vulgaris]
 gb|ESW15135.1| hypothetical protein PHAVU_007G047200g [Phaseolus vulgaris]
Length=498

 Score =   220 bits (561),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 168/429 (39%), Positives = 237/429 (55%), Gaps = 45/429 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+KET+ ++VP S +L +L       +   S     SS S+ LSLN+KDE+R
Sbjct  40    MKLRLRSLESKETLKIEVPNSCSLQQL-------IDTVSHTISSSSSSLHLSLNRKDEIR  92

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             +SSP+++L  LG+ +GDLIF++LNP       +  +    P+ P  ++      Q S E+
Sbjct  93    ASSPNDSLHSLGVAAGDLIFYSLNP-------TAFSLETLPHKPETASRDRPTVQNSPEM  145

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRK  1184
                     T  S      +K P L     E    V        D  V   + S P F++ 
Sbjct  146   L-------TGDSPSTPAVEKCPTLDPAEVETIEMVDG-----SDEAVAVSTNSEPFFVKS  193

Query  1183  VFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI-----  1019
             V  + L ++    D KLL+  VH V+LESGFVR+D      V    +L +   +      
Sbjct  194   VLKEALGNNVS--DFKLLVFTVHGVVLESGFVRIDKDSGMAVSCFHLLDDSPSASSSMIS  251

Query  1018  LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SSVHSVQLDKDHFVP  845
             L Y+LPEI        + A  +V L+FQTLG FV V GSLS +  S +H V LD+  +V 
Sbjct  252   LRYALPEIL------VNGASHSVNLRFQTLGHFVNVCGSLSDDTGSRLHYVCLDRRKYVR  305

Query  844   FLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPC  665
              L +  +N      +   + ++  +   EVFE W+ VKD LALPLLI+LCEKAG  LPPC
Sbjct  306   PLELMLANSESKGSVNDGEEIIFGN---EVFEMWKLVKDRLALPLLIDLCEKAGLELPPC  362

Query  664   FMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGGSW  485
             FMRLP E+KL ILE LP VDLAK++C CS+LRYL+++++LWK+K+ E+F     R G  +
Sbjct  363   FMRLPMEIKLLILERLPGVDLAKVACTCSELRYLSTSNELWKKKYLEEFGQGETR-GWLF  421

Query  484   KQKFVAAME  458
             K  F  + E
Sbjct  422   KDLFAVSWE  430



>ref|XP_006857066.1| hypothetical protein AMTR_s00065p00071220 [Amborella trichopoda]
 gb|ERN18533.1| hypothetical protein AMTR_s00065p00071220 [Amborella trichopoda]
Length=518

 Score =   218 bits (556),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 171/458 (37%), Positives = 248/458 (54%), Gaps = 55/458 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPP-STTLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLRLRS+E+KETI ++ PP   +L  LK        A +     S  S+ LSLNKKDEL
Sbjct  1     MKLRLRSLESKETIKIETPPFPCSLQALK-------TAIAESLGTSPASLHLSLNKKDEL  53

Query  1546  RSSSPDETLEMLGITSGDLIFFALNP----NVQESSESQITTGLSPNLPAESTDSINLSQ  1379
                 P+  ++  G+TSGDLIF+ LNP       E+S +  +   S  + A       +  
Sbjct  54    -DGPPNALIDSYGVTSGDLIFYTLNPVGFSQSMENSAAYSSFCSSSLVDAHIQVGTPICD  112

Query  1378  KSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDA------DVVG  1217
             K + ++ N    S   SD + + ++ P  +       V   E      DA       V+G
Sbjct  113   KDIVVAGNPSFISEPNSDKDFIVEEEPISLSNSNSTFVNSDEEKPGFDDAMAVDDETVLG  172

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKV-----PN  1052
             KS SVP FLR+V ++   D      H LL++AVHAV+LE+GFV LDP  ++++     P 
Sbjct  173   KSLSVPCFLRRVLSE--MDHKALDGHGLLILAVHAVMLETGFVGLDPQTNRQIDGCSIPE  230

Query  1051  QWILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL-SGNSSVH  878
              W     ++S+ L Y++PE+ +      ++ V +V LKF  LGKFV++YGSL +G+S ++
Sbjct  231   GW---ASRISVSLRYTVPELLN-----RTDGVESVVLKFHILGKFVLLYGSLCNGSSDIY  282

Query  877   SVQLDKDHFVP--------------FLNVAWSNCG-LSEEIAGKDGLLCTSPEKEVFEFW  743
              + L    F+P              F       C  LS E  G  G L +S E+EVF+ W
Sbjct  283   RLSLYVTQFLPAIFALSKSGSKGSSFEETGELGCSKLSHEREGL-GSLKSSYEREVFQLW  341

Query  742   RTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYL  563
             + VKD L+LPLL  LCEK G   PPC + +PTELKLK+LE L   D++K+ C+CS+LRY+
Sbjct  342   KIVKDQLSLPLLTALCEKTGLPPPPCLLCIPTELKLKVLEFLSPPDISKLGCVCSELRYV  401

Query  562   ASNDDLWKQKFEEQFNA---DWFRNGGSWKQKFVAAME  458
             +SNDD+WK KF E+F     +      SWK++++   E
Sbjct  402   SSNDDIWKAKFVEEFGPLKNERALTERSWKERYLVCFE  439



>ref|XP_010065288.1| PREDICTED: F-box protein SKIP22-like isoform X1 [Eucalyptus grandis]
Length=356

 Score =   209 bits (531),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 158/249 (63%), Gaps = 17/249 (7%)
 Frame = -3

Query  1234  DADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK---  1064
             D+  V   FS P FLR+V  +EL   DGG DH+LL+IAV AVLLE GFV +DP+      
Sbjct  59    DSTGVRSKFSEPYFLRRVLREELG-GDGG-DHRLLVIAVQAVLLEPGFVAVDPVTGMPAD  116

Query  1063  --KVPNQWILTEPQVSI---LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL  899
                + +QW    P  +    L YSLPE+      Q  N   ++ LKF++LG F+ VYG L
Sbjct  117   RFHLSDQW----PSAAFTMTLQYSLPELVA--RTQGLNVTESLVLKFESLGHFISVYGRL  170

Query  898   SGNSSVH-SVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGL  722
             +   SV   V L++  F P ++V W     + E+    G L  S EK+VFEFW+ VKDGL
Sbjct  171   AKAKSVLIRVCLNERRFAPIIDVMWVKGDDNVEVNEDGGSLNLSSEKQVFEFWKIVKDGL  230

Query  721   ALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLW  542
             ALPLLI+L E+ G  LP CF  LPTELKL+I ELLP +DLA++ C+ S+LRYLAS++DLW
Sbjct  231   ALPLLIDLTERVGLPLPSCFTCLPTELKLRIFELLPGIDLARVGCVSSELRYLASDNDLW  290

Query  541   KQKFEEQFN  515
             KQK++E+F 
Sbjct  291   KQKYDEEFG  299



>ref|XP_009412285.1| PREDICTED: F-box protein SKIP22-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   211 bits (538),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 166/447 (37%), Positives = 242/447 (54%), Gaps = 50/447 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+RSV +KET+ +  P  ++L +LK  L     +SS+       SIRLSLN+KDEL 
Sbjct  1     MKLRIRSVASKETLRIQAPDPSSLHDLKT-LIALALSSSSSISIPPGSIRLSLNRKDELL  59

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQE----------SSESQITTGLSPNLPAESTDS  1394
              SSP ++L  LG+T+GDLIFF++ P+ Q             E+  ++ L+P  P E+  +
Sbjct  60    PSSPQDSLHSLGLTAGDLIFFSIVPDSQTLAPSPSSAPAPEETVESSNLAPVPPPETPSA  119

Query  1393  IN-----LSQKSLELSSNLP------VESTNTSDFNSLSDKAPelvdqgeeeevevmeid  1247
             ++     LS ++L  SS+         ES+N S  ++ ++ +    D    +   V + D
Sbjct  120   VDDTPFGLSAQTLNFSSSSVAASVEIAESSNLSPVSTQNNPSAIASDLTSPQAEVVQQDD  179

Query  1246  weEKDAD--VVGKSFSVPGFLRKVFTKELSDSDG--GRDHKLLLIAVHAVLLESGFVRLD  1079
                 D +  VVGKS +VP FL++V   E  +++G  GR    L+I  HA  LESGFV   
Sbjct  180   VMALDVEPVVVGKSLAVPCFLKRVIEAEKGEAEGLLGR----LVITFHAAFLESGFVVSG  235

Query  1078  PILHKKVPNQWILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGS  902
                 +             +  + Y+LPE+  G  D    AV    L+F  +G +  VYG 
Sbjct  236   GGGGRGSRFPGGCPSKAATFSVRYTLPELV-GAVD--GRAVKVAILRFSMMGNYATVYGF  292

Query  901   LSGNSS-VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDG  725
             L+G+   V+ V +D     P L+++  +    EE             KEVF  W+ VKDG
Sbjct  293   LNGDHQDVYRVCIDLSKLAPLLSLSMDSLSKQEE-------------KEVFGLWKVVKDG  339

Query  724   LALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDL  545
             L LPLLI++C K G   P CFMRLPT+LK+KILE +  +D+AK+ C CS+LRYL+SNDDL
Sbjct  340   LTLPLLIDICRKNGLPSPTCFMRLPTDLKIKILEFVSGIDVAKIGCTCSELRYLSSNDDL  399

Query  544   WKQKFEEQFNA--DWFRNGGSWKQKFV  470
             WK +F E+F +  +    G SWK K+V
Sbjct  400   WKLRFLEEFGSVNERVLVGRSWKDKYV  426



>ref|XP_008793611.1| PREDICTED: F-box protein SKIP22-like [Phoenix dactylifera]
Length=494

 Score =   209 bits (531),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 165/438 (38%), Positives = 236/438 (54%), Gaps = 50/438 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+RS  TKET+ V+ P +++L +LK      L AS      S DSIRLSLN+ DEL 
Sbjct  1     MKLRVRSTATKETLRVEAPDASSLHDLK-----TLIASKLSPSISPDSIRLSLNRTDELF  55

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             + SP ++L  LG+T+GDL+FF+L P+ Q      I+   +P  P E+ DS   SQK   L
Sbjct  56    APSPGDSLPSLGLTAGDLLFFSLAPDSQ-----TISPTPAPIPPPENPDSDAPSQKDAIL  110

Query  1363  SSNLPVESTN---------TSDFNSLSD--KAPelvdqgeeeevevmei----dweEKDA  1229
              ++  ++S            S   S+ D    P L       +    E        E+++
Sbjct  111   DTSATLDSNRHEEIVAENPNSTVPSVQDALSGPTLTLDSNRTQEMAAEYPEDRMEVEEES  170

Query  1228  DVVGKSFSVPGFLRKVFTKELSDSDG--GRDHKLLLIAVHAVLLESGFVRLDPILHKKVP  1055
              V  KS SVP FL++V  +E  + +G  GR    L+I VHAV LESGF+  D     ++P
Sbjct  171   PVAKKSVSVPVFLKRVKEEEKGEVEGILGR----LVIVVHAVFLESGFLVYDGN-GSRLP  225

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNS-SVH  878
               W         + Y+LP +     D     V    LKF  +G +V VYG +SG+   V+
Sbjct  226   EGWASAATTAVSIQYTLPGLVGLGND--GKQVKIAILKFAVMGNYVTVYGYVSGDHPDVY  283

Query  877   SVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIEL  698
              V  D        ++   + G +EE             KE+F+ W+ VKDGL+L LLI++
Sbjct  284   RVCFDGSKLEHLFSLDMDSMGQTEE-------------KEIFQLWKAVKDGLSLHLLIDI  330

Query  697   CEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF  518
             C+K G  LP CFM LP +LK+K+LEL+P +D+AK++C CS+LRYL+S+D+LWK KF E+F
Sbjct  331   CQKNGLPLPACFMLLPVDLKIKVLELIPGIDVAKVACTCSELRYLSSDDELWKHKFVEEF  390

Query  517   NADWFRN--GGSWKQKFV  470
                  R   G SWK+K+ 
Sbjct  391   GLLDERQVAGRSWKEKYA  408



>ref|XP_010555093.1| PREDICTED: F-box protein SKIP22-like [Tarenaya hassleriana]
Length=496

 Score =   207 bits (528),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 151/408 (37%), Positives = 216/408 (53%), Gaps = 53/408 (13%)
 Frame = -3

Query  1579  IRLSLNKKDELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGL---------  1427
             +R+SLN+KDE  + S D T+  LG+TS DLI++ L P+   +S   IT+           
Sbjct  29    VRISLNRKDEFVAPSED-TIRSLGLTSSDLIYYFLEPSAFNASSLGITSSSEAQQNPVCD  87

Query  1426  ----SPNLPAEST-----------DSINLSQKSLELSS-------NLPVESTNTSDFNSL  1313
                 S NL  + T           +S +    S+EL         N+ V+    SD N  
Sbjct  88    LEDSSENLGDQKTLVQEFETVREIESNSTGNGSVELGGVPENHHLNMDVQKQTKSDLNFG  147

Query  1312  SDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKL  1133
              ++   +      E ++V        DA    K  S P FL+KV  +E +D+    +  +
Sbjct  148   GEEPIAVSGMEGPEPMDVEFYRVGYADA----KRLSEPFFLKKVVLEECTDTS---ESMI  200

Query  1132  LLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI-LSYSLPEIADGDTDQNSNAVP  956
             +++AVHAV+LESGF+ LDP    +        E   SI L Y+LPE+    T  + N   
Sbjct  201   MVMAVHAVMLESGFLLLDPESGVRAEKFSFSKETANSISLIYTLPELI---TRSDPNKNE  257

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLC  776
             TV LKFQ++G  ++VYGSL G SS H V LD+   VP +++       ++E + +     
Sbjct  258   TVSLKFQSIGPMLVVYGSLGGTSS-HRVYLDRRRLVPTIDLVMETLKSNKEGSSR-----  311

Query  775   TSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAK  596
                  EVFEFWR VKDG+A+PLLI LC+ AG  LPPC MRLPTELK KILE L   D+A+
Sbjct  312   --IYSEVFEFWRMVKDGVAMPLLIGLCDMAGLELPPCLMRLPTELKFKILESLHGADIAR  369

Query  595   MSCLCSDLRYLASNDDLWKQKFEEQFNADWFRN--GGSWKQKFVAAME  458
             ++C+CS++R++A +++LWKQK  E+      R     SWK KF A  E
Sbjct  370   VACVCSEMRFVAKDNNLWKQKCLEECGDLVNREEYAVSWKAKFAAFWE  417



>gb|KDP44550.1| hypothetical protein JCGZ_16383 [Jatropha curcas]
Length=335

 Score =   203 bits (516),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/260 (43%), Positives = 165/260 (63%), Gaps = 16/260 (6%)
 Frame = -3

Query  1219  GKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWIL  1040
             GK    P FL+ V  +EL +     D+KLL +A+HA+ +E GFV +D +   +V + +  
Sbjct  62    GKRIFEPYFLQSVLREELGEI--VTDNKLLFVAIHAIFVEFGFVGIDSVSGLRV-DLFRF  118

Query  1039  TEPQVSI-----LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLS-GNSSVH  878
              E Q S+     ++Y++PE+       N N   +V L FQTLG FVIVYGSL+ G S VH
Sbjct  119   LEEQSSMSFTTSVNYTVPELL-----ANDNVTESVVLNFQTLGGFVIVYGSLTKGQSLVH  173

Query  877   SVQLDKDHFVPFLNVAWSNCGLSEEI-AGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
              ++L+K  FVP +++ W N   S+ +    D  + ++PE E+F  W+ V+D LA PLLI+
Sbjct  174   KLRLNKCRFVPSISLIWVNSLKSDNVNESYDSFIMSNPETEIFNLWKLVRDELAYPLLID  233

Query  700   LCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQ  521
             LCEKA   LPPC MRLP +LKLKILE L  V +A+M+C+C ++  L+SN+DLWKQK+ E+
Sbjct  234   LCEKAVLDLPPCLMRLPADLKLKILESLSGVGIARMACMCKEMSCLSSNNDLWKQKYAEE  293

Query  520   FNADWFRNG-GSWKQKFVAA  464
             F  +    G  +WK+KFV++
Sbjct  294   FGTEPEMQGLVNWKEKFVSS  313



>ref|XP_010498884.1| PREDICTED: F-box protein SKIP22-like [Camelina sativa]
Length=467

 Score =   206 bits (525),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 171/432 (40%), Positives = 246/432 (57%), Gaps = 52/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRLHETRETLKLELADTGTLHDLRRRINPTAPSS----------VHLSLNRKDELL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALN-----PNVQESSES-QITTGLSPNLPAESTDSINLS  1382
             +SSP++TL  LG+TSGDLI+++++      +V+E  ES  + +G   N  A   DS+ + 
Sbjct  51    ASSPEDTLRSLGVTSGDLIYYSIDQSAFVASVEEVGESSNLESGSESNQAAAVHDSMGIG  110

Query  1381  ----QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGK  1214
                 Q  ++ + N  VE         +    P  V+Q ++ E+           A    K
Sbjct  111   FAEVQDQIKPNPNSTVEDPAEGSKTGIESPEPMDVEQLDDMEL-----------AAAESK  159

Query  1213  SFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTE  1034
               S P FLR +  ++  D+    +   L  +VHAV+LESGFV  D    K   ++ +LT 
Sbjct  160   RLSEPFFLRNILLEKSGDTS---ELTTLASSVHAVMLESGFVLFDSGSDKFSFSEKLLT-  215

Query  1033  PQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV-QLDKD  857
               VS L Y+LPEI      +++N + +V LKFQ LG +V+VYG++ G+SS      LDK 
Sbjct  216   --VS-LKYTLPEII---KSKDANTIESVTLKFQNLGHWVVVYGTVGGSSSGGVHVNLDKR  269

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              FVP +++        +E + +         ++VF FWR VKDGL +PLLI +C+KAG  
Sbjct  270   RFVPVIDMVMDTLKSDKEGSSR-------IYRQVFMFWRMVKDGLVIPLLIGICDKAGLE  322

Query  676   LPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FEEQFNADWFR  500
              PPC MRLPTELKLKILELLP V LAKM CLC+++RYLAS++DLWKQK  EE  N     
Sbjct  323   PPPCLMRLPTELKLKILELLPGVSLAKMGCLCTEMRYLASDNDLWKQKCLEEAKNVVGTG  382

Query  499   NGG--SWKQKFV  470
              G   +WK +F 
Sbjct  383   EGDLVNWKVRFA  394



>ref|XP_010026929.1| PREDICTED: F-box protein SKIP22-like [Eucalyptus grandis]
Length=437

 Score =   203 bits (516),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 157/438 (36%), Positives = 220/438 (50%), Gaps = 77/438 (18%)
 Frame = -3

Query  1720  KLRLRSVET--KETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             KLRLR +E+  K+T+ +DVP   +LP+L+R     L    +       S RLSLN+ DEL
Sbjct  10    KLRLRPLESNSKDTLKLDVPDPCSLPQLRR----ILAGRLSPPPPPGSSFRLSLNRTDEL  65

Query  1546  RSS---------SPDETLEMLGITSGDLIFFALNPNVQESSESQITT-GLSPNLPAESTD  1397
             +S           P  +L+ LG+ SGDL++++L P        ++      P +P +++ 
Sbjct  66    QSPCTRTSYLTPDPARSLQSLGLASGDLLYYSLIPGPPGGPPGEVADLERVPLVPEDASR  125

Query  1396  SINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVG  1217
             S        + S+++ V + + S                                A V  
Sbjct  126   SAG------DPSNSVSVLAADGS--------------------------------AGVRS  147

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPIL-----HKKVPN  1052
             K  S P FLRKV  KE    DGG DH+LL+IAVHAVLLESGFV ++P         ++P+
Sbjct  148   K-LSEPFFLRKVL-KEGLGGDGG-DHRLLVIAVHAVLLESGFVAVNPATGMPADRLRLPD  204

Query  1051  QWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV  872
             QW    P    L YSLPEI D    Q+ N   +V LKF ++G       S++  S  H V
Sbjct  205   QW----PFTMSLQYSLPEIVD--RTQSPNVPESVALKFHSIGD------SMTVKSDSHVV  252

Query  871   QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCE  692
              LDK  F P ++  W     + E+    G   +S EKEVF+FW+ VKD  A  LLI+L +
Sbjct  253   HLDKRRFAPIIDAMWPKGDANVEVNEDGGSSNSSTEKEVFKFWKIVKDDFARLLLIDLID  312

Query  691   KAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNA  512
             +A     PCF  LPT++KL I ELL  +DLAK++C+C +LR L S   LWKQK+ E+F  
Sbjct  313   RARL---PCFTSLPTDMKLSIFELLSGIDLAKVACVCRELRRLTSTKYLWKQKYVEEFGE  369

Query  511   DWFRNGGSWKQKFVAAME  458
                     WKQ F+   E
Sbjct  370   RIESGEIDWKQNFIQEKE  387



>ref|XP_010460152.1| PREDICTED: F-box protein SKIP22-like [Camelina sativa]
 ref|XP_010460153.1| PREDICTED: F-box protein SKIP22-like [Camelina sativa]
Length=478

 Score =   201 bits (511),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 165/427 (39%), Positives = 242/427 (57%), Gaps = 39/427 (9%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRLHETRETLKLELADTGTLHDLRRRINPTAPSS----------VHLSLNRKDELL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNV-----QESSESQITTGLSPNLPAESTDSINLSQ  1379
             +SSP++TL  LG+TSGDLI+++L+ +      Q    S +  G   N  A   DS+ +  
Sbjct  51    ASSPEDTLRSLGVTSGDLIYYSLDQSAFVTSDQVGESSNLELGSKSNPVAAVQDSMGIGF  110

Query  1378  KSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVP  1199
               +    N+  +    +  +++ D A       E  E   +E   + + A    K  S P
Sbjct  111   AEV---VNVVPDQAKLNPNSTVEDPAEGSKTGMEGPEPMDVEELDDMELAAAESKRLSEP  167

Query  1198  GFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI  1019
              FLR +  ++  D+    +   L  +VHAV+LESGFV  D    K   ++ +LT   VS 
Sbjct  168   FFLRNILLEKSGDTS---ELTTLASSVHAVMLESGFVLFDSGSDKFSFSEKLLT---VS-  220

Query  1018  LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV-QLDKDHFVPF  842
             L Y+LPE+      +++N + +V +KFQ LG +V+VYG++ G+SS      LDK  FVP 
Sbjct  221   LKYTLPELI---KSKDTNTIESVTVKFQNLGHWVVVYGTVGGSSSGGVHVNLDKRRFVPI  277

Query  841   LNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF  662
             +++        +E +       ++  ++VF FWR VKD L +PLLI LC+KAG   PPC 
Sbjct  278   IDMVMDTLKSDKEGS-------STIYRQVFMFWRMVKDSLVMPLLIGLCDKAGLEPPPCL  330

Query  661   MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FEEQFNADWFRNGG--  491
             MRLPTELKLKILELLP V +AKM CLC+++RYLAS++DLWKQK  EE  N      G   
Sbjct  331   MRLPTELKLKILELLPGVSVAKMGCLCTEMRYLASDNDLWKQKCLEEAKNVVGTGEGDLV  390

Query  490   SWKQKFV  470
             +WK +F 
Sbjct  391   NWKARFA  397



>gb|KDP44549.1| hypothetical protein JCGZ_16382 [Jatropha curcas]
Length=547

 Score =   201 bits (512),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/268 (43%), Positives = 165/268 (62%), Gaps = 16/268 (6%)
 Frame = -3

Query  1237  KDADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKV  1058
             + ++  GK    P FL+ V  +EL ++    D+KLL +A+HA+ LE GFV +D +   +V
Sbjct  213   ESSNANGKRIFEPYFLKSVLREELGEN--VTDNKLLFVAIHAIFLEFGFVGIDSVSGLRV  270

Query  1057  PNQWILTEPQVSI-----LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLS-  896
              + +   E Q S+     ++Y++PE+       N N   +V L FQTLG FV VYGSL+ 
Sbjct  271   -DLFHFLEEQSSMSFTTSVNYTVPELL-----ANDNVTESVVLSFQTLGGFVNVYGSLTQ  324

Query  895   GNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEI-AGKDGLLCTSPEKEVFEFWRTVKDGLA  719
             G S VH + L+K  FVP +++ W N   S+ +    D ++  +PE E+F  W+  +D LA
Sbjct  325   GQSLVHKLCLNKYRFVPSISLIWVNSLKSDNLNESYDSIIMANPETEIFNLWKLGRDELA  384

Query  718   LPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWK  539
              PLLI+LCEK G  LPPC MRLP +LKLKILE LP V  A+M+C+  ++ YLASN+DLWK
Sbjct  385   YPLLIDLCEKTGLDLPPCLMRLPADLKLKILESLPGVGSARMACMWKEMSYLASNNDLWK  444

Query  538   QKFEEQFNADWFRNG-GSWKQKFVAAME  458
             QK+ E+F       G  +WK KFV++ E
Sbjct  445   QKYAEEFGTKPEMQGLINWKAKFVSSWE  472


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 58/86 (67%), Gaps = 6/86 (7%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+++KET+ ++VP   TL +L+         S A S   S S   SLN+KDEL 
Sbjct  1     MKLRLRSLQSKETVKLEVPNECTLQQLRE------TLSLALSFPCSSSFHFSLNRKDELV  54

Query  1543  SSSPDETLEMLGITSGDLIFFALNPN  1466
             SSS  ++L  LGIT+GDLI+F+L+P+
Sbjct  55    SSSLQDSLISLGITAGDLIYFSLSPD  80



>ref|XP_002522107.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40307.1| conserved hypothetical protein [Ricinus communis]
Length=356

 Score =   195 bits (495),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 115/259 (44%), Positives = 158/259 (61%), Gaps = 17/259 (7%)
 Frame = -3

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILT  1037
             K  S P FL++    E    D   D KLL +A+HAVLLESGFV  D +   +V    IL 
Sbjct  14    KRISEPYFLKRALRGEEFGDDFSID-KLLFVAIHAVLLESGFVGFDSVSGLRVDLFHILQ  72

Query  1036  EPQ-----VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSS-VHS  875
             E Q      + +SY+LPE+ D     N N + +V LKF+TLG FVIVYGS+ G  S VH 
Sbjct  73    EQQPLKSFTTSVSYTLPELLD-----NDNVIDSVALKFRTLGHFVIVYGSMVGGKSLVHK  127

Query  874   VQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELC  695
             ++LDK  FVP +   W+    ++ +   D    +  E  V E WR VKD LA PLLI+LC
Sbjct  128   LRLDKCEFVPAIGSIWAPWDENDPMYEND----SYTENLVSELWRIVKDQLAFPLLIDLC  183

Query  694   EKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
              K G  LPPCFM LP ELK KILE L  +D+A+M+C+C D+R+L+S+++LW++K  E+F 
Sbjct  184   VKTGLLLPPCFMSLPPELKFKILESLHGLDIARMACVCKDMRHLSSDNNLWRKKVGEEFG  243

Query  514   -ADWFRNGGSWKQKFVAAM  461
              A   R   +WK++F +++
Sbjct  244   AASGVRRITNWKKQFASSL  262



>gb|KCW60650.1| hypothetical protein EUGRSUZ_H03378 [Eucalyptus grandis]
Length=377

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 145/248 (58%), Gaps = 15/248 (6%)
 Frame = -3

Query  1210  FSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTE  1034
              S P FLRKV  + L   DGG DH+LL+IAVHAV+LESGFV ++P   K  +P QW    
Sbjct  125   LSEPSFLRKVLKEGLG-GDGG-DHRLLVIAVHAVMLESGFVVVNPATGKLDLPGQW----  178

Query  1033  PQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDH  854
             P    L YSLPE+ D    Q+ N   +V LKF  +   + V       S   +V LDK  
Sbjct  179   PFTMSLQYSLPELVD--RVQSPNVAESVALKFHCIDNSITV------ESDSRAVHLDKRR  230

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             F P ++  W   G + E+    G   +S EKEVFEFW+ VK   A PLLIEL ++AG  L
Sbjct  231   FAPIIDAMWPKGGDNVEVNEDGGFSNSSTEKEVFEFWKIVKGDFARPLLIELTDRAGLPL  290

Query  673   PPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNG  494
             PPCF  LPT+LKL I ELL  +DLA+++C+  +L+ L S ++LWKQK+ E+F        
Sbjct  291   PPCFTSLPTDLKLSIFELLSGIDLARVACVSPELQRLTSTNELWKQKYVEEFGERIESGE  350

Query  493   GSWKQKFV  470
               WKQKF 
Sbjct  351   IDWKQKFT  358


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 4/82 (5%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+++ I +DVP + +LP+L+R     L    +       S RLSLN+ DEL+
Sbjct  1     MKLRLRSLESRDGIKLDVPDACSLPQLRR----ILAGRLSPPPPPGSSFRLSLNRTDELQ  56

Query  1543  SSSPDETLEMLGITSGDLIFFA  1478
             S  P ++L  LG+ SGDL++++
Sbjct  57    SPDPTDSLRSLGLVSGDLVYYS  78



>gb|KEH28962.1| F-box SKIP22-like protein [Medicago truncatula]
Length=271

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/236 (49%), Positives = 145/236 (61%), Gaps = 21/236 (9%)
 Frame = -3

Query  1207  SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQ  1028
             S P F+++V  + L D     D KLL+ AVHA +LESGF+R+D +   K+ +  ++ +  
Sbjct  3     STPDFVKRVLREALGDDVS--DFKLLVFAVHAFILESGFIRVDRVSGVKISSSHLIDDMS  60

Query  1027  VS---ILSYSLPEIADGDTDQNSNAVP-TVELKFQTLGKFVIVYGSLSGN--SSVHSVQL  866
              S    L Y+LPEI        +N  P ++ LK QTLG FV VYGSL  +  S+VH V L
Sbjct  61    SSSMICLRYTLPEIL-------TNGSPHSLNLKIQTLGHFVNVYGSLYDDVGSNVHRVYL  113

Query  865   DKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKA  686
             DK  F   L    SN    E IA  +       E EVFE W+ V D LALPLL++LC+KA
Sbjct  114   DKYRFSKPLKFMLSNF---ESIASFN---VNDDENEVFELWKIVNDRLALPLLMDLCDKA  167

Query  685   GFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF  518
             G  LPPCFM LP ELKL I E LP  DLAK+ C CS L+YLASND+LWK+KFEE+F
Sbjct  168   GLNLPPCFMSLPMELKLLIFEYLPGDDLAKVCCTCSKLQYLASNDELWKKKFEEEF  223



>gb|EYU37548.1| hypothetical protein MIMGU_mgv1a026068mg, partial [Erythranthe 
guttata]
Length=320

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 157/260 (60%), Gaps = 21/260 (8%)
 Frame = -3

Query  1225  VVGKSFSVPGFLRKVFTKELSDSDGGRD-HKLLLIAVHAVLLESGFVRLDPILHKKVPNQ  1049
             VVG SFSVP FLR+VFT+EL  + GGR  H LL++AVHAV+L+SGF+  D    K V   
Sbjct  17    VVGNSFSVPKFLREVFTEELGQASGGRRRHWLLVLAVHAVMLDSGFLEFDKKSKKVVRGF  76

Query  1048  WILTEPQV-SILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSS---V  881
                +   + S LS     +  G   +N      V LKFQ LGKF+ VYG+L   SS    
Sbjct  77    GFHSRGDLPSDLSLFYTPVPRGAFAENV----IVVLKFQPLGKFMTVYGALDNGSSKRST  132

Query  880   HSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
             +SVQL++D  VPFL   W++C    E+ G  GL  TSPEKEV +FW  VKD L  PLLI+
Sbjct  133   YSVQLNEDRLVPFLKFVWADC----ELDG--GLSNTSPEKEVSKFWIDVKDKLVSPLLID  186

Query  700   LCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQ  521
               +K+G    PCF  LP +LKL ILE L  VDLA++SC+ S+LR LAS D+LWK K+ E 
Sbjct  187   SYKKSGLEYLPCFTSLPADLKLNILECLSGVDLARVSCVSSELRSLASTDELWKSKYVEA  246

Query  520   F---NADWFRNGGSWKQKFV  470
             F   +   F N   WK  FV
Sbjct  247   FGDLDVLMFEN---WKSAFV  263



>ref|XP_010024195.1| PREDICTED: F-box protein SKIP22-like [Eucalyptus grandis]
Length=424

 Score =   195 bits (495),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 113/247 (46%), Positives = 145/247 (59%), Gaps = 15/247 (6%)
 Frame = -3

Query  1210  FSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTE  1034
              S P FLRKV  KE    DGG DH+LL+IAVHAV+LESGFV ++P   K  +P QW    
Sbjct  172   LSEPSFLRKVL-KEGLGGDGG-DHRLLVIAVHAVMLESGFVVVNPATGKLDLPGQW----  225

Query  1033  PQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDH  854
             P    L YSLPE+ D    Q+ N   +V LKF  +   + V       S   +V LDK  
Sbjct  226   PFTMSLQYSLPELVD--RVQSPNVAESVALKFHCIDNSITV------ESDSRAVHLDKRR  277

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             F P ++  W   G + E+    G   +S EKEVFEFW+ VK   A PLLIEL ++AG  L
Sbjct  278   FAPIIDAMWPKGGDNVEVNEDGGFSNSSTEKEVFEFWKIVKGDFARPLLIELTDRAGLPL  337

Query  673   PPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNG  494
             PPCF  LPT+LKL I ELL  +DLA+++C+  +L+ L S ++LWKQK+ E+F        
Sbjct  338   PPCFTSLPTDLKLSIFELLSGIDLARVACVSPELQRLTSTNELWKQKYVEEFGERIESGE  397

Query  493   GSWKQKF  473
               WKQKF
Sbjct  398   IDWKQKF  404


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  1744  NFLP--RVKMKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRL  1571
             NF P  R  MKLRLRS+E+++ I +DVP + +LP+L+R     L    +       S RL
Sbjct  39    NFAPVDRSVMKLRLRSLESRDGIKLDVPDACSLPQLRR----ILAGRLSPPPPPGSSFRL  94

Query  1570  SLNKKDELRSSSPDETLEMLGITSGDLIFFA  1478
             SLN+ DEL+S  P ++L  LG+ SGDL++++
Sbjct  95    SLNRTDELQSPDPTDSLRSLGLVSGDLVYYS  125



>ref|XP_009412931.1| PREDICTED: F-box protein SKIP22-like [Musa acuminata subsp. malaccensis]
Length=490

 Score =   196 bits (499),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 158/447 (35%), Positives = 233/447 (52%), Gaps = 54/447 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+RSV +KET+ +  P  ++L +LK  L     +SS+       SIRLSLN+KDEL 
Sbjct  1     MKLRIRSVASKETLRIQAPDPSSLHDLKT-LIARALSSSSSISIPPGSIRLSLNRKDELL  59

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQE----------SSESQITTGLSPNLPAES---  1403
               SP ++L  LG+TSG+LIFF + P  Q             E+  ++ L+P  P E+   
Sbjct  60    PPSPHDSLHSLGLTSGNLIFFYIVPASQTLAPSPSSAPAPEETVESSNLAPVPPPETPSA  119

Query  1402  ---------TDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmei  1250
                        ++NL   S+  S ++  ES+N +   +  + +    D    +   V + 
Sbjct  120   VDETPVRLHAQTLNLLSSSVATSMDI-AESSNLAPVLTQDNPSAIASDLSAPQAEVVQQD  178

Query  1249  dweEKDAD--VVGKSFSVPGFLRKVFTKELSDSDG--GRDHKLLLIAVHAVLLESGFVRL  1082
             D    DA+   VGKS SVP FL++V   E  +++G  GR    L++  HA  LESGFV  
Sbjct  179   DTLASDAEPVFVGKSLSVPYFLKRVMEAEKGEAEGLLGR----LVVTFHAAFLESGFVVS  234

Query  1081  DPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGS  902
                   ++P          S+  Y+LPE+  G  D  +  V    L+F  +G +  VYG 
Sbjct  235   GG--GSRLPTGRPSKAATFSV-QYTLPELV-GAVD--TRDVKVAMLRFSMMGNYATVYGF  288

Query  901   LSGNSS-VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDG  725
             L+G+   V+ V +D       L+++  +    EE             KEVF  W+ VKD 
Sbjct  289   LTGDHQDVYRVCIDLSKLASLLSLSMDSLSEQEE-------------KEVFGLWKVVKDE  335

Query  724   LALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDL  545
             L LPLLI++C K G   P CFMRLP EL+L IL+ + A+DLAK+ C CS+LR+L+S+D L
Sbjct  336   LTLPLLIDICRKNGLPSPTCFMRLPAELQLHILKHVSAIDLAKIGCTCSELRFLSSDDHL  395

Query  544   WKQKFEEQFNADWFR--NGGSWKQKFV  470
             WK++F  +  +   R   G SWK+K+V
Sbjct  396   WKRRFHVEIGSVNGRLITGRSWKEKYV  422



>ref|XP_010462864.1| PREDICTED: LOW QUALITY PROTEIN: putative F-box protein At1g23770 
[Camelina sativa]
Length=418

 Score =   193 bits (490),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 142/424 (33%), Positives = 223/424 (53%), Gaps = 76/424 (18%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRL+  +T+ET+ +++  + TL +L+RR++   P S          + LSLN+K+EL 
Sbjct  1     MKLRLKQHKTRETLNLELADTATLNDLRRRINPTAPFS----------VHLSLNRKEELL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             + SP++TL  LG+TSGD I++ ++   Q +  + +  G S N         + +Q  ++ 
Sbjct  51    APSPEDTLRSLGVTSGDRIYYTID---QSAFVATLHVGESSNWNLGD----DKTQDQVKG  103

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRK  1184
                + VE             AP                      A V  +  +VP FLRK
Sbjct  104   PDPMDVEM------------AP----------------------APVSKRLSTVPSFLRK  129

Query  1183  VFTKELSDSDGGRDHKL--LLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI-LS  1013
                ++      G D +L  L+++VHAV+LESGF+ LD        +++ +++  +S+   
Sbjct  130   TLLEK-----SGNDSQLTILVLSVHAVMLESGFLLLD----HDSDDKFSVSKKLLSLSFR  180

Query  1012  YSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNV  833
             YSLPE+    + +++N++ +V L+F  +G  V+VYG+      V    +DK  FV  +N+
Sbjct  181   YSLPELI---SRKDNNSLESVTLQFNNIGPKVVVYGNYKWRCFVRMTYVDKCRFVHVINL  237

Query  832   AWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRL  653
                     +E +  D        ++VF FWR VKD L +PLL +LC K G   PPC M L
Sbjct  238   VLDTLKFEKESSSID-------YRDVFLFWRMVKDDLVIPLLTDLCYKVGLEPPPCLMHL  290

Query  652   PTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWF---RNGGSWK  482
             PT+LK KILELLP V + KM+C+ +++RYLAS DDLWKQK  E+   D+F    +   WK
Sbjct  291   PTKLKRKILELLPGVSIGKMACVSTEMRYLASEDDLWKQKCLEEEAKDFFWALTDEVGWK  350

Query  481   QKFV  470
              +F 
Sbjct  351   CRFA  354



>ref|XP_002893306.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69565.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   189 bits (481),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 165/441 (37%), Positives = 247/441 (56%), Gaps = 62/441 (14%)
 Frame = -3

Query  1726  KMKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             +MKLRLR  ET+ET+ +++  + TL +L+RR++   P+S          + LSLN+KDEL
Sbjct  98    RMKLRLRHHETRETLKLELADTDTLHDLRRRINPTAPSS----------VHLSLNRKDEL  147

Query  1546  RSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSI---NLSQK  1376
              +SSP++TL  LG+ SGDLI+++L        E +    L+P   +ES  +I   ++   
Sbjct  148   ITSSPEDTLRSLGLISGDLIYYSLEAGESSGWELRDYQTLAPQ--SESNQAIVHESMGIG  205

Query  1375  SLELSSN------LPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGK  1214
               E+ SN       P E +  S+ + + D  P  V+Q + E             A    K
Sbjct  206   FAEVDSNPNSGVEDPAEGSKGSN-SGMDDPEPMDVEQLDMEL------------AAAGSK  252

Query  1213  SFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTE  1034
               S P FL+ V  ++  D+    +   L ++VHAV+LESGFV  D    +   ++ +LT 
Sbjct  253   RLSEPFFLKNVLLEKCGDTS---ELTTLALSVHAVMLESGFVLFDSGSDRFNFSKELLT-  308

Query  1033  PQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDH  854
               VS L Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK  
Sbjct  309   --VS-LRYTLPELI---KSEDTNTIESVTVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRR  362

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             FVP +++        EE +       +S  +EVF FWR VKD L +PLLI +C+KAG   
Sbjct  363   FVPVIDLVMDTSKSDEEGS-------SSIYREVFMFWRMVKDCLVIPLLIGICDKAGLES  415

Query  673   PPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN-------  515
             PPC MRLP+ELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ +       
Sbjct  416   PPCLMRLPSELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVDNFVGTEA  475

Query  514   ---ADW-FRNGGSWKQKFVAA  464
                 +W  R    W+QK +AA
Sbjct  476   GDSVNWKARFATFWRQKQLAA  496



>dbj|BAH57632.1| F-box family protein [Arabidopsis thaliana]
Length=475

 Score =   187 bits (475),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 163/433 (38%), Positives = 243/433 (56%), Gaps = 57/433 (13%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++  +P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRHHETRETLKLELADADTLHDLRRRINPTVPSS----------VHLSLNRKDELI  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESS-----ESQITTGLSPNLPAESTDSINLSQ  1379
             + SP++TL  LG+ SGDLI+F+L     ESS     +S+     S +      DSI  ++
Sbjct  51    TPSPEDTLRSLGLISGDLIYFSLEAG--ESSNWKLRDSETVASQSESNQTSVHDSIGFAE  108

Query  1378  KSLELSSNLPVESTNTS------DFNSLSDKAPelvdqgeeeevevmeidweEKDADVVG  1217
               +++  +    + NTS      D + +    P  V+Q + E             A    
Sbjct  109   --VDVGPDQAKSNPNTSVEDPEGDISGMEGPEPMDVEQLDMEL------------AAAGS  154

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILT  1037
             K  S P FL+ +  ++  D+    +   L ++VHAV+LESGFV L+    K   ++ +LT
Sbjct  155   KRLSEPFFLKNILLEKSGDTS---ELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLT  211

Query  1036  EPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKD  857
                VS L Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK 
Sbjct  212   ---VS-LRYTLPELI---KSKDTNTIESVSVKFQNLGPVVVVYGTVGGSSGRVHMNLDKR  264

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              FVP +++        EE +       +S  +EVF FWR VKD L +PLLI +C+KAG  
Sbjct  265   RFVPVIDLVMDTSTSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLE  317

Query  676   LPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRN  497
              PPC MRLPTELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ N      
Sbjct  318   PPPCLMRLPTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNFVVTE  377

Query  496   GG---SWKQKFVA  467
              G   +WK +F  
Sbjct  378   AGDSVNWKARFAT  390



>ref|NP_564203.1| F-box protein SKIP22 [Arabidopsis thaliana]
 sp|Q9ZUB8.1|SKI22_ARATH RecName: Full=F-box protein SKIP22; AltName: Full=SKP1-interacting 
partner 22 [Arabidopsis thaliana]
 gb|AAC98033.1| Contains similarity to gb|L26505 Met30p from Saccharomyces cerevisiae. 
ESTs gb|F14133, gb|T46217, gb|AA404758 and gb|Z37647 
come from this gene [Arabidopsis thaliana]
 gb|AAK83633.1| At1g23780/F5O8_31 [Arabidopsis thaliana]
 gb|AAN31083.1| At1g23780/F5O8_31 [Arabidopsis thaliana]
 dbj|BAH57636.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57638.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57643.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57644.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57645.1| F-box family protein [Arabidopsis thaliana]
 gb|AEE30431.1| F-box protein SKIP22 [Arabidopsis thaliana]
Length=475

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 163/433 (38%), Positives = 243/433 (56%), Gaps = 57/433 (13%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++  +P+S          + LSLN+KDEL 
Sbjct  1     MKLRLRHHETRETLKLELADADTLHDLRRRINPTVPSS----------VHLSLNRKDELI  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESS-----ESQITTGLSPNLPAESTDSINLSQ  1379
             + SP++TL  LG+ SGDLI+F+L     ESS     +S+     S +      DSI  ++
Sbjct  51    TPSPEDTLRSLGLISGDLIYFSLEAG--ESSNWKLRDSETVASQSESNQTSVHDSIGFAE  108

Query  1378  KSLELSSNLPVESTNTS------DFNSLSDKAPelvdqgeeeevevmeidweEKDADVVG  1217
               +++  +    + NTS      D + +    P  V+Q + E             A    
Sbjct  109   --VDVVPDQAKSNPNTSVEDPEGDISGMEGPEPMDVEQLDMEL------------AAAGS  154

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILT  1037
             K  S P FL+ +  ++  D+    +   L ++VHAV+LESGFV L+    K   ++ +LT
Sbjct  155   KRLSEPFFLKNILLEKSGDTS---ELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLT  211

Query  1036  EPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKD  857
                VS L Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK 
Sbjct  212   ---VS-LRYTLPELI---KSKDTNTIESVSVKFQNLGPVVVVYGTVGGSSGRVHMNLDKR  264

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              FVP +++        EE +       +S  +EVF FWR VKD L +PLLI +C+KAG  
Sbjct  265   RFVPVIDLVMDTSTSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLE  317

Query  676   LPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRN  497
              PPC MRLPTELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ N      
Sbjct  318   PPPCLMRLPTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNFVVTE  377

Query  496   GG---SWKQKFVA  467
              G   +WK +F  
Sbjct  378   AGDSVNWKARFAT  390



>gb|KEH22785.1| F-box SKIP22-like protein [Medicago truncatula]
Length=272

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 137/235 (58%), Gaps = 18/235 (8%)
 Frame = -3

Query  1207  SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQ  1028
             S P F+++V  + L D     D KLL+ AVHA +LESGFVR+D +    +    ++ +  
Sbjct  3     STPNFVKRVLREALGDDVS--DFKLLVFAVHAFILESGFVRVDHVSGMAISISHLIDDMS  60

Query  1027  VSI---LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SSVHSVQLD  863
              S    L Y+LPEI    +  + N      LK QTLG FV VYGSL  +  SSVH V LD
Sbjct  61    SSSMISLRYTLPEILTNGSSHSLN------LKIQTLGHFVNVYGSLYDDVGSSVHMVYLD  114

Query  862   KDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAG  683
             K  F   L     +   S      DG      + EV E W+ V D LA PLLI+LC+KAG
Sbjct  115   KCRFAKPLEFLLMSNSESNACVNVDG-----DKDEVLELWKIVNDRLAFPLLIDLCDKAG  169

Query  682   FGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF  518
               LPPCFM LP ELKL I E LP  DLAK+ C CS L+YLASND+LWK+KFEE+F
Sbjct  170   LILPPCFMSLPMELKLVIFEYLPGDDLAKVCCTCSKLQYLASNDELWKKKFEEEF  224



>dbj|BAH57639.1| F-box family protein [Arabidopsis thaliana]
Length=475

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 161/422 (38%), Positives = 239/422 (57%), Gaps = 35/422 (8%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   PAS          + LSLN+KDEL 
Sbjct  1     MKLRLRHHETRETLKLELADADTLHDLRRRINPTAPAS----------VHLSLNRKDELI  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             + S ++TL  LG+ SGDLI+++L     ESS  ++    S  L  +S  +  +   S+  
Sbjct  51    TPSAEDTLRSLGLISGDLIYYSLEAG--ESSNWKLRD--SETLAPQSESNQTIVHDSIGF  106

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRK  1184
             +    V     S+ NS  +  PE    G +    +     + + A    K  S P FL+ 
Sbjct  107   ADVDVVPDQAKSNSNSAVED-PEGESSGMDGPEPMDVEQLDMELAAAGSKRLSEPFFLKN  165

Query  1183  VFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILSYSL  1004
             +  ++  D+    +   L ++VHAV+LESGFV L+    K   ++ +LT   VS L Y+L
Sbjct  166   ILLEKSGDTS---ELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLT---VS-LRYTL  218

Query  1003  PEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWS  824
             PE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK  FVP +++   
Sbjct  219   PELI---KSKDTNTIESVTVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRRFVPVIDLVMD  275

Query  823   NCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTE  644
                  EE +       +S  +EVF FWR VKD L +PLLI +C+KAG   PPC MRLPTE
Sbjct  276   TSKSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLEPPPCLMRLPTE  328

Query  643   LKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG---SWKQKF  473
             LKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ N       G   +WK +F
Sbjct  329   LKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNIVVTETGDSVNWKARF  388

Query  472   VA  467
              A
Sbjct  389   TA  390



>dbj|BAH57630.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57633.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57635.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57637.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57640.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57641.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57642.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57649.1| F-box family protein [Arabidopsis thaliana]
Length=475

 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 159/425 (37%), Positives = 244/425 (57%), Gaps = 41/425 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   PAS          + LSLN+KDEL 
Sbjct  1     MKLRLRHHETRETLKLELADADTLHDLRRRINPTAPAS----------VHLSLNRKDELI  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAEST---DSINLSQKS  1373
             + S ++TL  LG+ SGDLI+++L      + + +    L+P   +  T   DSI  ++  
Sbjct  51    TPSAEDTLRSLGLISGDLIYYSLEAGESSNWKLRDFETLAPQSESNQTIVHDSIGFAEVD  110

Query  1372  LELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGF  1193
             +     +P ++ + S+ +++ D  PE    G +    +     + + A    K  S P F
Sbjct  111   V-----VPDQAKSNSN-SAVED--PEGESSGMDGPEPMDVEQLDMELAAAGSKRLSEPFF  162

Query  1192  LRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS  1013
             L+ +  ++  D+    +   L ++VHAV+LESGFV L+    K   ++ +LT   VS L 
Sbjct  163   LKNILLEKSGDTS---ELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLT---VS-LR  215

Query  1012  YSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNV  833
             Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK  FVP +++
Sbjct  216   YTLPELI---KSKDTNTIESVTVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRRFVPVIDL  272

Query  832   AWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRL  653
                     EE +       +S  +EVF FWR VKD L +PLLI +C+KAG   PPC MRL
Sbjct  273   VMDTSKSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLEPPPCLMRL  325

Query  652   PTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG---SWK  482
             PTELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ N       G   +WK
Sbjct  326   PTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNIVVTETGDSVNWK  385

Query  481   QKFVA  467
              +F A
Sbjct  386   ARFTA  390



>dbj|BAH57631.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57646.1| F-box family protein [Arabidopsis thaliana]
Length=475

 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 159/425 (37%), Positives = 244/425 (57%), Gaps = 41/425 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   PAS          + LSLN+KDEL 
Sbjct  1     MKLRLRHHETRETLKLELADADTLHDLRRRINPTAPAS----------VHLSLNRKDELI  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAEST---DSINLSQKS  1373
             + S ++TL  LG+ SGDLI+++L      + + +    L+P   +  T   DSI  ++  
Sbjct  51    TPSAEDTLRSLGLISGDLIYYSLKAGESSNWKLRDFETLAPQSESNQTIVHDSIGFAEVD  110

Query  1372  LELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGF  1193
             +     +P ++ + S+ +++ D  PE    G +    +     + + A    K  S P F
Sbjct  111   V-----VPDQAKSNSN-SAVED--PEGESSGMDGPEPMDVEQLDMELAAAGSKRLSEPFF  162

Query  1192  LRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS  1013
             L+ +  ++  D+    +   L ++VHAV+LESGFV L+    K   ++ +LT   VS L 
Sbjct  163   LKNILLEKSGDTS---ELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLT---VS-LR  215

Query  1012  YSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNV  833
             Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK  FVP +++
Sbjct  216   YTLPELI---KSKDTNTIESVTVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRRFVPVIDL  272

Query  832   AWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRL  653
                     EE +       +S  +EVF FWR VKD L +PLLI +C+KAG   PPC MRL
Sbjct  273   VMDTSKSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLEPPPCLMRL  325

Query  652   PTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG---SWK  482
             PTELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ N       G   +WK
Sbjct  326   PTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNIVVTETGDSVNWK  385

Query  481   QKFVA  467
              +F A
Sbjct  386   ARFTA  390



>dbj|BAH57650.1| F-box family protein [Arabidopsis thaliana]
Length=475

 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 159/425 (37%), Positives = 244/425 (57%), Gaps = 41/425 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   PAS          + LSLN+KDEL 
Sbjct  1     MKLRLRHHETRETLKLELADADTLHDLRRRINPTAPAS----------VHLSLNRKDELI  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAEST---DSINLSQKS  1373
             + S ++TL  LG+ SGDLI+++L      + + +    L+P   +  T   DSI  ++  
Sbjct  51    TPSAEDTLRSLGLISGDLIYYSLEAGESSNWKLRDFETLAPQSESNQTIVHDSIGFAEVD  110

Query  1372  LELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGF  1193
             +     +P ++ + S+ +++ D  PE    G +    +     + + A    K  S P F
Sbjct  111   V-----VPDQAKSNSN-SAVED--PEGESSGMDGPEPMDVEQLDMELAAAGSKRLSEPFF  162

Query  1192  LRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS  1013
             L+ +  ++  D+    +   L ++VHAV+LESGFV L+    K   ++ +LT   VS L 
Sbjct  163   LKNILLEKSGDTS---ELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLT---VS-LR  215

Query  1012  YSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNV  833
             Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK  FVP +++
Sbjct  216   YTLPELI---KSKDTNTIESVTVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRRFVPVIDL  272

Query  832   AWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRL  653
                     EE +       +S  +EVF FWR VKD L +PLLI +C+KAG   PPC MRL
Sbjct  273   VMDTSKSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLEPPPCLMRL  325

Query  652   PTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG---SWK  482
             PTELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ N       G   +WK
Sbjct  326   PTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNIVVTETGDSVNWK  385

Query  481   QKFVA  467
              +F A
Sbjct  386   ARFTA  390



>dbj|BAH57634.1| F-box family protein [Arabidopsis thaliana]
Length=475

 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 159/425 (37%), Positives = 244/425 (57%), Gaps = 41/425 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   PAS          + LSLN+KDEL 
Sbjct  1     MKLRLRHHETRETLKLELADADTLHDLRRRINPTAPAS----------VHLSLNRKDELI  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAEST---DSINLSQKS  1373
             + S ++TL  LG+ SGDLI+++L      + + +    L+P   +  T   DSI  ++  
Sbjct  51    TPSAEDTLRSLGLISGDLIYYSLEAGESSNWKLRDFETLAPQSESNQTIVHDSIGFAEVD  110

Query  1372  LELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGF  1193
             +     +P ++ + S+ +++ D  PE    G +    +     + + A    K  S P F
Sbjct  111   V-----VPDQAKSNSN-SAVED--PEGESSGMDGPEPMDVEQLDMELAAAGSKRLSEPFF  162

Query  1192  LRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS  1013
             L+ +  ++  D+    +   L ++VHAV+LESGFV L+    K   ++ +LT   VS L 
Sbjct  163   LKNILLEKSGDTS---ELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLT---VS-LR  215

Query  1012  YSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNV  833
             Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK  FVP +++
Sbjct  216   YTLPELI---KSKDTNTIESVTVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRRFVPVIDL  272

Query  832   AWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRL  653
                     EE +       +S  +EVF FWR VKD L +PLLI +C+KAG   PPC MRL
Sbjct  273   VMDTSKSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLEPPPCLMRL  325

Query  652   PTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG---SWK  482
             PTELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ N       G   +WK
Sbjct  326   PTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNIIVVTETGDSVNWK  385

Query  481   QKFVA  467
              +F A
Sbjct  386   ARFTA  390



>dbj|BAH57647.1| F-box family protein [Arabidopsis thaliana]
Length=475

 Score =   185 bits (469),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 159/425 (37%), Positives = 243/425 (57%), Gaps = 41/425 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   PAS          + LSLN+KDEL 
Sbjct  1     MKLRLRHHETRETLKLELADADTLHDLRRRINPTAPAS----------VHLSLNRKDELI  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAEST---DSINLSQKS  1373
             + S ++TL  LG+ SGDLI+++L      + + +    L+P   +  T   DSI  +   
Sbjct  51    TPSAEDTLRSLGLISGDLIYYSLEAGESSNWKLRDFETLAPQSESNQTIVHDSIGFADVD  110

Query  1372  LELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGF  1193
             +     +P ++ + S+ +++ D  PE    G +    +     + + A    K  S P F
Sbjct  111   V-----VPDQAKSNSN-SAVED--PEGESSGMDGPEPMDVEQLDMELAAAGSKRLSEPFF  162

Query  1192  LRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS  1013
             L+ +  ++  D+    +   L ++VHAV+LESGFV L+    K   ++ +LT   VS L 
Sbjct  163   LKNILLEKSGDTS---ELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLT---VS-LR  215

Query  1012  YSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNV  833
             Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK  FVP +++
Sbjct  216   YTLPELI---KSKDTNTIESVTVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRRFVPVIDL  272

Query  832   AWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRL  653
                     EE +       +S  +EVF FWR VKD L +PLLI +C+KAG   PPC MRL
Sbjct  273   VMDTSKSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLEPPPCLMRL  325

Query  652   PTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG---SWK  482
             PTELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ N       G   +WK
Sbjct  326   PTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNIVVTETGDSVNWK  385

Query  481   QKFVA  467
              +F A
Sbjct  386   ARFTA  390



>dbj|BAH57651.1| F-box family protein [Arabidopsis thaliana]
Length=475

 Score =   185 bits (469),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 164/433 (38%), Positives = 242/433 (56%), Gaps = 57/433 (13%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   PAS          + LSLN+KDEL 
Sbjct  1     MKLRLRHHETRETLKLELADADTLHDLRRRINPTAPAS----------VHLSLNRKDELI  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESS-----ESQITTGLSPNLPAESTDSINLSQ  1379
             + S ++TL  LG+ SGDLI+F+L     ESS     +S+     S +      DSI  ++
Sbjct  51    TPSAEDTLRSLGLISGDLIYFSLEAG--ESSNWKLRDSETVASQSESNQTSVHDSIGFAE  108

Query  1378  KSLELSSNLPVESTNTS------DFNSLSDKAPelvdqgeeeevevmeidweEKDADVVG  1217
               +++  +    + NTS      D + +    P  V+Q + E             A    
Sbjct  109   --VDVVPDQAKSNPNTSVEDPEGDISGMEGPEPMDVEQLDMEL------------AAAGS  154

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILT  1037
             K  S P FL+ +  ++  D+    +   L ++VHAV+LESGFV L+    K   ++ +LT
Sbjct  155   KRLSEPFFLKNILLEKSGDTS---ELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLT  211

Query  1036  EPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKD  857
                VS L Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK 
Sbjct  212   ---VS-LRYTLPELI---KSKDTNTIESVTVKFQNLGPVVVVYGTVGGSSGRVHMNLDKR  264

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              FVP +++        EE +       +S  +EVF FWR VKD L +PLLI +C+KAG  
Sbjct  265   RFVPVIDLVMDTSKSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLE  317

Query  676   LPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRN  497
              PPC MRLPTELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ N      
Sbjct  318   PPPCLMRLPTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNIVVTE  377

Query  496   GG---SWKQKFVA  467
              G   +WK +F A
Sbjct  378   TGDSVNWKARFTA  390



>dbj|BAH57648.1| F-box family protein [Arabidopsis thaliana]
Length=475

 Score =   184 bits (468),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 158/425 (37%), Positives = 244/425 (57%), Gaps = 41/425 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLR  ET+ET+ +++  + TL +L+RR++   PAS          + LSLN+KDEL 
Sbjct  1     MKLRLRHHETRETLKLELADADTLHDLRRRINPTAPAS----------VHLSLNRKDELI  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAEST---DSINLSQKS  1373
             + S ++TL  LG+ SGDLI+++L      + + +    L+P   +  T   DSI  ++  
Sbjct  51    TPSAEDTLRSLGLISGDLIYYSLEAGESSNWKLRDFETLAPQSESNQTIVHDSIGFAEVD  110

Query  1372  LELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGF  1193
             +     +P ++ + S+ +++ D  PE    G +    +     + + A    K  S P F
Sbjct  111   V-----VPDQAKSNSN-SAVED--PEGESSGMDGPEPMDVEQLDMELAAAGSKRLSEPFF  162

Query  1192  LRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS  1013
             L+ +  ++  D+    +   L ++VHAV+LESGFV L+    K   ++ +LT   VS L 
Sbjct  163   LKNILLEKSGDTS---ELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLT---VS-LR  215

Query  1012  YSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNV  833
             Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK  FVP +++
Sbjct  216   YTLPELI---KSKDTNTIESVTVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRRFVPVIDL  272

Query  832   AWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRL  653
                     EE +       +S  +EVF FWR VKD L +PLLI +C+KAG   PPC MRL
Sbjct  273   VMDTSKSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLEPPPCLMRL  325

Query  652   PTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG---SWK  482
             PTELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  ++ N       G   +WK
Sbjct  326   PTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLDEVNNIVVTETGDSVNWK  385

Query  481   QKFVA  467
              +F A
Sbjct  386   ARFTA  390



>ref|XP_010501564.1| PREDICTED: putative F-box protein At1g23770 [Camelina sativa]
Length=407

 Score =   182 bits (463),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 141/429 (33%), Positives = 223/429 (52%), Gaps = 91/429 (21%)
 Frame = -3

Query  1702  VETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELRSSSPDET  1523
             ++T+ET+ +++  + TL  L+R ++   P S          + LSLN+K+EL + SP+ T
Sbjct  7     LKTRETLNLELADTATLNNLRRHINPTAPFS----------VHLSLNRKEELLARSPEYT  56

Query  1522  LEMLGITSGDLIFFALNPNVQESSESQITTGLSPN--LPAESTDSINLSQKSLELSSNLP  1349
             L  LG+TSGD I++ ++   Q +  + +  G S N  L  E T      Q  ++ S  + 
Sbjct  57    LRSLGVTSGDRIYYTID---QSAFIASLHVGESSNWNLGDEKT------QDQVKGSEPMD  107

Query  1348  VESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRKVFTKE  1169
             VE             AP                      A V  +  +VP FLRK   ++
Sbjct  108   VE------------MAP----------------------APVSKRLSTVPSFLRKTLLEK  133

Query  1168  LSDSDGGRDHKL--LLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI-LSYSLPE  998
                   G D +L  L+++VHAV+LESGF+ LD        +++ +++  +S+ L YSL E
Sbjct  134   -----SGNDSRLTFLVLSVHAVMLESGFLLLD----HDSDDKFSVSKKLLSVSLRYSLSE  184

Query  997   IADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN------------SSVHSVQLDKDH  854
             +    + +++N++ +V L++  +G  V+VYG++SG+            S V    +DK  
Sbjct  185   LI---SRKDNNSLESVTLQYYNIGPKVVVYGTISGSRERVRMTYLDKRSFVRMTYVDKCR  241

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             F   +N+        +E +  D        ++V  FWR VKD L +PLL +LC+K G   
Sbjct  242   FAHVINLVLDTLKFEKESSSID-------YRDVLVFWRMVKDDLVIPLLTDLCDKVGLEP  294

Query  673   PPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FEEQFNADW-FR  500
             PPC M+LPT+LK KILELLP V + KM+C+C+++RYLAS+DDLWKQK  EE  +  W   
Sbjct  295   PPCLMQLPTKLKRKILELLPGVSIGKMACVCTEMRYLASDDDLWKQKCLEEAKDFFWALA  354

Query  499   NGGSWKQKF  473
             +   WK +F
Sbjct  355   DEVGWKCRF  363



>ref|XP_010109329.1| Putative F-box protein [Morus notabilis]
 gb|EXC21826.1| Putative F-box protein [Morus notabilis]
Length=330

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 145/264 (55%), Gaps = 35/264 (13%)
 Frame = -3

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDG--GRDHKLLLIAVHAVLLESGFVRLDPILHKKV  1058
              ++V   F    FLR+V  +  S+  G  GR+HKL+ IAVH V LESGFV  D       
Sbjct  8     VNLVRIKFPETCFLRRV-RRMASEEFGEDGRNHKLMAIAVHCVFLESGFVECDEF---HF  63

Query  1057  PNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL-SGNSSV  881
             P++W  +        Y+LPEI         N   ++ LK+Q LG FV V+GSL SG S  
Sbjct  64    PDEWSPSMAFTMSFRYTLPEIF------TLNLRESIVLKYQILGHFVNVFGSLTSGGSVT  117

Query  880   HSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
             + V LD+  F P ++   S C   +E            E EV+E W+ VKD  A PLLI 
Sbjct  118   YRVCLDEHKFAPAID---SVCAKGDEF-----------ESEVYELWKIVKDEFAFPLLIN  163

Query  700   LCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQ  521
             LC KAG   P CFMRLP+EL++KI E LP  DLAK+ C C DLRYL+ N+DLWK+K+ E+
Sbjct  164   LCAKAGLPSPLCFMRLPSELQMKIFEFLPGADLAKVGCACKDLRYLSCNNDLWKRKYSEE  223

Query  520   FNADWFRNGGS-----WKQKFVAA  464
             F  +     GS     WK+ F  A
Sbjct  224   FGME---MAGSHAVMHWKRAFAIA  244



>ref|XP_007148963.1| hypothetical protein PHAVU_005G029200g [Phaseolus vulgaris]
 gb|ESW20957.1| hypothetical protein PHAVU_005G029200g [Phaseolus vulgaris]
Length=489

 Score =   183 bits (464),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 154/415 (37%), Positives = 211/415 (51%), Gaps = 83/415 (20%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRL+S+E   T+ + VP S +L +L     +   + S     SS S+ LSLN+KDE+R
Sbjct  1     MKLRLKSLELNRTLIIKVPNSCSLQQL-----VDTLSHSLPFSSSSSSLHLSLNRKDEIR  55

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             +SSP  +L  LG+    LIF++ NP    +  SQ   G +P  PA               
Sbjct  56    ASSPHVSLHSLGVADHHLIFYSFNP---AAFSSQTLAGDAPFTPA---------------  97

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRK  1184
                  VE   T D                            E D  VV  + S P FLR+
Sbjct  98    -----VEKHPTLD------------------------SAEVESDEAVVLSTDSEPSFLRR  128

Query  1183  VFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKV---PNQWILTEPQVSILS  1013
             V   +L+D       KLL + VH V++E GF+R+D      +   P+      P  S++S
Sbjct  129   VPKNDLND------FKLLTLTVHRVVVEHGFLRIDKDSGTAISCFPSLDDSPSPFSSMIS  182

Query  1012  --YSLPEIADGDTDQNSNAVPTVELKFQTLGK-FVIVYGSLSGNS--SVHSVQLDKDHFV  848
               Y+LP+I  G          +V LKFQ LG+ FV V G LS +S  ++H V LDK  +V
Sbjct  183   LRYTLPQILVGGGSH------SVNLKFQRLGQHFVNVCGGLSDDSGSNLHHVCLDKRKYV  236

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
               L +   N     E  G +G       KEVFE  + VKD +ALPLLI+LCEK G  LPP
Sbjct  237   RPLELRLVN----GESKGSEG-------KEVFEMLKMVKDRVALPLLIDLCEKGGLDLPP  285

Query  667   CFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWF  503
             C M+LP ELK  ILE +P VDLAK++C CS+LR+L S+++LWK+K+ ++F    F
Sbjct  286   CLMKLPRELKGLILERVPGVDLAKVACTCSELRFLCSDNELWKKKYLKEFRKKKF  340



>gb|EYU37547.1| hypothetical protein MIMGU_mgv1a017729mg, partial [Erythranthe 
guttata]
Length=323

 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 155/270 (57%), Gaps = 26/270 (10%)
 Frame = -3

Query  1237  KDADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKV  1058
             K A V   SFS+P F++++F ++  + D    HKL++I VHA++L+ GF   D   +  V
Sbjct  13    KKAAVETASFSLPEFVKQLFVEQWGN-DAAYYHKLIVIVVHAIMLDFGFASFDTRSNSIV  71

Query  1057  PNQWILTEPQVSI----LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN  890
                 +  E    +    L Y+LP+      +     +  + LKFQ LG  + +YG+LS N
Sbjct  72    GAFHLRRELNSDLFKISLFYTLPQ------NDCGKCIRYIVLKFQILGDLMNIYGTLSEN  125

Query  889   SS-------VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKE-VFEFWRTV  734
              S        HSVQ D+   +PFLNV WSNC ++       GLL  +P +  + EF R V
Sbjct  126   VSGERRRIITHSVQADEYELIPFLNVIWSNCWVN-----NGGLLIETPSRRAMLEFMRNV  180

Query  733   KDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASN  554
             +D LALPLLI+L E +    PPCFM+LP ++KLKILELLP+VDLAK+SC  S+LR L   
Sbjct  181   RDNLALPLLIDLREASSLIPPPCFMKLPNDIKLKILELLPSVDLAKVSCASSELRDLGLM  240

Query  553   DDLWKQKFEEQFNADWFRNG--GSWKQKFV  470
             D LWK KF E+F  +   +G    W++ F+
Sbjct  241   DYLWKLKFFEEFGDEENEDGQKSCWRRAFL  270



>gb|KCW56829.1| hypothetical protein EUGRSUZ_I02498 [Eucalyptus grandis]
Length=514

 Score =   181 bits (458),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 152/480 (32%), Positives = 230/480 (48%), Gaps = 87/480 (18%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+++T+ +DVP   +LP L++        +   S     S RLSLN+ DEL+
Sbjct  1     MKLRLRSLESEDTLQLDVPDPCSLPLLRQ------ILADRLSHPPGSSFRLSLNRTDELQ  54

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             SS+P ++L+ LG+ SGDL+F++L+P    S E + ++  +P+  A + D ++  ++ ++ 
Sbjct  55    SSNPADSLQSLGLESGDLVFYSLDPGGFASPEDRGSS--NPDFYAGAFDQVSQGREGMD-  111

Query  1363  SSNLP---VESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGF  1193
             S N P         +D    +D  PE   + +         +      D  G        
Sbjct  112   SENWPDLGGRPEEAADSEMTTDLVPEDGREVDASGRADGRGNSSSASVDSDGDGLLAADG  171

Query  1192  LRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS  1013
              R V  +EL    G    KL++IAVHAV+ ESGFV LDP+   ++P   +   P VS   
Sbjct  172   SR-VSEEELGRYGG----KLIVIAVHAVMQESGFVALDPV--TEMPADRLCGNP-VS-FR  222

Query  1012  YSLPEIADGDTDQNSNAVPTVELKFQTLGKFVI---------------VYGSLSGNSSVH  878
             YSLPE+      Q+ N    V L +++ G  VI               ++ +L   +S H
Sbjct  223   YSLPELVA--RSQSLNMPECVTLTYESQGNTVIPSSSGKEVHEPWASYLHTALVCRASAH  280

Query  877   SVQL----------------DKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTS--------  770
                                  +     + ++A +N  L   +AG   + C          
Sbjct  281   CGNFPTALSASASAAASASALRRIITVYGSLAKANSDLRTVLAGSPRVCCLDMRRCLWVE  340

Query  769   ------------------PEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTE  644
                               P K++FEFW+ VKD LA PLL +L E  G  LP  FM LP E
Sbjct  341   GDDNDMKAHEDVGFSTPYPVKKMFEFWQMVKDRLASPLLRDLTESTGLSLPSYFMYLPPE  400

Query  643   LKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGGSWKQKFVAA  464
             LKLKI E L  VDLA++ C+CS+LRY  +N+DLWKQK+ +  +        SWK+K++AA
Sbjct  401   LKLKIFESLSGVDLARVGCVCSELRYSTANNDLWKQKYMDVVS-------NSWKRKYMAA  453



>ref|XP_010030889.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein SKIP22-like [Eucalyptus 
grandis]
Length=799

 Score =   182 bits (462),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 154/495 (31%), Positives = 236/495 (48%), Gaps = 97/495 (20%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+++T+ +DVP   +LP L++        +   S     S RLSLN+ DEL+
Sbjct  1     MKLRLRSLESEDTLQLDVPDPCSLPLLRQ------ILADRLSHPPGSSFRLSLNRTDELQ  54

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             SS+P ++L+ LG+ SGDL+F++L+P    S E + ++  +P+  A + D ++  ++ ++ 
Sbjct  55    SSNPADSLQSLGLESGDLVFYSLDPGGFASPEDRGSS--NPDFYAGAFDQVSQGREGMD-  111

Query  1363  SSNLP---VESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSF-----  1208
             S N P         +D    +D  PE   + +         +      D  G        
Sbjct  112   SENWPDLGGRPEEAADSEMTTDLVPEDGREVDASGRADGRGNSSSASVDSDGDGLLAADG  171

Query  1207  SVPG---------FLRKVFTKELSDSDGGR-DHKLLLIAVHAVLLESGFVRLDPILHKKV  1058
             SV G           +   T+ +S+ + GR   KL++IAVHAV+ ESGFV LDP+   ++
Sbjct  172   SVAGGNKSGEPYFLFKGALTQRVSEEELGRYGGKLIVIAVHAVMQESGFVALDPV--TEM  229

Query  1057  PNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVI------------  914
             P   +   P VS   YSLPE+      Q+ N    V L +++ G  VI            
Sbjct  230   PADRLCGNP-VS-FRYSLPELVA--RSQSLNMPECVTLTYESQGNTVIPSSSGKEVHEPW  285

Query  913   ---VYGSLSGNSSVHSVQL----------------DKDHFVPFLNVAWSNCGLSEEIAGK  791
                ++ +L   +S H                     +     + ++A +N  L   +AG 
Sbjct  286   ASYLHTALVCRASAHCGNFPTALSASASAAASASALRRIITVYGSLAKANSDLRTVLAGS  345

Query  790   DGLLCTS--------------------------PEKEVFEFWRTVKDGLALPLLIELCEK  689
               + C                            P K++FEFW+ VKD LA PLL +L E 
Sbjct  346   PRVCCLDMRRCLWVEGDDNDMKAHEDVGFSTPYPVKKMFEFWQMVKDRLASPLLRDLTES  405

Query  688   AGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNAD  509
              G  LP  FM LP ELKLKI E L  VDLA++ C+CS+LRY  +N+DLWKQK+ +  +  
Sbjct  406   TGLSLPSYFMYLPPELKLKIFESLSGVDLARVGCVCSELRYSTANNDLWKQKYMDVVS--  463

Query  508   WFRNGGSWKQKFVAA  464
                   SWK+K++AA
Sbjct  464   -----NSWKRKYMAA  473


 Score =   166 bits (420),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 144/237 (61%), Gaps = 4/237 (2%)
 Frame = -3

Query  1225  VVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQW  1046
             VV + FS P FL++V  KE S  DGG +H+LL++AVHAV+LESGFV +DP          
Sbjct  562   VVRRKFSEPYFLKRVL-KEESGGDGG-EHRLLVVAVHAVMLESGFVAVDPATGMPGDRFH  619

Query  1045  ILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQL  866
             +  + + + L YSLPE+     +Q+ N   ++ +KFQ+LG+F++VY  L   + +   +L
Sbjct  620   LSDQCRSTSLQYSLPELLVA-RNQSLNVPGSLLVKFQSLGQFIVVYRCLP-KAELGLRRL  677

Query  865   DKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKA  686
               D  V  L  +    G  +++    G   + P K V EFW+ VK GL LPLLI+L ++ 
Sbjct  678   CLDRRVLLLIRSMCAKGEGDDVEEDGGFSSSYPVKAVSEFWKIVKGGLELPLLIDLTKRP  737

Query  685   GFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
             G  LP CF  L TELKLKI E L  +DLA++ C+CS+LR L S++DLWK K  ++F 
Sbjct  738   GLPLPSCFPGLLTELKLKIFESLSGIDLARVGCVCSELRSLTSDNDLWKHKCVDEFK  794



>ref|XP_002893305.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69564.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=320

 Score =   172 bits (436),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 154/260 (59%), Gaps = 23/260 (9%)
 Frame = -3

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPN  1052
             A    K  S+P FL+ V  ++  D+    D   L ++VHAV+LESGFV L+   H    +
Sbjct  13    AATKSKRLSIPFFLKNVLLEKCGDTS---DLTALALSVHAVMLESGFVLLN---HGS--D  64

Query  1051  QWILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSG-NSSVH  878
             ++  ++  +S+ L Y+LPE+      +++N + +V +KFQ LG  ++VYG+L G    VH
Sbjct  65    KFSFSKELLSVSLRYTLPELI---IRKDTNTIESVTVKFQNLGPRLVVYGTLGGYGGRVH  121

Query  877   SVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIEL  698
                LDK  F+P ++         ++ +       +S  +EVF  WR VKD L +PL I L
Sbjct  122   MTYLDKRRFLPVIDSVVDTLKFEKQGS-------SSYYREVFMLWRMVKDDLVIPLWIGL  174

Query  697   CEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FEEQ  521
             C+KAG   PPC M LPTELKLKILE LP V +  M+C+C+++RYLAS++DLWKQK  EE 
Sbjct  175   CDKAGLESPPCLMLLPTELKLKILESLPGVSIGTMACVCTEMRYLASDNDLWKQKCLEEG  234

Query  520   FNADWFRNGGS--WKQKFVA  467
              +  W    G+  WK+KF +
Sbjct  235   KDCLWKLLTGNVDWKRKFAS  254



>gb|KHN01574.1| F-box protein SKIP22 [Glycine soja]
Length=269

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 139/223 (62%), Gaps = 20/223 (9%)
 Frame = -3

Query  1018  LSYSLPEI-ADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SSVHSVQLDKDHFV  848
             L Y+LPEI A+G       A  +V LKFQTLG FV V GSLS +  S +H V LDK  +V
Sbjct  22    LRYALPEILANG-------ASHSVNLKFQTLGHFVNVCGSLSDDVGSRLHFVCLDKRKYV  74

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
               L +  +N      +   + +L  S   EVFE W+ VKD LALPLLI+LCEKAGF LPP
Sbjct  75    RPLELMLANSEAKGSVNDGEDILFGS---EVFEMWKMVKDRLALPLLIDLCEKAGFDLPP  131

Query  667   CFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGGS  488
             CF RLP ELKL ILE LP VDLAK++C CS+LRYL+++++LWK+K+EE+F  +  R G  
Sbjct  132   CFTRLPMELKLLILERLPGVDLAKVACTCSELRYLSTSNELWKKKYEEEFGKEGDRKGWL  191

Query  487   WKQKFVAAMEnrk-------qrknmrrrRVFDPLRYVNPPFMG  380
             +K  F  + E +K       +R+ + R  +F P  +  PP  G
Sbjct  192   FKDLFAVSWETKKRWRAVPFRRRGISRNIIFSPNHFRMPPVWG  234



>ref|XP_003558438.1| PREDICTED: F-box protein SKIP22-like [Brachypodium distachyon]
Length=490

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 141/440 (32%), Positives = 207/440 (47%), Gaps = 48/440 (11%)
 Frame = -3

Query  1723  MKLRLRSVETK----ETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKK  1556
             MKLRLRS++ +    ET  V +P + TL ++K   +      S      ++S+RLSLN+ 
Sbjct  1     MKLRLRSMDARGGVAETHRVQLPDTATLSDVK---AFLAAKLSDAQPVPAESVRLSLNRS  57

Query  1555  DELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQK  1376
             +EL S  P  TL  LG+ SGDL+ F L+P        Q      P  P  S D+I +S  
Sbjct  58    EELLSPDPSATLVALGLASGDLLHFTLSPLRSHPPPPQAL----PRNP--SPDAIAIS--  109

Query  1375  SLELSSNLPVESTNTSD--------FNSLSDKAPelvdqgeeeevevmeidweEKDADVV  1220
              +   S  P E+  TS             S   P  +       V     D     A+ V
Sbjct  110   GIVACSTSPGEAGRTSSASLPQTIHIEPASSSPPSTLRLEPTLPVVSDSPDVVM--AEAV  167

Query  1219  GKSFSVPGFLRKVFTKELSDSDGGRDHKLLL----IAVHAVLLESGFVRLDPI-LHKKVP  1055
               + S P F+  +  +E+   + G     ++    IA+HA L+++GF+  +P        
Sbjct  168   DAAKSSPSFVIGLLKREMEAENAGSTEATVIHRFIIALHAALVDAGFLAANPPGCSLGFL  227

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSG-NSSVH  878
               W         + Y+LPEI           +  V L +  +  FV++YG + G  S VH
Sbjct  228   KDWASGALPTLTVKYTLPEIVSVLPVAEEGKI--VVLNYSLMPNFVMIYGCVPGAQSEVH  285

Query  877   SVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIEL  698
              + L+     P L +  ++ G  EE             KE+ + WR +KD + LPL++ L
Sbjct  286   RLCLELPKLAPLLYLDSNDVGEVEE-------------KEILDLWRVLKDEMCLPLMVSL  332

Query  697   CEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF  518
             C   G  LPPC M LP +LK KILE +P VDLA++ C C +L  LA++D+LWK K E +F
Sbjct  333   CRLNGLPLPPCLMALPGDLKAKILEFVPGVDLARVECTCKELGDLAADDNLWKTKCELEF  392

Query  517   NA--DWFRNGGSWKQKFVAA  464
              A  +  R   +WKQKFVAA
Sbjct  393   KACGENSRLSKNWKQKFVAA  412



>ref|XP_007148961.1| hypothetical protein PHAVU_005G029000g [Phaseolus vulgaris]
 gb|ESW20955.1| hypothetical protein PHAVU_005G029000g [Phaseolus vulgaris]
Length=387

 Score =   167 bits (422),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 146/432 (34%), Positives = 209/432 (48%), Gaps = 88/432 (20%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             M LR++ +E   T+ + +P S +L  L     +   +    S  S  S+ LSLN KDE+R
Sbjct  1     MNLRVKPLEFDRTLVIKLPNSCSLQHL-----IDTLSRILPSSSSFSSLHLSLNSKDEIR  55

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             +SSP  +L  LG+   DLIF++ NP    +  SQ   G +P  PA         +K   L
Sbjct  56    ASSPHVSLHSLGVADDDLIFYSFNP---AAFSSQTLAGDAPLTPA--------VEKHPTL  104

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRK  1184
              S             + SD+A                         ++  + S P FLR+
Sbjct  105   GSA-----------EAESDEA-------------------------LLLSTNSEPSFLRR  128

Query  1183  VFTKELSDSDGGRDH----KLLLIAVHAVLLESGFVRLDPILHKKV-----PNQWILTEP  1031
             +  + L+     R++    KLL + VH V++E GFVR+D      V     P+       
Sbjct  129   LLKEALT-----RNYLNVFKLLTLTVHRVVVEYGFVRIDKDSGTAVSCFPSPDDSPSPFS  183

Query  1030  QVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGK-FVIVYGSLSGNSS--VHSVQLDK  860
              +  L Y+LP+I  G    + N      LKFQ LG+ FV V G LS +S   +H V LD 
Sbjct  184   SMMSLRYTLPQILVGGGSHSVN------LKFQRLGQHFVNVCGGLSDDSGTRLHHVCLDT  237

Query  859   DHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGF  680
               +   L     N     E  G DG       +EVFE  + VKD +ALPLLI+LCEK G 
Sbjct  238   RRYARALESMQEN----GESKGSDG-------EEVFEMLKMVKDRVALPLLIDLCEKVGL  286

Query  679   GLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFR  500
              +PPC M+LPTELK  ILE +  VDLA+++C CS+LR+L S ++LWK+K+ E+F  +   
Sbjct  287   DIPPCLMKLPTELKELILERVAGVDLARVACTCSELRFLCSENELWKKKYLEEFGGE--S  344

Query  499   NGGSWKQKFVAA  464
              G  +K  F  +
Sbjct  345   EGSVFKDLFAVS  356



>dbj|BAK05875.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=497

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 136/439 (31%), Positives = 208/439 (47%), Gaps = 37/439 (8%)
 Frame = -3

Query  1723  MKLRLRSVETK----ETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKK  1556
             MKLRLRS++ +    ET  V +P +  L +++   S      SA     ++S+RLSLN+ 
Sbjct  1     MKLRLRSMDARGGVTETHRVQLPDTAVLSDVR---SFLAAKLSAAQPVPAESVRLSLNRS  57

Query  1555  DELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQK  1376
              ELRS  P  TL  LG+ SGDL++F L   +        T   +P+       S + S  
Sbjct  58    QELRSPDPSATLTALGLASGDLLYFTLTAELLPQPPPPQTLPRNPSPSIGQVASGSKSHG  117

Query  1375  SLELSS----NLPVESTNTS-----DFNSLSDKAPelvdqgeeeevevmeidweEKDADV  1223
                 SS    NL ++  ++S          S   P  +       V     D    +A  
Sbjct  118   EAGGSSSPPQNLHIQPVSSSLPQNLHIQPASSSLPGALLVEPSVPVASDPPDVVMTEAVH  177

Query  1222  VGKSFS--VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPN  1052
               KS S  V G L++    E +    G     L +A+ A L+++GF+  +P   +  +  
Sbjct  178   ASKSLSSLVIGILKREMEAENAGGANGTVIHRLAVALQAALVDAGFLAANPTGSRLGLLK  237

Query  1051  QWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSG-NSSVHS  875
              W         + Y+LPE+             TV L    +  +V++YG + G +S V  
Sbjct  238   DWASGAAATLTVKYTLPELVAMLPVAEEGK--TVVLNCSLMPNYVMIYGCVPGAHSEVRR  295

Query  874   VQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELC  695
             + L+     P L +  +  G +EE             KE+ E WR +KD L LPL+I LC
Sbjct  296   LCLELPKLAPLLYLDSNEVGATEE-------------KEILELWRVLKDELCLPLMISLC  342

Query  694   EKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
             +  G  LPPC M LP +LK K+LE +P V+LA++ C C +L+ LA++ DLWK++ E +F+
Sbjct  343   QLNGLRLPPCLMALPDDLKAKVLEFVPGVNLARVQCACKELQDLAADGDLWKRRCELEFS  402

Query  514   ADWFRNG--GSWKQKFVAA  464
                  +G  G+WKQ+FVAA
Sbjct  403   PSSKGSGWSGNWKQRFVAA  421



>dbj|BAK08172.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=497

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 136/439 (31%), Positives = 208/439 (47%), Gaps = 37/439 (8%)
 Frame = -3

Query  1723  MKLRLRSVETK----ETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKK  1556
             MKLRLRS++ +    ET  V +P +  L +++   S      SA     ++S+RLSLN+ 
Sbjct  1     MKLRLRSMDARGGVTETHRVQLPDTAVLSDVR---SFLAAKLSAAQPVPAESVRLSLNRS  57

Query  1555  DELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQK  1376
              ELRS  P  TL  LG+ SGDL++F L   +        T   +P+       S + S  
Sbjct  58    QELRSPDPSATLTALGLASGDLLYFTLTAELLPQPPPPQTLPRNPSPSIGQVASGSKSHG  117

Query  1375  SLELSS----NLPVESTNTS-----DFNSLSDKAPelvdqgeeeevevmeidweEKDADV  1223
                 SS    NL ++  ++S          S   P  +       V     D    +A  
Sbjct  118   EAGGSSSPPQNLHIQPVSSSLPQNLHIQPASSSLPGALLVEPSVPVASDPPDVVMTEAVH  177

Query  1222  VGKSFS--VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPN  1052
               KS S  V G L++    E +    G     L +A+ A L+++GF+  +P   +  +  
Sbjct  178   ASKSLSSLVIGILKREMEAENAGGANGTVIHRLAVALQAALVDAGFLAANPTGSRLGLLK  237

Query  1051  QWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSG-NSSVHS  875
              W         + Y+LPE+             TV L    +  +V++YG + G +S V  
Sbjct  238   DWASGAAATLTVKYTLPELVAMLPVAEKGK--TVVLNCSLMPNYVMIYGCVPGAHSEVRR  295

Query  874   VQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELC  695
             + L+     P L +  +  G +EE             KE+ E WR +KD L LPL+I LC
Sbjct  296   LCLELPKLAPLLYLDSNEVGATEE-------------KEILELWRVLKDELCLPLMISLC  342

Query  694   EKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
             +  G  LPPC M LP +LK K+LE +P V+LA++ C C +L+ LA++ DLWK++ E +F+
Sbjct  343   QLNGLRLPPCLMALPDDLKAKVLEFVPGVNLARVQCACKELQDLAADGDLWKRRCELEFS  402

Query  514   ADWFRNG--GSWKQKFVAA  464
                  +G  G+WKQ+FVAA
Sbjct  403   PSSKGSGWSGNWKQRFVAA  421



>ref|XP_009140225.1| PREDICTED: F-box protein SKIP22-like [Brassica rapa]
Length=368

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 151/258 (59%), Gaps = 22/258 (9%)
 Frame = -3

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPN  1052
             A    K  SVP  L+KV  ++  D  G     +L  +VHAV+LESGF+ L+   ++   +
Sbjct  84    ASAGSKRLSVPFLLKKVLLEKSGDESG---LTILATSVHAVMLESGFMLLN---NRGCFD  137

Query  1051  QWILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSS-VH  878
             ++  ++  +++ L Y+LPE+           V  V + FQ L   ++VYGSL G    V 
Sbjct  138   KFSFSKDLLTVSLRYTLPELI------TKTRVEYVTVTFQNLSNTIVVYGSLGGRGCMVK  191

Query  877   SVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIEL  698
              V L+K+ FV  +++        ++ +      C+S  +++F FW+ VKDGL++PLL  L
Sbjct  192   RVSLNKNRFVSVIDLVVDTLRFEKQAS------CSS-YRDMFTFWKMVKDGLSIPLLTCL  244

Query  697   CEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FEEQ  521
             CEK G  LP C M+LPTELK+KILEL+P   +AKM+C+C+++R LAS++ LWKQK  EE 
Sbjct  245   CEKYGLELPACLMQLPTELKMKILELVPGDSVAKMACICAEMRCLASDNGLWKQKCLEEA  304

Query  520   FNADWFRNGGSWKQKFVA  467
              +    R+  SWK +F A
Sbjct  305   KHLVVNRSSVSWKAEFAA  322



>ref|XP_010471030.1| PREDICTED: F-box protein SKIP22-like [Camelina sativa]
Length=389

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 128/408 (31%), Positives = 203/408 (50%), Gaps = 83/408 (20%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             M ++LR++ET ET+  +    +TL +L  +++ + P+S          +RLS+N+KD+L 
Sbjct  1     MTIQLRNLETNETLTFEFSDESTLNDLLLKINDSKPSS----------VRLSINRKDDLL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             ++S   TL  LG+ SGDLI+++L                      +S+D     QKS   
Sbjct  51    AASSQATLRSLGVKSGDLIYYSL----------------------DSSDCSAFVQKS---  85

Query  1363  SSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVG-------KSFS  1205
                   E+  +  F S+ +++    +                  A+ VG       K  S
Sbjct  86    ------EAVKSGSFPSIQNRSSNDTNH---------------GGAEEVGGMNLSGVKRLS  124

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQV  1025
              P FL+K+  +E  D+    +   +++ VHAV+LESGFV  +P L  +       +    
Sbjct  125   EPLFLKKILMEESGDT---WEFTTVVMTVHAVMLESGFVLFNPDLGMRFS----FSAGTS  177

Query  1024  SILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVP  845
               L Y+LP +       ++N    V +KF+ L   V VYGSL  +S V  V ++K  ++ 
Sbjct  178   VSLKYTLPSVI------SANGTGVVSVKFEDLVD-VEVYGSLDEDSLVDKVCINKGSYMH  230

Query  844   FLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPC  665
              +++      L E +   +     S  +EV  +WR +KDG+  PLL+ LC K G  LPPC
Sbjct  231   SVDL------LMETLESDNEQDTLSAHREVLVWWRLIKDGIVTPLLVNLCYKTGLELPPC  284

Query  664   FMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQ  521
             F+ LP ELK KIL  LP VD+A ++C+  +LR LAS++DLWKQK  E+
Sbjct  285   FISLPRELKHKILASLPGVDIAALACVTPELRGLASDNDLWKQKCLEE  332



>emb|CDY15942.1| BnaA04g11690D [Brassica napus]
Length=368

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/253 (38%), Positives = 149/253 (59%), Gaps = 22/253 (9%)
 Frame = -3

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILT  1037
             K  SVP  L+KV  ++  D  G     +L  +VHAV+LESGF+ L+   ++   +++  +
Sbjct  89    KRLSVPFHLKKVLLEKSGDESG---LTILATSVHAVMLESGFLLLN---NRGCFDKFTFS  142

Query  1036  EPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSS-VHSVQLD  863
             +  +++ L Y+LPE+           V  V + FQ+L   ++VYGSL G    V  V L+
Sbjct  143   KDLLTVSLRYTLPELI------TKTRVEYVTVTFQSLSNTIVVYGSLGGRGCMVKRVSLN  196

Query  862   KDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAG  683
             K+ FV  +++        ++ +      C+S  ++VF FW+ VKDGL++PL+  LCEK G
Sbjct  197   KNRFVSVIDLVVDTLRFEKQAS------CSS-YRDVFTFWKMVKDGLSIPLMTCLCEKYG  249

Query  682   FGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FEEQFNADW  506
               LPPC M LP ELK+KILEL+P   +AKM+C+C++++ LAS+D LWK K  EE  +   
Sbjct  250   LELPPCLMFLPRELKMKILELVPGDSVAKMACVCAEMQCLASDDGLWKHKCLEEAKHLVV  309

Query  505   FRNGGSWKQKFVA  467
              R+  SWK +F A
Sbjct  310   NRSSVSWKAEFAA  322



>ref|XP_010415712.1| PREDICTED: F-box protein SKIP22-like [Camelina sativa]
Length=389

 Score =   160 bits (406),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 128/404 (32%), Positives = 205/404 (51%), Gaps = 75/404 (19%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             M ++LR++ET ET+  +    +TL +L+ +++ + P+S          +RLS+N+KD+L 
Sbjct  1     MTIQLRNLETNETLTFEFSDESTLNDLRLKINDSTPSS----------VRLSINRKDDLL  50

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLEL  1364
             ++S   TL  LG+ SG LI+++L                      +S+D     QKS  +
Sbjct  51    AASSQATLRSLGVNSGYLIYYSL----------------------DSSDCSAFVQKSETV  88

Query  1363  -SSNLP-VESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVG-KSFSVPGF  1193
              S ++P  ++ ++SD N                         E    ++ G K  S P F
Sbjct  89    KSGSIPSFQNQSSSDTNH--------------------GGAEELGGMNLSGVKRVSEPLF  128

Query  1192  LRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS  1013
             L+K+  +E  D+    +   +++ VHAV+LESGFV  +P L  +       +      L 
Sbjct  129   LKKILMEESGDT---WEFTTVVMTVHAVMLESGFVLFNPDLGMRFS----FSAGTSVSLK  181

Query  1012  YSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNV  833
             Y+LP +       ++N    V +KF+ L   V VYGSL  +S V  V ++K  ++  +++
Sbjct  182   YTLPSVI------SANGTEVVSVKFEDLVD-VEVYGSLDEDSLVDKVCINKRSYMHIVDL  234

Query  832   AWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRL  653
                   L E +   +     S  +EV  +WR +KDG+  PLL+ LC K G  LPPCF+ L
Sbjct  235   ------LMETLESDNEQDTLSAHREVLVWWRLIKDGIVTPLLVNLCYKTGLELPPCFISL  288

Query  652   PTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQ  521
             P ELK KIL  LP VD+A ++C+  +LR LAS++DLWKQK  E+
Sbjct  289   PRELKHKILASLPGVDIAALACVSPELRDLASDNDLWKQKCLEE  332



>ref|XP_007149055.1| hypothetical protein PHAVU_005G037100g [Phaseolus vulgaris]
 gb|ESW21049.1| hypothetical protein PHAVU_005G037100g [Phaseolus vulgaris]
Length=357

 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 141/416 (34%), Positives = 200/416 (48%), Gaps = 110/416 (26%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELK---RRlslalpassafsmhssdSIRLSLNKKD  1553
             MKLRLRS+E   T+ + VP S +L +L      +  +  + S +   S  S+ LS N KD
Sbjct  1     MKLRLRSLEFNGTLKIKVPNSCSLQQLIDTLSHIISSSCSDSDYYDSSPSSLHLSFNGKD  60

Query  1552  ELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKS  1373
             E+R+SSP ++L  LG+                +++  I    +P   + S D  ++    
Sbjct  61    EIRASSPHDSLHSLGV----------------AADDLIFYSFNPTPESASCDRPSVQ---  101

Query  1372  LELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGF  1193
                  N P          + +  AP                      + VV  + S   F
Sbjct  102   -----NAP---------ETFAGDAP----------------------SAVVLSTSSEAFF  125

Query  1192  LRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLD-------PILHKKVPNQWILTE  1034
             +R+V  KE+  +D   D KLL++ VH V++E GFVR+D          H   P   +++ 
Sbjct  126   VRRV-PKEVLGNDLN-DLKLLVLTVHRVVVEYGFVRIDKEPGTAVSCFHSPSPFSSMIS-  182

Query  1033  PQVSILSYSLPEI-ADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSS--VHSVQLD  863
                  L Y+LPEI  DG +        +V LKFQTLG FVIV   LS +S   +H V LD
Sbjct  183   -----LRYTLPEILVDGGSH-------SVNLKFQTLGHFVIVCVGLSDDSGWRLHHVCLD  230

Query  862   KDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAG  683
             K                  E  G D          VFE  + VKD +ALPLLI+LCEK+G
Sbjct  231   KG-----------------ESKGSD----------VFEMLKMVKDRVALPLLIDLCEKSG  263

Query  682   FGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
               LPPCFM L  ELKL ILE +  VDLAK++C CS+LR+L ++++LWK+K+ E+F 
Sbjct  264   LDLPPCFMELVMELKLLILERVHGVDLAKVACTCSELRFLCNDNELWKKKYLEEFG  319



>ref|NP_173789.1| F-box family protein [Arabidopsis thaliana]
 sp|Q9ZUB9.1|FB17_ARATH RecName: Full=Putative F-box protein At1g23770 [Arabidopsis thaliana]
 gb|AAC98032.1| Contains similarity to gb|L26505 Met30p from Saccharomyces cerevisiae 
[Arabidopsis thaliana]
 gb|AEE30430.1| F-box family protein [Arabidopsis thaliana]
Length=350

 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 155/260 (60%), Gaps = 23/260 (9%)
 Frame = -3

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPN  1052
             A    K  S P FL+ V  ++  D+    D   L ++VHAV+LESGFV LD   H    +
Sbjct  36    AAAKSKRLSEPFFLKNVLLEKSGDTS---DLTALALSVHAVMLESGFVLLD---HGS--D  87

Query  1051  QWILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSS-VH  878
             ++  ++  +S+ L Y+LPE+    T +++N V +V ++FQ +G  ++VYG+L G+   VH
Sbjct  88    KFSFSKKLLSVSLRYTLPELI---TRKDTNTVESVTVRFQNIGPRLVVYGTLGGSCKRVH  144

Query  877   SVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIEL  698
                LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI L
Sbjct  145   MTSLDKSRFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELVIPLLIGL  197

Query  697   CEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FEEQ  521
             C+KAG   PPC M LPTELKLKILELLP V +  M+C+C+++RYLAS++DLW+ K  EE 
Sbjct  198   CDKAGLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWEHKCLEEG  257

Query  520   FNADW--FRNGGSWKQKFVA  467
                 W  +     WK+KF +
Sbjct  258   KGCLWKLYTGDVDWKRKFAS  277



>ref|XP_006422750.1| hypothetical protein CICLE_v10028907mg [Citrus clementina]
 gb|ESR35990.1| hypothetical protein CICLE_v10028907mg [Citrus clementina]
Length=307

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/248 (41%), Positives = 142/248 (57%), Gaps = 15/248 (6%)
 Frame = -3

Query  1198  GFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI  1019
              FL++VF +  S +D   D  +L +AVHAV+L+SGFV   P   KK+    +   P  + 
Sbjct  52    SFLKRVFEEAGSLADDD-DSGILRVAVHAVMLQSGFVCFVPESKKKIDGSQL---PNPTQ  107

Query  1018  LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSV-HSVQLDKDHFVPF  842
             ++Y+LPE  D     N   + TV LKF+  G    + GSLS    V H + L+   FVP 
Sbjct  108   VNYTLPEAFDF---SNFTKIETVVLKFEDSGDLFHIEGSLSEKEPVVHQLSLNPTRFVPP  164

Query  841   LNVAWSNCGLSEEIAGKDGLLCTS----PEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             L++A+ N   S+ I  +  +  +S    PE EVFE  R V D L  PLLI+L  K G   
Sbjct  165   LDLAFVN---SDMIDSRIRMCGSSSNQYPENEVFELHRLVSDALVYPLLIDLRLKLGLIP  221

Query  673   PPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNG  494
             PPCFMRLP ELK KIL+LL  VD+A+ + +CS+LR LA +D+LW++K +E+F        
Sbjct  222   PPCFMRLPAELKRKILDLLIGVDIARAASVCSELRNLAKDDELWRRKCKEEFGFRGSFRR  281

Query  493   GSWKQKFV  470
              SWK  ++
Sbjct  282   ESWKIMYM  289



>gb|KDO49536.1| hypothetical protein CISIN_1g038588mg [Citrus sinensis]
Length=307

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 102/250 (41%), Positives = 143/250 (57%), Gaps = 19/250 (8%)
 Frame = -3

Query  1198  GFLRKVFTK--ELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQV  1025
              FL++VF +   L+D D   D  +L +AVHAV+L+SGFV   P   KK+    +   P  
Sbjct  52    SFLKRVFEEAGSLADDD---DSGILRVAVHAVMLQSGFVCFVPESKKKIDGSQL---PNP  105

Query  1024  SILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSV-HSVQLDKDHFV  848
             + ++Y+LPE  D     N   + TV LKF+  G    + GSLS    V H + L+   FV
Sbjct  106   TQVNYTLPEAFDF---SNFTKIETVVLKFEDSGDLFHIEGSLSEKEPVVHQLSLNPTRFV  162

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTS----PEKEVFEFWRTVKDGLALPLLIELCEKAGF  680
             P L++A+ N   S+ I  +  +  +S    PE EVFE  R V D L  PLLI+L  K G 
Sbjct  163   PPLDLAFVN---SDMIDSRIRMCGSSSNQYPENEVFELHRLVSDALVYPLLIDLRLKLGL  219

Query  679   GLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFR  500
               PPCFMRLP ELK KIL+LL  VD+A+ + +CS+LR LA +D+LW++K +E+F      
Sbjct  220   IPPPCFMRLPAELKRKILDLLIGVDIARAASVCSELRNLAKDDELWRRKCKEEFGFRGSF  279

Query  499   NGGSWKQKFV  470
                SWK  ++
Sbjct  280   RRESWKIMYM  289



>emb|CDX99652.1| BnaC04g34090D [Brassica napus]
Length=236

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 130/217 (60%), Gaps = 19/217 (9%)
 Frame = -3

Query  1108  LLESGFVRLDPILHKKVPNQWILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQT  932
             +LESGF+ L+   ++   +++  ++  +++ L Y+LPE+           V  V + FQ+
Sbjct  1     MLESGFMLLN---NRGFFDKFTFSKDLLTVSLRYTLPELI------TKTRVEYVTVTFQS  51

Query  931   LGKFVIVYGSLSGNSS-VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEV  755
             L   V+VYGSL G    V  V L+K+ FV  +++        ++ +        S  ++V
Sbjct  52    LSNTVVVYGSLGGRGGMVQRVSLNKNKFVSVIDLVVDTLKFEKQAS-------CSSYRDV  104

Query  754   FEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSD  575
             F FW+ VKDGL++PLL  LCEK G  LPPC M+LPTELK+KILEL+P   +AKM+C+C++
Sbjct  105   FTFWKMVKDGLSIPLLTCLCEKYGLELPPCLMQLPTELKMKILELVPGDSVAKMACVCAE  164

Query  574   LRYLASNDDLWKQKFEEQFNADWF-RNGGSWKQKFVA  467
             +R LAS+D LWK K  E+ N     R+  SWK +F A
Sbjct  165   MRCLASDDGLWKHKCLEEANHLVVNRSSVSWKAEFAA  201



>ref|XP_009335274.1| PREDICTED: putative F-box protein At1g23770 [Pyrus x bretschneideri]
Length=265

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 131/250 (52%), Gaps = 32/250 (13%)
 Frame = -3

Query  1195  FLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQ--------W-I  1043
             FLR+  T+EL+D     +H+ L+IAVHAV LESGFV +DPI  K+  +Q        W  
Sbjct  18    FLRRALTEELADERS--NHERLIIAVHAVFLESGFVSIDPISGKQTDDQDRPRLLDKWST  75

Query  1042  LTEPQVSILSYSLPEIADGDTD----------QNSNAVPT---VELKFQTLGKFVIVYGS  902
             L + Q   L Y+ P+I    T+           N N +     ++L FQ+ G FV VY S
Sbjct  76    LDQSQTMWLYYTFPQILQNWTNIEKSNGWTNIGNYNVIEGGGGIQLMFQSRGNFVNVYPS  135

Query  901   LSGN-----SSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRT  737
             LSG      S +H + LD+  F P +   W+   +  ++  +D     SPEKE+ E W+ 
Sbjct  136   LSGYRLGLYSPIHHLCLDEQRFCPAIEFLWATRDV--DLGDRDLHQYQSPEKEILELWKI  193

Query  736   VKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLAS  557
               D + LP LIELC  AG   P  FM L  ELK KI E L  VD+ K+ C+C  LR   +
Sbjct  194   SMDEIVLPFLIELCPMAGLPAPTVFMDLLPELKRKIFESLSGVDIVKVPCVCKKLRNRVN  253

Query  556   ND-DLWKQKF  530
             +D + WK KF
Sbjct  254   DDQEFWKHKF  263



>ref|XP_010427808.1| PREDICTED: F-box protein SKIP22 [Camelina sativa]
Length=394

 Score =   149 bits (375),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 125/429 (29%), Positives = 206/429 (48%), Gaps = 85/429 (20%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNK--KDE  1550
             M + LR++ET ET+  +    +TL +L+ +++ + P+S          + LS+N+  +DE
Sbjct  1     MTIHLRNLETNETLTFEFSDESTLHDLRLKINDSTPSS----------VGLSINRNDEDE  50

Query  1549  LRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSL  1370
             L + S   TL  LG+ SGDLI F+L+ + + +   + +      + A S  SI  +Q S 
Sbjct  51    LLAVSSQATLRSLGVKSGDLICFSLDSSDRSAFAQKKSETNHQAIEAVSIPSIQ-NQSSN  109

Query  1369  ELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFL  1190
             + +++   E     + + +                                K  S P FL
Sbjct  110   DTTNHGGAEELGGMNLSGV--------------------------------KRLSEPLFL  137

Query  1189  RKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILSY  1010
             +K+  +E  D+    +   +++ VHAV+L+SGFV  +P L  +       +      L Y
Sbjct  138   KKILMEESGDT---WEFTTVVMTVHAVMLDSGFVLFNPDLGMRFS----FSAGTSVSLKY  190

Query  1009  SLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVA  830
             +LP +       ++N    V L F+ L   V VYGSL  +S V  V ++K  ++  +++ 
Sbjct  191   TLPSVI------SANGTEVVTLNFEDLVD-VEVYGSLDEDSLVDKVCINKRSYMNIVDLL  243

Query  829   WSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLP  650
               +   +EE+         S  ++V  +WR +KDG+  PLL+ LC K G  LPPCF+ LP
Sbjct  244   MESD--NEEVT-------LSVHRKVLVWWRMIKDGIVTPLLVNLCYKTGLELPPCFISLP  294

Query  649   TELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQ-----------------KFEEQ  521
              ELK KIL  LP VD+A ++C+  +LR +AS+ DLWKQ                 K++E 
Sbjct  295   RELKHKILASLPGVDIAALACVSPELRDMASDSDLWKQKCLEECKHLVTEGNDVVKWKEM  354

Query  520   FNADWFRNG  494
             F + W R G
Sbjct  355   FASYWTRKG  363



>ref|XP_008382804.1| PREDICTED: putative F-box protein At1g23770 [Malus domestica]
Length=266

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/256 (38%), Positives = 134/256 (52%), Gaps = 32/256 (13%)
 Frame = -3

Query  1195  FLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQ--------W-I  1043
             FLR+  T+EL+D     +H+ L+IAVHAVLLESGFV +DPI  K+  +Q        W  
Sbjct  15    FLRRALTEELADERS--NHERLVIAVHAVLLESGFVPIDPISGKQTDDQDRPHLLDKWST  72

Query  1042  LTEPQVSILSYSLPEIADGDTD----------QNSNAVPT---VELKFQTLGKFVIVYGS  902
             L + Q   + Y+LP+I    T+           N N +     ++L  Q+ G FV VY S
Sbjct  73    LDQSQTMWVYYTLPQILQNWTNIEKSKGWTITGNYNVIEGGGGIQLMIQSRGNFVNVYPS  132

Query  901   LSGN-----SSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRT  737
             LSG      S +H + LD+  F P +   W+N  +  ++  +D     SPEKE+ E W+ 
Sbjct  133   LSGYRLGLYSPIHHLCLDEQRFCPAIEFLWANRDV--DLGDRDLHQYQSPEKEILELWKI  190

Query  736   VKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLAS  557
               D + LP LIELC  AG   P  FM L  E+K KI E L  VD+ K+  +C  LR L +
Sbjct  191   XXDEIVLPFLIELCPMAGLPAPTVFMDLLPEIKRKIFESLSGVDILKVPGVCKKLRNLVN  250

Query  556   ND-DLWKQKFEEQFNA  512
             +D + WK KF  +   
Sbjct  251   DDQEFWKHKFRSRVEG  266



>ref|XP_006304729.1| hypothetical protein CARUB_v10012066mg [Capsella rubella]
 gb|EOA37627.1| hypothetical protein CARUB_v10012066mg [Capsella rubella]
Length=377

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/260 (39%), Positives = 151/260 (58%), Gaps = 23/260 (9%)
 Frame = -3

Query  1237  KDADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKV  1058
             K A  V K FS+  FL+K+  ++  D     D  +L+++VHAV+LESGF+ LD       
Sbjct  22    KIAPAVSKRFSITFFLKKILLEKSGDDS---DLTILVLSVHAVMLESGFLLLD-----HG  73

Query  1057  PN-QWILTEPQVSI-LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSS  884
             PN ++  ++  +S+ L YSLPE+    + +++N + +V L+F  +G  V+VYG+L G   
Sbjct  74    PNDRFSFSKKLLSVSLRYSLPELI---SRKDNNKLESVTLRFHNIGPRVVVYGTLGGTGE  130

Query  883   -VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLL  707
              V+   L K  FVP +++        +E +       +   ++VF FWR VKD + +PLL
Sbjct  131   RVYMTSLAKRRFVPVIDLVVDTLKFEKESS-------SIHYRQVFMFWRMVKDDVVIPLL  183

Query  706   IELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-F  530
               LCEK G   PP  + LP EL LKILE LP V +  M+C+C++LR +AS++DLWKQK  
Sbjct  184   TRLCEKTGLDPPPSLLSLPPELTLKILESLPGVSIGHMACVCTELRGVASDNDLWKQKCL  243

Query  529   EEQFNADWFRNGG-SWKQKF  473
             EE  N  W   G   WK++F
Sbjct  244   EEAKNHIWTLTGRIDWKRRF  263



>gb|EEE58649.1| hypothetical protein OsJ_10030 [Oryza sativa Japonica Group]
Length=436

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 140/250 (56%), Gaps = 32/250 (13%)
 Frame = -3

Query  1177  TKELSDSDGGRDHKL---LLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQVSILSY  1010
             TK   ++ GG D  +   L++A+HA LL++GF+  +P+    ++P  W         + Y
Sbjct  133   TKREMENVGGADGTVICRLVVALHAALLDAGFLYANPVGSCLQLPQNWASGSFVPVSMKY  192

Query  1009  SLPEIADGDTDQNSNAVPTVE------LKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFV  848
             +LPE+ +        A+P VE      L +  +G F++VYG + G +S   V+       
Sbjct  193   TLPELVE--------ALPVVEEGMVAVLNYSLMGNFMMVYGHVPGATS--GVRRLCLELP  242

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
                 + + +   S+E++       T+ E+E+ E WR +KD + LPL+I LC+     LPP
Sbjct  243   ELAPLLYLD---SDEVS-------TAEEREIHELWRVLKDEMCLPLMISLCQLNNLSLPP  292

Query  667   CFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN--ADWFRNG  494
             C M LP ++K K+LE +P VDLA++ C C +LR LA++D+LWK+K E +FN   +  + G
Sbjct  293   CLMALPGDVKAKVLEFVPGVDLARVQCTCKELRDLAADDNLWKKKCEMEFNTQGESSQVG  352

Query  493   GSWKQKFVAA  464
              +WK++F AA
Sbjct  353   RNWKERFGAA  362



>gb|ABF94799.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=482

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 140/250 (56%), Gaps = 32/250 (13%)
 Frame = -3

Query  1177  TKELSDSDGGRDHKL---LLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQVSILSY  1010
             TK   ++ GG D  +   L++A+HA LL++GF+  +P+    ++P  W         + Y
Sbjct  179   TKREMENVGGADGTVICRLVVALHAALLDAGFLYANPVGSCLQLPQNWASGSFVPVSMKY  238

Query  1009  SLPEIADGDTDQNSNAVPTVE------LKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFV  848
             +LPE+ +        A+P VE      L +  +G F++VYG + G +S   V+       
Sbjct  239   TLPELVE--------ALPVVEEGMVAVLNYSLMGNFMMVYGHVPGATS--GVRRLCLELP  288

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
                 + + +   S+E++       T+ E+E+ E WR +KD + LPL+I LC+     LPP
Sbjct  289   ELAPLLYLD---SDEVS-------TAEEREIHELWRVLKDEMCLPLMISLCQLNNLSLPP  338

Query  667   CFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN--ADWFRNG  494
             C M LP ++K K+LE +P VDLA++ C C +LR LA++D+LWK+K E +FN   +  + G
Sbjct  339   CLMALPGDVKAKVLEFVPGVDLARVQCTCKELRDLAADDNLWKKKCEMEFNTQGESSQVG  398

Query  493   GSWKQKFVAA  464
              +WK++F AA
Sbjct  399   RNWKERFGAA  408



>ref|XP_006486881.1| PREDICTED: F-box protein SKIP22-like [Citrus sinensis]
Length=307

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 104/250 (42%), Positives = 144/250 (58%), Gaps = 19/250 (8%)
 Frame = -3

Query  1198  GFLRKVFTK--ELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQV  1025
              FL++VF +   L+D D   D  +L +AVHAV+L+SGFV   P   KK+    +   P  
Sbjct  52    SFLKRVFEEAGSLADDD---DSGILRVAVHAVMLQSGFVCFVPESKKKIDGSQL---PNP  105

Query  1024  SILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSV-HSVQLDKDHFV  848
             + ++Y+LPE  D     N   + TV LKF+  G    + GSLS    V H + L+   FV
Sbjct  106   TQVNYTLPEAFDF---SNFTKIETVVLKFEDSGDLFHIEGSLSEKEPVVHQLSLNPTRFV  162

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTS----PEKEVFEFWRTVKDGLALPLLIELCEKAGF  680
             P L++A+ N   S+ I  +  +  +S    PE EVFE  R V D L  PLLI+L  K G 
Sbjct  163   PPLDLAFVN---SDMIDSRIRMCGSSSNQYPENEVFELHRLVSDALVYPLLIDLRLKLGL  219

Query  679   GLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFR  500
               PPCFMRLP ELKLKILELL  VD+A+ + +CS+LR LA +D+LW++K +E+F      
Sbjct  220   IPPPCFMRLPAELKLKILELLIGVDIARAASVCSELRNLAKDDELWRRKCKEEFGFRGSF  279

Query  499   NGGSWKQKFV  470
                SWK  ++
Sbjct  280   RRESWKIMYM  289



>ref|XP_004301718.1| PREDICTED: putative F-box protein At1g23770-like [Fragaria vesca 
subsp. vesca]
Length=295

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 139/259 (54%), Gaps = 37/259 (14%)
 Frame = -3

Query  1210  FSVPGFLRKVFTKELSDSDGGRDHK---LLLIAVHAVLLESGFVRLDPI--LHKKVPNQW  1046
             +S+   LR+V  +EL+  D  R+HK   LL+ AVHAVLL+SGFVR      +H  +    
Sbjct  21    YSLSLSLRRVLKEELAPQDLHRNHKNNKLLVAAVHAVLLDSGFVRFSSATSVHDALSEFG  80

Query  1045  ILTEPQVSILS--YSLPEI-ADGDTDQNSNAVPT--VELKFQTLGKF-------------  920
                   VS +S  Y+LP+I A  D    S+ + T    LKF+ LG++             
Sbjct  81    FSEFGSVSGMSHSYTLPQILAQQDNKDCSSNLKTQGFVLKFEYLGQYFSPHQKRTRHVAP  140

Query  919   --VIVYGSLSGNSSVHS-------VQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSP  767
               V V GSL  + S          +++D++ F P     W N      +     +     
Sbjct  141   RIVRVSGSLISSGSRFGEKDKEVCLEVDENKFAPAFEFFWGN-----SMRNTTAIFLRFR  195

Query  766   EKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSC  587
             E++V EFWR VKD +ALPL+I++C +AG   P C M LP ELK++ILE +P+V+LAK+  
Sbjct  196   ERQVREFWRMVKDEIALPLMIDICAEAGLPAPLCLMTLPPELKVQILEAMPSVELAKVGG  255

Query  586   LCSDLRYLASNDDLWKQKF  530
             +C +LR LA++++LWK K 
Sbjct  256   VCKELRDLANDNELWKHKL  274



>ref|NP_001049465.1| Os03g0232000 [Oryza sativa Japonica Group]
 dbj|BAF11379.1| Os03g0232000 [Oryza sativa Japonica Group]
Length=475

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 140/250 (56%), Gaps = 32/250 (13%)
 Frame = -3

Query  1177  TKELSDSDGGRDHKL---LLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQVSILSY  1010
             TK   ++ GG D  +   L++A+HA LL++GF+  +P+    ++P  W         + Y
Sbjct  172   TKREMENVGGADGTVICRLVVALHAALLDAGFLYANPVGSCLQLPQNWASGSFVPVSMKY  231

Query  1009  SLPEIADGDTDQNSNAVPTVE------LKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFV  848
             +LPE+ +        A+P VE      L +  +G F++VYG + G +S   V+       
Sbjct  232   TLPELVE--------ALPVVEEGMVAVLNYSLMGNFMMVYGHVPGATS--GVRRLCLELP  281

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
                 + + +   S+E++       T+ E+E+ E WR +KD + LPL+I LC+     LPP
Sbjct  282   ELAPLLYLD---SDEVS-------TAEEREIHELWRVLKDEMCLPLMISLCQLNNLSLPP  331

Query  667   CFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN--ADWFRNG  494
             C M LP ++K K+LE +P VDLA++ C C +LR LA++D+LWK+K E +FN   +  + G
Sbjct  332   CLMALPGDVKAKVLEFVPGVDLARVQCTCKELRDLAADDNLWKKKCEMEFNTQGESSQVG  391

Query  493   GSWKQKFVAA  464
              +WK++F AA
Sbjct  392   RNWKERFGAA  401



>ref|XP_006302363.1| hypothetical protein CARUB_v10020430mg [Capsella rubella]
 gb|EOA35261.1| hypothetical protein CARUB_v10020430mg [Capsella rubella]
Length=391

 Score =   137 bits (345),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 134/424 (32%), Positives = 200/424 (47%), Gaps = 77/424 (18%)
 Frame = -3

Query  1720  KLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELRS  1541
             K+ LR++ET ETI  +     TL +L+ ++    P+S          +RLS++  DEL  
Sbjct  3     KIHLRNLETNETITFEFSDECTLHDLQLKIKEPSPSS----------VRLSIHLNDELLE  52

Query  1540  SSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLELS  1361
              S   TL+ LG+ SGD+I ++L+ +   +   +  T       AES  S+  SQ   E  
Sbjct  53    VSSQATLQSLGVKSGDIISYSLDSSDCSAVVPKSETNHQATEAAES-GSVPRSQNEAE--  109

Query  1360  SNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSVPGFLRKV  1181
                  E     + + L                                K  S P FL+K+
Sbjct  110   ----AEELGGMNLSGL--------------------------------KRLSEPLFLKKI  133

Query  1180  FTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILSYSLP  1001
               ++  D+    +   +++ VHAV+LESGFV   P L   +P  +   +     L Y+LP
Sbjct  134   LMEKCGDT---WELTTVVMTVHAVMLESGFVLFGPDL--GLP--FSFADVNEVSLKYTLP  186

Query  1000  E--IADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAW  827
                IA G     S  V T  LKF+ LG  V VYG L+    V  V ++K  ++   ++  
Sbjct  187   SSVIASG-----SEVVIT--LKFENLGD-VEVYGYLNEEMLVDKVSVNKSSYMHAADLLM  238

Query  826   SNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPT  647
                  + E   +D L      +EV  +WR +KD +  PLL++LC K G  LPPCF+ LP 
Sbjct  239   E----TSESDNEDTL--RVHHREVRVWWRRIKDCIVTPLLVDLCYKLGLELPPCFVILPR  292

Query  646   ELKLKILELLPAVDLAKMSCLCSDLRYLASND-DLWKQKFEEQFNADWFRNGG---SWKQ  479
             ELK KILE L  VD+A ++C+ ++LR L S+D +LWKQK  E    D  R G    +WK+
Sbjct  293   ELKHKILEQLHGVDIAALACVSTELRELTSSDNELWKQKCLE-VCKDLVRGGNDEVNWKE  351

Query  478   KFVA  467
             +F  
Sbjct  352   RFAG  355



>gb|EMT20422.1| Putative F-box protein [Aegilops tauschii]
Length=326

 Score =   135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/261 (33%), Positives = 136/261 (52%), Gaps = 29/261 (11%)
 Frame = -3

Query  1216  KSFS--VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQW  1046
             KS S  V G L++    E +    G     L +++ A L+++GF+  +P+  +  +   W
Sbjct  9     KSLSSLVIGILKRQMEAENAGGANGTVIHRLAVSLQAALVDAGFLAENPMGSRLGLLKDW  68

Query  1045  ILTEPQVSILSYSLPEIA----DGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSG-NSSV  881
                      + Y+LPE+     +G+  +      TV L    +  FV++YG + G +S V
Sbjct  69    ASGAAATLTVKYTLPELVAMLPEGEEGK------TVVLNCSLMPNFVMIYGCVPGAHSEV  122

Query  880   HSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
               + L+     P L +  +  G +EE             KE+ E WR +KD L LPL+I 
Sbjct  123   RRLCLELPKLAPLLYLDSNEVGATEE-------------KEILELWRVLKDELCLPLMIS  169

Query  700   LCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQ  521
             LC+  G  LPPC M LP +LK K+LE +P V LA++ C C +L+ LA++D+LWK + E +
Sbjct  170   LCQLNGLRLPPCLMALPGDLKAKVLEFVPGVGLARVQCACKELQDLAADDNLWKMRLELE  229

Query  520   FNADWFRNG--GSWKQKFVAA  464
              +     +G  G+WKQ+FVAA
Sbjct  230   MSPSSKGSGWSGNWKQRFVAA  250



>ref|XP_002887295.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63554.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=187

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 113/197 (57%), Gaps = 21/197 (11%)
 Frame = -3

Query  1135  LLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             ++++ VHAV+L+SGFV  DP        ++  +E  +  L+Y+L  +             
Sbjct  12    IVVMTVHAVMLKSGFVLFDP----DSSMRFSFSEETLVSLNYTLASVK-----------G  56

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLC  776
              V L F+ LG  V+VYGSLS  S V  V +DK   V  +++        +E   +D L  
Sbjct  57    IVSLNFENLGGEVVVYGSLSAGSLVGMVSIDKRRSVHIVDLLMDTSKSDKE---EDTL--  111

Query  775   TSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAK  596
              S  +EV  +WR +KDG+  PLL++LCE  G  LPPCF+ LP ELK KILE LP VD+A 
Sbjct  112   -SIHREVLVWWRMIKDGIVTPLLVDLCEITGLELPPCFICLPRELKHKILESLPGVDIAT  170

Query  595   MSCLCSDLRYLASNDDL  545
             ++C+ S+LR LAS +DL
Sbjct  171   LACVSSELRDLASENDL  187



>gb|EEC74815.1| hypothetical protein OsI_10635 [Oryza sativa Indica Group]
Length=479

 Score =   135 bits (340),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 86/254 (34%), Positives = 139/254 (55%), Gaps = 43/254 (17%)
 Frame = -3

Query  1177  TKELSDSDGGRDHKL---LLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSI----  1019
             TK   ++ GG D  +   L++A+HA LL++GF+  +P+          L  PQ       
Sbjct  179   TKREMENVGGADGTVICRLVVALHAALLDAGFLYANPV-------GSCLQLPQSGSFVPV  231

Query  1018  -LSYSLPEIADGDTDQNSNAVPTVE------LKFQTLGKFVIVYGSLSGNSSVHSVQLDK  860
              + Y+LPE+ +        A+P VE      L +  +G F++VYG + G +S   V+   
Sbjct  232   SMKYTLPELVE--------ALPAVEEGMVAVLNYSLMGNFMMVYGHVPGATS--GVRRLC  281

Query  859   DHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGF  680
                     + + +   S+E++       T+ E+E+ E WR +KD + LPL+I LC+    
Sbjct  282   LELPELAPLLYLD---SDEVS-------TAEEREIHELWRVLKDEMCLPLMISLCQLNNL  331

Query  679   GLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN--ADW  506
              LPPC M LP ++K K+LE +P VDLA++ C C +LR LA++D+LWK+K E +FN   + 
Sbjct  332   SLPPCLMALPGDVKAKVLEFVPGVDLARVQCTCKELRDLAADDNLWKKKCEMEFNTQGES  391

Query  505   FRNGGSWKQKFVAA  464
              + G +WK++F AA
Sbjct  392   SQVGRNWKERFGAA  405



>ref|XP_010904578.1| PREDICTED: putative F-box protein At1g23770 [Elaeis guineensis]
Length=342

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 132/247 (53%), Gaps = 34/247 (14%)
 Frame = -3

Query  1195  FLRKVFTKELSDSDG--GRDHKLLLIAVHAVLLESGFVRLD---PILHKKVPNQWILTEP  1031
             FL +V T E + S G  GR    L+IAVHAV L+ GFV  D   P+L    P+ W     
Sbjct  21    FLMRVMTDEKAKSKGNLGR----LVIAVHAVFLDCGFVLADAGEPLL----PDGWHSPSA  72

Query  1030  QVSILSYSLPEIADGDTDQNSNAVPTVELKFQ-TLGKFVIVYGSLSG-NSSVHSVQLDKD  857
              VS+       ++    + N  AV    L F  T    V + GSL   +S ++ +  D  
Sbjct  73    TVSVRYTLPKLLSPLPPESNGTAV---VLSFSATALDDVSINGSLDQPDSRIYRISFDIS  129

Query  856   HFV-PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGF  680
                 P +    S  G++E+            EK+V + WRTV D L+ PLLIE+C K G 
Sbjct  130   KLAGPLIK---SMHGMNEK-----------EEKKVLKLWRTVSDELSRPLLIEICSKNGL  175

Query  679   GLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFR  500
              +P   M LPT+LK +IL+ LP VDLA+M C+C++ + LAS+D LWKQKFEE+F + W  
Sbjct  176   PVPYSLMSLPTDLKTRILDFLPGVDLARMQCVCAEWKQLASSDQLWKQKFEEEFGS-WAV  234

Query  499   NGGSWKQ  479
             +  +WK+
Sbjct  235   DSATWKE  241



>tpg|DAA44190.1| TPA: hypothetical protein ZEAMMB73_495019 [Zea mays]
Length=480

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 133/431 (31%), Positives = 194/431 (45%), Gaps = 78/431 (18%)
 Frame = -3

Query  1723  MKLRLRSVETK------ETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLN  1562
             MKLRLRS++ +      ET  VD+PP+ TL ++K   +L     SA     ++S+RLSLN
Sbjct  1     MKLRLRSMQARGGSAAVETHRVDLPPTATLADVK---TLLASKLSAAQPVPAESVRLSLN  57

Query  1561  KKDELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLS  1382
             + +EL S  P  TL  LG+ SGDL+FF L+P    +  +Q      P  P+ S+ +    
Sbjct  58    RSEELVSPDPAATLPSLGLASGDLVFFTLSPLTALAPPAQAL----PRNPSPSSGAAASI  113

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSV  1202
              ++ +       + + T DF+S S                          A VV  SF V
Sbjct  114   AEAADRGKG--SKQSGTGDFSSSS-----------------------LAQAVVVSPSFPV  148

Query  1201  PGFLRKVFTKELS-DSDGG------RDHKLLLIAVHAV---------------LLESGFV  1088
                 R V  +E + D+  G      RD K  +  V A                LL++GF+
Sbjct  149   ASGTRDVVMEEEAVDATKGWSSFVLRDLKREMDNVGAAEGTAAGRLVAALHAALLDAGFL  208

Query  1087  RLDPI-LHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIV  911
                    H  +P  W     +   + Y++PE++   +      V  V L +  +  FV+V
Sbjct  209   TAKLTGSHLSLPQGWPSGALKPLTIKYTIPELSSMVSVTEEGKV--VVLNYSLMANFVMV  266

Query  910   YGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVK  731
             YG + G  S           V  L +          + G    L    EK V + WR +K
Sbjct  267   YGYVPGAQSE----------VCRLCLELPGLEPLLYLDGDQ--LNGVHEKGVHDLWRVLK  314

Query  730   DGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASND  551
             D + LPL+I LC+  G  LPPC M LP +LK K+L  LP VDLAK+ C C ++  LAS+D
Sbjct  315   DEICLPLMISLCQLNGLRLPPCLMALPADLKTKVLGFLPGVDLAKVECTCKEMMNLASDD  374

Query  550   DLWKQ---KFE  527
              +WK+   KFE
Sbjct  375   SIWKKLVSKFE  385



>gb|AAO00689.1| Hypothetical protein [Oryza sativa Japonica Group]
Length=776

 Score =   133 bits (334),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 129/231 (56%), Gaps = 30/231 (13%)
 Frame = -3

Query  1177  TKELSDSDGGRDHKL---LLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQVSILSY  1010
             TK   ++ GG D  +   L++A+HA LL++GF+  +P+    ++P  W         + Y
Sbjct  179   TKREMENVGGADGTVICRLVVALHAALLDAGFLYANPVGSCLQLPQNWASGSFVPVSMKY  238

Query  1009  SLPEIADGDTDQNSNAVPTVE------LKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFV  848
             +LPE+ +        A+P VE      L +  +G F++VYG + G +S   V+       
Sbjct  239   TLPELVE--------ALPVVEEGMVAVLNYSLMGNFMMVYGHVPGATS--GVRRLCLELP  288

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
                 + + +   S+E++       T+ E+E+ E WR +KD + LPL+I LC+     LPP
Sbjct  289   ELAPLLYLD---SDEVS-------TAEEREIHELWRVLKDEMCLPLMISLCQLNNLSLPP  338

Query  667   CFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
             C M LP ++K K+LE +P VDLA++ C C +LR LA++D+LWK+K E +FN
Sbjct  339   CLMALPGDVKAKVLEFVPGVDLARVQCTCKELRDLAADDNLWKKKCEMEFN  389



>gb|ABF94800.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=809

 Score =   133 bits (334),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 129/231 (56%), Gaps = 30/231 (13%)
 Frame = -3

Query  1177  TKELSDSDGGRDHKL---LLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQVSILSY  1010
             TK   ++ GG D  +   L++A+HA LL++GF+  +P+    ++P  W         + Y
Sbjct  179   TKREMENVGGADGTVICRLVVALHAALLDAGFLYANPVGSCLQLPQNWASGSFVPVSMKY  238

Query  1009  SLPEIADGDTDQNSNAVPTVE------LKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFV  848
             +LPE+ +        A+P VE      L +  +G F++VYG + G +S   V+       
Sbjct  239   TLPELVE--------ALPVVEEGMVAVLNYSLMGNFMMVYGHVPGATS--GVRRLCLELP  288

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
                 + + +   S+E++       T+ E+E+ E WR +KD + LPL+I LC+     LPP
Sbjct  289   ELAPLLYLD---SDEVS-------TAEEREIHELWRVLKDEMCLPLMISLCQLNNLSLPP  338

Query  667   CFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
             C M LP ++K K+LE +P VDLA++ C C +LR LA++D+LWK+K E +FN
Sbjct  339   CLMALPGDVKAKVLEFVPGVDLARVQCTCKELRDLAADDNLWKKKCEMEFN  389



>gb|ABF94798.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=810

 Score =   133 bits (334),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 129/231 (56%), Gaps = 30/231 (13%)
 Frame = -3

Query  1177  TKELSDSDGGRDHKL---LLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQVSILSY  1010
             TK   ++ GG D  +   L++A+HA LL++GF+  +P+    ++P  W         + Y
Sbjct  179   TKREMENVGGADGTVICRLVVALHAALLDAGFLYANPVGSCLQLPQNWASGSFVPVSMKY  238

Query  1009  SLPEIADGDTDQNSNAVPTVE------LKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFV  848
             +LPE+ +        A+P VE      L +  +G F++VYG + G +S   V+       
Sbjct  239   TLPELVE--------ALPVVEEGMVAVLNYSLMGNFMMVYGHVPGATS--GVRRLCLELP  288

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
                 + + +   S+E++       T+ E+E+ E WR +KD + LPL+I LC+     LPP
Sbjct  289   ELAPLLYLD---SDEVS-------TAEEREIHELWRVLKDEMCLPLMISLCQLNNLSLPP  338

Query  667   CFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN  515
             C M LP ++K K+LE +P VDLA++ C C +LR LA++D+LWK+K E +FN
Sbjct  339   CLMALPGDVKAKVLEFVPGVDLARVQCTCKELRDLAADDNLWKKKCEMEFN  389



>ref|XP_001776852.1| predicted protein [Physcomitrella patens]
 gb|EDQ58402.1| predicted protein [Physcomitrella patens]
Length=693

 Score =   130 bits (328),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 95/280 (34%), Positives = 146/280 (52%), Gaps = 40/280 (14%)
 Frame = -3

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPIL------HKKVPNQWI  1043
             +P  L++V   E            L++A+HAV+LE+GFV   P           +P  W 
Sbjct  310   LPDLLQRVLQHEHGKVK--ERQAFLVLAIHAVMLETGFVLQHPTDAVGSSDRCGLPVDWS  367

Query  1042  LTEPQVSILSYSLPEIADGDTDQNSNA-VPTVELKFQTLGKFVIVYGSLSGN--SSVHSV  872
               +  ++ L+Y+LPEI    +     + V    L+ Q +G F++VYG+++G   S V+ +
Sbjct  368   -GKGGLANLTYTLPEITTAASASAQTSAVGDALLRCQFIGNFLVVYGAVTGGQGSEVYRL  426

Query  871   QL-------------DKDHFVPFL-NVAWSNCGLSE-----EIAGKDGLLCTSPEK----  761
              L             DKD+    L N+A     + E     E    +G++  +P K    
Sbjct  427   SLPVSRYLQKDFVVEDKDNTRDALKNLAKDGEEIKEGATPMECLTSEGIV--TPSKVDMF  484

Query  760   -EVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCL  584
               VFE W+ VKD L+LPLL  +CEKAG   P   + LPTELK+K+LE LPA  LA + C+
Sbjct  485   CNVFELWQQVKDNLSLPLLTCICEKAGLQPPASLLLLPTELKIKLLENLPAAALATLCCV  544

Query  583   CSDLRYLASNDDLWKQKFEEQFNADWFR--NGGSWKQKFV  470
             CS+L++LAS+++LWK +F+ +F +D  R   G  WK  + 
Sbjct  545   CSELKFLASSEELWKARFKAEFKSDATRAPGGRGWKVAYA  584



>dbj|BAH20254.1| AT1G23780 [Arabidopsis thaliana]
Length=283

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 118/187 (63%), Gaps = 13/187 (7%)
 Frame = -3

Query  1018  LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFL  839
             L Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK  FVP +
Sbjct  22    LRYTLPELIK---YKDTNTIESVSVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRRFVPVI  78

Query  838   NVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFM  659
             ++        EE +       +S  +EVF FWR VKD L +PLLI +C+KAG   PPC M
Sbjct  79    DLVMDTSTSDEEGS-------SSIYREVFMFWRMVKDRLVIPLLIGICDKAGLEPPPCLM  131

Query  658   RLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGG---S  488
             RLPTELKLKILELLP V +  M+C+C+++RYLAS++DLWKQK  E+ N       G   +
Sbjct  132   RLPTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNFVVTEAGDSVN  191

Query  487   WKQKFVA  467
             WK +F  
Sbjct  192   WKARFAT  198



>ref|XP_011046013.1| PREDICTED: F-box protein SKIP22-like [Populus euphratica]
Length=314

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 14/204 (7%)
 Frame = -3

Query  1126  IAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS--YSLPEIADGDTDQNSNAVPT  953
             IA HA+LLE GF+  D     KV      T+   +  +  Y+LP    G     +    +
Sbjct  80    IATHAILLEFGFIGFDLKSGMKVDQFRPPTDLSSNAFTMWYTLP----GLLLPENVVAES  135

Query  952   VELKFQTLGKFVIVYGSLS-GNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLC  776
             + +K Q     V V GSL+ G S +H V L+   F   +N+  +NC        ++ L+ 
Sbjct  136   IYVKVQCSEDIVNVCGSLTKGGSDIHRVCLNGKGFGRTINLLRANCE-------RNSLMN  188

Query  775   TSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAK  596
              + + EV +  + +KDGLALPLLI+LCEK G  LPPCF RLP ELKLKI+ LL  VD+ +
Sbjct  189   DNDKNEVRQLEKVLKDGLALPLLIDLCEKTGMALPPCFDRLPRELKLKIMGLLSLVDVGR  248

Query  595   MSCLCSDLRYLASNDDLWKQKFEE  524
             M C+CS+LR+L+    L  Q+F++
Sbjct  249   MECVCSELRFLSRATRLICQRFQQ  272



>gb|EYU37549.1| hypothetical protein MIMGU_mgv1a022435mg, partial [Erythranthe 
guttata]
Length=254

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 125/246 (51%), Gaps = 40/246 (16%)
 Frame = -3

Query  1210  FSVPGFLRKVFTKELSDSD-GGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTE  1034
             FS P FLR +  +E  D D   R HKL +IA HAV+LE GFV  D   +  V        
Sbjct  19    FSAPNFLRNLLMQESRDDDVSKRHHKLAVIATHAVMLECGFVPFDKESNAVVSG---FRS  75

Query  1033  PQV---SILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKF-VIVYGSLS------GNSS  884
             P V     L Y+LPE          NAV    L+F+  G++ V V G L       GN  
Sbjct  76    PLVWPTRRLFYTLPEKNTAHGKSIQNAV----LEFRISGEYSVTVNGRLDMETEKVGN--  129

Query  883   VHSVQLDKDHFVPFLN---VAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALP  713
              HSVQ  +D    F+N   V  SN    EE+ G            V+ FW+ VKD L LP
Sbjct  130   -HSVQFKEDQLATFMNNVLVTDSNNTNGEEVNGG----------AVYRFWKRVKDNLVLP  178

Query  712   LLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQ  536
             LL EL + + +    C  +LP +LK++IL+ L AVDLAK +C C +L  +AS DD LWK 
Sbjct  179   LLTELRQVSCY----C-QKLPVDLKVEILKWLSAVDLAKATCFCYELSSIASRDDYLWKI  233

Query  535   KFEEQF  518
             KF ++F
Sbjct  234   KFVQEF  239



>ref|XP_011037604.1| PREDICTED: F-box protein SKIP22-like [Populus euphratica]
Length=314

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 117/216 (54%), Gaps = 14/216 (6%)
 Frame = -3

Query  1162  DSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS--YSLPEIAD  989
             D D    +    IA HA+LLE GF+  D     KV      T+   +  +  Y+LP    
Sbjct  68    DEDCSFSNHNAAIATHAILLEFGFIGFDLKSGMKVDQFRPPTDLSSNAFTMWYTLP----  123

Query  988   GDTDQNSNAVPTVELKFQTLGKFVIVYGSLS-GNSSVHSVQLDKDHFVPFLNVAWSNCGL  812
             G     +    ++ +K Q     V V GSL+ G S +H V L+   F   +N+  +NC  
Sbjct  124   GLLLPENVVAESIYVKVQCSEDIVNVCGSLTKGGSDIHRVCLNGKAFGRAINLLRANCE-  182

Query  811   SEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLK  632
                   ++ L+  + + EV +  + +KDGLALPLLI+LCEK G  LPPCF RLP ELKLK
Sbjct  183   ------RNSLMNDNDKNEVRQLEKFLKDGLALPLLIDLCEKTGMALPPCFDRLPRELKLK  236

Query  631   ILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEE  524
             I+ LL  VD+ +M C+CS+LR+L+    L  Q+F++
Sbjct  237   IMGLLSLVDVGRMECVCSELRFLSRATRLICQRFQQ  272



>ref|XP_011037603.1| PREDICTED: putative F-box protein At1g23770 [Populus euphratica]
Length=314

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 119/216 (55%), Gaps = 14/216 (6%)
 Frame = -3

Query  1162  DSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS--YSLPEIAD  989
             D D    +  + IA HA+LLE GF+  D     KV      T+   +  +  Y+LP    
Sbjct  68    DEDCSFSNHNVAIATHAILLEFGFIGFDLKSGMKVDQFRPPTDLSSNAFTMWYTLP----  123

Query  988   GDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSS-VHSVQLDKDHFVPFLNVAWSNCGL  812
             G     +    ++ +K Q     V VYGSL+ + S +H V L+   F   +N+  +NC  
Sbjct  124   GLLLPENVVAESIYVKVQCSEDTVNVYGSLTKDGSDIHRVCLNGKAFGRAINLLRANCE-  182

Query  811   SEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLK  632
                   ++ L+  + + EV +  + +KDGLALPLLI+LCEK G  LPPCF RLP ELKLK
Sbjct  183   ------RNSLMNDNDKNEVRQLEKFLKDGLALPLLIDLCEKTGMALPPCFDRLPRELKLK  236

Query  631   ILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEE  524
             I+ LL  VD+ +M C+CS+LR+L+  + L  Q F++
Sbjct  237   IMGLLSLVDVGRMECVCSELRFLSRANRLIWQIFQQ  272



>ref|XP_002306104.2| hypothetical protein POPTR_0004s16190g [Populus trichocarpa]
 gb|EEE86615.2| hypothetical protein POPTR_0004s16190g [Populus trichocarpa]
Length=315

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 118/217 (54%), Gaps = 15/217 (7%)
 Frame = -3

Query  1162  DSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILS--YSLPEIAD  989
             D D    +  + IA HA+LLE GF+  D     KV      T+   +  +  Y+LP    
Sbjct  68    DEDCSFSNHNVAIATHAILLEFGFIAFDLKSGMKVDQFRPPTDLSSNAFTMWYTLP----  123

Query  988   GDTDQNSNAVPTVELKFQTLGKFVI-VYGSLS-GNSSVHSVQLDKDHFVPFLNVAWSNCG  815
             G     +    ++ +K Q   + ++ V GSL+ G S +H V L+   F   +N+  +NC 
Sbjct  124   GLLLPENVVAESIYVKVQYCSEDIVNVCGSLTKGGSDIHRVCLNGKGFGRNINLLRANCE  183

Query  814   LSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKL  635
              +  + G D       + E  +  + +KDGLALPLLI+LCEK G  LPPCF RLP ELKL
Sbjct  184   RNSLMNGND-------KNEDRQLEKVLKDGLALPLLIDLCEKTGMALPPCFDRLPRELKL  236

Query  634   KILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEE  524
             KI+ LL  VD+ +M C+CS+LR+L+    L  Q+F++
Sbjct  237   KIMGLLSLVDVGRMECVCSELRFLSRATRLIWQRFQQ  273



>dbj|BAH57583.1| F-box family protein [Arabidopsis lyrata]
Length=264

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 121/196 (62%), Gaps = 21/196 (11%)
 Frame = -3

Query  1018  LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFL  839
             L Y+LPE+      +++N + +V +KFQ LG  V+VYG++ G+S    + LDK  FVP +
Sbjct  3     LRYTLPELIK---SEDTNTIESVTVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRRFVPVI  59

Query  838   NVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFM  659
             ++      L  +  G  G+      +EVF FWR VKD L +PLLI +C+KAG   PPC M
Sbjct  60    DLVMDT--LKSDEGGSLGIY-----REVFMFWRMVKDCLVIPLLIGICDKAGLESPPCLM  112

Query  658   RLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFN----------AD  509
             RLP+ELKLKILELLP V +  M+C+C+++RY AS++DLWKQK  E+ +           +
Sbjct  113   RLPSELKLKILELLPGVSIGNMACVCTEMRYRASDNDLWKQKCLEEVDNFVGTEAGDSVN  172

Query  508   W-FRNGGSWKQKFVAA  464
             W  R    W+QK +AA
Sbjct  173   WKARFATFWRQKQLAA  188



>dbj|BAH57582.1| F-box family protein [Arabidopsis lyrata]
Length=173

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 86/142 (61%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            V+   LDK  F+P ++         ++ +       +S   EVF  WR VKD L +PL I
Sbjct  2    VYMTYLDKRRFLPVIDSVVDTLKFEKQGS-------SSYYHEVFMLWRMVKDDLVIPLWI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+KAG   PPC M LPTELKLKILE LP V +  M+C+C+++RYLAS++DLWKQK  E
Sbjct  55   GLCDKAGLESPPCLMLLPTELKLKILESLPGVSIGNMACVCTEMRYLASDNDLWKQKCLE  114

Query  526  EQFNADWFRNGGS--WKQKFVA  467
            E  +  W    G+  WK+KF +
Sbjct  115  EGKDCLWKLLTGNVDWKRKFAS  136



>ref|XP_002306233.2| hypothetical protein POPTR_0004s16180g, partial [Populus trichocarpa]
 gb|EEE86744.2| hypothetical protein POPTR_0004s16180g, partial [Populus trichocarpa]
Length=309

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 116/217 (53%), Gaps = 29/217 (13%)
 Frame = -3

Query  1162  DSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILSYSLPEIADGD  983
             D D    +  + IA HA+LLE GF+             +IL   Q  + +YS      G 
Sbjct  76    DEDCSFSNHNVAIATHAILLEFGFI------------GFILQ--QTCLQTYS----RCGI  117

Query  982   TDQNSNAVPTV---ELKFQTLGKFVIVYGSLS-GNSSVHSVQLDKDHFVPFLNVAWSNCG  815
               Q S  + T+    LK Q     V V GSL+ G S +H V L+   F   +N+  +N  
Sbjct  118   LFQGSCFLKTLVLNRLKVQCSEDIVNVCGSLTKGGSDIHRVCLNGKGFGRNINLLRAN--  175

Query  814   LSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKL  635
                    ++ L+  + + EV +  + +KDGLALPLLI+LCEK G  LPPCF RLP ELKL
Sbjct  176   -----YERNSLMNDNDKNEVRQLEKVLKDGLALPLLIDLCEKTGMALPPCFDRLPRELKL  230

Query  634   KILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEE  524
             KI+ LL  VD+ +M C+CS+LR+L+    L  Q+F++
Sbjct  231   KIMGLLSLVDVGRMECVCSELRFLSRATRLIWQRFQQ  267



>ref|XP_002986189.1| hypothetical protein SELMODRAFT_49052, partial [Selaginella moellendorffii]
 gb|EFJ12720.1| hypothetical protein SELMODRAFT_49052, partial [Selaginella moellendorffii]
Length=160

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 109/196 (56%), Gaps = 39/196 (20%)
 Frame = -3

Query  1135  LLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQV---SILSYSLPEIADGDTDQNSN  965
             LL++AVHAV+LE+GFV              IL  P +   S + Y+LPE+     D+   
Sbjct  1     LLILAVHAVMLETGFV--------------ILGRPTIAGASSIKYTLPELGQLKNDE---  43

Query  964   AVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
                 V L+ Q++G+F++VYGS+ G+S +  + L    F+                 G+  
Sbjct  44    --ARVLLRCQSVGEFMVVYGSVQGSSQIFRLSLSISKFL-----------------GEQY  84

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVD  605
                 S  K+ F  W+ +KD L L LL+ LCE AG  LP CF  LPTELK+KILE LPA+D
Sbjct  85    QASFSLYKDAFALWKEIKDNLTLRLLMLLCEIAGLPLPACFQILPTELKMKILEFLPALD  144

Query  604   LAKMSCLCSDLRYLAS  557
             +A++S + S+LR+LA+
Sbjct  145   VARISMVSSELRFLAA  160



>ref|XP_002877958.1| hypothetical protein ARALYDRAFT_906819 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54217.1| hypothetical protein ARALYDRAFT_906819 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   111 bits (277),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 62/130 (48%), Positives = 86/130 (66%), Gaps = 17/130 (13%)
 Frame = -3

Query  919  VIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWR  740
            V++YGSLSG SS   V LDK  FVP ++   S+         K+G   +S  +EVF++WR
Sbjct  2    VVLYGSLSG-SSPRRVLLDKRGFVPVIDTLKSD---------KEG--SSSIYREVFKYWR  49

Query  739  TVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLA  560
            TVK  L +PLLI +  K      PC M LPTE+K+K++ELLP   +AKM+CLC++LR L+
Sbjct  50   TVKYDLVIPLLIGITNKT-----PCLMCLPTEIKMKMIELLPGASVAKMACLCTELRSLS  104

Query  559  SNDDLWKQKF  530
             +DDLWK+K+
Sbjct  105  LDDDLWKRKW  114



>ref|XP_002522109.1| hypothetical protein RCOM_1382970 [Ricinus communis]
 gb|EEF40309.1| hypothetical protein RCOM_1382970 [Ricinus communis]
Length=235

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 83/125 (66%), Gaps = 8/125 (6%)
 Frame = -3

Query  886  SVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKE-VFEFWRTVKDGLALPL  710
            ++H+V L+   FV F  V+    GL  ++     LL   P +     FW+ VKD L LPL
Sbjct  46   AIHAVFLE-SGFVGFKTVS----GLRADLFRH--LLLEQPFRTFTTSFWKIVKDWLVLPL  98

Query  709  LIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKF  530
            LI+LCEKA   LPPC MRLP ELKLKILE LP  D+A+M+C+C +++ L+S++DLWKQKF
Sbjct  99   LIDLCEKAALDLPPCLMRLPAELKLKILESLPGTDIARMACVCKEMQCLSSDNDLWKQKF  158

Query  529  EEQFN  515
             E+F 
Sbjct  159  GEEFG  163



>ref|XP_002984999.1| hypothetical protein SELMODRAFT_49051, partial [Selaginella moellendorffii]
 gb|EFJ13874.1| hypothetical protein SELMODRAFT_49051, partial [Selaginella moellendorffii]
Length=160

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 108/193 (56%), Gaps = 33/193 (17%)
 Frame = -3

Query  1135  LLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             LL++AVHAV+LE+GFV L        P     T    S + Y+LPE+     D+      
Sbjct  1     LLILAVHAVMLETGFVILG------CP-----TIAGASSIKYTLPELGQLKNDE-----A  44

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLC  776
              V L+ Q++G+F++VYGS+ G+S +  + L    F+                 G+     
Sbjct  45    RVLLRCQSVGEFMVVYGSVQGSSQIFRLSLSISKFL-----------------GEQDQAS  87

Query  775   TSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAK  596
              S  K+ F  W+ +KD L L LL+ LCE AG  LP CF  LPTELK+KILE LPA+D+A+
Sbjct  88    FSLYKDAFALWKEIKDNLTLRLLMLLCEIAGLPLPACFQILPTELKMKILEFLPALDVAR  147

Query  595   MSCLCSDLRYLAS  557
             +S + S+LR+LA+
Sbjct  148   ISMVSSELRFLAA  160



>ref|XP_002321452.2| hypothetical protein POPTR_0015s02220g [Populus trichocarpa]
 gb|EEF05579.2| hypothetical protein POPTR_0015s02220g [Populus trichocarpa]
Length=397

 Score =   113 bits (283),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  766  EKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSC  587
            E E FE W+ VKDGL LPLLI++C+K G  LPPC MRLPTELKLKILE L A+D+AKM  
Sbjct  240  ENENFELWKIVKDGLVLPLLIDICKKVGLFLPPCLMRLPTELKLKILESLAAIDIAKMES  299

Query  586  LCSDLRYLASNDDLWKQKFEEQF  518
            + S+++ L+SN+D W+QKF E+F
Sbjct  300  VSSEMQCLSSNNDPWQQKFVEEF  322



>ref|XP_002468225.1| hypothetical protein SORBIDRAFT_01g042080 [Sorghum bicolor]
 gb|EER95223.1| hypothetical protein SORBIDRAFT_01g042080 [Sorghum bicolor]
Length=475

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 94/185 (51%), Gaps = 28/185 (15%)
 Frame = -3

Query  1069  HKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN  890
             H  +P  W     +   + Y++PE++   +      V  V L +  +G FV+VYG     
Sbjct  215   HLSLPQGWPSGALKPLTIRYTVPELSSMLSVTEEGKV--VVLNYSLMGNFVMVYGY----  268

Query  889   SSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSP-------EKEVFEFWRTVK  731
               VH  Q +              C L  E+ G + LL           EK V + WR +K
Sbjct  269   --VHGAQSEV-------------CRLCLELPGLESLLYLDSDQLSGVHEKGVHDLWRVLK  313

Query  730   DGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASND  551
             D + LPL+I LC+  G  LPPCFM LP +LK K+LE LP VDLAK+ C C ++R LAS+D
Sbjct  314   DEICLPLMISLCQLNGLRLPPCFMALPADLKTKVLEFLPGVDLAKVECTCKEMRNLASDD  373

Query  550   DLWKQ  536
              +WK+
Sbjct  374   SIWKK  378


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 57/90 (63%), Gaps = 8/90 (9%)
 Frame = -3

Query  1723  MKLRLRSVETK-----ETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNK  1559
             MKLRLRS+E +     ET  VD+PP+ TL +++   +L     SA     ++S+RLSLN+
Sbjct  1     MKLRLRSMEARGGAAAETHRVDLPPTATLADVR---TLLASKLSAAQPVPAESVRLSLNR  57

Query  1558  KDELRSSSPDETLEMLGITSGDLIFFALNP  1469
              +EL S  P  TL  LG+ SGDL+FF L+P
Sbjct  58    SEELVSPDPAATLPSLGLASGDLVFFTLSP  87



>gb|EYU37551.1| hypothetical protein MIMGU_mgv1a005787mg [Erythranthe guttata]
Length=470

 Score =   112 bits (280),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 89/152 (59%), Gaps = 11/152 (7%)
 Frame = -3

Query  919  VIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWR  740
            ++  G  S     +SV++ +D  +PF N+   N     +I G D    TSP KEVF FWR
Sbjct  279  MVESGKESEKKDTYSVRMKEDQLIPFANIVIEN-----KIGGIDKR--TSPGKEVFTFWR  331

Query  739  TVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLA  560
            T+KD LA+PL ++L     +G    FMRL T+LKLKILE L   DLA +  +C +L+ LA
Sbjct  332  TIKDDLAVPLSMDLR----YGSSNYFMRLSTKLKLKILESLSVADLANVGSVCHELKCLA  387

Query  559  SNDDLWKQKFEEQFNADWFRNGGSWKQKFVAA  464
            S+D LWK K+E++F+ +      SWK  +  A
Sbjct  388  SSDKLWKSKYEDEFDDNKKDARVSWKMAYRMA  419


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 63/118 (53%), Gaps = 9/118 (8%)
 Frame = -3

Query  1231  ADVVGKSFSVPGFLRKVFTKEL-SDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKV-  1058
             +D   KSFSVPGFLR+   +E   D  G R  KL++IA H ++LE GF+  D   +  V 
Sbjct  41    SDATDKSFSVPGFLREFLMEEFGGDGGGSRHRKLMVIATHTIMLECGFLGFDEKSNAVVN  100

Query  1057  ----PNQWILT-EPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL  899
                 P  W  + +P    L Y+LPE  +   D  S  V  V L+F++ G+F+ V G L
Sbjct  101   GFRPPRDWPPSGDPFAMSLFYTLPESNNRPRDGES--VKNVVLEFESSGEFITVSGRL  156



>gb|ADE77516.1| unknown [Picea sitchensis]
Length=306

 Score =   109 bits (273),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -3

Query  775  TSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAK  596
            +S E  VFE WR VKD L++P+L  LCEK G   PP  + LPTELKLKILE LPAVD+A+
Sbjct  107  SSQEMRVFELWRIVKDRLSMPVLTALCEKTGLPSPPSLILLPTELKLKILEFLPAVDVAR  166

Query  595  MSCLCSDLRYLASNDDLWKQKFEEQFNA  512
            + C+C++ R+L+ ND+LWK+K+  +  +
Sbjct  167  LGCVCTEFRFLSVNDELWKKKYAAELGS  194



>ref|XP_006372530.1| hypothetical protein POPTR_0017s02510g, partial [Populus trichocarpa]
 gb|ERP50327.1| hypothetical protein POPTR_0017s02510g, partial [Populus trichocarpa]
Length=189

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 82/143 (57%), Gaps = 22/143 (15%)
 Frame = -3

Query  946  LKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSP  767
            ++   +   V+V GSL+ + S   + LD+  F P L++   NC L E+            
Sbjct  1    MRRTAINDCVVVSGSLAKSRSKLYLTLDQQRFGPVLDLLRRNC-LEEDRTS---------  50

Query  766  EKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSC  587
              EV++ W+TVKD L LPL I+L EK    LPPCFMRLP +LKLKILELLPA+    M  
Sbjct  51   --EVYDLWKTVKDHLLLPLTIQLSEKTVVTLPPCFMRLPPDLKLKILELLPAL---MMQS  105

Query  586  LCSDLRYLASNDDLWKQKFEEQF  518
            LC       SN+DLWK+ F E+F
Sbjct  106  LC-------SNNDLWKRGFSEEF  121



>ref|NP_177193.1| F-box protein [Arabidopsis thaliana]
 sp|O64600.1|FB81_ARATH RecName: Full=F-box protein At1g70360 [Arabidopsis thaliana]
 gb|AAC18805.1| F17O7.10 [Arabidopsis thaliana]
 gb|AEE35049.1| F-box protein [Arabidopsis thaliana]
Length=174

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 104/193 (54%), Gaps = 30/193 (16%)
 Frame = -3

Query  1135  LLLIAVHAVLLESGFVRLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             ++++ VHAV+LESGFV  DP        ++  ++  +  L+Y+LP +             
Sbjct  12    IVIMTVHAVMLESGFVLFDP----DSSMRFSFSKKTLVSLNYTLPSVKG-----------  56

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLC  776
              V L F+   K  IV       S V  V +DK  +V  +++        EE   +D L  
Sbjct  57    IVGLNFE---KEAIV------GSFVRVVSIDKRSYVHIVDLLMETLKSDEE---EDTL--  102

Query  775   TSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAK  596
              S + +V  +WR +KDG+  PLL++LC K G  LPPCF+ LP ELK KILE LP VD+  
Sbjct  103   -SIDCKVLVWWRMIKDGIVTPLLVDLCYKTGLELPPCFISLPRELKHKILESLPGVDIGT  161

Query  595   MSCLCSDLRYLAS  557
             ++C+ S+LR +AS
Sbjct  162   LACVSSELRDMAS  174



>dbj|BAH57622.1| F-box family protein [Arabidopsis thaliana]
Length=181

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 87/142 (61%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            VH   LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI
Sbjct  2    VHMTSLDKSRFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELVIPLLI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+KAG   PPC M LPTELKLKILELLP V +  M+C+C+++RYLAS++DLW+ K  E
Sbjct  55   GLCDKAGLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWEHKCLE  114

Query  526  EQFNADW--FRNGGSWKQKFVA  467
            E     W  +     WK+KF +
Sbjct  115  EGKGCLWKLYTGDVDWKRKFAS  136



>dbj|BAH57621.1| F-box family protein [Arabidopsis thaliana]
Length=181

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 86/142 (61%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            VH   LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI
Sbjct  2    VHMTSLDKSRFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELVIPLLI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+KAG   PPC M LPTELKLKILELLP V +  M+C+C+++RYLAS++DLW  K  E
Sbjct  55   GLCDKAGLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWDHKCLE  114

Query  526  EQFNADW--FRNGGSWKQKFVA  467
            E     W  +     WK+KF +
Sbjct  115  EGKGCLWKLYTGDVDWKRKFAS  136



>ref|XP_010507315.1| PREDICTED: F-box protein At1g70360-like [Camelina sativa]
Length=137

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 53/131 (40%), Positives = 76/131 (58%), Gaps = 7/131 (5%)
 Frame = -3

Query  913  VYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTV  734
            VYG L   S V  V ++K  ++  ++       L  E    D     S  +EV  +WR +
Sbjct  8    VYGFLDEASLVDKVCINKHIYMLIVD-------LVLETLESDNEDTLSIHREVLVWWRMI  60

Query  733  KDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASN  554
            KDG+ +PLL+ LC K    LPPC +RLP E+K KIL  LP VD+A ++ +  +LR +AS+
Sbjct  61   KDGIVMPLLVNLCYKTDLELPPCLIRLPREIKHKILASLPGVDIATLAYVTPELRDMASD  120

Query  553  DDLWKQKFEEQ  521
            +DLWKQK  E+
Sbjct  121  NDLWKQKCLEE  131



>dbj|BAH57624.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57625.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57609.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57613.1| F-box family protein [Arabidopsis thaliana]
Length=184

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 85/142 (60%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            VH   LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI
Sbjct  2    VHMTSLDKSRFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELVIPLLI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+K     PPC M LPTELKLKILELLP V +  M+C+C+++RYLAS++DLW+ K  E
Sbjct  55   GLCDKTVLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWEHKCLE  114

Query  526  EQFNADW--FRNGGSWKQKFVA  467
            E     W  +     WK+KF +
Sbjct  115  EGKGCLWKLYTGDVDWKRKFAS  136



>dbj|BAH57626.1| F-box family protein [Arabidopsis thaliana]
Length=181

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 85/142 (60%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            VH   LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI
Sbjct  2    VHMTSLDKSRFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELVIPLLI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+K     PPC M LPTELKLKILELLP V +  M+C+C+++RYLAS++DLW+ K  E
Sbjct  55   GLCDKTVLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWEHKCLE  114

Query  526  EQFNADW--FRNGGSWKQKFVA  467
            E     W  +     WK+KF +
Sbjct  115  EGKGCLWKLYTGDVDWKRKFAS  136



>dbj|BAH57623.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57629.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57612.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57616.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57617.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57618.1| F-box family protein [Arabidopsis thaliana]
Length=181

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 85/142 (60%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            VH   LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI
Sbjct  2    VHMTSLDKSRFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELVIPLLI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+K     PPC M LPTELKLKILELLP V +  M+C+C+++RYLAS++DLW+ K  E
Sbjct  55   GLCDKTVLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWEHKCLE  114

Query  526  EQFNADW--FRNGGSWKQKFVA  467
            E     W  +     WK+KF +
Sbjct  115  EGKGCLWKLYTGDVDWKRKFAS  136



>dbj|BAH57608.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57619.1| F-box family protein [Arabidopsis thaliana]
Length=184

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 84/142 (59%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            VH   LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI
Sbjct  2    VHMTSLDKSRFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELVIPLLI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+K     PPC M LPTELKLKILELLP V +  M+C+C+++RYLAS++DLW  K  E
Sbjct  55   GLCDKTVLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWDHKCLE  114

Query  526  EQFNADW--FRNGGSWKQKFVA  467
            E     W  +     WK+KF +
Sbjct  115  EGKGCLWKLYTGDVDWKRKFAS  136



>dbj|BAH57628.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57610.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57614.1| F-box family protein [Arabidopsis thaliana]
 dbj|BAH57615.1| F-box family protein [Arabidopsis thaliana]
Length=181

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 84/142 (59%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            VH   LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI
Sbjct  2    VHMTSLDKSRFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELVIPLLI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+K     PPC M LPTELKLKILELLP V +  M+C+C+++RYLAS++DLW  K  E
Sbjct  55   GLCDKTVLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWDHKCLE  114

Query  526  EQFNADW--FRNGGSWKQKFVA  467
            E     W  +     WK+KF +
Sbjct  115  EGKGCLWKLYTGDVDWKRKFAS  136



>ref|NP_001183495.1| uncharacterized protein LOC100501928 [Zea mays]
 gb|ACR36963.1| unknown [Zea mays]
Length=409

 Score = 99.0 bits (245),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 90/184 (49%), Gaps = 17/184 (9%)
 Frame = -3

Query  1069  HKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN  890
             H  +P  W     +   + Y++PE++   +      V  V L +  +  FV+VYG + G 
Sbjct  216   HLSLPQGWPSGALKPLTIKYTIPELSSMVSVTEEGKV--VVLNYSLMANFVMVYGYVPGA  273

Query  889   SSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPL  710
              S           V  L +          + G    L    EK V + WR +KD + LPL
Sbjct  274   QSE----------VCRLCLELPGLEPLLYLDGDQ--LNGVHEKGVHDLWRVLKDEICLPL  321

Query  709   LIELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQ--  536
             +I LC+  G  LPPC M LP +LK K+L  LP VDLAK+ C C ++  LAS+D +WK+  
Sbjct  322   MISLCQLNGLRLPPCLMALPADLKTKVLGFLPGVDLAKVECTCKEMMNLASDDSIWKKLV  381

Query  535   -KFE  527
              KFE
Sbjct  382   SKFE  385



>dbj|BAH57611.1| F-box family protein [Arabidopsis thaliana]
Length=181

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 85/142 (60%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            VH   LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI
Sbjct  2    VHMTSLDKSRFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELLIPLLI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+K     PPC M LPTELKLKILELLP V +  M+C+C+++RYLAS++DLW+ K  E
Sbjct  55   GLCDKTVLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWEHKCLE  114

Query  526  EQFNADW--FRNGGSWKQKFVA  467
            E     W  +     WK+KF +
Sbjct  115  EGKGCLWKLYTGDVDWKRKFAS  136



>dbj|BAH57627.1| F-box family protein [Arabidopsis thaliana]
Length=181

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 84/142 (59%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            VH   LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI
Sbjct  2    VHMTSLDKSRFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELVIPLLI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+K     PPC M LPTELKLKILELLP V +  M C+C+++RYLAS++DLW+ K  E
Sbjct  55   GLCDKTVLESPPCLMLLPTELKLKILELLPGVSIGYMXCVCTEMRYLASDNDLWEHKCLE  114

Query  526  EQFNADW--FRNGGSWKQKFVA  467
            E     W  +     WK+KF +
Sbjct  115  EGKGCLWKLYTGDVDWKRKFAS  136



>dbj|BAH57620.1| F-box family protein [Arabidopsis thaliana]
Length=181

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 85/142 (60%), Gaps = 10/142 (7%)
 Frame = -3

Query  883  VHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
            VH   LDK  F+P +++        ++ +       +S  +EVF  WR VKD L +PLLI
Sbjct  2    VHMTSLDKSWFLPVIDLVVDTLKFEKQGS-------SSYYREVFMLWRMVKDELVIPLLI  54

Query  703  ELCEKAGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FE  527
             LC+K     PPC M LPTELKLKILELLP V +  M+C+C+++RYLAS++DLW+ K  E
Sbjct  55   GLCDKTVLESPPCLMLLPTELKLKILELLPGVSIGYMACVCTEMRYLASDNDLWEHKCLE  114

Query  526  EQFNADW--FRNGGSWKQKFVA  467
            E     W  +     WK+KF +
Sbjct  115  EGKGCLWKLYTGDVDWKRKFAS  136



>gb|KHN19388.1| F-box protein SKIP22 [Glycine soja]
Length=443

 Score = 97.1 bits (240),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 76/125 (61%), Gaps = 13/125 (10%)
 Frame = -3

Query  1018  LSYSLPEI-ADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SSVHSVQLDKDHFV  848
             L Y+LPEI A+GD+        +V  KFQTLG FV V GSLS +  S +H V LDK  +V
Sbjct  187   LRYALPEILANGDSH-------SVNFKFQTLGHFVNVCGSLSDDVRSRLHFVCLDKCKYV  239

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
               L    +N      +   + +L  S   EVFE W+ VKD +ALPLLI+LCEKAGF LPP
Sbjct  240   RPLEFMLANSEAKGSVNDGEDILFGS---EVFEVWKMVKDWVALPLLIDLCEKAGFDLPP  296

Query  667   CFMRL  653
             CF+ L
Sbjct  297   CFLHL  301


 Score = 62.8 bits (151),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 7/87 (8%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLRLRS+E+KET+ ++V  S +L +LK          S     SS  + +SLN+KDE+ 
Sbjct  2     MKLRLRSLESKETLKIEVLDSCSLFQLKD-------TVSRTISSSSSFLHISLNRKDEIH  54

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNV  1463
             + S  E L  LG++ GDLIF++LNP +
Sbjct  55    APSSKEPLNSLGVSVGDLIFYSLNPTI  81



>emb|CDX89734.1| BnaC03g46480D [Brassica napus]
Length=177

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 80/162 (49%), Gaps = 36/162 (22%)
 Frame = -3

Query  1018  LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFL  839
             L Y+LP I    T      +  V L+FQ+L    +VYGSLSG    H VQ      VP +
Sbjct  39    LRYTLPAI----TKDTKKMIEFVTLRFQSLSNTFVVYGSLSG----HMVQRVNRFVVPVV  90

Query  838   NVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFM  659
             ++        ++ +       +S  +EVF FWR                 +G  LPPC M
Sbjct  91    DLVMDTLKFVKQAS-------SSSYREVFVFWRM----------------SGLELPPCLM  127

Query  658   RLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK  533
             RLP ELKLKILE      +A M+C+ +++R+L ++DD  +++
Sbjct  128   RLPRELKLKILEF-----IANMACVSTEMRHLVASDDGLRKR  164



>ref|XP_010065289.1| PREDICTED: putative F-box protein At1g23770 isoform X2 [Eucalyptus 
grandis]
Length=222

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 81/145 (56%), Gaps = 17/145 (12%)
 Frame = -3

Query  1234  DADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK---  1064
             D+  V   FS P FLR+V  +EL   DGG DH+LL+IAV AVLLE GFV +DP+      
Sbjct  59    DSTGVRSKFSEPYFLRRVLREELG-GDGG-DHRLLVIAVQAVLLEPGFVAVDPVTGMPAD  116

Query  1063  --KVPNQWILTEPQVSI---LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSL  899
                + +QW    P  +    L YSLPE+      Q  N   ++ LKF++LG F+ VYG L
Sbjct  117   RFHLSDQW----PSAAFTMTLQYSLPELV--ARTQGLNVTESLVLKFESLGHFISVYGRL  170

Query  898   SGNSSV-HSVQLDKDHFVPFLNVAW  827
             +   SV   V L++  F P ++V W
Sbjct  171   AKAKSVLIRVCLNERRFAPIIDVMW  195



>ref|XP_005846838.1| hypothetical protein CHLNCDRAFT_134618 [Chlorella variabilis]
 gb|EFN54736.1| hypothetical protein CHLNCDRAFT_134618 [Chlorella variabilis]
Length=453

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 109/237 (46%), Gaps = 32/237 (14%)
 Frame = -3

Query  1228  DVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQ  1049
             +++  S  VP +L +  T + S +   +  +LL++A HA +LE+GFV             
Sbjct  159   ELLATSQRVPTYLLR--TLQHSCTQHTQPAELLMLAAHAAMLETGFV-----------PS  205

Query  1048  WILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQ  869
             W+     +   S S+  +A   +   + ++  +       G  +     ++G +S     
Sbjct  206   WV----ALPAGSGSIYHVAMSGSCWATRSICRIRYHLANGGSMMTEATQVAGGTS-----  256

Query  868   LDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEK  689
               +    P   +  S+ G         G++           W  +KDGLA P+L+    +
Sbjct  257   --EQQQGPAFTLQCSSLG--------GGVVLALDPASTRRLWTALKDGLAFPMLLAAYAE  306

Query  688   AGFGLPPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF  518
             AG   P   + LP ++K ++LEL+ A DLA + C CS+LR+LAS D+LW+  FE +F
Sbjct  307   AGLPPPVGLLALPEDIKHRLLELVEAQDLASLCCTCSELRHLASQDELWRPLFEREF  363



>gb|KFK42245.1| hypothetical protein AALP_AA2G230200 [Arabis alpina]
Length=214

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 46/72 (64%), Gaps = 5/72 (7%)
 Frame = -3

Query  667  CFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQK-FEEQFNADWFRNGG  491
            C M LPTELKLKILE LP   +AKM+CLC ++RYLAS+ DLWKQK  EE  N     N G
Sbjct  18   CLMSLPTELKLKILESLPGASVAKMACLCKEMRYLASDSDLWKQKCLEESTNVSVVNNFG  77

Query  490  S----WKQKFVA  467
            S    WK  F  
Sbjct  78   SDSVNWKATFAG  89



>gb|AFK48968.1| unknown [Medicago truncatula]
Length=138

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  661  MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF  518
            MRLP ELKL I E LP  DLAK+ C CS+L+YLASNDDLWK+KFEE+F
Sbjct  1    MRLPMELKLLIFEYLPGDDLAKVCCTCSELQYLASNDDLWKKKFEEEF  48



>gb|EYU37550.1| hypothetical protein MIMGU_mgv1a010931mg [Erythranthe guttata]
Length=297

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 106/226 (47%), Gaps = 32/226 (14%)
 Frame = -3

Query  1210  FSVPGFLRKVFTKEL-SDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKVPNQWI---  1043
             FS   F++++F ++  S        KL++I VHAV+L+SGF   D      V    +   
Sbjct  57    FSFAKFVKQMFVEQWWSIPSASHRQKLIVIMVHAVMLDSGFAAFDKRSKSTVGCFHLRDE  116

Query  1042  LTE-------PQVSILSYSLPEIADGDTDQNSNA----VPTVELKFQTLGKFVIVYGSLS  896
             LTE       P +  L Y+LP   D + D  ++     +    L+   +  ++ VY +L 
Sbjct  117   LTEFDLPKISPHLLRLFYTLPHDEDEEEDNCNDCDFKIIRKAVLEIHFVDDYMTVYANLE  176

Query  895   GNSSVHS----VQLDKDHFVPFLNVAWSNCGLS---EEIAGKDGLLC-TSPEKEVFEFWR  740
                  H     +++ +   +PFLNV W+ C  S   +E  G++GL+  TSP K + +F R
Sbjct  177   DTVWCHRRTYRLKVYEYEVIPFLNVIWNKCWDSWWNDETCGEEGLIADTSPGKVIDKFLR  236

Query  739   TVKDGLALPLLIELCEKAGFGLPP---------CFMRLPTELKLKI  629
              V++ +ALPLL +L     F   P         CF R+ T  K ++
Sbjct  237   NVREIIALPLLADLRLAVWFDRLPKDIKWLSELCFSRMATRRKKRV  282



>gb|EYU37546.1| hypothetical protein MIMGU_mgv1a023168mg [Erythranthe guttata]
Length=184

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 81/164 (49%), Gaps = 33/164 (20%)
 Frame = -3

Query  1018  LSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVI-VYGSLSGN----SSVHSVQLDKDH  854
             L Y+LP+ +    D        V LKFQ+L K  + VYG L+ N    +  H VQL++  
Sbjct  49    LFYTLPQTSGESIDN------VVVLKFQSLWKLTMSVYGRLANNRRRSTRTHLVQLNE--  100

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
                        C LS  +             +V EF   VKD LA+ LL ++ E++G   
Sbjct  101   -----------CKLSSSLKSV---------LDVIEFSIDVKDNLAMRLLTDIREESGLEP  140

Query  673   PPCFMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLW  542
             P CF  LP +LKLKILE     +LA +S + S++R  AS D+LW
Sbjct  141   PTCFTILPKDLKLKILESFSITELANVSRVNSEMRGSASRDELW  184



>ref|XP_004675769.1| PREDICTED: F-box only protein 7 isoform X1 [Condylura cristata]
Length=522

 Score = 72.0 bits (175),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 113/432 (26%), Positives = 182/432 (42%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPS-TTLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTGPLEIPDAEPTLGQL--RAQLSQALLPTWGYSSDTRFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
                  +ETL   GI SGDLI   L      PN+  S++S+ ++  +   P+ +  S   S
Sbjct  57    TGD--EETLASYGIVSGDLICLILEDAIAAPNLPSSTDSEHSSLQNNEQPSLAASSSQPS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelv-dqgeeeevevmeidweEKDADVVGKSFS  1205
              ++  LS + P ++  +  +N  S   P    +    +++  +E        + +  S S
Sbjct  115   TQNELLSDSFPEQAAQSDVWNDDSMSGPSQNFEAEPVQDLVEVEEGPGVYPTEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
               G +          +D    H  L++ +H ++LESG++ +        +P  W      
Sbjct  175   EDGRVPHSLETLYQSADCSNSHDALIVLIHLLMLESGYIPQGTEAKAVSMPENW--KSGG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P   DG             L    LG  V+V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYTHPLCEDG----------CAALTCVPLGTLVVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E  G+D        K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------RKEEPGED---VAKIYKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+  +   F    
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FIASNDQLLWRCLYLRDFRDGT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   ARVRDTDWKELY  396



>ref|XP_008578864.1| PREDICTED: F-box only protein 7 isoform X1 [Galeopterus variegatus]
Length=523

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 117/433 (27%), Positives = 184/433 (42%), Gaps = 53/433 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEMPEAEPTLGQL--RAHLSRALLPTWGYSSDTRFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  S   P+ +  S    
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDTIPAPNLPSSTDSEHSSLQSNEQPSLAASSNQAH  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
                 +LS +L  ++  T  +N  S   P    + +  +  V   +      ++ +  S S
Sbjct  115   TPDEQLSDSLQGQAAQTDVWNDDSMSGPNHGFEAKSIQDVVDMEEGTGFYLSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHKKV--PNQWILTEP  1031
             V G +          SD    +  L++ +H ++LESG+ +      K V  P +W     
Sbjct  175   VEGQVPHSLETLYQSSDCSNANDALIVLIHLLMLESGY-KPQGTEAKAVSMPERW--KSS  231

Query  1030  QVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDK  860
              V  L Y+ P    G          +  L    LG  ++V  +L  NS + SV   QL  
Sbjct  232   GVYKLQYTHPLCEGG----------SAALTCLPLGNLIVVNATLKINSEIRSVKRLQLLP  281

Query  859   DHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGF  680
             + F+           L E +A           K++ +  R  KD L  PLL     +   
Sbjct  282   ESFI-------CKDELGENVAKI--------YKDLQKISRLFKDQLVYPLLA--FTRQAL  324

Query  679   GLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNAD  509
              LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+  +   F   
Sbjct  325   NLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCHDL-FIASNDPLLWRCLYLRDFRDS  383

Query  508   WFRNGGS-WKQKF  473
               R G + WK+ +
Sbjct  384   TVRVGDTDWKELY  396



>ref|XP_005643974.1| hypothetical protein COCSUDRAFT_48944 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19430.1| hypothetical protein COCSUDRAFT_48944 [Coccomyxa subellipsoidea 
C-169]
Length=792

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 73/158 (46%), Gaps = 18/158 (11%)
 Frame = -3

Query  979  DQNSNAVPTVELKFQTLGKFVIVYGSLSGN--SSVHSVQLDKDHFVPFLNVAWSNCGLSE  806
            D+ S       +K+ T G  ++V+GS +    S +    +D  H  P             
Sbjct  547  DEPSAMRAPCTVKYVTFGGSLVVWGSTASGRMSHISIAAVDYIHSQP-------------  593

Query  805  EIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKIL  626
               GK G       +++   +  +KDG   P+LI LC + G   PP    LPTELKL  L
Sbjct  594  ---GKSGSEPRLSARDLSGLYMRLKDGFIHPILIALCAEEGRQPPPSLQLLPTELKLLCL  650

Query  625  ELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNA  512
              L A DLA ++C   DLR++AS++ LW+     +F A
Sbjct  651  RHLQARDLAALACASRDLRHVASSEVLWEPLLVAEFGA  688



>ref|XP_008053636.1| PREDICTED: F-box only protein 7 isoform X2 [Tarsius syrichta]
Length=523

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 112/429 (26%), Positives = 185/429 (43%), Gaps = 45/429 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P++VP +  TL +L  R  L+          S     ++LN KD L
Sbjct  1     MKLRVRI--QKRTWPLEVPGAEPTLGQL--RAHLSQALLPTCGHSSDTRFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  S + P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQSNDQPSLATSSNQAS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  +LS +   ++  +  +N+     P    + E  +  V+  +      ++ +  S S
Sbjct  115   IRDEQLSGSFQGQAAQSDVWNTGDMAEPSQNVEAESIQDVVIMEEVTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++++H ++LESG++ +        +P +W      
Sbjct  175   VDGQVPHSLETLYQSADCSDASDALIVSIHLLMLESGYIPQGTEAKAVSMPEKW--KSRG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFV  848
             V  L Y+ P    G +           L    LG  V++  +L  N+ + SV+  K   +
Sbjct  233   VYKLQYTHPLCEGGSS----------SLTCVPLGNLVVINATLKINNEIRSVK--KLQLL  280

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
             P   +     G  E +A           K++ +  R  KD L  PLL     +    LP 
Sbjct  281   PESFICKEEPG--ENVAKI--------YKDLPKLSRLFKDQLVYPLLA--FTRQALNLPD  328

Query  667   CF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADWFR-  500
              F  + LP ELKL+I  LL    +  +S +C DL  +ASND  LW+  +   F  +  R 
Sbjct  329   VFGLIVLPLELKLRIFRLLDVRSVLALSAVCRDL-LIASNDPLLWRCLYLRDFRDNTIRV  387

Query  499   NGGSWKQKF  473
                 WK+ +
Sbjct  388   RDTDWKELY  396



>ref|NP_001033148.1| F-box only protein 7 [Bos taurus]
 sp|Q2T9S7.1|FBX7_BOVIN RecName: Full=F-box only protein 7 [Bos taurus]
 gb|AAI11287.1| F-box protein 7 [Bos taurus]
Length=522

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 108/430 (25%), Positives = 181/430 (42%), Gaps = 48/430 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+R    K T P+D+P     P L +  +    A   +   S     ++LN KD L 
Sbjct  1     MKLRVRL--QKRTWPLDMP--EVEPTLGQLRAYLSQALPTWGYSSDARFAITLNNKDALT  56

Query  1543  SSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLSQ  1379
                 +ETL   GI SGDL+   L      PN+  S+ S+ ++  + + P+ +T S   + 
Sbjct  57    GD--EETLASYGIVSGDLLCLILEDAIAAPNLPSSTVSEHSSVQNNDQPSLATSSSQSNI  114

Query  1378  KSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKD-ADVVGKSFSV  1202
             +  +L  +L  ++T +  +N  S   P    + E     V   +      A+ +  S SV
Sbjct  115   QDAQLHDSLQGQATQSEVWNDDSVSGPGQHFEAEAVPDVVDVEEGTGYYLAEPMLCSESV  174

Query  1201  PGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQV  1025
              G +          +D       L++++H ++LESG++ +        +P  W L    V
Sbjct  175   EGQVPHSLEILYQSADCLNPCDALIVSIHLLMLESGYIPQGTEAKAVSMPQNWRLG--GV  232

Query  1024  SILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDH  854
               L Y+ P    G          +  L    LG  +++  +L  NS V SV   QL  + 
Sbjct  233   YKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINSEVRSVKRLQLLPES  282

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             F+             +E +G++  +     K++ +  R  KD L  PLL     +    L
Sbjct  283   FI------------CKEESGENVAMIY---KDLQKLSRLFKDQLVYPLLA--FTRQALNL  325

Query  673   PPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFR  500
             P  F  + LP ELKL+I  LL    +  +S +C DL   +++  LW+  +   F     R
Sbjct  326   PDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLCITSNDQLLWRCLYLRDFRDGSIR  385

Query  499   NGGS-WKQKF  473
                + WK+ +
Sbjct  386   GRDTDWKELY  395



>ref|XP_008841330.1| PREDICTED: F-box only protein 7 isoform X1 [Nannospalax galili]
Length=522

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 114/432 (26%), Positives = 182/432 (42%), Gaps = 54/432 (13%)
 Frame = -3

Query  1717  LRLRSVETKETIPVDVP-PSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELRS  1541
             +RLR    K T P+++P  + TL +L  R  L+     ++   S     ++LN KD L  
Sbjct  1     MRLRVRLQKRTGPLELPVAAPTLGQL--RAHLSQALLPSWGFSSDTRFAITLNNKDAL--  56

Query  1540  SSPDETLEMLGITSGDLIFFALN--------PNVQESSESQITTGLSPNLPAESTDSINL  1385
             +  +ETL   GI SGDLI   L         P+  +S  S +     P+L A S  +   
Sbjct  57    TGDEETLASYGIVSGDLICLVLEDAMPRPNLPSSTDSEHSSLQNNDQPSLAASSNQASIP  116

Query  1384  SQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFS  1205
              ++  + +  LP +S     +N  S + P    + E  +   ME D     ++ +  S +
Sbjct  117   DEQWSDSAQGLPAQS---DAWNDNSVEGPRYNVEAELVQDVAMEEDSGFCPSEPMLCSEA  173

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++ VH ++LESG++ +        +P++W L+   
Sbjct  174   VEGQVPHSLEILYQSADCSNASDALIVLVHLLMLESGYIPQRTEAKAVSMPDKWKLS--G  231

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P    G          +  L    LG  +IV  +L  NS + SV   QL  +
Sbjct  232   VYKLQYTHPLCEGG----------SAVLTCVPLGNLIIVNATLRINSEIKSVKRLQLLPE  281

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              FV              E  G++        K++ +  R  KD L  PLL     +    
Sbjct  282   SFV------------CTEQPGENA---AKVYKDLQKLSRLFKDQLVYPLLA--FTRQALN  324

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL ++ SND  LW+  +   F    
Sbjct  325   LPDVFGLVVLPLELKLRIFRLLDVPSVLALSAVCRDL-FITSNDPLLWRCLYLRDFRDGT  383

Query  505   FRNGGS-WKQKF  473
              R   + WK+ +
Sbjct  384   VRGRDTDWKELY  395



>ref|NP_001165222.1| F-box only protein 7 [Sus scrofa]
 gb|ADB19862.1| F-box protein 7 [Sus scrofa]
Length=527

 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 114/444 (26%), Positives = 182/444 (41%), Gaps = 71/444 (16%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L+          S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEMPEAEPTLGQL--RAHLSQALLPTCGYSSDARFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +       
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQNNDQPSLAASFSPSG  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVV----GK  1214
              +  +LS +   ++  +  +N  S   P    + E              D DVV    G 
Sbjct  115   IQDEQLSDSFQGQAAQSDVWNDDSMSGPSQNSEAE-------------PDQDVVDMEEGT  161

Query  1213  SF----------SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILH  1067
              F          SV G +          +D       L++++H ++LESG++ +      
Sbjct  162   GFYPSEPMLCSESVEGQVPHSLETLYQSADCSSPSDALIVSIHLLMLESGYMPQGTEARA  221

Query  1066  KKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNS  887
               +P  W      V  L Y+ P    G          +  L    LG  +++  +L  NS
Sbjct  222   VSMPENW--RSGGVYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKLNS  269

Query  886   SVHSVQLDKDHFVP--FLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALP  713
              + SV+  +   +P  F+    S   L E +A           K++ +  R  KD L  P
Sbjct  270   EIRSVK--RLQLLPESFICKEESENVLGENVAKI--------YKDLQKLSRLFKDQLVYP  319

Query  712   LLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LW  542
             LL     +    LP  F  + LP ELKL+I  LL    +  +S +C DL Y+ASND  LW
Sbjct  320   LLA--FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-YIASNDQLLW  376

Query  541   KQKFEEQFNADWFRNGGS-WKQKF  473
             +  +   F     R   + WK+ +
Sbjct  377   RCLYLRDFRDGTVRGRDTDWKELY  400



>ref|XP_003258173.1| PREDICTED: F-box only protein 7 isoform 1 [Nomascus leucogenys]
Length=522

 Score = 68.6 bits (166),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 114/432 (26%), Positives = 191/432 (44%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP +  TL +L+ RL+ +L  +  FS  +  +I  +LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVPETEPTLGQLRARLTQSLRCTLGFSSDTRFTI--TLNYKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++      P+ +T S   S
Sbjct  57    --TGEEETLASYGIVSGDLICLILQDDIPAPNLPSSTDSEHSSLQDNEQPSLATSSNQAS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   IQDEQPSDSFQGQAAQSDVWNDDSTLGPSQNFEAESIQGIADMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++ L        +P +W      
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPLGTEAKALSMPEKW--KSSG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E  G++    T   K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------HKEKLGEN---VTKIYKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVQDTDWKELY  396



>ref|XP_008973225.1| PREDICTED: F-box only protein 7 isoform X2 [Pan paniscus]
Length=524

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 111/432 (26%), Positives = 183/432 (42%), Gaps = 49/432 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP +  TL  L+      L   S F   S+    ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVPETEPTLGHLRSHHRQFLLCLSVFLGSSNTRFTITLNYKDPL  58

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  +   P+ +T S   S
Sbjct  59    --TGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTS  116

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  117   MQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSES  176

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++          +P +W      
Sbjct  177   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKW--KSSG  234

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  235   VYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  284

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  285   SFI-------CKEKLGENVANI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALN  327

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  328   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  386

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  387   VRVQDTDWKELY  398



>ref|NP_036311.3| F-box only protein 7 isoform 1 [Homo sapiens]
 sp|Q9Y3I1.1|FBX7_HUMAN RecName: Full=F-box only protein 7 [Homo sapiens]
 gb|AAF67155.1|AF233225_1 F-box protein FBX [Homo sapiens]
 emb|CAB43356.1| hypothetical protein [Homo sapiens]
 emb|CAG30377.1| FBXO7 [Homo sapiens]
 emb|CAK54519.1| FBXO7 [synthetic construct]
 emb|CAK54818.1| FBXO7 [synthetic construct]
 gb|EAW60025.1| F-box protein 7, isoform CRA_c [Homo sapiens]
Length=522

 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 111/432 (26%), Positives = 183/432 (42%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKR-RlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP   T P L   R  L       +   S+    ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVP--ETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  +   P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   MQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++          +P +W L+   
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLS--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEKLGENVANI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVQDTDWKELY  396



>gb|EAW60026.1| F-box protein 7, isoform CRA_d [Homo sapiens]
Length=522

 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 111/432 (26%), Positives = 183/432 (42%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKR-RlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP   T P L   R  L       +   S+    ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVP--ETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  +   P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   MQDEQPSDSFQGQAAQSGVWNDDSMVGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++          +P +W L+   
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLS--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEKLGENVANI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVQDTDWKELY  396



>gb|ADB19861.1| F-box protein 7 [Sus scrofa]
 gb|AEK33398.1| F-box protein 7 [Sus scrofa]
Length=527

 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 113/444 (25%), Positives = 182/444 (41%), Gaps = 71/444 (16%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L+          S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEMPEAEPTLGQL--RAHLSQALLPTCGYSSDARFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +       
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQNNDQPSLAASFSPSG  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVV----GK  1214
              +  +LS +   ++  +  +N  S   P    + E              D DVV    G 
Sbjct  115   IQDEQLSDSFQGQAAQSDVWNDDSMSGPSQNSEAE-------------PDQDVVDMEEGT  161

Query  1213  SF----------SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILH  1067
              F          SV G +          +D       L++++H ++LESG++ +      
Sbjct  162   GFYPSEPMLCSESVEGQVPHSLETLYQSADCSSPSDALIVSIHLLMLESGYMPQGTEARA  221

Query  1066  KKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNS  887
               +P  W      V  L Y+ P    G          +  L    LG  +++  +L  N+
Sbjct  222   VSMPENW--RSGGVYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKLNN  269

Query  886   SVHSVQLDKDHFVP--FLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALP  713
              + SV+  +   +P  F+    S   L E +A           K++ +  R  KD L  P
Sbjct  270   EIRSVK--RLQLLPESFICKEESENVLGENVAKI--------YKDLQKLSRLFKDQLVYP  319

Query  712   LLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LW  542
             LL     +    LP  F  + LP ELKL+I  LL    +  +S +C DL Y+ASND  LW
Sbjct  320   LLA--FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-YIASNDQLLW  376

Query  541   KQKFEEQFNADWFRNGGS-WKQKF  473
             +  +   F     R   + WK+ +
Sbjct  377   RCLYLRDFRDGTVRGRDTDWKELY  400



>ref|XP_003989263.1| PREDICTED: F-box only protein 7 [Felis catus]
Length=522

 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 122/442 (28%), Positives = 180/442 (41%), Gaps = 72/442 (16%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+R    K T PV++P +   P L    +  L + S F   S     ++LN KD L 
Sbjct  1     MKLRVRL--QKRTWPVEMPDAE--PTLGHLRNHLLLSLSIFLGSSDTRFAITLNNKDAL-  55

Query  1543  SSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDS-----INLSQ  1379
              +  +ETL   GI SGDLI   L   +            +PNLP+ STDS      N  Q
Sbjct  56    -TGDEETLASYGIVSGDLICLILEDAIP-----------APNLPS-STDSEHSSLQNNDQ  102

Query  1378  KSLELSSNLP-VESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGK----  1214
              SL  SSN   V+    SD  S   +A +   + +E      +    E   DVV      
Sbjct  103   PSLAASSNQSIVQDEQPSD--SFQGQAAQTDVRNDENMSGPSQTFETESVQDVVAMEEGT  160

Query  1213  ----------SFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK  1064
                       S SV G +          +D       L++++H ++LESG++   P    
Sbjct  161   GVCPSEPMLCSESVEGQVPHSLEVLYHSADCSSPSDALIVSIHLLMLESGYIPQGPEAKA  220

Query  1063  -KVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNS  887
               +P  W      V  L Y+ P    G          +  L    LG  +++  +L  NS
Sbjct  221   MSMPENW--RSGGVYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINS  268

Query  886   SVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLL  707
              + SV  ++   +P   +  +  G  E +A           K++ +  R  KD L  PLL
Sbjct  269   ELRSV--NRLQLLPESFICKTEPG--ENVAKV--------YKDLQKLSRLFKDQLVYPLL  316

Query  706   IELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQ  536
                  +    LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+ 
Sbjct  317   A--FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FIASNDQLLWRC  373

Query  535   KFEEQFNADWFR-NGGSWKQKF  473
              +   F     R     WK+ +
Sbjct  374   LYLRDFRDGTARVRDTDWKELY  395



>gb|EFB18566.1| hypothetical protein PANDA_010472 [Ailuropoda melanoleuca]
Length=481

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 97/380 (26%), Positives = 155/380 (41%), Gaps = 45/380 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L     +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+
Sbjct  7     ITLNNKDALTGD--EETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQNNDQPS  64

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDA  1229
              +  S   S +  + S     ++T T   N+ S   P    +    +   ME       +
Sbjct  65    LAASSNQSSTQDEQPSDAFQGQATQTDVGNNDSMSGPSQPFEAGSVQDVDMEEGTGVFPS  124

Query  1228  DVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPN  1052
             + +  S S  G +          +D    +  L+++VH ++LESG++         ++P 
Sbjct  125   EPMLCSESEEGQVPHSLEILYQSADCSNANDALIVSVHLLMLESGYIPQGTEAKALRMPE  184

Query  1051  QWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV  872
              W      V  L Y+ P    G          +  L    LG  VI+  +L  NS + SV
Sbjct  185   HW--KSGGVYKLQYTHPLCEGG----------SAALTCVPLGALVIINATLKINSELRSV  232

Query  871   ---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
                QL  + F+                  + G       K++ +  R  KD L  PLL  
Sbjct  233   KRLQLLPESFI---------------CKAEPGESVAKIYKDLQKLSRLFKDQLVCPLLA-  276

Query  700   LCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKF  530
                +    LP  F  + LP ELKL+I  LL    +  +S +C DL  +ASND  LW+  +
Sbjct  277   -FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-LIASNDQLLWRCLY  334

Query  529   EEQFNADWFRNGGS-WKQKF  473
                F     R   + WK+ +
Sbjct  335   LRDFRDGTVRARDTDWKELY  354



>ref|XP_004418132.1| PREDICTED: F-box only protein 7 isoform 1 [Ceratotherium simum 
simum]
Length=523

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 112/429 (26%), Positives = 184/429 (43%), Gaps = 45/429 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L+     A    S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEMPEAEPTLGQL--RAHLSQALLPASGYSSDTRFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P  +  S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQNNDQPPLAVSSSQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  +LS +   ++  +  +N  S   P    + E  +  V   +       + +  S S
Sbjct  115   VQDEQLSDSFQGQAAQSDVWNDDSTSGPSQHFEAESIQDVVDMEEGTGFYPVEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D    +  L++AVH ++LESG++ +        +P  W L    
Sbjct  175   VDGQVPHSLETLYQSADCSDPNDALIVAVHLLMLESGYIPQGTEAKAVSMPENWKLG--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFV  848
             V  L Y+ P    G          +  L    LG  +++  +L  N+ + SV+  +   +
Sbjct  233   VYKLRYTHPLCEGG----------SAALTCVPLGTLIVINATLKINNEIRSVK--RLQLL  280

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
             P   +     G  E +A           K++ +  R  KD L  PLL     +    LP 
Sbjct  281   PASFIRKEELG--ENVAKI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALNLPD  328

Query  667   CF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADWFRN  497
              F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+  +   F     R 
Sbjct  329   VFGLIVLPLELKLRIFRLLDVRSVLSLSAVCHDL-FIASNDPLLWRCLYLRDFRDSTVRA  387

Query  496   GGS-WKQKF  473
               + WK+ +
Sbjct  388   RDTDWKELY  396



>ref|XP_005893759.1| PREDICTED: F-box only protein 7 [Bos mutus]
 ref|XP_010851666.1| PREDICTED: F-box only protein 7 isoform X1 [Bison bison bison]
 tpg|DAA29513.1| TPA: F-box only protein 7 [Bos taurus]
 gb|ELR57835.1| F-box only protein 7 [Bos mutus]
Length=522

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 106/430 (25%), Positives = 180/430 (42%), Gaps = 48/430 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+R    K T P+D+P     P L +  +    A   +   S     ++LN KD L 
Sbjct  1     MKLRVRL--QKRTWPLDMP--EVEPTLGQLRAYLSQALPTWGYSSDARFAITLNNKDAL-  55

Query  1543  SSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLSQ  1379
              +  +ETL   GI SGDL+   L      PN+  S+ S+ ++  + + P+ +  S   + 
Sbjct  56    -TGDEETLASYGIVSGDLLCLILEDAIAAPNLPSSTVSEHSSVQNNDQPSLAASSSQSNI  114

Query  1378  KSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKD-ADVVGKSFSV  1202
             +  +L  +L  ++  +  +N  S   P    + E     V   +      A+ +  S SV
Sbjct  115   QDAQLHDSLQGQAAQSEVWNDDSVSGPGQHFEAEAVPDVVDVEEGTGYYLAEPMLCSESV  174

Query  1201  PGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQV  1025
              G +          +D       L++++H ++LESG++ +        +P  W L    V
Sbjct  175   EGQVPHSLEILYQSADCLNPCDALIVSIHLLMLESGYIPQGTEAKAVSMPQNWRLG--GV  232

Query  1024  SILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDH  854
               L Y+ P    G          +  L    LG  +++  +L  NS V SV   QL  + 
Sbjct  233   YKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINSEVRSVKRLQLLPES  282

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             F+             +E +G++  +     K++ +  R  KD L  PLL     +    L
Sbjct  283   FI------------CKEESGENVAMIY---KDLQKLSRLFKDQLVYPLLA--FTRQALNL  325

Query  673   PPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFR  500
             P  F  + LP ELKL+I  LL    +  +S +C DL   +++  LW+  +   F     R
Sbjct  326   PDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLCITSNDQLLWRCLYLRDFRDGSIR  385

Query  499   NGGS-WKQKF  473
                + WK+ +
Sbjct  386   GRDTDWKELY  395



>dbj|BAF84661.1| unnamed protein product [Homo sapiens]
Length=522

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 111/432 (26%), Positives = 183/432 (42%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKR-RlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP   T P L   R  L       +   S+    ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVP--ETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  +   P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   MQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++          +P +W L+   
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLS--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNELRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEKLGENVANI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVQDTDWKELY  396



>gb|AAH08361.1| F-box protein 7 [Homo sapiens]
 emb|CAL37618.1| hypothetical protein [synthetic construct]
 gb|ABW03590.1| F-box protein 7 [synthetic construct]
 gb|ABW03591.1| F-box protein 7 [synthetic construct]
 dbj|BAG10938.1| F-box only protein 7 [synthetic construct]
 gb|AIC56109.1| FBXO7, partial [synthetic construct]
Length=522

 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 111/432 (26%), Positives = 183/432 (42%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKR-RlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP   T P L   R  L       +   S+    ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVP--ETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  +   P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   IQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++          +P +W L+   
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLS--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEKLGENVANI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVQDTDWKELY  396



>ref|XP_002501684.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62942.1| predicted protein [Micromonas sp. RCC299]
Length=552

 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 45/85 (53%), Gaps = 1/85 (1%)
 Frame = -3

Query  748  FWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKIL-ELLPAVDLAKMSCLCSDL  572
             WR  KD LALP  I     AG   PP F+ LP ELKL  L  L  A D+  +   C +L
Sbjct  295  LWRDAKDSLALPASIRARSAAGLPSPPPFLALPDELKLATLAHLAEARDVCAVGATCREL  354

Query  571  RYLASNDDLWKQKFEEQFNADWFRN  497
              LAS+DDLWK   + +F A+   +
Sbjct  355  AALASSDDLWKPLHDAEFGAETLND  379



>ref|XP_009232566.1| PREDICTED: F-box only protein 7 isoform X1 [Pongo abelii]
Length=522

 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 114/442 (26%), Positives = 184/442 (42%), Gaps = 71/442 (16%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKR-RlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP   T P L + R  L       +   S     ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVP--ETEPTLGQLRWHLRQSLLCTWGYSSDTRFTITLNYKDPL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  +   P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVV-GKSF-  1208
              +  + S +   ++  +  +N  S   P    + E  +           +AD+  G  F 
Sbjct  115   IQDEQPSDSFQGQAAQSDVWNDDSTLGPSQNFEAESIQ----------DNADMAEGTGFC  164

Query  1207  ---------SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KV  1058
                      SV G +          +D    +  L++ +H ++LESG++          +
Sbjct  165   LSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSM  224

Query  1057  PNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVH  878
             P +W L+   V  L Y  P + +G +           L    LG  ++V  +L  N+ + 
Sbjct  225   PEKWKLS--GVYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIR  272

Query  877   SV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLL  707
             SV   QL  + F+           L E +A           K++ +  R  KD L  PLL
Sbjct  273   SVKRLQLLPESFI-------CKEKLGENVAKI--------YKDLQKLSRLFKDQLVYPLL  317

Query  706   IELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQ  536
                  +    LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+ 
Sbjct  318   A--FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRF  374

Query  535   KFEEQFNADWFR-NGGSWKQKF  473
              +   F  +  R     WK+ +
Sbjct  375   LYLRDFRDNTVRVQDTDWKELY  396



>ref|XP_007946416.1| PREDICTED: F-box only protein 7 isoform X1 [Orycteropus afer 
afer]
Length=523

 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 114/399 (29%), Positives = 162/399 (41%), Gaps = 82/399 (21%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDS  1394
             ++LN KD L     +ETL   GI SGDLI   L   +            +PNLP+ STDS
Sbjct  48    ITLNNKDALTGD--EETLASYGIVSGDLICLILEDAIP-----------APNLPS-STDS  93

Query  1393  INLS-----QKSLELSSNLP-VESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKD  1232
                S     Q SL  SSN P ++    SD  SL  +A E     ++  VE  E    E  
Sbjct  94    EPSSLQHNDQPSLATSSNQPSIQGGQPSD--SLQGQAAESDVGNDDTMVEPSEDVEAESV  151

Query  1231  ADVV----GKSF----------SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESG  1094
              D V    G  F          +V G +          +D    +  L++ +H ++LESG
Sbjct  152   QDAVDMEEGTGFCPSEPMLCSETVEGQVPHSLETLYHAADCSNANDALIVLIHLLMLESG  211

Query  1093  FV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFV  917
             ++ +        +P +W      V  L Y+ P    G          T  L    LG  +
Sbjct  212   YIPQGTEAKAASMPEKW--KSGGVYKLQYTHPLCNGG----------TAALTCVPLGTLI  259

Query  916   IVYGSLSGNSSVHSV---QLDKDHFV----PFLNVAWSNCGLSEEIAGKDGLLCTSPEKE  758
             IV  +L  N+ + SV   QL  + F+    P  NVA                      K+
Sbjct  260   IVNATLKINNDIRSVKRLQLLPESFICKEEPEENVAKMY-------------------KD  300

Query  757   VFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCL  584
             + +  R  KD L  PLL     +    LP  F  + LP ELKL+I  LL A  +  +S +
Sbjct  301   LQKLSRLFKDQLVYPLLA--FTRQALNLPDVFGLVVLPLELKLRIFRLLDARSVLSLSAV  358

Query  583   CSDLRYLASNDD-LWKQKFEEQFNADWFRNGGS-WKQKF  473
             C DL ++ASND  LW+  +   F     R   + WK+ +
Sbjct  359   CRDL-FIASNDQLLWRCLYLRDFRDSTARARDTDWKELY  396



>ref|XP_009436518.1| PREDICTED: F-box only protein 7 isoform X3 [Pan troglodytes]
Length=418

 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 110/418 (26%), Positives = 184/418 (44%), Gaps = 50/418 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP +  TL  L+ RL  +L  +  +S ++  +I  +LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVPETEPTLGHLRSRLRQSLLCTWGYSSNTRFTI--TLNYKDPL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  +   P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATISNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   MQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++ +        +P +W      
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKW--KSSG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEKLGENVANI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNA  512
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F A
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRA  382



>ref|NP_001162200.1| F-box only protein 7 [Papio anubis]
 gb|ABW96828.1| F-box protein 7, isoform 1 (predicted) [Papio anubis]
Length=522

 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 111/432 (26%), Positives = 186/432 (43%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVPEAEPTLGQL--RAHLSQALLCTWGYSSDTRFTITLNYKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNLPSSTDSEHSSLQNNDQPSLATSSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   LQDEQPSDSFQGQAAQSDVWNDDSTLGPSQNFEAESIQDIEDMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++          +P +W L+   
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYMPQGTEAKALSMPEKWKLS--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYMHP-LCEGSS---------AALTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEKLGEHVAKI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALS  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVQDTDWKELY  396



>ref|XP_005655574.1| PREDICTED: F-box only protein 7 isoform X1 [Sus scrofa]
Length=523

 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 112/445 (25%), Positives = 182/445 (41%), Gaps = 77/445 (17%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L+          S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEMPEAEPTLGQL--RAHLSQALLPTCGYSSDARFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +       
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQNNDQPSLAASFSPSG  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVV----GK  1214
              +  +LS +   ++  +  +N  S   P    + E              D DVV    G 
Sbjct  115   IQDEQLSDSFQGQAAQSDVWNDDSMSGPSQNSEAE-------------PDQDVVDMEEGT  161

Query  1213  SF----------SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILH  1067
              F          SV G +          +D       L++++H ++LESG++ +      
Sbjct  162   GFYPSEPMLCSESVEGQVPHSLETLYQSADCSSPSDALIVSIHLLMLESGYMPQGTEARA  221

Query  1066  KKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNS  887
               +P  W      V  L Y+ P    G          +  L    LG  +++  +L  N+
Sbjct  222   VSMPENW--RSGGVYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKLNN  269

Query  886   SVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLAL  716
              + SV   QL  + F+             +E +G++        K++ +  R  KD L  
Sbjct  270   EIRSVKRLQLLPESFI------------CKEESGEN---VAKIYKDLQKLSRLFKDQLVY  314

Query  715   PLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-L  545
             PLL     +    LP  F  + LP ELKL+I  LL    +  +S +C DL Y+ASND  L
Sbjct  315   PLLA--FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-YIASNDQLL  371

Query  544   WKQKFEEQFNADWFRNGGS-WKQKF  473
             W+  +   F     R   + WK+ +
Sbjct  372   WRCLYLRDFRDGTVRGRDTDWKELY  396



>ref|XP_006865302.1| PREDICTED: F-box only protein 7 [Chrysochloris asiatica]
Length=526

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 112/439 (26%), Positives = 179/439 (41%), Gaps = 65/439 (15%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L       +   S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTGPLEMPEAEPTLGQL--RAHLGQVLLPTWGYSSDTRFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
                  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P  +  S   S
Sbjct  57    TGD--EETLASYGIVSGDLICLVLEDAIPAPNLPSSTDSEHSSLQNNDQPPLAASSNQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSV  1202
             ++   LS +   ++  +  +N  S   P      E     V          +  G  +S 
Sbjct  115   KQDEPLSDSFSGQAAQSDLWNDDSMPGPSSDVGAESVPDAVEME-------EGAGFYYSE  167

Query  1201  PGFLRKVFTKELSDS--------DGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQ  1049
             P    +    ++  S        D    +  L++ +H ++LESG++ +        +P +
Sbjct  168   PMLCSETVEGQVPHSLETLYHAADCSNANDALIVLIHLLMLESGYIPQGTEAKAASMPEK  227

Query  1048  WILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV-  872
             W      V  L Y+ P    G          +  L    LGK ++V  +L   + + SV 
Sbjct  228   W--KSGGVYKLQYTHPLCNGG----------SAALTCVPLGKLIVVNATLKICNEIRSVK  275

Query  871   --QLDKDHFVPFLNVAWSNC-GLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
               QL  + F+         C G  E+ A K         K++ +  R  KD L  PLL  
Sbjct  276   RLQLLPESFI---------CKGEPEDNAAKV-------YKDLPKLSRLFKDQLVYPLLA-  318

Query  700   LCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFE  527
                +    LP  F  + LP ELKL+IL LL    +  +S +C DL   AS+  LW+  + 
Sbjct  319   -LSRQALNLPDVFGLVVLPLELKLRILRLLDVRSVLSLSAVCRDLCIAASDPLLWRCLYL  377

Query  526   EQFNADWFRNGGS-WKQKF  473
               F     R   + WK+ +
Sbjct  378   RDFRDSTARARDTDWKELY  396



>ref|XP_001153721.2| PREDICTED: F-box only protein 7 isoform X1 [Pan troglodytes]
Length=522

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 112/432 (26%), Positives = 188/432 (44%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP +  TL  L+ RL  +L  +  +S ++  +I  +LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVPETEPTLGHLRSRLRQSLLCTWGYSSNTRFTI--TLNYKDPL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  +   P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATISNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   MQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++          +P +W      
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKW--KSSG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEKLGENVANI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVQDTDWKELY  396



>ref|XP_005655575.1| PREDICTED: F-box only protein 7 isoform X2 [Sus scrofa]
Length=523

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 121/446 (27%), Positives = 183/446 (41%), Gaps = 79/446 (18%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L+          S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEMPEAEPTLGQL--RAHLSQALLPTCGYSSDARFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDS-----INLS  1382
               +  +ETL   GI SGDLI   L   +            +PNLP+ STDS      N  
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIP-----------APNLPS-STDSEHSSLQNND  102

Query  1381  QKSLELS-SNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVV----G  1217
             Q SL  S S   ++    SD  S   +A +     ++  V   +    E D DVV    G
Sbjct  103   QPSLAASFSPSGIQDEQLSD--SFQGQAAQSDVWNDDSMVGPSQNSEAEPDQDVVDMEEG  160

Query  1216  KSF----------SVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPIL  1070
               F          SV G +          +D       L++++H ++LESG++ +     
Sbjct  161   TGFYPSEPMLCSESVEGQVPHSLETLYQSADCSSPSDALIVSIHLLMLESGYMPQGTEAR  220

Query  1069  HKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGN  890
                +P  W      V  L Y+ P    G          +  L    LG  +++  +L  N
Sbjct  221   AVSMPENW--RSGGVYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKLN  268

Query  889   SSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLA  719
             + + SV   QL  + F+             +E +G++        K++ +  R  KD L 
Sbjct  269   NEIRSVKRLQLLPESFI------------CKEESGEN---VAKIYKDLQKLSRLFKDQLV  313

Query  718   LPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-  548
              PLL     +    LP  F  + LP ELKL+I  LL    +  +S +C DL Y+ASND  
Sbjct  314   YPLLA--FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-YIASNDQL  370

Query  547   LWKQKFEEQFNADWFRNGGS-WKQKF  473
             LW+  +   F     R   + WK+ +
Sbjct  371   LWRCLYLRDFRDGTVRGRDTDWKELY  396



>ref|XP_006914760.1| PREDICTED: LOW QUALITY PROTEIN: F-box only protein 7 [Pteropus 
alecto]
Length=650

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 99/395 (25%), Positives = 159/395 (40%), Gaps = 74/395 (19%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L  +  +ETL   GI SGDLI   L      PN+  S++S  ++  + + P+
Sbjct  177   ITLNNKDAL--TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSDHSSLQNNDQPS  234

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDA  1229
              +  SI  S++  + S +   E+  +  +N  S   P    + E  +             
Sbjct  235   LAASSIQPSKQEEQWSDSFQGEAAQSDVWNDDSMSGPSQNFEAESIQDV----------V  284

Query  1228  DVVGK-----------SFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-R  1085
             DV G            S SV G +          +D    +  L++++H ++LESG++ +
Sbjct  285   DVEGGTGFCPSEPMLCSESVEGQVPHSLETLYQSADCSNPNDALIVSLHLLMLESGYIPQ  344

Query  1084  LDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYG  905
                     +P  W      V  L Y+ P    G          +  L    LG  +++  
Sbjct  345   GTEAKAMSMPENW--KSGGVYKLQYTHPLCEGG----------SAALTCVPLGNLIVINA  392

Query  904   SLSGNSSVHSV---QLDKDHFV----PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEF  746
             +L  N+ + SV   QL  + F+    P  NVA                      K++ + 
Sbjct  393   TLKINNEIRSVKRLQLLPESFICKEEPAENVA-------------------KIYKDLQKL  433

Query  745   WRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDL  572
              R  KD L  PLL     +    LP  F  + LP ELKL+I  LL    +  +S +C DL
Sbjct  434   SRLFKDQLVYPLLA--FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCHDL  491

Query  571   RYLASNDD-LWKQKFEEQFNADWFR-NGGSWKQKF  473
              ++ASND  LW+  +   F     R     WK+ +
Sbjct  492   -FIASNDQLLWRCLYLRDFRDGSVRVRDTDWKELY  525



>ref|NP_001244387.1| F-box only protein 7 [Macaca mulatta]
 ref|XP_005567544.1| PREDICTED: F-box only protein 7 isoform X1 [Macaca fascicularis]
Length=522

 Score = 65.9 bits (159),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 110/430 (26%), Positives = 183/430 (43%), Gaps = 49/430 (11%)
 Frame = -3

Query  1717  LRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDELRS  1541
             +RLR    K T P++VP +  TL +L  R  L+      +   S     ++LN KD L  
Sbjct  1     MRLRVRLQKRTWPLEVPEAEPTLGQL--RAHLSQALLCTWGYSSDTRFTITLNYKDAL--  56

Query  1540  SSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLSQK  1376
             +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +T S   S +
Sbjct  57    TGDEETLASYGIVSGDLICLILQDDIPAPNLPSSTDSEHSSLQNNDQPSLATSSNETSIQ  116

Query  1375  SLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFSVP  1199
               + S +   ++  +  +N  S   P    + E  +      +      ++ +  S SV 
Sbjct  117   DEQPSDSFQGQAAQSDVWNDDSTLGPSQNFEAESIQDIEDMAEGTGFYPSEPMLCSESVE  176

Query  1198  GFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQVS  1022
             G +          +D    +  L++ +H ++LESG++          +P +W L+   V 
Sbjct  177   GQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYMPQGTEAKALSMPEKWKLS--GVY  234

Query  1021  ILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHF  851
              L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  + F
Sbjct  235   KLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESF  284

Query  850   VPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLP  671
             +           L E +A           K++ +  R  KD L  PLL     +    LP
Sbjct  285   I-------CKEKLGEHVAKI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALSLP  327

Query  670   PCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADWFR  500
               F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  +  R
Sbjct  328   DVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNTVR  386

Query  499   -NGGSWKQKF  473
                  WK+ +
Sbjct  387   VQDTDWKELY  396



>ref|XP_007973761.1| PREDICTED: F-box only protein 7 isoform X1 [Chlorocebus sabaeus]
Length=522

 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 110/432 (25%), Positives = 188/432 (44%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVPEAEPTLGQL--RAHLSQALLCTWGYSSDTRFTITLNYKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNLPSSTDSEHSSLQNNDQPSLATSSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   IQDEQPSDSFQGQAAQSDVWNDDSTLGPSQNFEAESIQDIEDMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++          +P +W L+   
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYMPQGTEAKALSMPEKWKLS--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYVHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E  G++    +   K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------CKEKLGEN---VSKIYKDLQKLSRLFKDQLVYPLLA--FTRQALS  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVQDTDWKELY  396



>ref|XP_007973764.1| PREDICTED: F-box only protein 7 isoform X3 [Chlorocebus sabaeus]
Length=418

 Score = 65.1 bits (157),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 109/418 (26%), Positives = 185/418 (44%), Gaps = 50/418 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVPEAEPTLGQL--RAHLSQALLCTWGYSSDTRFTITLNYKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNLPSSTDSEHSSLQNNDQPSLATSSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   IQDEQPSDSFQGQAAQSDVWNDDSTLGPSQNFEAESIQDIEDMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++ +        +P +W L+   
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYMPQGTEAKALSMPEKWKLS--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +      VP        LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYVHP-LCEGSS-ATLTCVP--------LGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E  G++    +   K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------CKEKLGEN---VSKIYKDLQKLSRLFKDQLVYPLLA--FTRQALS  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNA  512
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F A
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRA  382



>ref|XP_004006757.1| PREDICTED: F-box only protein 7 [Ovis aries]
Length=523

 Score = 65.1 bits (157),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 110/431 (26%), Positives = 181/431 (42%), Gaps = 49/431 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+D+P +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLDMPEAEPTLGQL--RAHLSQALLPTWGYSSDARFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S+ S+ ++  + + P+ +  S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIAAPNLPSSTVSEHSSLQNNDQPSLAASSSQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  +L  +L  ++     +N  S   P    + E     V   +      A+ +  S S
Sbjct  115   IQDAQLHDSLQGQAAQPEAWNDDSVSGPGQHFEAESVPDVVDVEEGAGFYPAEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D       L++++H ++LESG++          +P  W L    
Sbjct  175   VEGQVPHSLEILYQSADCSNPCDALIVSIHLLMLESGYIPQGTEAKALSMPENWRLG--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P    G          +  L    LG  +++  +L  NS V SV   QL  +
Sbjct  233   VYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINSEVRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E +G++  +     K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------CKEESGENVAMIY---KDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWF  503
             LP  F  + LP ELKL+I  LL    +  +S +C DL   +++  LW+  +   F     
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLCITSNDQLLWRCLYLRDFRDGSI  385

Query  502   RNGGS-WKQKF  473
             R   + WK+ +
Sbjct  386   RGRDTDWKELY  396



>ref|XP_007198428.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein 7 [Balaenoptera 
acutorostrata scammoni]
Length=523

 Score = 65.1 bits (157),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 94/381 (25%), Positives = 160/381 (42%), Gaps = 46/381 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L  +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+
Sbjct  48    ITLNNKDAL--TGDEETLASYGIVSGDLICLILEDAIAAPNLPSSTDSEHSSLQNNDQPS  105

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KD  1232
              +  S   S +  +L  +   +   +  +N  S   P    + E     V   +      
Sbjct  106   LAASSGQSSIQDEQLRDSFQGQEAQSDVWNDGSMSGPSQNFEAESIPDVVDVEEGTGFYP  165

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVP  1055
             ++ +  S SV G +          +D       L++++H ++LESG++ +        +P
Sbjct  166   SEPMLCSESVEGQVPHSLETLYQSADCSNPSDALIVSIHLLMLESGYIPQGTEAKAVSMP  225

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS  875
               W      V  L Y+ P    G          +  L    LG  +++  +L  N+ + S
Sbjct  226   ENW--RSGGVYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINNEIRS  273

Query  874   V---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
             V   QL  + F+             +E +G++        K++ +  R  KD L  PLL 
Sbjct  274   VKRLQLLPESFI------------CKEESGEN---VAKIYKDLQKLSRLFKDQLVYPLLA  318

Query  703   ELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQK  533
                 +    LP  F  + LP ELKL+I  LL    +  +S +C DL Y+ASND  LW+  
Sbjct  319   --FTRQALNLPDVFGLVVLPLELKLRIFRLLDIRSVLSLSAVCRDL-YIASNDQLLWRCL  375

Query  532   FEEQFNADWFRNGGS-WKQKF  473
             +   F     R   + WK+ +
Sbjct  376   YLRDFRDGTVRGRDTDWKELY  396



>gb|ACB21205.1| F-box only protein 7 isoform 1 (predicted) [Callicebus moloch]
Length=522

 Score = 65.1 bits (157),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 112/428 (26%), Positives = 184/428 (43%), Gaps = 45/428 (11%)
 Frame = -3

Query  1717  LRLRSVETKETIPVDVPPS-TTLPELKRRlslalpassafsmhssdSIRLSLNKKDELRS  1541
             +RLR    K T P++VP +  TL +L  R  L+L     +   S     ++LN KD L  
Sbjct  1     MRLRVRLEKRTQPLEVPEAEPTLGQL--RTHLSLALLPTWGYSSDTRFAITLNNKDALTG  58

Query  1540  SSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLSQK  1376
                +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +T S   S +
Sbjct  59    D--EETLASYGIVSGDLICLVLEDAIPAPNLPSSTDSEHSSLQNNDQPSLATSSNQTSIQ  116

Query  1375  SLELSSNL--PVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGKSFSV  1202
               +LS +   P   +N  + +++S  +     +  ++  +V E         ++  S SV
Sbjct  117   DEQLSDSFQGPAAQSNVWNDDNMSGPSQNFEAESIQDIADVEESTGFYPSEPMLC-SESV  175

Query  1201  PGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQV  1025
              G +          +D       L++ +H ++LESG++ +        +P +W      V
Sbjct  176   EGQVPHSLETLYLSADCSDASDALIVLIHLLMLESGYIPQGTEAKAMSMPEKW--KSSGV  233

Query  1024  SILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVP  845
               L Y  P + +G +           L    LG  ++V  +L  NS + SV+  +   +P
Sbjct  234   YKLQYMHP-LCEGSS---------AALTCVPLGNLIVVNATLKINSEIRSVK--RLQLLP  281

Query  844   FLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPC  665
                +   N G  E +A           K + +  R  KD L  PLL     +    LP  
Sbjct  282   ESFICKENLG--ENVAKI--------YKGLQKLSRLFKDQLVYPLLA--FTRQALNLPDV  329

Query  664   F--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADWFR-N  497
             F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F     R  
Sbjct  330   FGLVVLPLELKLRIFRLLDVRSILSLSAVCRDL-FTASNDPLLWRFLYLRDFRDSTVRVQ  388

Query  496   GGSWKQKF  473
                WK+ +
Sbjct  389   DTDWKELY  396



>ref|XP_007096560.1| PREDICTED: F-box only protein 7, partial [Panthera tigris altaica]
Length=492

 Score = 65.1 bits (157),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 106/392 (27%), Positives = 158/392 (40%), Gaps = 68/392 (17%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDS  1394
             ++LN KD L  +  +ETL   GI SGDLI   L   +            +PNLP+ STDS
Sbjct  17    ITLNNKDAL--TGDEETLASYGIVSGDLICLILEDAIP-----------APNLPS-STDS  62

Query  1393  -----INLSQKSLELSSNLP-VESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKD  1232
                   N  Q SL  SSN   V+    SD  S   +A +   + +E      +    E  
Sbjct  63    EHSSLQNNDQPSLAASSNQSIVQDEQPSD--SFQGQAAQTDVRNDENMSGPSQTFETESV  120

Query  1231  ADVVGK--------------SFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESG  1094
              DVV                S SV G +          +D       L++++H ++LESG
Sbjct  121   QDVVAMEEGTGACPSEPMLCSESVEGQVPHSLEVLYHSADCSSPSDALIVSIHLLMLESG  180

Query  1093  FVRLDPILHK-KVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFV  917
             ++   P      +P  W      V  L Y+ P    G          +  L    LG  +
Sbjct  181   YIPQGPEAKAMSMPENW--RSGGVYKLQYTHPLCEGG----------SAALTCVPLGNLI  228

Query  916   IVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRT  737
             ++  +L  NS + SV  ++   +P   +  +  G  E +A           K++ +  R 
Sbjct  229   VINATLKINSELRSV--NRLQLLPESFICKTEPG--ENVAKI--------YKDLQKLSRL  276

Query  736   VKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYL  563
              KD L  PLL     +    LP  F  + LP ELKL+I  LL    +  +S +C DL ++
Sbjct  277   FKDQLVYPLLA--FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FI  333

Query  562   ASNDD-LWKQKFEEQFNADWFR-NGGSWKQKF  473
             ASND  LW+  +   F     R     WK+ +
Sbjct  334   ASNDQLLWRCLYLRDFRDGTARVRDTDWKELY  365



>ref|XP_010377442.1| PREDICTED: F-box only protein 7 isoform X1 [Rhinopithecus roxellana]
Length=522

 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 111/432 (26%), Positives = 184/432 (43%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVPEAEPTLGQL--RAHLSQALLCTWGYSSDTRFTITLNYKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  S + P+ +  S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNLPSSTDSEHSSLQSNDQPSLAISSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   IQDAQPSDSFQGQAAQSDVWNDNSTLGPSQNFEAESIQDIEDMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D       L++ +H ++LESG++          +P +W L+   
Sbjct  175   VEGQVPHSLETLYQSADCSDASDALIVLIHLLMLESGYMPQGTEAKALSMPEKWKLS--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLHYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEKLGENVAKI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALS  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVQDTDWKELY  396



>gb|EAY77609.1| hypothetical protein OsI_32651 [Oryza sativa Indica Group]
Length=357

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 99/224 (44%), Gaps = 29/224 (13%)
 Frame = -3

Query  1156  DGGRDHKLLLIAVHAVLLESGFV---RLDPILHKKVPNQWILTEPQVSILSYSLPEIADG  986
             D  R    LLI  HA  L++GFV     D     ++P +   T   +  L Y+ P++   
Sbjct  17    DAERPLGRLLILAHAAFLDAGFVPAAAADDDNSIRLPRKVGRTASSLP-LRYAAPQLLHW  75

Query  985   DTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSE  806
               D  +     V+L+    G+ +++Y S++  S +            +L+  W       
Sbjct  76    PDDAAA-----VQLRLCAHGRHLVLYVSMARTSILRE----------WLDTYWVCLDALA  120

Query  805   EIAGKDGLLCTSP-----EKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTEL  641
               A   G L  +      +  +   W  + D L   +L+++C + G  L P FM LP ++
Sbjct  121   AAALLGGALDDTARALRRDARLAALWGALADRLCRRVLVDMCARNGVTLEPTFMSLPDDV  180

Query  640   KLKILELLP-AVDLAKMSCLCSDLRYLASNDD----LWKQKFEE  524
             K  IL  LP   DLA++ C C+ LR L ++ D    LWK ++E+
Sbjct  181   KAAILARLPDGDDLARVECACAGLRRLVADRDRDAALWKPRYEK  224



>ref|XP_010377444.1| PREDICTED: F-box only protein 7 isoform X3 [Rhinopithecus roxellana]
Length=418

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 110/418 (26%), Positives = 181/418 (43%), Gaps = 50/418 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVPEAEPTLGQL--RAHLSQALLCTWGYSSDTRFTITLNYKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  S + P+ +  S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNLPSSTDSEHSSLQSNDQPSLAISSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   IQDAQPSDSFQGQAAQSDVWNDNSTLGPSQNFEAESIQDIEDMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++ +H ++LESG++ +        +P +W L+   
Sbjct  175   VEGQVPHSLETLYQSADCSDASDALIVLIHLLMLESGYMPQGTEAKALSMPEKWKLS--G  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +      VP        LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLHYMHP-LCEGSS-ATLTCVP--------LGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEKLGENVAKI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALS  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNA  512
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F A
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRA  382



>ref|XP_003783315.1| PREDICTED: F-box only protein 7 [Otolemur garnettii]
 gb|ACH53065.1| F-box only protein 7 isoform 1 (predicted) [Otolemur garnettii]
Length=518

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 93/380 (24%), Positives = 158/380 (42%), Gaps = 45/380 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L  +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+
Sbjct  48    ITLNNKDAL--TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQNNDQPS  105

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDA  1229
              +  S     +  +LS +   ++  +  +N  S          E  +   +E       A
Sbjct  106   LAASSSQACIQDEQLSDSFQGQAAQSDVWNDDSMSGTSQNFGAESMQDVDVEEGAGFSPA  165

Query  1228  DVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPN  1052
             + +  S S  G +          +D    +  L++ +H ++LESG++ +        +P 
Sbjct  166   EPMLCSESQEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKAVSMPE  225

Query  1051  QWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV  872
             +W      V  L Y  P    G          +  L    LG  ++V  +L  N+ + SV
Sbjct  226   KW--KSSGVYKLQYMHPLCEGG----------SAALTCVPLGNLIVVNATLKINNEIRSV  273

Query  871   ---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIE  701
                QL  + F+             +E  G++        K++ +  R  KD L  PLL  
Sbjct  274   KRLQLLPESFI------------CKEEPGEN---VAKIYKDLPKLSRLFKDQLVYPLLA-  317

Query  700   LCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKF  530
                +    LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+  +
Sbjct  318   -FTRQALNLPDAFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FIASNDPLLWRCLY  375

Query  529   EEQFNADWFR-NGGSWKQKF  473
                F  +  R     WK+ +
Sbjct  376   LRDFRDNTVRVRDTDWKELY  395



>ref|XP_010968782.1| PREDICTED: F-box only protein 7 [Camelus bactrianus]
Length=562

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 110/432 (25%), Positives = 184/432 (43%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P++VP +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  40    MKLRVRL--QKRTWPLEVPGAEPTLGQL--RAYLSQALLPTWGYSSDTRFAITLNNKDAL  95

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
                  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +  S   S
Sbjct  96    TGD--EETLASYGIVSGDLICLVLEDAIPAPNLPSSTDSEHSSLQNNDQPSLAASSSQSS  153

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  +LS +   ++  +   N  S   P    + E  +  V   +      ++ +  S +
Sbjct  154   IQDEQLSDSFQGQAAKSDVCNDDSMSGPSQNFEAESIQDVVDMEEGTGFYPSEPMLCSEA  213

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++++H ++LESG++ +        +P  W      
Sbjct  214   VEGQVPHSLETLYQSADCSNPSDALIVSIHLLMLESGYIPQGTEAKAVSMPENW--RSGG  271

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P    G          +  L    LG  +++  +L  NS + SV   QL  +
Sbjct  272   VYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINSEIRSVKRLQLLPE  321

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E +G++        K++ +  R  KD L  PLL     +    
Sbjct  322   SFI------------CKEESGEN---VAKIYKDLQKLSRLFKDQLVYPLLA--FTRQALN  364

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+  +   F    
Sbjct  365   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCHDL-FIASNDQLLWRCLYLRDFRDGT  423

Query  505   FRNGGS-WKQKF  473
              R   + WK+ +
Sbjct  424   VRGRDTDWKELY  435



>ref|XP_006205918.1| PREDICTED: F-box only protein 7 isoform X1 [Vicugna pacos]
Length=585

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 109/432 (25%), Positives = 185/432 (43%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P++VP +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  63    MKLRVRL--QKRTWPLEVPGAEPTLGQL--RAYLSQALLPTWGYSSDTRFAITLNNKDAL  118

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +  S   S
Sbjct  119   --TGDEETLASYGIVSGDLICLVLEDAIPAPNLPSSTDSEHSSLQNNDQPSLAASSSQSS  176

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  +LS +   ++  +   N  S   P    + E  +  V   +      ++ +  S +
Sbjct  177   IQDEQLSDSFQGQAAKSDVCNDDSMSGPSQNFEAESIQDVVDMEEGTGFYPSEPMLCSEA  236

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++++H ++LESG++ +        +P  W      
Sbjct  237   VEGQVPHSLETLYQSADCSNPSDALIVSIHLLMLESGYIPQGTEAKAVSMPENW--RSGG  294

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P    G          +  L    LG  +++  +L  N+ + SV   QL  +
Sbjct  295   VYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINNEIRSVKRLQLLPE  344

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E +G++        K++ +  R  KD L  PLL     +    
Sbjct  345   SFI------------CKEESGENA---AKIYKDLQKLSRLFKDQLVYPLLA--FTRQALN  387

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+  +   F    
Sbjct  388   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCHDL-FIASNDQLLWRCLYLRDFRDGT  446

Query  505   FRNGGS-WKQKF  473
              R   + WK+ +
Sbjct  447   VRGRDTDWKELY  458



>ref|XP_010992483.1| PREDICTED: F-box only protein 7 [Camelus dromedarius]
Length=523

 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 109/432 (25%), Positives = 185/432 (43%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P++VP +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEVPGAEPTLGQL--RAYLSQALLPTWGYSSDTRFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +  S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLVLEDAIPAPNLPSSTDSEHSSLQNNDQPSLAASSSQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  +LS +   ++  +   N  S   P    + E  +  V   +      ++ +  S +
Sbjct  115   IQDEQLSDSFQGQAAKSDVCNDDSMSGPSQNFEAESIQDVVDMEEGTGFYPSEPMLCSEA  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++++H ++LESG++ +        +P  W      
Sbjct  175   VEGQVPHSLETLYQSADCSNPSDALIVSIHLLMLESGYIPQGTEAKAVSMPENW--RSGG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P    G          +  L    LG  +++  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E +G++        K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------CKEESGEN---VAKIYKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+  +   F    
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCHDL-FIASNDQLLWRCLYLRDFRDGT  384

Query  505   FRNGGS-WKQKF  473
              R   + WK+ +
Sbjct  385   VRGRDTDWKELY  396



>ref|XP_006069618.1| PREDICTED: F-box only protein 7 isoform X2 [Bubalus bubalis]
Length=522

 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 106/430 (25%), Positives = 182/430 (42%), Gaps = 48/430 (11%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKDELR  1544
             MKLR+R    K T P+D+P +   P L +  +    A   +   S     ++LN KD L 
Sbjct  1     MKLRVRL--QKRTWPLDMPEAE--PTLGQLRAYLSQALPTWGYSSDARFAITLNNKDAL-  55

Query  1543  SSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLSQ  1379
              +  +ETL   GI SGDL+   L      PN+  S+ S+ ++  + + P+ +  S   S 
Sbjct  56    -TGDEETLASYGIVSGDLLCLILEDAIAAPNLPSSTVSEHSSLQNNDQPSLAASSSQSSI  114

Query  1378  KSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFSV  1202
             +  +L ++L  ++  +  ++  S   P    + E     V   +      A+ +  S SV
Sbjct  115   QDAQLHASLQGQAAQSEVWHDGSASGPGQHFEAESVPDVVDVEEGTGFYLAEPMLCSESV  174

Query  1201  PGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQV  1025
              G +          +D       L++++H ++LESG++ +        +P  W L    V
Sbjct  175   EGQVPHSLEILYQSADCSNPCDALIVSIHLLMLESGYIPQGTEAKAASMPENWRLG--GV  232

Query  1024  SILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDH  854
               L Y+ P    G          +  L    LG  +++  +L  NS V SV   QL  + 
Sbjct  233   YQLQYTHPLCEAG----------SAVLTCVPLGSLIVINATLKINSEVRSVKRLQLLPES  282

Query  853   FVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL  674
             F+             +E +G++  +     K++ +  R  KD L  PLL     +    L
Sbjct  283   FI------------CKEESGENVAMIY---KDLQKLSRLFKDQLVYPLLA--FTRQALNL  325

Query  673   PPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFR  500
             P  F  + LP ELKL+I  LL    +  +S +C DL   +++  LW+  +   F     R
Sbjct  326   PDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLCITSNDQLLWRCLYLRDFRDGSIR  385

Query  499   NGGS-WKQKF  473
                + WK+ +
Sbjct  386   GRDTDWKELY  395



>ref|XP_008142926.1| PREDICTED: F-box only protein 7 isoform X1 [Eptesicus fuscus]
Length=524

 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 113/432 (26%), Positives = 179/432 (41%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P    TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEMPEEEPTLGQL--RAHLSQALLPTWGYSSDTRFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQNNDQPSLATPSSQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   E+  +  +N  S   P    + E  E  V   +      ++ +  S S
Sbjct  115   IQDEQRSDSFQGEAAQSDVWNDGSMPGPSQNVEAESIEDIVDMDEDTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
               G +          +D       L++ +H ++LESG++ +        +P  W      
Sbjct  175   EEGQVPHSLETLYQSADCSSPSDALIVCIHLLMLESGYIPQGTETKAISMPENW--KSGG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P    G          +  L    LG  V++  +L  NS + SV   QL  +
Sbjct  233   VYKLQYTHPLCEGG----------SAALTCVPLGNLVVINATLKINSEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEELGENVANI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL  +ASND  LW+  +   F    
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-LIASNDQLLWRCLYLRDFRDGT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVRDTDWKELY  396



>ref|XP_006205919.1| PREDICTED: F-box only protein 7 isoform X2 [Vicugna pacos]
Length=523

 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 109/432 (25%), Positives = 185/432 (43%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P++VP +  TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEVPGAEPTLGQL--RAYLSQALLPTWGYSSDTRFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +  S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLVLEDAIPAPNLPSSTDSEHSSLQNNDQPSLAASSSQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  +LS +   ++  +   N  S   P    + E  +  V   +      ++ +  S +
Sbjct  115   IQDEQLSDSFQGQAAKSDVCNDDSMVGPSQNFEAESIQDVVDMEEGTGFYPSEPMLCSEA  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++++H ++LESG++ +        +P  W      
Sbjct  175   VEGQVPHSLETLYQSADCSNPSDALIVSIHLLMLESGYIPQGTEAKAVSMPENW--RSGG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P    G          +  L    LG  +++  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E +G++        K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------CKEESGENAAKIY---KDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+  +   F    
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCHDL-FIASNDQLLWRCLYLRDFRDGT  384

Query  505   FRNGGS-WKQKF  473
              R   + WK+ +
Sbjct  385   VRGRDTDWKELY  396



>ref|NP_001064095.2| Os10g0130200 [Oryza sativa Japonica Group]
 gb|AAM23246.1|AC092553_12 Unknown protein [Oryza sativa Japonica Group]
 gb|AAM47617.1|AC122147_6 Unknown protein [Oryza sativa Japonica Group]
 gb|AAP51984.1| F-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26009.2| Os10g0130200 [Oryza sativa Japonica Group]
Length=359

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 97/224 (43%), Gaps = 29/224 (13%)
 Frame = -3

Query  1156  DGGRDHKLLLIAVHAVLLESGFVRLDPILHK---KVPNQWILTEPQVSILSYSLPEIADG  986
             D  R    LLI  HA  L++GFV           ++P +   T   +  L Y+ P++   
Sbjct  19    DAERPLGRLLILAHAAFLDAGFVPAAAAADDNSIRLPRKVGRTASSLP-LRYAAPQLLHW  77

Query  985   DTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSE  806
               D  +     V+L+    G+ +++Y S++  S           F  +L+  W       
Sbjct  78    PDDAAA-----VQLRLCAHGRHLVLYVSMARCSM----------FREWLDTYWVCLDALA  122

Query  805   EIAGKDGLLCTSP-----EKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTEL  641
               A   G L  +      +  +   W  + D L   +L+++C + G  L P FM LP ++
Sbjct  123   AAALLGGALDDTARALRRDARLAALWGALADRLCRRVLVDVCARNGVTLEPTFMSLPDDV  182

Query  640   KLKILELLP-AVDLAKMSCLCSDLRYLASNDD----LWKQKFEE  524
             K  IL  LP   DLA+  C C+ LR L ++ D    LWK ++E+
Sbjct  183   KAAILARLPDGDDLARAECTCAGLRRLVADRDRDAALWKPRYEK  226



>ref|XP_004063414.1| PREDICTED: F-box only protein 7 isoform 1 [Gorilla gorilla gorilla]
Length=522

 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 110/432 (25%), Positives = 180/432 (42%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKR-RlslalpassafsmhssdSIRLSLNKKDEL  1547
             M+LR+R +  K T P++VP   T P L   R  L       +   S+    ++LN KD L
Sbjct  1     MRLRVRLL--KRTWPLEVP--ETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ +   +   P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSPLQNNEQPSLATSSNQTS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   ++  +  +N  S   P    + E  +      +      ++ +  S S
Sbjct  115   IQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQ  1028
             V G +          +D    +  L++ +H ++LESG++          +P +W      
Sbjct  175   VEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKW--KSSG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P + +G +           L    LG  ++V  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEKLGENVANI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  + 
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFLYLRDFRDNT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRIQDTDWKELY  396



>ref|XP_006170430.1| PREDICTED: F-box only protein 7, partial [Tupaia chinensis]
Length=507

 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 94/383 (25%), Positives = 159/383 (42%), Gaps = 49/383 (13%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN--------PNVQESSESQITTGLSPN  1418
             ++LN KD L  +  +ETL   GI SGDLI   L         P+  +S  S + +   P 
Sbjct  32    ITLNNKDAL--TGDEETLASYGIVSGDLICLVLEDAIPAPNFPSSTDSEHSSLQSNDQPP  89

Query  1417  LPAESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE  1238
             L A  + +   S++  + S     +S   +D + +S   P    +   +  +V E     
Sbjct  90    LAASCSQASIQSEQLGDPSQGQAAQSDVRNDDDRVSGPGPSFEAESLRDVEDVDEGAGFC  149

Query  1237  KDADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKK  1061
                 ++  S +V G +          +D    ++ L++++H ++LESG++ +        
Sbjct  150   PTEPMLC-SEAVEGQVPHSLETLYQSADCADANEALVVSIHLLMLESGYLPQGTEAKAVA  208

Query  1060  VPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSV  881
             +P +W      V  L Y+ P    G          +  L    LG  ++V  +L  N+ +
Sbjct  209   MPEKW--KSGGVFRLQYTHPLCEGG----------SASLTCVPLGNLIVVNATLKINNEI  256

Query  880   HSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPL  710
              SV   QL  + F+             +E  G++        K++ +  R  KD L  PL
Sbjct  257   RSVKRLQLLPESFI------------HQEEPGENAAKIY---KDLQKLSRLFKDQLVYPL  301

Query  709   LIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWK  539
             L     +    LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+
Sbjct  302   LA--FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FIASNDPLLWR  358

Query  538   QKFEEQFNADWFR-NGGSWKQKF  473
               +   F     R     WK+ +
Sbjct  359   CLYLRDFRDGTVRVRDTDWKELY  381



>gb|EAY73643.1| hypothetical protein OsI_01532 [Oryza sativa Indica Group]
Length=329

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 97/229 (42%), Gaps = 19/229 (8%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFVRLDP-----ILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNS  968
             L++  HA  L +GFV            + +P++   T   +S L Y++P++    T Q  
Sbjct  27    LVVVAHAAFLHAGFVPYSAGGRSSASRRPLPDEIGATASSLS-LRYTVPDLLRQTTTQRR  85

Query  967   NA-VPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHF--VPFLNVAWSNCGLSEEIA  797
              +   T  L+    G  V+ YG L+G+++         H+  +  L+VA      S  ++
Sbjct  86    RSRAETAVLRLCAHGDHVVFYGYLTGDANQFQRLQTTRHWACIDALSVA------SVLLS  139

Query  796   GKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELL  617
             G       +   +    W+ +  GLA  L +++C K    LPP    L  +L+  IL  L
Sbjct  140   GGLDATAHALAADGAGLWKKLAGGLARRLFVDMCRKNSKHLPPRLTTLSADLQEDILRRL  199

Query  616   PAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGGSWKQKFV  470
                D+A +   C  LR L +  ++    F  QF   W     +W Q ++
Sbjct  200   AVEDIAAVYFTCRGLRDLIAGSEVLNNDF--QFGELWMNF--AWSQGYL  244



>gb|AAF04471.1|AF129537_1 F-box protein Fbx7 [Homo sapiens]
Length=482

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 95/381 (25%), Positives = 161/381 (42%), Gaps = 46/381 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L     +ETL   GI SGDLI   L+     PN+  S++S+ ++  +   P+
Sbjct  8     ITLNYKDPLTGD--EETLASYGIVSGDLICLILHDDIPPPNIPSSTDSEHSSLQNNEQPS  65

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KD  1232
              +T S   S +  + S +   ++  +  +N  S   P    + E  +      +      
Sbjct  66    LATSSNQTSIQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYP  125

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVP  1055
             ++ +  S SV G +          +D    +  L++ +H ++LESG++          +P
Sbjct  126   SEPLLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSLP  185

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS  875
              +W L+   V  L Y +  + +G +           L    LG  ++V  +L  N+ + S
Sbjct  186   EKWKLS--GVYKLQY-MHHLCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRS  233

Query  874   V---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
             V   QL  + F+           L E +A           K++ +  R  KD L  PLL 
Sbjct  234   VKRLQLLPESFI-------CKEKLGENVANI--------YKDLQKLSRLFKDQLVYPLLA  278

Query  703   ELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQK  533
                 +    LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  
Sbjct  279   --FTRQALNLPNVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFL  335

Query  532   FEEQFNADWFR-NGGSWKQKF  473
             +   F  +  R     WK+ +
Sbjct  336   YLRDFRDNTVRVQDTDWKELY  356



>ref|XP_009007985.1| PREDICTED: F-box only protein 7 isoform X1 [Callithrix jacchus]
Length=522

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 109/434 (25%), Positives = 179/434 (41%), Gaps = 55/434 (13%)
 Frame = -3

Query  1732  RVKMKLRLRSVETKETIPVDVPPSTTLPELKRRlslalpassafsmhssdSIRLSLNKKD  1553
             RV+++ R + VE  E  P       TL +L  R  L+L     +   S     ++LN KD
Sbjct  4     RVRLEKRTQQVEVPEAEP-------TLGQL--RTHLSLALLPTWGYSSDTRFAITLNNKD  54

Query  1552  ELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSIN  1388
              L  +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +T S  
Sbjct  55    AL--TGDEETLASYGIVSGDLICLVLEDAIPAPNLPSSTDSEHSSLQNNDQPSLATSSNQ  112

Query  1387  LSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKS  1211
              S +  +LS +   ++  +  +N  +   P    + E  +   +  +      ++ +  S
Sbjct  113   TSIQGEQLSDSFQGQAAQSDVWNDDNMSGPSQNFEAESIQDIAVMEESTGFYPSEPMLCS  172

Query  1210  FSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTE  1034
              SV G +          ++       L++ +H ++LESG+  +        +P +W    
Sbjct  173   ESVEGQVPHSLETLYQSANCSDASDALIVLIHLLMLESGYTPQGTEAKAMSMPEKW--KS  230

Query  1033  PQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLD  863
               V  L Y  P    G          +  L    LG  ++V  +L  NS + SV   QL 
Sbjct  231   SGVYKLQYMHPLCEGG----------SAALTCVPLGNLIVVNATLKINSEIRSVKRLQLL  280

Query  862   KDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAG  683
              + F+           L E +A           K++ +  R  KD L  PLL     +  
Sbjct  281   PESFI-------CKEKLGENVAKI--------YKDLQKLSRLFKDQLVYPLLA--FTRQA  323

Query  682   FGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNA  512
               LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  +   F  
Sbjct  324   LNLPDVFGLVVLPLELKLRIFRLLDVRSILSLSAVCRDL-FTASNDPLLWRFLYLRDFRD  382

Query  511   DWFR-NGGSWKQKF  473
                R     WK+ +
Sbjct  383   STVRVQDTDWKELY  396



>ref|XP_008142927.1| PREDICTED: F-box only protein 7 isoform X2 [Eptesicus fuscus]
Length=524

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 113/432 (26%), Positives = 179/432 (41%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P    TL +L  R  L+      +   S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEMPEEEPTLGQL--RAHLSQALLPTWGYSSDTRFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +T S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQNNDQPSLATPSSQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KDADVVGKSFS  1205
              +  + S +   E+  +  +N  S   P    + E  E  V   +      ++ +  S S
Sbjct  115   IQDEQRSDSFQGEAAQSDVWNDGSMVGPSQNVEAESIEDIVDMDEDTGFYPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
               G +          +D       L++ +H ++LESG++ +        +P  W      
Sbjct  175   EEGQVPHSLETLYQSADCSSPSDALIVCIHLLMLESGYIPQGTETKAISMPENW--KSGG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P    G          +  L    LG  V++  +L  NS + SV   QL  +
Sbjct  233   VYKLQYTHPLCEGG----------SAALTCVPLGNLVVINATLKINSEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+           L E +A           K++ +  R  KD L  PLL     +    
Sbjct  283   SFI-------CKEELGENVANI--------YKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL  +ASND  LW+  +   F    
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-LIASNDQLLWRCLYLRDFRDGT  384

Query  505   FR-NGGSWKQKF  473
              R     WK+ +
Sbjct  385   VRVRDTDWKELY  396



>gb|EHH65784.1| hypothetical protein EGM_02621, partial [Macaca fascicularis]
Length=492

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 96/381 (25%), Positives = 161/381 (42%), Gaps = 46/381 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L     +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+
Sbjct  18    ITLNYKDALTGD--EETLASYGIVSGDLICLILQDDIPAPNLPSSTDSEHSSLQNNDQPS  75

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KD  1232
              +T S   S +  + S +   ++  +  +N  S   P    + E  +      +      
Sbjct  76    LATSSNETSIQDEQPSDSFQGQAAQSDVWNDNSTLGPSQNFEAESIQDIEDMAEGTGFYP  135

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVP  1055
             ++ +  S SV G +          +D    +  L++ +H ++LESG++          +P
Sbjct  136   SEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYMPQGTEAKALSMP  195

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS  875
              +W L+   V  L Y  P + +G +           L    LG  ++V  +L  N+ + S
Sbjct  196   EKWKLS--GVYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRS  243

Query  874   V---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
             V   QL  + F+           L E +A           K++ +  R  KD L  PLL 
Sbjct  244   VKRLQLLPESFI-------CKEKLGEHVAKI--------YKDLQKLSRLFKDQLVYPLLA  288

Query  703   ELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQK  533
                 +    LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  
Sbjct  289   --FTRQALSLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFL  345

Query  532   FEEQFNADWFR-NGGSWKQKF  473
             +   F  +  R     WK+ +
Sbjct  346   YLRDFRDNTVRVQDTDWKELY  366



>gb|ABZ10471.1| F-box only protein 7 isoform 1 (predicted) [Callithrix jacchus]
Length=522

 Score = 62.8 bits (151),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 95/381 (25%), Positives = 158/381 (41%), Gaps = 46/381 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L  +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+
Sbjct  48    ITLNNKDAL--TGDEETLASYGIVSGDLICLVLEDAIPAPNLPSSTDSEHSSLQNNDQPS  105

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KD  1232
              +T S   S +  +LS +   ++  +  +N  +   P    + E  +   +  +      
Sbjct  106   LATSSNQTSIQGEQLSDSFQGQAAQSDVWNDDNMSGPSQNFEAESIQDIAVMEESTGFYP  165

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVP  1055
             ++ +  S SV G +          ++       L++ +H ++LESG+  +        +P
Sbjct  166   SEPMLCSESVEGQVPHSLETLYQSANCSDASDALIVLIHLLMLESGYTPQGTEAKAMSMP  225

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS  875
              +W      V  L Y  P    G          +  L    LG  ++V  +L  NS + S
Sbjct  226   EKW--KSSGVYKLQYMHPLCEGG----------SATLTCVPLGNLIVVNATLKINSEIRS  273

Query  874   V---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
             V   QL  + F+           L E +A           K++ +  R  KD L  PLL 
Sbjct  274   VKRLQLLPESFI-------CKEKLGENVAKI--------YKDLQKLSRLFKDQLVYPLLA  318

Query  703   ELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQK  533
                 +    LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  
Sbjct  319   --FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSILSLSAVCRDL-FTASNDPLLWRFL  375

Query  532   FEEQFNADWFR-NGGSWKQKF  473
             +   F     R     WK+ +
Sbjct  376   YLRDFRDSTVRVQDTDWKELY  396



>ref|XP_007449495.1| PREDICTED: F-box only protein 7 isoform X1 [Lipotes vexillifer]
Length=523

 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 109/432 (25%), Positives = 182/432 (42%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L       +   S     ++LN +D L
Sbjct  1     MKLRVRL--QKRTWPLEMPQAEPTLGQL--RAHLRQALLPTWGYSSDTRFAITLNNEDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +  S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIAAPNLPSSTDSEHSSLQNNDQPSLAASSSQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEK-DADVVGKSFS  1205
              +  +L  +   ++  +  +N  S   P    + E     V   +      ++ +  S S
Sbjct  115   IQDEQLRDSFQGQAAQSDVWNDGSMSGPSHNFEAESIPDVVDAEEGTGFFPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++++H ++LESG++ +        +P  W      
Sbjct  175   VEGQVPHSLETLYQSADCSNPSDALIVSIHLLMLESGYIPQGTEAKAVSMPENW--RSGG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P    G          +  L    LG  +++  +L  NS + SV   QL  +
Sbjct  233   VYKLQYMHPLCEGG----------SAALTCVPLGNLIVINATLKINSEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E +G++        K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------CKEESGEN---VAKIYKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL Y+ASND  LW+  +   F    
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-YIASNDQLLWRCLYLRDFRDGT  384

Query  505   FRNGGS-WKQKF  473
              R   + WK+ +
Sbjct  385   VRGRDTDWKELY  396



>ref|XP_006092813.1| PREDICTED: F-box only protein 7 [Myotis lucifugus]
Length=546

 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 97/381 (25%), Positives = 159/381 (42%), Gaps = 46/381 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L  +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+
Sbjct  70    ITLNNKDAL--TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQNNDQPS  127

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KD  1232
              +T S   S +  + + +   E+  +  +N  S   P    + E  E  V   +      
Sbjct  128   LATPSSQSSIQDEQRTDSFQGEAAQSDVWNDGSMPGPSQNVEAESIEDIVDMDEDTGFYP  187

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVP  1055
             ++ +  S S  G +          +D       L++ +H ++LESG++ +        +P
Sbjct  188   SEPMLCSESEEGQVPHSLETLYQSADCSSPSDALIVCIHLLMLESGYIPQGTETKAISMP  247

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS  875
               W      V  L Y+ P    G             L    LG  V++  +L  NS + S
Sbjct  248   ENW--KSGGVYKLQYTHPLCEGG----------FAALTCVPLGTLVVINATLKINSEIRS  295

Query  874   V---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
             V   QL  + F+             +E  GK+     +  K++ +  R  KD L  PLL 
Sbjct  296   VKRLQLLPESFI------------CKEELGKN---VANIYKDLQKLSRLFKDQLVYPLLA  340

Query  703   ELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQK  533
                 +    LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+  
Sbjct  341   --FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FIASNDQLLWRCL  397

Query  532   FEEQFNADWFR-NGGSWKQKF  473
             +   F     R     WK+ +
Sbjct  398   YLRDFRDGTVRVRDTDWKELY  418



>ref|XP_004414246.1| PREDICTED: F-box only protein 7 isoform 1 [Odobenus rosmarus 
divergens]
Length=523

 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 108/429 (25%), Positives = 181/429 (42%), Gaps = 45/429 (10%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L+          S     ++LN KD L
Sbjct  1     MKLRVRL--QKRTWPLEMPDAEPTLGQL--RAHLSQALLPTRGFSSDTRFAITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +  S    
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEYSSLQNNDQPSLAASSNQSG  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEK-DADVVGKSFS  1205
              +  + S++   ++  T   N      P    +    +  V   +      ++ +  S S
Sbjct  115   IQDEQPSASFQGQAAQTDVCNDDDMSGPSQTLEAGSVQDVVDMEEGTGVFPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D    +  L+++VH ++LESG++ +        +P  W      
Sbjct  175   VEGQVPHSLEILYQSADCSNANDALIVSVHLLMLESGYIPQGTEAKALSMPEHW--KSGG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFV  848
             V  L Y+ P    G          +  L    LG  V++  +L  NS + SV+  +   +
Sbjct  233   VYKLQYTHPLCEGG----------SAVLTCVPLGTLVVINATLKINSELTSVK--RLQLL  280

Query  847   PFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPP  668
             P   +  +  G  E +A        +  K++ +  R  KD L  PLL     +    LP 
Sbjct  281   PGSFICKAEPG--ENVA--------TIYKDLQKLSRLFKDQLVYPLLA--FTRQALNLPD  328

Query  667   CF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADWFRN  497
              F  + LP ELKL+I  LL    +  +S +C DL  +ASND  LW+  +   F     R 
Sbjct  329   VFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-LIASNDQLLWRCLYLRDFRDGAVRA  387

Query  496   GGS-WKQKF  473
               + WK+ +
Sbjct  388   RDTDWKELY  396



>gb|EAZ15194.1| hypothetical protein OsJ_30613 [Oryza sativa Japonica Group]
Length=361

 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/226 (26%), Positives = 97/226 (43%), Gaps = 31/226 (14%)
 Frame = -3

Query  1156  DGGRDHKLLLIAVHAVLLESGFVRLDPILHK---KVPNQWILTEPQVSILSYSLPEIADG  986
             D  R    LLI  HA  L++GFV           ++P +   T   +  L Y+ P++   
Sbjct  19    DAERPLGRLLILAHAAFLDAGFVPAAAAADDNSIRLPRKVGRTASSLP-LRYAAPQLLHW  77

Query  985   DTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAW-------  827
               D  +     V+L+    G+ +++Y S++  S           F  +L+  W       
Sbjct  78    PDDAAA-----VQLRLCAHGRHLVLYVSMARCSM----------FREWLDTYWVCLDALA  122

Query  826   SNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPT  647
             +   L+  +      L       +   W  + D L   +L+++C + G  L P FM LP 
Sbjct  123   AAALLAGGLDDTARALRRERGARLAALWGALADRLCRRVLVDVCARNGVTLEPTFMSLPD  182

Query  646   ELKLKILELLP-AVDLAKMSCLCSDLRYLASNDD----LWKQKFEE  524
             ++K  IL  LP   DLA+  C C+ LR L ++ D    LWK ++E+
Sbjct  183   DVKAAILARLPDGDDLARAECTCAGLRRLVADRDRDAALWKPRYEK  228



>ref|XP_006662158.1| PREDICTED: uncharacterized protein LOC102719619 [Oryza brachyantha]
Length=887

 Score = 62.4 bits (150),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 58/218 (27%), Positives = 93/218 (43%), Gaps = 38/218 (17%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-----RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNS  968
             L+I  HA  LE+GF+     R +P    ++P Q   T   ++ L Y+ P++       + 
Sbjct  25    LVILAHAAFLEAGFLAAGADRYNPF---RLPTQVGRTASGLT-LRYTAPQLL------HR  74

Query  967   NAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDKDHFVPFLNVAWSNCGLSEEIAGKD  788
                 TV L+    G+ +++Y  +                 P+L+  W N           
Sbjct  75    PDAATVALRLCAQGRSLVLYVCVESGK-------------PWLDTYWVNLDALAAARLLS  121

Query  787   GLL-----CTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGL--PPCFMRLPTELKLKI  629
             G L       + +  +   W  + + L   +L++LC  +G  L   P FM LP +LK  I
Sbjct  122   GGLDDTARALTRDARLAALWGALTEKLFRRVLVDLCANSGVPLVPDPSFMSLPCDLKAAI  181

Query  628   LELLPAV-DLAKMSCLCSDLRYLASNDD--LWKQKFEE  524
             LE L    DLA++ C C+ LR L +  D  LWK + E 
Sbjct  182   LERLAGGDDLARVECTCTGLRRLVAERDAALWKPRPEH  219



>ref|XP_007449496.1| PREDICTED: F-box only protein 7 isoform X2 [Lipotes vexillifer]
Length=523

 Score = 62.0 bits (149),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 109/432 (25%), Positives = 182/432 (42%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L       +   S     ++LN +D L
Sbjct  1     MKLRVRL--QKRTWPLEMPQAEPTLGQL--RAHLRQALLPTWGYSSDTRFAITLNNEDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +  S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIAAPNLPSSTDSEHSSLQNNDQPSLAASSSQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEK-DADVVGKSFS  1205
              +  +L  +   ++  +  +N  S   P    + E     V   +      ++ +  S S
Sbjct  115   IQDEQLRDSFQGQAAQSDVWNDGSMVGPSHNFEAESIPDVVDAEEGTGFFPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++++H ++LESG++ +        +P  W      
Sbjct  175   VEGQVPHSLETLYQSADCSNPSDALIVSIHLLMLESGYIPQGTEAKAVSMPENW--RSGG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y  P    G          +  L    LG  +++  +L  NS + SV   QL  +
Sbjct  233   VYKLQYMHPLCEGG----------SAALTCVPLGNLIVINATLKINSEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E +G++        K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------CKEESGEN---VAKIYKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL Y+ASND  LW+  +   F    
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-YIASNDQLLWRCLYLRDFRDGT  384

Query  505   FRNGGS-WKQKF  473
              R   + WK+ +
Sbjct  385   VRGRDTDWKELY  396



>emb|CDY71474.1| BnaCnng73090D [Brassica napus]
Length=318

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 24/140 (17%)
 Frame = -3

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDH-KLLLIAVHAVLLESGFVRLDPILHKKVPNQWIL  1040
             K  S P FL+ +    L +S G       L ++VHAV+LESGFV ++P+      +++  
Sbjct  68    KRLSEPFFLKNIL---LENSSGDTSELTTLAMSVHAVMLESGFVLINPV---SSDDKFSF  121

Query  1039  TEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSVQLDK  860
             ++     L Y+LPE+           V +V + FQ+L   V+VYGSLSGN  V  V LDK
Sbjct  122   SKE----LIYTLPEL-----------VESVTVTFQSLTNKVVVYGSLSGN--VRRVYLDK  164

Query  859   DHFVPFLNVAWSNCGLSEEI  800
               F+P ++   S+  +S  I
Sbjct  165   SRFMPVIDTLKSDEEVSSSI  184



>ref|XP_008703858.1| PREDICTED: F-box only protein 7 [Ursus maritimus]
Length=484

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 95/381 (25%), Positives = 155/381 (41%), Gaps = 46/381 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L  +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+
Sbjct  9     ITLNNKDAL--TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQNNDQPS  66

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEK-D  1232
              +  S   S +  + S     ++T T  +N  S   P    +    +  V   +      
Sbjct  67    LAASSNQSSTQDEQPSDAFQGQATQTDVWNDDSMSGPSQPFEAGSVQDVVDMEEGAGVFP  126

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVP  1055
             ++ +  S S  G +          +D       L+++VH ++LESG++          +P
Sbjct  127   SEPMLCSESEEGQVPHSLEILYQSADCSNASDALIVSVHLLMLESGYIPQGTEAKALSMP  186

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS  875
              +W      V  L Y+ P    G          +  L    LG  V++  +L  NS + S
Sbjct  187   ERW--KSGGVYRLQYTHPLCEGG----------SAALTCVPLGTLVVINATLKINSELRS  234

Query  874   V---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
             V   QL  + F+                  + G       K++ +  R  KD L  PLL 
Sbjct  235   VKRLQLLPESFI---------------CKAEPGESVAKIYKDLQKLSRLFKDQLVYPLLA  279

Query  703   ELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQK  533
                 +    LP  F  + LP ELKL+I  LL    +  +S +C DL  +ASND  LW+  
Sbjct  280   --FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-LIASNDQLLWRCL  336

Query  532   FEEQFNADWFRNGGS-WKQKF  473
             +   F     R   + WK+ +
Sbjct  337   YLRDFRDGTVRARDTDWKELY  357



>gb|EHH20175.1| hypothetical protein EGK_02974, partial [Macaca mulatta]
Length=508

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 96/381 (25%), Positives = 160/381 (42%), Gaps = 46/381 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L     +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+
Sbjct  34    ITLNYKDALTGD--EETLASYGIVSGDLICLILQDDIPAPNLPSSTDSEHSSLQNNDQPS  91

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KD  1232
              +T S   S +  + S +   ++  +  +N  S   P    + E  +      +      
Sbjct  92    LATSSNETSIQDEQPSDSFQGQAAQSDVWNDDSTLGPSQNFEAESIQDIEDMAEGTGFYP  151

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVP  1055
             ++ +  S SV G +          +D    +  L++ +H ++LESG++          +P
Sbjct  152   SEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYMPQGTEAKALSMP  211

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS  875
              +W L+   V  L Y  P + +G +           L    LG  ++V  +L  N+ + S
Sbjct  212   EKWKLS--GVYKLQYMHP-LCEGSS---------ATLTCVPLGNLIVVNATLKINNEIRS  259

Query  874   V---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
             V   QL  + F            L E +A           K++ +  R  KD L  PLL 
Sbjct  260   VKRLQLLPESFT-------KKNILGEHVAKI--------YKDLQKLSRLFKDQLVYPLLA  304

Query  703   ELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQK  533
                 +    LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+  
Sbjct  305   --FTRQALSLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-FTASNDPLLWRFL  361

Query  532   FEEQFNADWFR-NGGSWKQKF  473
             +   F  +  R     WK+ +
Sbjct  362   YLRDFRDNTVRVQDTDWKELY  382



>gb|KFO61229.1| F-box only protein 7, partial [Corvus brachyrhynchos]
Length=498

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 96/213 (45%), Gaps = 32/213 (15%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFVRLDPILHKKV--PNQWILTEPQVSILSYSLPEIADGDTDQNSNAV  959
             L++ VH +++E+G+V    I  K V  P +W      +  L Y+ P   +G         
Sbjct  162   LIVLVHLLMMETGYVPQG-IEAKAVSMPEKWRGN--GIYKLQYTHPLCGEG---------  209

Query  958   PTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKD  788
              +  L    LG+ + +  +L  N  + SV   QL    FV F + A+S   L E++AG  
Sbjct  210   -SAGLTCVPLGELIAINATLKINEEIKSVKRIQLLPSSFVCFQDPAFSLPSLIEKVAGV-  267

Query  787   GLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLP  614
                     K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL 
Sbjct  268   -------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLD  318

Query  613   AVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQF  518
                L  +S +C DL Y ASND  LW+  +   F
Sbjct  319   VRSLISLSAVCRDL-YTASNDQLLWRFMYLRDF  350



>ref|XP_004318488.1| PREDICTED: F-box only protein 7 isoform 1 [Tursiops truncatus]
Length=523

 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 108/432 (25%), Positives = 182/432 (42%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L       +   S     ++LN +D L
Sbjct  1     MKLRVRL--QKRTWPLEIPQAEPTLGQL--RAHLRQALLPTWGYSSDTRFAITLNNEDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +  S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIAAPNLPSSTDSEHSSLQNNDQPSLAASSSQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEK-DADVVGKSFS  1205
              +  +L  +   ++  +  +N  S   P    + E     V   +      ++ +  S S
Sbjct  115   IQDEQLRDSFQGQAAQSDVWNDGSMVGPSHNFEAESIPDVVDAEEGTGFFPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++++H ++LESG++ +        +P  W      
Sbjct  175   VEGQVPHSLETLYQSADCSNPSDALIVSIHLLMLESGYIPQGTEAKAVSMPENW--RSGG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P    G          +  L    LG  +++  +L  NS + SV   QL  +
Sbjct  233   VYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINSEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E +G++        K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------CKEESGEN---VAKIYKDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL  +ASND  LW+  +   F    
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-CIASNDQLLWRCLYLRDFRDGT  384

Query  505   FRNGGS-WKQKF  473
              R   + WK+ +
Sbjct  385   VRGRDTDWKELY  396



>gb|ACC68887.1| F-box only protein 7 isoform 1 (predicted) [Rhinolophus ferrumequinum]
Length=523

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 108/436 (25%), Positives = 186/436 (43%), Gaps = 59/436 (14%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPSTTLPELKR-RlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K+T P+++P   T P L + R  L+      +   S     ++LN KD L
Sbjct  1     MKLRVRL--QKQTWPLEMP--ETEPTLGQLREHLSQALLPTWGYSSDTRFEITLNNKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  S + P+ +  S    
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIPAPNLPSSTDSEHSSLQSNDQPSLAASSRQSR  114

Query  1381  QKSLELSSNLPVES--TNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVV---G  1217
              +  + S +   E+  ++    +S+S  +     +  ++ V++ E         ++    
Sbjct  115   TQDEQWSDSCRGEAAQSDVRSVDSMSGPSQNFEAESIQDIVDMEEGTGFCPSEPMLCSEA  174

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWIL  1040
                 VP  L  ++      +D       L++++H ++LESG++ +        +P  W  
Sbjct  175   AEGQVPHSLETLY----QSADCSSPCDALIVSIHLLMLESGYIPQGTEAKAMSMPESW--  228

Query  1039  TEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---Q  869
                 V  L Y+ P    G             L    LG  V++  +L  N+ + SV   Q
Sbjct  229   KSGGVYKLQYTHPLCEGG----------AAALTCVPLGNLVVINATLKINNEIKSVKRLQ  278

Query  868   LDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEK  689
             L  + F+             +E +G++        K++ +  R  KD L  PLL     +
Sbjct  279   LLPESFI------------CKEESGEN---VAKIYKDLQKLSRLFKDQLVYPLLA--FTR  321

Query  688   AGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQF  518
                 LP  F  + LP ELKL+I  LL    +  +S +C DL ++ASND  LW+  +   F
Sbjct  322   QALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCHDL-FIASNDQLLWRCLYLRDF  380

Query  517   NADWFRNGGS-WKQKF  473
                  R   + WK+ +
Sbjct  381   RDGTGRGRDTDWKELY  396



>ref|XP_005680709.1| PREDICTED: F-box only protein 7 [Capra hircus]
Length=555

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 93/380 (24%), Positives = 158/380 (42%), Gaps = 44/380 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L  +  +ETL   GI SGDLI   L      PN+  S+ S+ ++  + + P+
Sbjct  80    ITLNNKDAL--TGDEETLASYGIVSGDLICLILEDAIAAPNLPSSTVSEHSSLQNNDQPS  137

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KD  1232
              +  S   S +  +L  +L  ++     +N  S   P    + E     V   +      
Sbjct  138   LAASSSQSSIQDAQLHDSLQGQAAQPEAWNDDSVSGPGQHFEAESVPDVVDVEEGAGFYP  197

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVP  1055
             A+ +  S SV G +          +D       L++++H ++LESG++          +P
Sbjct  198   AEPMLCSESVEGQVPHSLEILYQSADCSNPCDALIVSIHLLMLESGYIPQGTEAKALSMP  257

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS  875
               W L    V  L Y+ P    G          +  L    LG  +++  +L  N+ V S
Sbjct  258   ENWRLG--GVYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINNEVRS  305

Query  874   V---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
             V   QL  + F+             +E +G++  +     K++ +  R  KD L  PLL 
Sbjct  306   VKRLQLLPESFI------------CKEESGENVAMIY---KDLQKLSRLFKDQLVYPLLA  350

Query  703   ELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKF  530
                 +    LP  F  + LP ELKL+I  LL    +  +S +C DL   +++  LW+  +
Sbjct  351   --FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLCITSNDQLLWRCLY  408

Query  529   EEQFNADWFRNGGS-WKQKF  473
                F     R   + WK+ +
Sbjct  409   LRDFRDGSIRGRDTDWKELY  428



>ref|XP_004269451.1| PREDICTED: F-box only protein 7 isoform 1 [Orcinus orca]
Length=523

 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 107/432 (25%), Positives = 182/432 (42%), Gaps = 51/432 (12%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL +L  R  L       +   S     ++LN +D L
Sbjct  1     MKLRVRL--QKRTWPLEIPQAEPTLGQL--RAHLRQALLPTWGYSSDTRFAITLNNEDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPAESTDSINLS  1382
               +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+ +  S   S
Sbjct  57    --TGDEETLASYGIVSGDLICLILEDAIAAPNLPSSTDSEHSSLQNNDQPSLAASSSQSS  114

Query  1381  QKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEK-DADVVGKSFS  1205
              +  +L  +   ++  +  +N  S   P    + E     V   +      ++ +  S S
Sbjct  115   IQDEQLRDSFQGQAAQSDVWNDGSMVGPSHSFEAESIPDVVDAEEGTGFFPSEPMLCSES  174

Query  1204  VPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQ  1028
             V G +          +D       L++++H ++LESG++ +        +P  W      
Sbjct  175   VEGQVPHSLETLYQSADCSNPSDALIVSIHLLMLESGYIPQGTEAKAVSMPENW--RSGG  232

Query  1027  VSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKD  857
             V  L Y+ P    G          +  L    LG  +++  +L  N+ + SV   QL  +
Sbjct  233   VYKLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINNEIRSVKRLQLLPE  282

Query  856   HFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFG  677
              F+             +E +G++        K++ +  R  KD L  PLL     +    
Sbjct  283   SFI------------CKEESGENAAKIY---KDLQKLSRLFKDQLVYPLLA--FTRQALN  325

Query  676   LPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADW  506
             LP  F  + LP ELKL+I  LL    +  +S +C DL  +ASND  LW+  +   F    
Sbjct  326   LPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-CIASNDQLLWRCLYLRDFRDGT  384

Query  505   FRNGGS-WKQKF  473
              R   + WK+ +
Sbjct  385   VRGRDTDWKELY  396



>ref|XP_004347188.1| Fbox domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR21806.1| Fbox domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=256

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = -3

Query  664  FMRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDDLWKQKFEEQF---NADWFRNG  494
              RLP EL   I +LLP  DL++MS +C  LR +A+ D LW+Q++ +++    A   +  
Sbjct  7    LTRLPAELLFHICQLLPLADLSRMSGVCRSLRVVANADSLWRQRYLQRYYHPTAGGSQRT  66

Query  493  GSWKQKF  473
             SWKQ+F
Sbjct  67   TSWKQRF  73



>gb|KFW81213.1| F-box only protein 7, partial [Manacus vitellinus]
Length=502

 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 94/212 (44%), Gaps = 30/212 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   +G          
Sbjct  166   LIVLVHLLMMETGYVPQGTEAKAVSMPEKW--RGNGVYKLQYTHPLCEEG----------  213

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  V +  +L  N+ + SV   QL    FV F + A+    L E++AG   
Sbjct  214   SAGLTCVPLGDLVAINATLKINNEIKSVKRIQLLPASFVSFQDPAFYLSSLIEKVAGV--  271

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  272   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  323

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQF  518
               L  +S +C DL Y ASND  LW+  +   F
Sbjct  324   RSLISLSAVCRDL-YTASNDQLLWRFMYLRDF  354



>ref|XP_006138033.1| PREDICTED: F-box only protein 7 [Pelodiscus sinensis]
Length=344

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 98/226 (43%), Gaps = 38/226 (17%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P++W      V  L Y+ P   DG          
Sbjct  130   LIVLVHLLMMETGYVPQGTEAKAVSMPDKW--RSGGVYKLQYTHPLCEDG----------  177

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  +++  +L  NS + SV   QL    F+ F          SEE  G  G
Sbjct  178   SAALTCVPLGDLIVINATLKINSEIKSVKRLQLLPTSFICFQE--------SEENVG--G  227

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
             +      K++ +  R  KD L  PLL     +    LP  F  + LP ELKL+I  LL  
Sbjct  228   IY-----KDLQKLSRLFKDQLVYPLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDI  280

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADWFR-NGGSWKQ  479
               L  +S +C DL Y ASND  LW+  +   F     R     WK+
Sbjct  281   RSLLSLSAVCRDL-YTASNDQLLWRFIYLRDFRDPIARPRDTDWKE  325



>ref|XP_005040029.1| PREDICTED: F-box only protein 7 [Ficedula albicollis]
Length=611

 Score = 58.9 bits (141),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 102/379 (27%), Positives = 145/379 (38%), Gaps = 70/379 (18%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-PNVQESSESQITTGLSPNLPAESTD  1397
             ++LN+KD L  +   +TL   GI SGDLI   L  P+ Q S         +P        
Sbjct  130   ITLNRKDAL--TEDQKTLASYGIVSGDLICLLLEEPDEQPSLPPLPPAAPAPLQNGHEPS  187

Query  1396  SI--NLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADV  1223
             S+  N SQ      +N P E       NS  D+                      +DAD+
Sbjct  188   SLTPNSSQ------ANSPREEGQNEPSNSEKDRMEVQESDERAGSSLEFPSGLVPEDADL  241

Query  1222  VGKSFSVPGFLRKVFTKELSDSDGGRDHKL---------------LLIAVHAVLLESGFV  1088
                + S P     +   E +D  G   H L               L++ VH +++E+G+V
Sbjct  242   EEGAGSYPS--EPMLCSEAAD--GETPHSLEMLYLSAECTSATDALIVLVHLLMMETGYV  297

Query  1087  RLDPILHKKV--PNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVI  914
                 I  K V  P +W      V  L Y+ P   +G          +  L    LG  + 
Sbjct  298   PQG-IEAKAVSMPEKWRGN--GVYKLQYTHPLCGEG----------SAGLTCVPLGDLIA  344

Query  913   VYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFW  743
             +  +L  N  + SV   QL    FV F +         E++AG          K++ +  
Sbjct  345   INATLKINEEIKSVKRIQLLPSSFVCFQD--------PEKVAGV--------YKDLQKLS  388

Query  742   RTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLR  569
             R  KD L   LL     +    LP  F  + LP ELKL+I  LL    L  +S +C DL 
Sbjct  389   RLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDVRSLISLSAVCRDL-  445

Query  568   YLASNDD-LWKQKFEEQFN  515
             Y ASND  LW+  +   F 
Sbjct  446   YTASNDQLLWRFMYLRDFR  464



>gb|KFV86169.1| F-box only protein 7, partial [Struthio camelus australis]
Length=497

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 98/228 (43%), Gaps = 31/228 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W  +   V  L Y+ P   +G          
Sbjct  161   LIVLVHLLMMETGYVPQGTEAKAVSMPEKWRGS--GVYKLQYTHPLCEEG----------  208

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             T  L    LG  V + G+L  N  +  V   QL    FV F   A+    L E++AG   
Sbjct  209   TAGLTCVPLGDLVAINGTLKINKEIKGVKRIQLLPASFVCFQEPAFCLPVLIEKVAGV--  266

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  267   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  318

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADWFR-NGGSWKQKF  473
               L  +S +C DL Y ASND  LW+  +   F     R     WK+ +
Sbjct  319   RSLISLSAVCRDL-YTASNDQLLWRFIYLRDFRDPIARPRDTDWKELY  365



>ref|XP_001366168.1| PREDICTED: F-box only protein 7 [Monodelphis domestica]
Length=518

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 119/442 (27%), Positives = 178/442 (40%), Gaps = 75/442 (17%)
 Frame = -3

Query  1723  MKLRLRSVETKETIPVDVPPST-TLPELKRRlslalpassafsmhssdSIRLSLNKKDEL  1547
             MKLR+R    K T P+++P +  TL EL  R  L      A+   S     ++LN KD L
Sbjct  1     MKLRVRV--RKRTAPLELPGAEPTLGEL--RAHLRQALLPAWGYSSDIQFAVTLNSKDAL  56

Query  1546  RSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDSINLSQKSLE  1367
               +  ++TL   GI  GDLI   L    ++   + +         A S+ + N  Q SL 
Sbjct  57    --TEDEKTLAEYGIVCGDLICLVLEEATEDLPRASLDL-------AHSSFASNHDQPSLA  107

Query  1366  LSSNL--------------PVESTNTSDFNSLS-DKAPelvdqgeeeevevmeidweEKD  1232
              S +L               V+S  +   +SL  D      D   EE       +     
Sbjct  108   TSQSLRSRQGERELNDPYSAVQSAESMPGSSLDLDSGLIQEDVDMEEGTGGYPSEPMLCS  167

Query  1231  ADVVGKSFSVPGFLRKVF-TKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KV  1058
               V G+   VP  L  ++ + E S ++       L++ VH ++LESG++ L        +
Sbjct  168   EAVDGQ---VPHSLEMLYHSAECSSTNDA-----LIVLVHLLMLESGYIPLGTEAKAVSM  219

Query  1057  PNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVH  878
             P  W      V  L Y  P   DG          T  L    LG  +++  +L  N+ + 
Sbjct  220   PENW--RSGGVYKLQYMHPLCEDG----------TAALTCVPLGSLIVINATLKINNEIR  267

Query  877   SV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLL  707
             SV   QL  + F+     A       E++A K         K++ +  R  KD L  PLL
Sbjct  268   SVKRLQLLPESFICPPKQA------EEQVASK--------YKDLQKLSRLFKDQLVYPLL  313

Query  706   IELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQ  536
                  +    LP  F  + LP ELKL+I  LL    +  +S +C DL + ASND  LW+ 
Sbjct  314   A--FARQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLALSAVCRDL-FNASNDQLLWRF  370

Query  535   KFEEQFNADWFR-NGGSWKQKF  473
              +   F     R     WK+ +
Sbjct  371   MYLRDFRDGAVRPRDTDWKELY  392



>ref|NP_001064110.1| Os10g0133100 [Oryza sativa Japonica Group]
 gb|ABB46692.1| F-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26024.1| Os10g0133100 [Oryza sativa Japonica Group]
 dbj|BAG92309.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50526.1| hypothetical protein OsJ_30626 [Oryza sativa Japonica Group]
Length=330

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/228 (25%), Positives = 100/228 (44%), Gaps = 17/228 (7%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-----RLDPILHKKVPNQWILTEPQVSILSYSLPEI-ADGDTDQN  971
             L++  HA  L +GFV            + +P++       +S L Y++PE+     T + 
Sbjct  27    LVVVAHAAFLHAGFVPYSAGGSSSASRRPLPDEIGAVASSLS-LRYTVPELLRRTTTQRR  85

Query  970   SNAVPTVELKFQTLGKFVIVYGSLSGNSS-VHSVQLDKDHFVPFLNVAWSNCGLSEEIAG  794
              +   T  L+    G  V+ YG L+G+++ V  +Q  + H+     ++ ++  LS ++  
Sbjct  86    RSRAETAVLRLCAHGDHVVFYGYLTGDANQVQRLQTTR-HWACIDALSVASVLLSGDLDA  144

Query  793   KDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLP  614
                 L           W+ +  GLA  L +++C K    LPP    LP +L+  IL  L 
Sbjct  145   TAHALADDGAG----LWKKLAGGLARRLFVDMCRKNSRLLPPRLTSLPPDLQEDILRRLA  200

Query  613   AVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGGSWKQKFV  470
               D+A M   C+ LR L +  ++    F  Q+   W     +W Q ++
Sbjct  201   VEDIAAMYFTCTGLRDLIAGSEVLNNNF--QWGELWMNF--AWSQGYL  244



>gb|EOB07206.1| F-box only protein 7, partial [Anas platyrhynchos]
Length=497

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 92/213 (43%), Gaps = 30/213 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   +G          
Sbjct  161   LIVLVHLLMMETGYVPQGTEAKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------  208

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  V +  +L  N  +  V   QL    FV F   A+S   L E++AG   
Sbjct  209   SAGLTCVPLGDLVAINATLKINKEIKGVKRIQLLPASFVCFQEPAFSLSALIEKVAGV--  266

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  267   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  318

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFN  515
               L  +S +C DL Y ASND  LW+  +   F 
Sbjct  319   RSLISLSAVCRDL-YAASNDQLLWRFMYLRDFR  350



>ref|XP_001508986.2| PREDICTED: F-box only protein 7 [Ornithorhynchus anatinus]
Length=485

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 100/376 (27%), Positives = 151/376 (40%), Gaps = 48/376 (13%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDS  1394
             ++LNKKD L  +  +ETL   GI  GDLI   L      S      +GL     + S  +
Sbjct  17    ITLNKKDAL--TEDNETLASYGIVCGDLICVVLEDASLPSPTDSALSGLQDRSESPSLTA  74

Query  1393  INLSQKSLELSSNLPVESTNTSDFNSLS-DKAPelvdqgeeeevevmeidweEKDADVVG  1217
               L   S   S+   V++ + +   SL  D      D   EE       +       V G
Sbjct  75    SRLENPSPAHSAQDDVQNDDFTAGTSLEFDPGLTQHDMDLEETAGSYFFEPMLCSEAVDG  134

Query  1216  KSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWIL  1040
             +   VP  L  ++    ++  G  D   L++ VH ++LESG++ L        +P +W  
Sbjct  135   Q---VPHSLETLYHS--AECTGTND--ALIVLVHLLMLESGYLPLGTEAKAGSMPEKW--  185

Query  1039  TEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---Q  869
                 V  L Y+ P   DG             L    LG  +++  +L  N+ + SV   Q
Sbjct  186   RSGGVYKLQYTHPLCEDG----------CAALICVPLGNLIVINATLKINNEIRSVKRLQ  235

Query  868   LDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEK  689
             L  + F+        N    E +A           K++ +  R  KD L  PLL     +
Sbjct  236   LLPESFI-------CNQEQEENVA--------RVYKDLQKLSRLFKDQLVYPLLA--FAR  278

Query  688   AGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQF  518
                 LP  F  + LP ELKL+I  LL    +  +S +C DL   ASND  LW+  +   F
Sbjct  279   QALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-LTASNDQLLWRFMYLRDF  337

Query  517   NADWFRNGGS-WKQKF  473
                  R+  + WK+ +
Sbjct  338   RDSTSRSRDTDWKELY  353



>ref|XP_003771163.1| PREDICTED: F-box only protein 7 [Sarcophilus harrisii]
Length=510

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 97/228 (43%), Gaps = 37/228 (16%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH ++LESG+  L        +P +W      V  L Y+ P   DG          
Sbjct  186   LIVLVHLLMLESGYTPLGTEAKAVSMPEKW--RSGGVYKLQYTHPLCEDG----------  233

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             T  L    LG  V++  +L  N+ + SV   QL  + F+     A       E +A K  
Sbjct  234   TAALTCVPLGSLVVINATLKINNEIRSVKRLQLLPESFICPHEQA------EENVARK--  285

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L  PLL     +    LP  F  + LP ELKL+I  LL  
Sbjct  286   ------YKDLQKLSRLFKDQLVYPLLA--FARQALNLPDVFGLIVLPLELKLRIFRLLDV  337

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADWFR-NGGSWKQKF  473
               +  +S +C DL ++ASND  LW+  +   F     R     WK+ +
Sbjct  338   RSVLSLSAVCRDL-FIASNDQLLWRFMYLRDFRDCAVRPRDTDWKELY  384



>gb|KFP60713.1| F-box only protein 7, partial [Cariama cristata]
Length=497

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 109/383 (28%), Positives = 157/383 (41%), Gaps = 71/383 (19%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDS  1394
             ++LN+KD L      +TL   GI SGDLI   L     E ++ Q      PNLP  S+  
Sbjct  9     ITLNRKDALTEDQ--KTLASYGIVSGDLICLLL-----EEADGQ------PNLPPSSSAP  55

Query  1393  INLSQKSLELSSNLPVESTNTS----DFNSLSD--KAPelvdqgeeeevevme--idweE  1238
               L Q   E S+ +P +S  +S      N  SD  KAP  V + +E     +E       
Sbjct  56    PPL-QNGHEPSTLIPNKSQASSPKEEGQNEQSDNQKAPVEVQKSDERAGSSLEFPSGLVP  114

Query  1237  KDADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKL---------------LLIAVHAVLL  1103
             +D D+   + S P     +   E +D  G   H L               L++ VH +++
Sbjct  115   EDVDLEEGTGSYPS--EPMLCSEAAD--GEIPHSLEMLYLSAECTSATDALIVLVHLLMM  170

Query  1102  ESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLG  926
             E+G+V +        +P +W      V  L Y+ P   +G          +  L    LG
Sbjct  171   ETGYVPQGTEAKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------SAGLTCVPLG  218

Query  925   KFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEV  755
               V +  +L  N  +  V   QL    FV F   A+    L E++AG          K++
Sbjct  219   DLVAINATLKINKEIKGVKRIQLLPASFVCFQEPAFYLSSLIEKVAGV--------YKDL  270

Query  754   FEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLC  581
              +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL    L  +S +C
Sbjct  271   QKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDVRSLISLSAVC  328

Query  580   SDLRYLASNDD-LWKQKFEEQFN  515
              DL Y ASND  LW+  +   F 
Sbjct  329   RDL-YTASNDQLLWRFMYLRDFR  350



>ref|XP_007102048.1| PREDICTED: F-box only protein 7 [Physeter catodon]
Length=545

 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 91/381 (24%), Positives = 158/381 (41%), Gaps = 46/381 (12%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALN-----PNVQESSESQITTGLSPNLPA  1409
             ++LN KD L  +  +ETL   GI SGDLI   L      PN+  S++S+ ++  + + P+
Sbjct  70    ITLNNKDAL--TGDEETLASYGIVSGDLICLILEDAIAAPNLPSSTDSEHSSLQNNDQPS  127

Query  1408  ESTDSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweE-KD  1232
              +      S +  +   +   ++  +  +N  S   P    + E     V   +      
Sbjct  128   LAASPSQSSIQDEQPRDSFQGQAAQSDVWNDGSMSGPSQNFEAESIPDVVDAEEGTGFYP  187

Query  1231  ADVVGKSFSVPGFLRKVFTKELSDSDGGRDHKLLLIAVHAVLLESGFV-RLDPILHKKVP  1055
             ++ +  S SV G +          +D       L++++H ++LESG++ +        +P
Sbjct  188   SEPMLCSESVEGQVPHSLETLYQSADCSNPSDALIVSIHLLMLESGYIPQGTEAKAVCLP  247

Query  1054  NQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHS  875
               W      V  L Y+ P    G          +  L    LG  +++  +L  N+ + S
Sbjct  248   ENW--RSGGVYRLQYTHPLCEGG----------SAALTCVPLGNLIVINATLKINNDIRS  295

Query  874   V---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLI  704
             V   QL  + F+             +E +G++        K++ +  R  KD L  PLL 
Sbjct  296   VKRLQLLPESFI------------CKEESGEN---VAKIYKDLQKLSRLFKDQLVYPLLA  340

Query  703   ELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQK  533
                 +    LP  F  + LP ELKL+I  LL    +  +S +C DL  +ASND  LW+  
Sbjct  341   --FTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDL-CIASNDQLLWRCL  397

Query  532   FEEQFNADWFRNGGS-WKQKF  473
             +   F     R   + WK+ +
Sbjct  398   YLRDFRDGTVRGRDTDWKELY  418



>gb|KFV92036.1| F-box only protein 7, partial [Eurypyga helias]
Length=495

 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 100/379 (26%), Positives = 151/379 (40%), Gaps = 64/379 (17%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQIT--TGLSPNLPAEST  1400
             ++LN+KD L      +TL   GI SGDLI   L    +E  +  +      +P L     
Sbjct  8     ITLNRKDALTEDQ--KTLASYGIVSGDLICLLLG---EEDGQPNLPLPPSAAPRLENGHE  62

Query  1399  DSINLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevm--eidweEKDAD  1226
              S  ++ +S    +N P E  N     S   KAP  V + +E     +        +D D
Sbjct  63    SSTLITDRS---QANSPKEWQNE---QSDKQKAPVEVQRIDERAGSSLEFTSGLVPEDVD  116

Query  1225  VVGKSFSVPGFLRKVFTKELSDSDGGRDHKL---------------LLIAVHAVLLESGF  1091
             +   + S P     +   E +D  G   H L               L++ VH +++E+G+
Sbjct  117   LEEGTGSYPS--EPMLCSEAAD--GEIPHSLEMLYLSAECTSATDALIVLVHLLMMETGY  172

Query  1090  V-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVI  914
             V +        +P +W      V  L Y+ P   +G          +  L    LG  V 
Sbjct  173   VPQGTEAKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------SAGLTCVPLGDLVA  220

Query  913   VYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFW  743
             +  +L  N  +  V   QL    F+ F   A+    L+E++AG          K++ +  
Sbjct  221   INATLKINKEIKGVKRIQLLPASFICFQEPAFCLSSLTEKVAGV--------YKDLQKLS  272

Query  742   RTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLR  569
             R  KD L   LL     +    LP  F  + LP ELKL+I  LL    L  +S +C DL 
Sbjct  273   RLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDVRSLISLSAVCRDL-  329

Query  568   YLASNDD-LWKQKFEEQFN  515
             Y ASND  LW+  +   F 
Sbjct  330   YTASNDQLLWRFMYLRDFR  348



>gb|AAL01164.1|AC079843_4 Hypothetical protein [Oryza sativa Japonica Group]
 gb|AAN11200.1| Hypothetical protein [Oryza sativa Japonica Group]
Length=379

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/228 (25%), Positives = 100/228 (44%), Gaps = 17/228 (7%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-----RLDPILHKKVPNQWILTEPQVSILSYSLPEI-ADGDTDQN  971
             L++  HA  L +GFV            + +P++       +S L Y++PE+     T + 
Sbjct  27    LVVVAHAAFLHAGFVPYSAGGSSSASRRPLPDEIGAVASSLS-LRYTVPELLRRTTTQRR  85

Query  970   SNAVPTVELKFQTLGKFVIVYGSLSGNSS-VHSVQLDKDHFVPFLNVAWSNCGLSEEIAG  794
              +   T  L+    G  V+ YG L+G+++ V  +Q  + H+     ++ ++  LS ++  
Sbjct  86    RSRAETAVLRLCAHGDHVVFYGYLTGDANQVQRLQTTR-HWACIDALSVASVLLSGDLDA  144

Query  793   KDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLP  614
                 L           W+ +  GLA  L +++C K    LPP    LP +L+  IL  L 
Sbjct  145   TAHALADDGAG----LWKKLAGGLARRLFVDMCRKNSRLLPPRLTSLPPDLQEDILRRLA  200

Query  613   AVDLAKMSCLCSDLRYLASNDDLWKQKFEEQFNADWFRNGGSWKQKFV  470
               D+A M   C+ LR L +  ++    F  Q+   W     +W Q ++
Sbjct  201   VEDIAAMYFTCTGLRDLIAGSEVLNNNF--QWGELWM--NFAWSQGYL  244



>gb|KFO95410.1| F-box only protein 7, partial [Calypte anna]
Length=494

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 92/213 (43%), Gaps = 30/213 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   +G          
Sbjct  158   LIVLVHLLMMEAGYVPQGTEAKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------  205

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG+ V +  +L  N  +  V   QL    FV F   A+    L E++AG   
Sbjct  206   SAGLTCVPLGELVAINATLKINKEIKGVKRIQLLPSSFVCFQEPAFYLSSLIEKVAGV--  263

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  264   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  315

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFN  515
               L  +S +C DL Y ASND  LW+  +   F 
Sbjct  316   RSLISLSAVCRDL-YTASNDQLLWRFMYLRDFR  347



>ref|XP_004675770.1| PREDICTED: F-box only protein 7 isoform X2 [Condylura cristata]
Length=443

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 98/237 (41%), Gaps = 38/237 (16%)
 Frame = -3

Query  1159  SDGGRDHKLLLIAVHAVLLESGFVRLDPILHK-KVPNQWILTEPQVSILSYSLPEIADGD  983
             +D    H  L++ +H ++LESG++          +P  W      V  L Y+ P   DG 
Sbjct  111   ADCSNSHDALIVLIHLLMLESGYIPQGTEAKAVSMPENW--KSGGVYKLQYTHPLCEDG-  167

Query  982   TDQNSNAVPTVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGL  812
                         L    LG  V+V  +L  N+ + SV   QL  + F+            
Sbjct  168   ---------CAALTCVPLGTLVVVNATLKINNEIRSVKRLQLLPESFI------------  206

Query  811   SEEIAGKDGLLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELK  638
              +E  G+D        K++ +  R  KD L  PLL     +    LP  F  + LP ELK
Sbjct  207   RKEEPGED---VAKIYKDLQKLSRLFKDQLVYPLLA--FTRQALNLPDVFGLVVLPLELK  261

Query  637   LKILELLPAVDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADWFR-NGGSWKQKF  473
             L+I  LL    +  +S +C DL ++ASND  LW+  +   F     R     WK+ +
Sbjct  262   LRIFRLLDVRSVLSLSAVCRDL-FIASNDQLLWRCLYLRDFRDGTARVRDTDWKELY  317



>gb|KFW83418.1| F-box only protein 7, partial [Phalacrocorax carbo]
Length=397

 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 92/213 (43%), Gaps = 30/213 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   +G          
Sbjct  61    LIVLVHLLMMETGYVPQGTEAKAVSMPEKW--RGNGVYKLQYTHPLCEEG----------  108

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  V +  +L  N  +  V   QL    FV F + A+    L E++AG   
Sbjct  109   SAGLTCVPLGDLVAINATLKINKEIKGVKRIQLLPASFVSFQDPAFYLSSLIEKVAGV--  166

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  167   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  218

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFN  515
               L  +S +C DL Y ASND  LW+  +   F 
Sbjct  219   RSLISLSAVCRDL-YTASNDQLLWRFMYLRDFR  250



>gb|KFP84963.1| F-box only protein 7, partial [Acanthisitta chloris]
Length=495

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 107/391 (27%), Positives = 158/391 (40%), Gaps = 85/391 (22%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQITTGLSPNLPAESTDS  1394
             ++LN+KD L      +TL   GI SGDLI   L       ++ Q      PNLP   T +
Sbjct  9     ITLNRKDALTEDQ--KTLASYGIVSGDLICLLLR-----EADGQ------PNLPLPPTTT  55

Query  1393  INLSQKSLELSSNLPVESTNTSDFNSLSDKAPelvdqgeeeevevmeidweEKDADVVGK  1214
                 Q   E S+ +P    +TS  NS     P+   Q E+ + +  +++ +  D    G 
Sbjct  56    CPPLQNGHEPSTLIP----HTSQANS-----PQEEGQSEQSDNQKAQMEVQMSDERKAGS  106

Query  1213  SFSVPGFL--RKVFTKELSDS------------DGGRDHKL---------------LLIA  1121
             S   P  L    V  +E + S            DG   H L               L++ 
Sbjct  107   SLEFPSGLVPEDVAVEEGTGSYTSEPMLCGEAADGEIPHSLEMLYLSAECTSATDALIVL  166

Query  1120  VHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVEL  944
             VH +++E+G+V +        +P +W      V  L Y+ P   +G          +  L
Sbjct  167   VHLLMMETGYVPQGTEAKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------SAGL  214

Query  943   KFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAG--KD--G  785
                 LG  V++  +L  N  + SV   QL    FV F + A       E++AG  KD   
Sbjct  215   ICVPLGDLVVINATLKINKEIKSVKRIQLLPASFVCFNDPASYLSSFIEKVAGVYKDLQK  274

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCFMRLPTELKLKILELLPAVD  605
             L C   ++ V+      +  L LP +        FGL    + LP ELKL+I  LL    
Sbjct  275   LSCLFKDQLVYSLLAAARQALNLPDV--------FGL----VVLPLELKLRIFRLLDVRS  322

Query  604   LAKMSCLCSDLRYLASNDD-LWKQKFEEQFN  515
             L  +S +C DL Y ASND  LW+  +   F 
Sbjct  323   LLSLSAVCRDL-YTASNDQLLWRFMYLRDFR  352



>gb|KGL78403.1| F-box only protein 7, partial [Tinamus guttatus]
Length=490

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 102/379 (27%), Positives = 151/379 (40%), Gaps = 69/379 (18%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQ--------ITTGLSPN  1418
             ++LN KD L  +  ++TL   GI SGDLI   L   V + S           +  G  P+
Sbjct  8     ITLNNKDAL--TEDEKTLASYGIVSGDLICLLLEEAVAKPSPPPPSSSTPAPLQNGQEPS  65

Query  1417  --LPAESTDSINLSQKSLELSSNLPVES--------TNTSDFNSLSDKAPelvdqgeeee  1268
               +P +S  S    +++  LS N  V++           S     SD  PE  D  E   
Sbjct  66    TSIPKKSQASSPKERQNGGLSDNQKVQAEVQRNDDDKEKSSLEFASDLVPEDADLEEGTG  125

Query  1267  vevmeidweEKDADVVGKSFSVPGFLRKVF-TKELSDSDGGRDHKLLLIAVHAVLLESGF  1091
                 E     + AD       +P  L  ++ + E S +        L++ VH +++E+G+
Sbjct  126   CYPSEPMLCSEAAD-----GQIPHSLETLYHSAECSSATDA-----LIVLVHLLMMEAGY  175

Query  1090  V-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVI  914
             V +        +P +W      V  L Y+ P   +G          T  L    LG  V+
Sbjct  176   VPQGTEAKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------TAGLTCVPLGDLVV  223

Query  913   VYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFW  743
             + G+L  N  +  V   QL    FV F           E++AG          K++ +  
Sbjct  224   INGTLKINKEIKGVKRIQLLPTSFVCFQE--------PEKVAGV--------YKDLQKLS  267

Query  742   RTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLR  569
             R  KD L   LL     +    LP  F  + LP ELKL+I  LL    L  +S +C DL 
Sbjct  268   RLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDVRSLISLSAVCRDL-  324

Query  568   YLASNDD-LWKQKFEEQFN  515
             Y ASND  LW+  +   F 
Sbjct  325   YTASNDQLLWRFMYLRDFR  343



>gb|KFP42535.1| F-box only protein 7, partial [Chlamydotis macqueenii]
Length=496

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 91/212 (43%), Gaps = 30/212 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   +G          
Sbjct  160   LIVLVHLLMMEAGYVPQGTEAKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------  207

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  V V  +L  N  +  V   QL    FV F   A+    L E++AG   
Sbjct  208   SAGLTCVPLGDLVAVNATLKINKEIKGVKRIQLLPASFVCFQEPAFYLSSLIEKVAGV--  265

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  266   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  317

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQF  518
               L  +S +C DL Y ASND  LW+  +   F
Sbjct  318   RSLISLSTVCRDL-YTASNDQLLWRFMYLRDF  348



>gb|KFQ00593.1| F-box only protein 7, partial [Haliaeetus albicilla]
Length=496

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 91/213 (43%), Gaps = 30/213 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   +G          
Sbjct  160   LIVLVHLLMMETGYVPQGTEAKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------  207

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  V +  +L  N  +  V   QL    FV F   A+    L E++AG   
Sbjct  208   SAGLTCVPLGDLVAINATLKINKEIKGVKRIQLLPASFVCFQEPAFYLSSLIEKVAGV--  265

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  266   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  317

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFN  515
               L  +S +C DL Y ASND  LW+  +   F 
Sbjct  318   RSLISLSAVCRDL-YTASNDQLLWRFMYLRDFR  349



>gb|KFP81590.1| F-box only protein 7, partial [Apaloderma vittatum]
Length=496

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 91/213 (43%), Gaps = 30/213 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   +G          
Sbjct  160   LIVLVHLLMMEAGYVPQGTECKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------  207

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  V +  +L  N  +  V   QL    FV F   A+    L E++AG   
Sbjct  208   SAGLTCVPLGDLVAINATLKINKEIKGVKRIQLLPASFVCFQEPAFYFSSLIEKVAGV--  265

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  266   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  317

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFN  515
               L  +S +C DL Y ASND  LW+  +   F 
Sbjct  318   RSLISLSAVCRDL-YTASNDQLLWRFMYLRDFR  349



>ref|XP_010214657.1| PREDICTED: F-box only protein 7, partial [Tinamus guttatus]
Length=489

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 102/379 (27%), Positives = 151/379 (40%), Gaps = 69/379 (18%)
 Frame = -3

Query  1573  LSLNKKDELRSSSPDETLEMLGITSGDLIFFALNPNVQESSESQ--------ITTGLSPN  1418
             ++LN KD L  +  ++TL   GI SGDLI   L   V + S           +  G  P+
Sbjct  7     ITLNNKDAL--TEDEKTLASYGIVSGDLICLLLEEAVAKPSPPPPSSSTPAPLQNGQEPS  64

Query  1417  --LPAESTDSINLSQKSLELSSNLPVES--------TNTSDFNSLSDKAPelvdqgeeee  1268
               +P +S  S    +++  LS N  V++           S     SD  PE  D  E   
Sbjct  65    TSIPKKSQASSPKERQNGGLSDNQKVQAEVQRNDDDKEKSSLEFASDLVPEDADLEEGTG  124

Query  1267  vevmeidweEKDADVVGKSFSVPGFLRKVF-TKELSDSDGGRDHKLLLIAVHAVLLESGF  1091
                 E     + AD       +P  L  ++ + E S +        L++ VH +++E+G+
Sbjct  125   CYPSEPMLCSEAAD-----GQIPHSLETLYHSAECSSATDA-----LIVLVHLLMMEAGY  174

Query  1090  V-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVPTVELKFQTLGKFVI  914
             V +        +P +W      V  L Y+ P   +G          T  L    LG  V+
Sbjct  175   VPQGTEAKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------TAGLTCVPLGDLVV  222

Query  913   VYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDGLLCTSPEKEVFEFW  743
             + G+L  N  +  V   QL    FV F           E++AG          K++ +  
Sbjct  223   INGTLKINKEIKGVKRIQLLPTSFVCFQE--------PEKVAGV--------YKDLQKLS  266

Query  742   RTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPAVDLAKMSCLCSDLR  569
             R  KD L   LL     +    LP  F  + LP ELKL+I  LL    L  +S +C DL 
Sbjct  267   RLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDVRSLISLSAVCRDL-  323

Query  568   YLASNDD-LWKQKFEEQFN  515
             Y ASND  LW+  +   F 
Sbjct  324   YTASNDQLLWRFMYLRDFR  342



>ref|XP_007062736.1| PREDICTED: F-box only protein 7 [Chelonia mydas]
Length=501

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 93/212 (44%), Gaps = 37/212 (17%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   DG          
Sbjct  172   LIVLVHLLMMETGYVPQGTEAKAVSMPEKW--RSGGVYKLQYTHPLCEDG----------  219

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  +++  +L  N+ + SV   QL    F+ F          SEE  G  G
Sbjct  220   SAALTCVPLGDLIVINATLKINNEIKSVKRLQLLPTSFICFQE--------SEENVG--G  269

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
             +      K++ +  R  KD L  PLL     +    LP  F  + LP ELKL+I  LL  
Sbjct  270   VY-----KDLQKLSRLFKDQLVYPLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDI  322

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQF  518
               L  +S +C DL Y ASND  LW+  +   F
Sbjct  323   RSLLSLSAVCRDL-YTASNDQLLWRFIYLRDF  353



>gb|KFV05047.1| F-box only protein 7, partial [Pterocles gutturalis]
Length=496

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 91/212 (43%), Gaps = 30/212 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   +G          
Sbjct  160   LIVLVHLLMMETGYVPQGTECKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------  207

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  V +  +L  N  +  V   QL    FV F   A+    L E++AG   
Sbjct  208   SAGLTCVPLGDLVAINATLKINKEIKGVKRIQLLPASFVCFQESAFYFSSLIEKVAGV--  265

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  266   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  317

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQF  518
               L  +S +C DL Y ASND  LW+  +   F
Sbjct  318   RSLISLSAVCRDL-YTASNDQLLWRFIYLRDF  348



>gb|KFQ79745.1| F-box only protein 7, partial [Phoenicopterus ruber ruber]
Length=496

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 91/213 (43%), Gaps = 30/213 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   +G          
Sbjct  160   LIVLVHLLMMETGYVPQGTEAKAVSMPEKW--RGKGVYKLQYTHPLCEEG----------  207

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  V +  +L  N  +  V   QL    FV F   A+    L E++AG   
Sbjct  208   SAGLTCVPLGDLVAINATLKINKEIKGVKKIQLLPASFVCFQEPAFYLSSLIEKVAGV--  265

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  266   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  317

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFN  515
               L  +S +C DL Y ASND  LW+  +   F 
Sbjct  318   RSLISLSAVCRDL-YTASNDQLLWRFMYLRDFR  349



>ref|XP_008841331.1| PREDICTED: F-box only protein 7 isoform X2 [Nannospalax galili]
Length=443

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 99/228 (43%), Gaps = 38/228 (17%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH ++LESG++ +        +P++W L+   V  L Y+ P    G          
Sbjct  119   LIVLVHLLMLESGYIPQRTEAKAVSMPDKWKLS--GVYKLQYTHPLCEGG----------  166

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  +IV  +L  NS + SV   QL  + FV              E  G++ 
Sbjct  167   SAVLTCVPLGNLIIVNATLRINSEIKSVKRLQLLPESFV------------CTEQPGENA  214

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L  PLL     +    LP  F  + LP ELKL+I  LL  
Sbjct  215   ---AKVYKDLQKLSRLFKDQLVYPLLA--FTRQALNLPDVFGLVVLPLELKLRIFRLLDV  269

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFNADWFRNGGS-WKQKF  473
               +  +S +C DL ++ SND  LW+  +   F     R   + WK+ +
Sbjct  270   PSVLALSAVCRDL-FITSNDPLLWRCLYLRDFRDGTVRGRDTDWKELY  316



>ref|XP_009372161.1| PREDICTED: F-box protein SKIP22-like [Pyrus x bretschneideri]
Length=265

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 48/92 (52%), Gaps = 19/92 (21%)
 Frame = -3

Query  736  VKDGLALPLLIELCEKAGFGL----------------PPCFMRLPTELKLKILELLPAVD  605
            V D + LP LIEL    GF +                P   M LP+ELK+K+LE  P VD
Sbjct  108  VNDEIVLPFLIELRRNPGFPIVLPFPIEFGQKPLSVSPTGIMGLPSELKMKVLESPPGVD  167

Query  604  LAKMSCLCSDLRYLAS---NDDLWKQKFEEQF  518
            + K++C+C  ++ + +   ++ LW+ K+ E+ 
Sbjct  168  IVKLACVCKGMKNMVNDVIDELLWRDKYYEEI  199



>gb|KFW73487.1| F-box only protein 7, partial [Pygoscelis adeliae]
Length=497

 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 91/213 (43%), Gaps = 30/213 (14%)
 Frame = -3

Query  1132  LLIAVHAVLLESGFV-RLDPILHKKVPNQWILTEPQVSILSYSLPEIADGDTDQNSNAVP  956
             L++ VH +++E+G+V +        +P +W      V  L Y+ P   +G          
Sbjct  161   LIVLVHLLMMETGYVPQGTEAKAVSMPEKWRGN--GVYKLQYTHPLCEEG----------  208

Query  955   TVELKFQTLGKFVIVYGSLSGNSSVHSV---QLDKDHFVPFLNVAWSNCGLSEEIAGKDG  785
             +  L    LG  V +  +L  N  +  V   QL    FV F   A+    L E++AG   
Sbjct  209   SAGLTCVPLGDLVAINATLKINKEIKGVKRIQLLPASFVCFQEPAFYLSSLIEKVAGV--  266

Query  784   LLCTSPEKEVFEFWRTVKDGLALPLLIELCEKAGFGLPPCF--MRLPTELKLKILELLPA  611
                    K++ +  R  KD L   LL     +    LP  F  + LP ELKL+I  LL  
Sbjct  267   ------YKDLQKLSRLFKDQLVYSLLA--AARQALNLPDVFGLVVLPLELKLRIFRLLDV  318

Query  610   VDLAKMSCLCSDLRYLASNDD-LWKQKFEEQFN  515
               L  +S +C DL Y ASND  LW+  +   F 
Sbjct  319   RSLISLSAVCRDL-YTASNDQLLWRFMYLRDFR  350



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5062430735620