BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25132_g3_i1 len=1749 path=[1727:0-1033 2761:1034-1052
24234:1053-1057 24239:1058-1067 2795:1068-1078 2806:1079-1125
2853:1126-1142 2870:1143-1199 24300:1200-1201 24302:1202-1202
2930:1203-1748]

Length=1749
                                                                      Score     E

ref|XP_009592399.1|  PREDICTED: vacuolar-processing enzyme              696   0.0      
emb|CAB42651.2|  putative preprolegumain                                692   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009771365.1|  PREDICTED: vacuolar-processing enzyme beta-i...    692   0.0      
ref|XP_004245733.1|  PREDICTED: vacuolar-processing enzyme beta-i...    676   0.0      
ref|XP_006355496.1|  PREDICTED: vacuolar-processing enzyme beta-i...    672   0.0      
ref|XP_011069632.1|  PREDICTED: vacuolar-processing enzyme              652   0.0      
gb|EYU24761.1|  hypothetical protein MIMGU_mgv1a005235mg                646   0.0      
ref|XP_010676183.1|  PREDICTED: vacuolar-processing enzyme              645   0.0      
ref|XP_006391830.1|  hypothetical protein EUTSA_v10023430mg             644   0.0      
gb|EYU34366.1|  hypothetical protein MIMGU_mgv1a018579mg                642   0.0      
gb|AES90963.2|  vacuolar processing enzyme                              640   0.0      
ref|XP_003608766.1|  Vacuolar-processing enzyme                         639   0.0      
gb|KDP25622.1|  hypothetical protein JCGZ_20778                         639   0.0      
ref|XP_010473493.1|  PREDICTED: vacuolar-processing enzyme beta-i...    638   0.0      
ref|XP_011033921.1|  PREDICTED: vacuolar-processing enzyme-like         639   0.0      
gb|KHN09785.1|  Vacuolar-processing enzyme                              637   0.0      
ref|XP_008796848.1|  PREDICTED: vacuolar-processing enzyme              637   0.0      
ref|XP_007209951.1|  hypothetical protein PRUPE_ppa004795mg             635   0.0      
ref|XP_006477253.1|  PREDICTED: vacuolar-processing enzyme-like         636   0.0      
ref|XP_010418271.1|  PREDICTED: vacuolar-processing enzyme beta-i...    634   0.0      
ref|XP_010430341.1|  PREDICTED: vacuolar-processing enzyme beta-i...    633   0.0      
ref|NP_001236678.1|  vacuolar-processing enzyme precursor               632   0.0      
ref|XP_006440379.1|  hypothetical protein CICLE_v10019686mg             633   0.0      
ref|XP_009112700.1|  PREDICTED: vacuolar-processing enzyme beta-i...    630   0.0      
ref|NP_176458.1|  vacuolar-processing enzyme beta                       630   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933721.1|  PREDICTED: vacuolar-processing enzyme              630   0.0      
ref|XP_006302155.1|  hypothetical protein CARUB_v10020164mg             631   0.0      
emb|CDY39808.1|  BnaA09g10600D                                          630   0.0      
ref|XP_002304429.2|  hypothetical protein POPTR_0003s11280g             630   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006579475.1|  PREDICTED: seed maturation protein PM40 isof...    629   0.0      
ref|XP_011018251.1|  PREDICTED: vacuolar-processing enzyme              628   0.0      
emb|CDY03258.1|  BnaC09g10900D                                          626   0.0      
ref|XP_004515742.1|  PREDICTED: vacuolar-processing enzyme-like         626   0.0      
gb|KHG24041.1|  Vacuolar-processing enzyme                              625   0.0      
ref|XP_010093667.1|  Vacuolar-processing enzyme                         624   0.0      
ref|XP_009382344.1|  PREDICTED: legumain-like                           625   0.0      
gb|AET08888.1|  vacuolar processing enzyme 1                            623   0.0      
ref|XP_010646818.1|  PREDICTED: vacuolar-processing enzyme              623   0.0      
gb|AGC54786.1|  beta vacuolar processing enzyme                         622   0.0      
ref|XP_002509577.1|  Vacuolar-processing enzyme precursor               621   0.0      Ricinus communis
ref|XP_010053427.1|  PREDICTED: vacuolar-processing enzyme isofor...    621   0.0      
ref|XP_003569976.1|  PREDICTED: vacuolar-processing enzyme beta-i...    620   0.0      
emb|CBI28507.3|  unnamed protein product                                623   0.0      
gb|AET08895.1|  vacuolar processing enzyme 2                            619   0.0      
dbj|BAA09615.1|  vacuolar processing enzyme                             619   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41386.1|  asparaginyl endopeptidase REP-2                        619   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001238297.1|  seed maturation protein PM40 precursor             619   0.0      
gb|AET08892.1|  vacuolar processing enzyme 2                            618   0.0      
ref|XP_007039931.1|  Beta vacuolar processing enzyme                    619   0.0      
ref|XP_008369533.1|  PREDICTED: legumain                                617   0.0      
emb|CAQ00096.1|  legumain                                               615   0.0      Hordeum vulgare subsp. vulgare [barley]
ref|XP_002452849.1|  hypothetical protein SORBIDRAFT_04g033520          613   0.0      Sorghum bicolor [broomcorn]
ref|NP_001105183.1|  vacuolar processing enzyme1 precursor              612   0.0      Zea mays [maize]
ref|XP_010259032.1|  PREDICTED: vacuolar-processing enzyme-like         612   0.0      
ref|XP_008437131.1|  PREDICTED: legumain                                612   0.0      
emb|CDP09908.1|  unnamed protein product                                612   0.0      
ref|XP_002448237.1|  hypothetical protein SORBIDRAFT_06g023820          612   0.0      Sorghum bicolor [broomcorn]
ref|XP_004147613.1|  PREDICTED: vacuolar-processing enzyme-like         611   0.0      
sp|P49046.1|LEGU_CANEN  RecName: Full=Legumain; AltName: Full=Asp...    610   0.0      Canavalia ensiformis [horse bean]
ref|XP_008238625.1|  PREDICTED: LOW QUALITY PROTEIN: legumain           611   0.0      
ref|XP_010553469.1|  PREDICTED: vacuolar-processing enzyme beta-i...    611   0.0      
gb|AFW72544.1|  vacuolar processing enzyme 1                            610   0.0      
ref|XP_004298668.1|  PREDICTED: vacuolar-processing enzyme-like         609   0.0      
gb|EPS73966.1|  asparaginyl endopeptidase                               604   0.0      
ref|XP_006647602.1|  PREDICTED: vacuolar-processing enzyme-like         604   0.0      
ref|XP_004953273.1|  PREDICTED: vacuolar-processing enzyme beta-i...    605   0.0      
gb|AAF19550.1|AC007190_18  F23N19.7                                     605   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886459.1|  F23N19.7                                           605   0.0      
ref|XP_008668185.1|  PREDICTED: LOC100286140 isoform X1                 603   0.0      
ref|XP_007155624.1|  hypothetical protein PHAVU_003G217500g             600   0.0      
sp|O24326.1|VPE2_PHAVU  RecName: Full=Vacuolar-processing enzyme;...    600   0.0      Phaseolus vulgaris [French bean]
ref|XP_004976374.1|  PREDICTED: vacuolar-processing enzyme-like         600   0.0      
emb|CAB16318.1|  cysteine proteinase precursor                          595   0.0      Vicia narbonensis
emb|CAA07639.1|  cysteine proteinase precursor                          594   0.0      Vicia sativa [spring vetch]
ref|NP_001152500.1|  LOC100286140                                       592   0.0      Zea mays [maize]
ref|XP_010695188.1|  PREDICTED: vacuolar-processing enzyme-like         589   0.0      
ref|XP_010264202.1|  PREDICTED: vacuolar-processing enzyme-like         579   0.0      
ref|NP_001047562.1|  Os02g0644000                                       574   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010053430.1|  PREDICTED: vacuolar-processing enzyme isofor...    572   0.0      
ref|XP_006838617.1|  hypothetical protein AMTR_s00002p00230280          572   0.0      
emb|CBX26639.1|  vacuolar processing enzyme 2c                          571   0.0      
ref|NP_001053428.1|  Os04g0537900                                       570   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMS56335.1|  Vacuolar-processing enzyme beta-isozyme                 569   0.0      
ref|XP_006652582.1|  PREDICTED: vacuolar-processing enzyme-like         570   0.0      
gb|EEC77714.1|  hypothetical protein OsI_16797                          566   0.0      Oryza sativa Indica Group [Indian rice]
gb|KHG28226.1|  Vacuolar-processing enzyme                              564   0.0      
gb|EMT33588.1|  Vacuolar-processing enzyme beta-isozyme                 563   0.0      
ref|XP_003580236.1|  PREDICTED: vacuolar-processing enzyme beta-i...    563   0.0      
gb|EMS56147.1|  Vacuolar-processing enzyme                              557   0.0      
emb|CAE03020.3|  OSJNBa0091D06.13                                       558   0.0      Oryza sativa [red rice]
emb|CAQ00098.1|  legumain                                               556   0.0      Hordeum vulgare subsp. vulgare [barley]
emb|CBX26640.1|  vacuolar processing enzyme 2d                          555   0.0      
gb|AAL40390.1|  C13 cysteine proteinase precursor                       551   0.0      Oryza sativa Indica Group [Indian rice]
gb|KDO48391.1|  hypothetical protein CISIN_1g016176mg                   545   0.0      
ref|XP_008797891.1|  PREDICTED: vacuolar-processing enzyme              547   0.0      
gb|ABS57371.1|  VPE1                                                    543   0.0      Triticum aestivum [Canadian hard winter wheat]
emb|CAQ00097.1|  legumain                                               542   0.0      Hordeum vulgare subsp. vulgare [barley]
gb|ABR18199.1|  unknown                                                 542   0.0      Picea sitchensis
emb|CBX26638.1|  vacuolar processing enzyme 2b                          540   0.0      
ref|XP_002455802.1|  hypothetical protein SORBIDRAFT_03g025440          540   0.0      Sorghum bicolor [broomcorn]
ref|XP_010911246.1|  PREDICTED: vacuolar-processing enzyme              540   0.0      
ref|XP_007012236.1|  Gamma vacuolar processing enzyme                   538   0.0      
ref|XP_009398114.1|  PREDICTED: vacuolar-processing enzyme-like         534   0.0      
ref|XP_009361606.1|  PREDICTED: vacuolar-processing enzyme-like         537   0.0      
emb|CDP08231.1|  unnamed protein product                                537   0.0      
gb|ACG34144.1|  vacuolar processing enzyme precursor                    536   0.0      Zea mays [maize]
gb|AGC94756.1|  vacuolar processing enzyme                              536   0.0      
ref|NP_001241716.1|  uncharacterized protein LOC100856894 precursor     536   0.0      
ref|XP_008393660.1|  PREDICTED: vacuolar-processing enzyme              536   0.0      
gb|ACR24644.1|  vacuolar processing enzyme                              535   0.0      Malus hupehensis var. mengshanensis
ref|NP_001105119.1|  legumain-like protease precursor                   535   0.0      Zea mays [maize]
gb|ABF00019.1|  legumain precursor                                      535   0.0      Saccharum officinarum [noble cane]
gb|AGC94757.1|  vacuolar processing enzyme                              535   0.0      
dbj|BAD25788.1|  putative asparaginyl endopeptidase REP-2               530   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002516472.1|  Vacuolar-processing enzyme precursor, putative     534   0.0      Ricinus communis
gb|AGC94759.1|  vacuolar processing enzyme                              534   0.0      
gb|AGC94758.1|  vacuolar processing enzyme                              533   0.0      
gb|AET08893.1|  vacuolar processing enzyme 4                            533   0.0      
gb|EEE54813.1|  hypothetical protein OsJ_02232                          534   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003550283.1|  PREDICTED: vacuolar-processing enzyme-like         533   0.0      
ref|XP_009420869.1|  PREDICTED: vacuolar-processing enzyme-like         533   0.0      
emb|CAN70603.1|  hypothetical protein VITISV_040193                     533   0.0      Vitis vinifera
emb|CAQ00099.1|  legumain                                               533   0.0      Hordeum vulgare subsp. vulgare [barley]
gb|AEY68248.1|  legumain                                                533   0.0      
ref|NP_001043344.1|  Os01g0559600                                       533   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105613.1|  LOC542609 precursor                                532   0.0      Zea mays [maize]
ref|XP_010526156.1|  PREDICTED: vacuolar-processing enzyme gamma-...    533   0.0      
ref|XP_003569218.1|  PREDICTED: vacuolar-processing enzyme-like         532   0.0      
emb|CBI20614.3|  unnamed protein product                                532   0.0      
ref|NP_001236564.1|  vacuolar processing enzyme 2 precursor             531   0.0      
ref|XP_007222246.1|  hypothetical protein PRUPE_ppa004713mg             531   1e-180   
ref|XP_002276759.2|  PREDICTED: vacuolar-processing enzyme              532   2e-180   Vitis vinifera
gb|ACF79136.1|  unknown                                                 531   2e-180   Zea mays [maize]
gb|AAF69014.1|AF260827_1  cysteine protease                             531   2e-180   Ipomoea batatas [batate]
ref|XP_009337146.1|  PREDICTED: vacuolar-processing enzyme-like         531   2e-180   
gb|EYU29312.1|  hypothetical protein MIMGU_mgv1a005315mg                530   5e-180   
ref|XP_011096125.1|  PREDICTED: vacuolar-processing enzyme              530   5e-180   
gb|KHN37015.1|  Vacuolar-processing enzyme                              528   1e-179   
emb|CAC18100.1|  putative legumain                                      528   2e-179   Zea mays [maize]
ref|XP_008377927.1|  PREDICTED: vacuolar-processing enzyme-like         528   2e-179   
ref|XP_004291017.1|  PREDICTED: vacuolar-processing enzyme-like         528   2e-179   
ref|XP_009616670.1|  PREDICTED: vacuolar-processing enzyme-like         528   2e-179   
ref|XP_002324151.1|  asparaginyl endopeptidase family protein           528   2e-179   Populus trichocarpa [western balsam poplar]
gb|AET08896.1|  vacuolar processing enzyme 4                            528   4e-179   
gb|AET08891.1|  vacuolar processing enzyme 4                            527   6e-179   
gb|KHG13131.1|  Vacuolar-processing enzyme                              527   6e-179   
gb|KDP34125.1|  hypothetical protein JCGZ_07696                         527   7e-179   
emb|CAB64545.1|  legumain-like protease                                 526   8e-179   Zea mays [maize]
ref|XP_002960690.1|  hypothetical protein SELMODRAFT_75074              526   2e-178   
ref|XP_006853917.1|  hypothetical protein AMTR_s00036p00187360          525   2e-178   
ref|XP_006646004.1|  PREDICTED: vacuolar-processing enzyme-like         527   2e-178   
ref|XP_010049168.1|  PREDICTED: vacuolar-processing enzyme-like         526   2e-178   
emb|CBM41515.1|  legumain/vacuolar processing enzyme                    526   2e-178   
gb|KHG30636.1|  Vacuolar-processing enzyme                              525   3e-178   
ref|XP_010432633.1|  PREDICTED: vacuolar-processing enzyme gamma-...    524   8e-178   
ref|XP_006296251.1|  hypothetical protein CARUB_v10025418mg             524   9e-178   
ref|XP_009407316.1|  PREDICTED: vacuolar-processing enzyme-like         523   2e-177   
gb|AAK15049.1|AF238384_1  asparaginyl endopeptidase                     523   2e-177   Vigna radiata var. radiata [golden gram]
ref|XP_010447316.1|  PREDICTED: vacuolar-processing enzyme gamma-...    523   2e-177   
gb|ACQ91103.1|  vacuolar processing enzyme a                            523   2e-177   Populus tomentosa [Chinese white poplar]
dbj|BAA76745.1|  asparaginyl endopeptidase (VmPE-1A)                    523   3e-177   Vigna mungo [urad dal]
ref|XP_011019532.1|  PREDICTED: vacuolar-processing enzyme isofor...    522   5e-177   
ref|XP_009762556.1|  PREDICTED: vacuolar-processing enzyme-like         521   1e-176   
ref|XP_010437829.1|  PREDICTED: vacuolar-processing enzyme gamma-...    521   2e-176   
gb|ABK25457.1|  unknown                                                 519   2e-176   Picea sitchensis
dbj|BAA76744.1|  asparaginyl endopeptidase (VmPE-1)                     520   4e-176   Vigna mungo [urad dal]
dbj|BAJ95226.1|  predicted protein                                      520   4e-176   
ref|XP_010526069.1|  PREDICTED: vacuolar-processing enzyme gamma-...    520   4e-176   
ref|XP_002983346.1|  hypothetical protein SELMODRAFT_445464             520   5e-176   
emb|CDM87100.1|  unnamed protein product                                519   5e-176   
ref|XP_004960991.1|  PREDICTED: vacuolar-processing enzyme-like         519   6e-176   
ref|XP_002308580.1|  asparaginyl endopeptidase family protein           519   8e-176   Populus trichocarpa [western balsam poplar]
ref|XP_010244352.1|  PREDICTED: vacuolar-processing enzyme-like         518   1e-175   
ref|XP_003525979.1|  PREDICTED: vacuolar-processing enzyme-like         518   1e-175   
gb|KHN29737.1|  Vacuolar-processing enzyme                              518   2e-175   
gb|EPS65165.1|  vacuolar processing enzyme-1b                           518   2e-175   
ref|XP_006412409.1|  hypothetical protein EUTSA_v10025034mg             517   4e-175   
ref|XP_006578073.1|  PREDICTED: vacuolar-processing enzyme-like         516   8e-175   
dbj|BAC86022.1|  unnamed protein product                                516   1e-174   
ref|XP_007160985.1|  hypothetical protein PHAVU_001G033500g             516   1e-174   
dbj|BAJ33795.1|  unnamed protein product                                515   2e-174   
ref|XP_004501477.1|  PREDICTED: vacuolar-processing enzyme-like         515   3e-174   
gb|EYU20379.1|  hypothetical protein MIMGU_mgv1a005412mg                515   3e-174   
ref|XP_007136809.1|  hypothetical protein PHAVU_009G076100g             515   3e-174   
ref|XP_003603121.1|  Vacuolar processing enzyme                         515   3e-174   
ref|XP_006355320.1|  PREDICTED: vacuolar-processing enzyme              514   4e-174   
sp|O24325.1|VPE1_PHAVU  RecName: Full=Vacuolar-processing enzyme;...    514   5e-174   Phaseolus vulgaris [French bean]
gb|EMT00724.1|  Vacuolar-processing enzyme                              514   5e-174   
ref|XP_006408834.1|  hypothetical protein EUTSA_v10001970mg             513   1e-173   
ref|XP_004245113.1|  PREDICTED: vacuolar-processing enzyme-like         513   2e-173   
gb|AEO79971.1|  vacuolar processing enzyme                              513   2e-173   
emb|CDY11506.1|  BnaA09g40720D                                          513   3e-173   
ref|XP_002880728.1|  alpha-vacuolar processing enzyme                   512   4e-173   
gb|ACC68680.1|  vacoular processing enzyme 1                            511   6e-173   Solanum tuberosum [potatoes]
emb|CDP09909.1|  unnamed protein product                                512   7e-173   
gb|EPS59704.1|  hypothetical protein M569_15100                         509   8e-173   
ref|XP_010429610.1|  PREDICTED: vacuolar-processing enzyme alpha-...    511   9e-173   
ref|XP_009117035.1|  PREDICTED: vacuolar-processing enzyme alpha-...    511   1e-172   
ref|XP_010417372.1|  PREDICTED: vacuolar-processing enzyme alpha-...    511   1e-172   
ref|XP_004253098.1|  PREDICTED: vacuolar-processing enzyme              510   2e-172   
dbj|BAC54829.1|  vacuolar processing enzyme-2                           509   3e-172   Nicotiana tabacum [American tobacco]
ref|XP_004968980.1|  PREDICTED: vacuolar-processing enzyme-like         509   4e-172   
ref|XP_001759301.1|  predicted protein                                  509   6e-172   
ref|XP_006342509.1|  PREDICTED: vacuolar-processing enzyme-like         509   6e-172   
ref|XP_009410798.1|  PREDICTED: vacuolar-processing enzyme              509   8e-172   
ref|XP_009607675.1|  PREDICTED: vacuolar-processing enzyme-like         508   9e-172   
emb|CAH56498.1|  cysteine protease                                      508   1e-171   Solanum lycopersicum
ref|XP_010669169.1|  PREDICTED: vacuolar-processing enzyme-like         508   1e-171   
ref|XP_010669172.1|  PREDICTED: vacuolar-processing enzyme-like         508   2e-171   
ref|XP_010097094.1|  Vacuolar-processing enzyme                         507   2e-171   
ref|XP_010472621.1|  PREDICTED: vacuolar-processing enzyme alpha-...    507   5e-171   
emb|CDX76736.1|  BnaC08g33220D                                          506   6e-171   
ref|XP_004159537.1|  PREDICTED: vacuolar-processing enzyme-like         506   1e-170   
gb|KFK32531.1|  hypothetical protein AALP_AA6G255400                    506   1e-170   
gb|EMT10444.1|  Vacuolar-processing enzyme                              507   1e-170   
ref|XP_004142919.1|  PREDICTED: vacuolar-processing enzyme-like         506   1e-170   
ref|XP_006285517.1|  hypothetical protein CARUB_v10006959mg             504   3e-170   
ref|XP_008444493.1|  PREDICTED: vacuolar-processing enzyme-like         505   3e-170   
gb|ACB30368.1|  vascular processing enzyme-3                            504   3e-170   Capsicum annuum
ref|XP_002993765.1|  hypothetical protein SELMODRAFT_137569             502   5e-170   
sp|P49044.1|VPE_VICSA  RecName: Full=Vacuolar-processing enzyme; ...    504   6e-170   Vicia sativa [spring vetch]
emb|CDX75302.1|  BnaA01g04000D                                          504   8e-170   
ref|XP_009125229.1|  PREDICTED: vacuolar-processing enzyme gamma-...    503   1e-169   
ref|XP_001769381.1|  predicted protein                                  501   3e-169   
ref|XP_008220440.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    503   3e-169   
ref|XP_009780274.1|  PREDICTED: vacuolar-processing enzyme-like         502   3e-169   
emb|CDX68923.1|  BnaC01g05300D                                          501   5e-169   
ref|XP_009616632.1|  PREDICTED: vacuolar-processing enzyme-like         501   7e-169   
ref|XP_006450795.1|  hypothetical protein CICLE_v10008097mg             500   3e-168   
gb|KFK29905.1|  hypothetical protein AALP_AA7G193600                    500   3e-168   
ref|NP_180165.1|  alpha-vacuolar processing enzyme                      498   7e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429611.1|  PREDICTED: vacuolar-processing enzyme alpha-...    498   9e-168   
ref|NP_195020.1|  vacuolar-processing enzyme gamma                      498   2e-167   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA18924.1|  gamma-VPE                                              497   3e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011081710.1|  PREDICTED: vacuolar-processing enzyme              497   3e-167   
ref|XP_002987841.1|  hypothetical protein SELMODRAFT_126781             495   5e-167   
ref|XP_004498922.1|  PREDICTED: vacuolar-processing enzyme-like         497   5e-167   
emb|CBX26637.1|  vacuolar processing enzyme 2a                          493   8e-167   
emb|CAQ00100.1|  legumain                                               495   9e-167   Hordeum vulgare subsp. vulgare [barley]
gb|AAD04882.1|  C13 endopeptidase NP1 precursor                         492   2e-166   Hordeum vulgare [barley]
ref|XP_002867219.1|  GAMMA-VPE                                          495   2e-166   
gb|AES90965.2|  vacuolar processing enzyme                              489   5e-166   
gb|EMT14075.1|  Vacuolar-processing enzyme beta-isozyme                 491   6e-166   
ref|XP_003608768.1|  Vacuolar-processing enzyme                         489   7e-166   
ref|NP_001275777.1|  vacuolar-processing enzyme precursor               494   8e-166   
gb|KEH39941.1|  vacuolar processing enzyme                              493   2e-165   
gb|KHG17266.1|  Vacuolar-processing enzyme                              491   3e-165   
gb|ACJ84443.1|  unknown                                                 491   1e-164   Medicago truncatula
ref|XP_001755207.1|  predicted protein                                  488   4e-164   
gb|AIB06797.1|  cte peptide ligase                                      487   3e-163   
gb|EMT07410.1|  Vacuolar-processing enzyme beta-isozyme                 485   3e-163   
gb|EMT06055.1|  Vacuolar-processing enzyme                              483   2e-161   
gb|EMS65516.1|  Vacuolar-processing enzyme                              481   2e-161   
gb|EMT06287.1|  Vacuolar-processing enzyme                              478   1e-160   
gb|EMS54452.1|  Vacuolar-processing enzyme                              477   3e-160   
gb|EMT17626.1|  Vacuolar-processing enzyme                              484   4e-160   
gb|EMT02419.1|  Vacuolar-processing enzyme                              479   1e-159   
ref|XP_002441635.1|  hypothetical protein SORBIDRAFT_09g030710          476   2e-159   Sorghum bicolor [broomcorn]
ref|XP_001784456.1|  predicted protein                                  474   2e-158   
ref|XP_008654306.1|  PREDICTED: uncharacterized protein LOC100192...    472   1e-157   
ref|XP_010669196.1|  PREDICTED: vacuolar-processing enzyme gamma-...    468   3e-156   
ref|XP_006371860.1|  hypothetical protein POPTR_0018s04650g             467   2e-155   
ref|XP_010669185.1|  PREDICTED: vacuolar-processing enzyme gamma-...    461   3e-153   
emb|CAB42655.1|  putative preprolegumain                                457   5e-153   Vicia narbonensis
ref|XP_009396761.1|  PREDICTED: vacuolar-processing enzyme-like         457   3e-152   
gb|KCW81643.1|  hypothetical protein EUGRSUZ_C03004                     456   5e-152   
ref|NP_001056504.1|  Os05g0593900                                       455   5e-151   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001131347.1|  uncharacterized protein LOC100192667 precursor     456   5e-151   Zea mays [maize]
gb|AFK40405.1|  unknown                                                 447   2e-149   
ref|XP_008240642.1|  PREDICTED: vacuolar-processing enzyme-like         448   1e-148   
ref|XP_007202848.1|  hypothetical protein PRUPE_ppa014701mg             446   9e-148   
gb|KDO48392.1|  hypothetical protein CISIN_1g016176mg                   440   1e-147   
ref|NP_001275272.1|  vacoular processing enzyme 2 precursor             445   4e-147   
ref|XP_011019533.1|  PREDICTED: vacuolar-processing enzyme isofor...    442   6e-147   
ref|XP_008392598.1|  PREDICTED: vacuolar-processing enzyme-like         442   5e-146   
ref|XP_006654878.1|  PREDICTED: vacuolar-processing enzyme-like         442   6e-146   
ref|XP_007023637.1|  Delta vacuolar processing enzyme, putative         443   1e-145   
ref|XP_006355332.1|  PREDICTED: vacuolar-processing enzyme-like         439   9e-145   
ref|XP_006450041.1|  hypothetical protein CICLE_v10013934mg             438   2e-144   
gb|KDO80009.1|  hypothetical protein CISIN_1g011066mg                   437   3e-144   
ref|XP_002310920.1|  hypothetical protein POPTR_0008s00410g             438   3e-144   
ref|XP_003589032.1|  Vacuolar-processing enzyme                         437   3e-144   
ref|XP_003622265.1|  Vacuolar processing enzyme-1b                      437   4e-144   
ref|XP_011033074.1|  PREDICTED: vacuolar-processing enzyme alpha-...    437   8e-144   
ref|XP_009371107.1|  PREDICTED: vacuolar-processing enzyme-like         436   1e-143   
ref|XP_008370166.1|  PREDICTED: vacuolar-processing enzyme-like         435   3e-143   
ref|XP_009344982.1|  PREDICTED: vacuolar-processing enzyme-like         435   3e-143   
ref|XP_008337583.1|  PREDICTED: vacuolar-processing enzyme-like         435   3e-143   
ref|XP_008337582.1|  PREDICTED: vacuolar-processing enzyme-like         434   4e-143   
ref|XP_009371106.1|  PREDICTED: vacuolar-processing enzyme-like         434   4e-143   
ref|XP_009371110.1|  PREDICTED: vacuolar-processing enzyme-like         434   8e-143   
ref|XP_008337584.1|  PREDICTED: vacuolar-processing enzyme-like         433   1e-142   
ref|XP_004303795.1|  PREDICTED: vacuolar-processing enzyme-like         433   1e-142   
ref|XP_008228013.1|  PREDICTED: vacuolar-processing enzyme-like         432   5e-142   
ref|XP_010034095.1|  PREDICTED: vacuolar-processing enzyme-like         431   1e-141   
ref|XP_007216154.1|  hypothetical protein PRUPE_ppa015210mg             431   1e-141   
ref|XP_006599066.1|  PREDICTED: vacuolar-processing enzyme-like         431   2e-141   
gb|KHN27584.1|  Vacuolar-processing enzyme                              431   2e-141   
ref|XP_010112450.1|  Vacuolar-processing enzyme                         430   3e-141   
ref|XP_008367906.1|  PREDICTED: vacuolar-processing enzyme-like         428   1e-140   
ref|XP_003608767.1|  Vacuolar-processing enzyme                         420   7e-140   
ref|XP_009783281.1|  PREDICTED: vacuolar-processing enzyme-like         426   1e-139   
ref|XP_006355318.1|  PREDICTED: vacuolar-processing enzyme-like         424   5e-139   
ref|XP_004305798.1|  PREDICTED: vacuolar-processing enzyme-like         422   1e-138   
ref|XP_008361289.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    422   2e-138   
ref|XP_006355333.1|  PREDICTED: vacuolar-processing enzyme-like         421   5e-138   
ref|XP_009764212.1|  PREDICTED: vacuolar-processing enzyme-like         421   6e-138   
ref|XP_006450794.1|  hypothetical protein CICLE_v10008097mg             418   1e-137   
ref|XP_008352319.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    420   1e-137   
ref|XP_004245377.1|  PREDICTED: vacuolar-processing enzyme-like         420   2e-137   
gb|KCW53993.1|  hypothetical protein EUGRSUZ_J03190                     420   2e-137   
ref|XP_010034096.1|  PREDICTED: vacuolar-processing enzyme-like         420   2e-137   
ref|XP_002266627.1|  PREDICTED: vacuolar-processing enzyme              420   3e-137   
ref|XP_010112451.1|  Vacuolar-processing enzyme                         434   4e-137   
ref|XP_010669190.1|  PREDICTED: vacuolar-processing enzyme-like         419   5e-137   
ref|XP_009621616.1|  PREDICTED: vacuolar-processing enzyme gamma-...    417   1e-136   
ref|XP_004245119.1|  PREDICTED: vacuolar-processing enzyme-like         417   2e-136   
ref|XP_010034097.1|  PREDICTED: vacuolar-processing enzyme alpha-...    418   3e-136   
ref|XP_010545489.1|  PREDICTED: vacuolar-processing enzyme gamma-...    416   8e-136   
gb|KHG20621.1|  Vacuolar-processing enzyme                              414   4e-135   
ref|XP_009379206.1|  PREDICTED: vacuolar-processing enzyme-like         412   2e-134   
ref|XP_010508646.1|  PREDICTED: vacuolar-processing enzyme-like i...    412   3e-134   
ref|XP_008380412.1|  PREDICTED: vacuolar-processing enzyme              411   7e-134   
ref|XP_010545490.1|  PREDICTED: vacuolar-processing enzyme alpha-...    413   2e-133   
ref|XP_006355331.1|  PREDICTED: vacuolar-processing enzyme-like         409   3e-133   
tpg|DAA36671.1|  TPA: hypothetical protein ZEAMMB73_569687              403   3e-133   
ref|XP_009616671.1|  PREDICTED: vacuolar-processing enzyme-like         409   8e-133   
ref|XP_010034886.1|  PREDICTED: vacuolar-processing enzyme-like         413   3e-132   
ref|XP_006355317.1|  PREDICTED: vacuolar-processing enzyme-like         405   6e-132   
ref|XP_004245120.1|  PREDICTED: vacuolar-processing enzyme gamma-...    405   7e-132   
ref|XP_010325045.1|  PREDICTED: vacuolar-processing enzyme-like         405   1e-131   
ref|XP_010487991.1|  PREDICTED: vacuolar-processing enzyme gamma-...    404   3e-131   
gb|EYU21190.1|  hypothetical protein MIMGU_mgv1a005661mg                404   3e-131   
ref|XP_010508655.1|  PREDICTED: vacuolar-processing enzyme alpha-...    408   6e-131   
emb|CAB51545.1|  vacuolar processing enzyme                             402   9e-131   
ref|XP_006450035.1|  hypothetical protein CICLE_v10013957mg             400   8e-130   
ref|XP_006355330.1|  PREDICTED: vacuolar-processing enzyme-like         399   2e-129   
ref|XP_002883236.1|  DELTA-VPE                                          399   3e-129   
ref|XP_010325261.1|  PREDICTED: vacuolar-processing enzyme-like         398   1e-128   
ref|XP_004245378.1|  PREDICTED: vacuolar-processing enzyme-like         403   2e-128   
ref|XP_010487992.1|  PREDICTED: vacuolar-processing enzyme alpha-...    400   3e-128   
ref|XP_009794187.1|  PREDICTED: vacuolar-processing enzyme-like         394   8e-128   
ref|XP_010466201.1|  PREDICTED: vacuolar-processing enzyme alpha-...    396   1e-126   
gb|KDO48393.1|  hypothetical protein CISIN_1g016176mg                   384   5e-126   
dbj|BAA90621.1|  putative asparagine-specific endopeptidase precu...    389   1e-125   
ref|XP_004499511.1|  PREDICTED: vacuolar-processing enzyme gamma-...    387   4e-125   
gb|KFK39346.1|  vacuolar processing enzyme                              387   8e-125   
gb|KCW53991.1|  hypothetical protein EUGRSUZ_J03188                     386   1e-124   
ref|XP_009111229.1|  PREDICTED: vacuolar-processing enzyme-like         386   2e-124   
ref|XP_006296792.1|  hypothetical protein CARUB_v10016221mg             384   2e-123   
gb|KDO80010.1|  hypothetical protein CISIN_1g011066mg                   380   2e-123   
ref|XP_009145662.1|  PREDICTED: vacuolar-processing enzyme              384   3e-123   
ref|XP_006406410.1|  hypothetical protein EUTSA_v10020662mg             383   3e-123   
dbj|BAJ89125.1|  predicted protein                                      377   6e-123   
emb|CDY25397.1|  BnaA05g18870D                                          382   6e-123   
gb|ACJ85695.1|  unknown                                                 374   3e-122   
ref|XP_010325264.1|  PREDICTED: vacuolar-processing enzyme-like         383   1e-121   
ref|XP_009762559.1|  PREDICTED: vacuolar-processing enzyme-like         378   1e-121   
ref|NP_188656.1|  delta vacuolar processing enzyme                      379   1e-121   
ref|XP_005846964.1|  hypothetical protein CHLNCDRAFT_24292              379   1e-121   
gb|AAM60827.1|  vacuolar processing enzyme/asparaginyl endopeptid...    379   1e-121   
gb|KCW53994.1|  hypothetical protein EUGRSUZ_J03190                     377   2e-121   
ref|XP_005651789.1|  hypothetical protein COCSUDRAFT_64138              380   2e-121   
ref|XP_004491990.1|  PREDICTED: vacuolar-processing enzyme-like         377   9e-121   
emb|CDY29802.1|  BnaC05g31880D                                          377   1e-120   
gb|KCW53995.1|  hypothetical protein EUGRSUZ_J03190                     374   2e-120   
ref|XP_009616669.1|  PREDICTED: vacuolar-processing enzyme-like         372   3e-119   
emb|CDY42232.1|  BnaA01g25630D                                          375   4e-119   
gb|EMT15482.1|  Vacuolar-processing enzyme                              375   9e-119   
ref|XP_006450793.1|  hypothetical protein CICLE_v10008097mg             368   1e-118   
ref|NP_001189938.1|  delta vacuolar processing enzyme                   375   2e-118   
emb|CAE84598.1|  putative legumain                                      369   3e-118   
ref|XP_004491991.1|  PREDICTED: vacuolar-processing enzyme-like         370   5e-118   
gb|KDO80007.1|  hypothetical protein CISIN_1g011066mg                   367   1e-117   
ref|XP_007216228.1|  hypothetical protein PRUPE_ppa016772mg             364   2e-116   
emb|CDY12724.1|  BnaC04g29170D                                          365   1e-115   
ref|XP_006382030.1|  hypothetical protein POPTR_0006s24900g             358   2e-115   
emb|CAN76990.1|  hypothetical protein VITISV_028106                     362   5e-115   
dbj|BAD94396.1|  beta-VPE                                               355   7e-115   
gb|EAY99261.1|  hypothetical protein OsI_21225                          360   1e-114   
gb|AES80307.2|  vacuolar processing enzyme                              360   4e-114   
ref|XP_006838618.1|  hypothetical protein AMTR_s00002p00230380          353   4e-114   
dbj|BAD51741.1|  vacuolar processing enzyme 1b                          353   6e-114   
dbj|BAD51740.1|  vacuolar processing enzyme 1a                          351   2e-113   
emb|CDY71653.1|  BnaCnng73810D                                          349   6e-113   
gb|AFK44897.1|  unknown                                                 351   2e-112   
gb|ABR17022.1|  unknown                                                 349   5e-112   
ref|XP_003624089.1|  Vacuolar processing enzyme-1a                      355   5e-112   
ref|XP_004499586.1|  PREDICTED: vacuolar-processing enzyme-like         350   2e-110   
ref|XP_004516951.1|  PREDICTED: vacuolar-processing enzyme-like         348   2e-109   
ref|XP_006382031.1|  hypothetical protein POPTR_0006s24900g             341   5e-109   
ref|XP_004499587.1|  PREDICTED: vacuolar-processing enzyme gamma-...    345   3e-108   
gb|AES79969.2|  vacuolar processing enzyme                              343   8e-108   
ref|XP_004491693.1|  PREDICTED: vacuolar-processing enzyme-like         343   1e-107   
gb|KDO80012.1|  hypothetical protein CISIN_1g011066mg                   336   5e-107   
ref|XP_009783032.1|  PREDICTED: vacuolar-processing enzyme-like         334   4e-106   
gb|AIT97058.1|  vacuolar processing enzyme                              333   9e-106   
ref|XP_003623751.1|  Vacuolar processing enzyme-1b                      338   1e-105   
gb|KFM24068.1|  Vacuolar-processing enzyme beta-isozyme                 338   7e-103   
gb|KDO80008.1|  hypothetical protein CISIN_1g011066mg                   318   3e-100   
ref|XP_008367907.1|  PREDICTED: vacuolar-processing enzyme-like         317   5e-100   
ref|XP_004491694.1|  PREDICTED: vacuolar-processing enzyme-like         324   6e-100   
gb|KDO80013.1|  hypothetical protein CISIN_1g011066mg                   314   1e-98    
gb|KDD72820.1|  C13 peptidase                                           310   2e-96    
gb|ACU21276.1|  unknown                                                 305   2e-95    
gb|KHG10620.1|  Vacuolar-processing enzyme                              308   1e-94    
ref|XP_006368681.1|  hypothetical protein POPTR_0001s07710g             297   7e-93    
ref|XP_004491696.1|  PREDICTED: vacuolar-processing enzyme-like         303   3e-92    
ref|XP_006450038.1|  hypothetical protein CICLE_v100139432mg            298   3e-92    
ref|XP_001703162.1|  vacuolar processing enzyme                         303   4e-90    
gb|KHG10619.1|  Vacuolar-processing enzyme                              297   6e-90    
ref|XP_004499640.1|  PREDICTED: vacuolar-processing enzyme-like         294   2e-89    
ref|XP_004082135.1|  PREDICTED: legumain-like                           285   8e-86    
gb|EAY99324.1|  hypothetical protein OsI_21293                          277   7e-85    
gb|EPS60990.1|  vacuolar processing enzyme a                            277   8e-85    
gb|EJY80671.1|  Hemoglobinase-type cysteine proteinase                  281   4e-84    
gb|ACO55745.1|  legumain                                                280   9e-84    
ref|XP_006822143.1|  PREDICTED: LOW QUALITY PROTEIN: legumain-like      280   1e-83    
ref|XP_004517111.1|  PREDICTED: vacuolar-processing enzyme-like         276   3e-83    
gb|AAS94231.1|  legumain-like protease precursor                        278   4e-83    
ref|XP_003746513.1|  PREDICTED: legumain-like                           276   3e-82    
ref|XP_004635214.1|  PREDICTED: legumain                                275   4e-82    
dbj|BAF51711.1|  tick legumain                                          275   5e-82    
ref|XP_005339200.1|  PREDICTED: legumain                                274   1e-81    
gb|KFO95700.1|  Legumain                                                273   2e-81    
ref|XP_008490697.1|  PREDICTED: legumain                                273   2e-81    
emb|CDW88179.1|  peptidase c13 family protein                           275   7e-81    
ref|XP_010607523.1|  PREDICTED: legumain                                272   1e-80    
dbj|BAJ97485.1|  predicted protein                                      271   3e-80    
ref|XP_005390389.1|  PREDICTED: legumain                                270   8e-80    
emb|CDW79224.1|  peptidase c13 family protein                           270   9e-80    
ref|XP_008864865.1|  hypothetical protein H310_02944                    270   1e-79    
ref|NP_001005720.1|  legumain precursor                                 269   1e-79    
gb|KFU94233.1|  Legumain                                                269   1e-79    
ref|XP_010002025.1|  PREDICTED: legumain                                269   1e-79    
ref|XP_010083272.1|  PREDICTED: legumain                                268   2e-79    
ref|XP_003462699.1|  PREDICTED: legumain                                268   2e-79    
gb|KFV16582.1|  Legumain                                                268   2e-79    
gb|KFP52812.1|  Legumain                                                268   4e-79    
ref|XP_004681662.1|  PREDICTED: legumain                                268   4e-79    
ref|XP_005149570.1|  PREDICTED: legumain                                267   5e-79    
ref|XP_005021504.1|  PREDICTED: legumain                                267   5e-79    
ref|XP_004584387.1|  PREDICTED: legumain                                267   5e-79    
ref|XP_009928897.1|  PREDICTED: legumain                                267   5e-79    
gb|ACF35524.1|  putative legumain-like protease precursor               268   5e-79    
gb|KFQ56909.1|  Legumain                                                267   6e-79    
ref|XP_010020757.1|  PREDICTED: legumain                                267   8e-79    
ref|XP_004885825.1|  PREDICTED: legumain isoform X2                     267   8e-79    
gb|KFQ29398.1|  Legumain                                                266   9e-79    
gb|KFW89187.1|  Legumain                                                266   9e-79    
ref|XP_003756190.1|  PREDICTED: legumain                                266   9e-79    
ref|XP_009499577.1|  PREDICTED: legumain                                266   9e-79    
ref|XP_008938241.1|  PREDICTED: legumain                                266   1e-78    
ref|XP_421328.1|  PREDICTED: legumain isoform X3                        266   1e-78    
gb|KFW04862.1|  Legumain                                                266   1e-78    
gb|KFQ72646.1|  Legumain                                                266   1e-78    
ref|NP_999924.1|  legumain precursor                                    266   1e-78    
ref|XP_010282975.1|  PREDICTED: legumain                                266   1e-78    
ref|XP_009576001.1|  PREDICTED: legumain                                266   1e-78    
gb|KFW72980.1|  Legumain                                                266   1e-78    
gb|KFO87181.1|  Legumain                                                266   2e-78    
ref|XP_009330638.1|  PREDICTED: legumain                                266   2e-78    
gb|KGL86051.1|  Legumain                                                266   2e-78    
ref|XP_009893669.1|  PREDICTED: legumain                                266   2e-78    
ref|XP_010130294.1|  PREDICTED: legumain                                266   2e-78    
ref|XP_004491989.1|  PREDICTED: vacuolar-processing enzyme-like         261   2e-78    
gb|KFQ92133.1|  Legumain                                                266   2e-78    
ref|XP_004540898.1|  PREDICTED: legumain-like                           266   2e-78    
ref|XP_008071136.1|  PREDICTED: legumain                                266   2e-78    
gb|KFV15585.1|  Legumain                                                265   2e-78    
ref|XP_003445512.1|  PREDICTED: legumain-like                           266   2e-78    
ref|XP_009474163.1|  PREDICTED: legumain                                265   2e-78    
ref|XP_009981958.1|  PREDICTED: legumain                                265   3e-78    
gb|KFP33305.1|  Legumain                                                265   3e-78    
ref|XP_009011832.1|  hypothetical protein HELRODRAFT_185311             266   3e-78    
ref|XP_010710146.1|  PREDICTED: legumain                                265   3e-78    
gb|ABM88796.1|  asparaginyl endopeptidase                               265   3e-78    
ref|XP_004885824.1|  PREDICTED: legumain isoform X1                     266   3e-78    
ref|XP_008158153.1|  PREDICTED: legumain                                265   3e-78    
ref|XP_010204068.1|  PREDICTED: legumain                                265   3e-78    
gb|KFQ10712.1|  Legumain                                                265   4e-78    
ref|XP_009948847.1|  PREDICTED: legumain                                265   4e-78    
gb|KFM08581.1|  Legumain                                                265   5e-78    
ref|XP_010392656.1|  PREDICTED: legumain                                265   6e-78    
ref|XP_009279064.1|  PREDICTED: legumain                                265   6e-78    
gb|KFO56104.1|  Legumain                                                264   6e-78    
ref|XP_008627939.1|  PREDICTED: legumain                                264   7e-78    
gb|KFP11255.1|  Legumain                                                264   7e-78    
gb|KFP63184.1|  Legumain                                                264   8e-78    
ref|XP_009647266.1|  PREDICTED: legumain                                264   8e-78    
gb|KFR12503.1|  Legumain                                                264   9e-78    
ref|XP_007472623.1|  PREDICTED: legumain                                264   9e-78    
ref|XP_008819942.1|  PREDICTED: legumain                                264   9e-78    
ref|XP_009694735.1|  PREDICTED: legumain                                264   9e-78    
gb|AGU41795.1|  legumain-like protein                                   265   1e-77    
ref|XP_009935106.1|  PREDICTED: legumain                                264   1e-77    
ref|XP_005814710.1|  PREDICTED: legumain-like                           264   1e-77    
gb|KFV74867.1|  Legumain                                                263   1e-77    
gb|KFV73105.1|  Legumain                                                263   1e-77    
gb|KFW76022.1|  Legumain                                                263   1e-77    



>ref|XP_009592399.1| PREDICTED: vacuolar-processing enzyme [Nicotiana tomentosiformis]
Length=494

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/461 (77%), Positives = 396/461 (86%), Gaps = 5/461 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WDPLIR PVD +DDES + +  G RWAVLVAGSNGY NYRHQADVCHAYQILKRGGLKDE
Sbjct  39    WDPLIRSPVD-RDDESEDKD--GVRWAVLVAGSNGYGNYRHQADVCHAYQILKRGGLKDE  95

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA +  NPR GVIINHPNG+DVYAGVPKDYTG+ VTAANLYAVLLGDK  V
Sbjct  96    NIVVFMYDDIAKSELNPRPGVIINHPNGSDVYAGVPKDYTGEHVTAANLYAVLLGDKSAV  155

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGK+VDSK +DRIF+YY+DHGGPGVLGMPN+P LYA DFIEVLKKKH+AGTYK+MV+
Sbjct  156   KGGSGKIVDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAKDFIEVLKKKHAAGTYKEMVL  215

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             Y+EACESGS FEGMMPEDLNIYVTTASNAEESSWGTYCPG +P PPPEYITCLGDLYSVA
Sbjct  216   YIEACESGSVFEGMMPEDLNIYVTTASNAEESSWGTYCPGMDPPPPPEYITCLGDLYSVA  275

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSESHNL +ETI++QYE VK RTSN+N++ AGSHVMEYGS++ IKPEKVYLYQGFDP
Sbjct  276   WMEDSESHNLKKETIKQQYEKVKERTSNFNNYNAGSHVMEYGSKE-IKPEKVYLYQGFDP  334

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             AT NLP N+I       VVNQRDADLLF+WERYK   DN++ KAKL KEITDTMLHR+ L
Sbjct  335   ATANLPANKI-AFAHVEVVNQRDADLLFLWERYKKLADNSLEKAKLRKEITDTMLHRKHL  393

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S+D +GV LFGP  GS++L SVR+PGL LVDDW CLKS VR+FE HCGSL QYGMKHM
Sbjct  394   DGSVDAIGVFLFGPTKGSSVLNSVREPGLPLVDDWDCLKSTVRLFELHCGSLTQYGMKHM  453

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             RAFANICN+ +S  AMEEA    C+E K  +YT  ++ +SA
Sbjct  454   RAFANICNNGVSRDAMEEAFMAACNERKIEEYTAANRGFSA  494



>emb|CAB42651.2| putative preprolegumain [Nicotiana tabacum]
Length=494

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/461 (77%), Positives = 395/461 (86%), Gaps = 5/461 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WDPLIR PVD +DDES + +  G RWAVLVAGSNGY NYRHQADVCHAYQILKRGGLKDE
Sbjct  39    WDPLIRSPVD-RDDESEDKD--GVRWAVLVAGSNGYGNYRHQADVCHAYQILKRGGLKDE  95

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA +  NPR GVIINHPNG+DVYAGVPKDYTG+ VTAANLYAVLLGDK  V
Sbjct  96    NIVVFMYDDIAKSELNPRPGVIINHPNGSDVYAGVPKDYTGEHVTAANLYAVLLGDKSAV  155

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGK+VDSK +DRIF+YY+DHGGPGVLGMPN+P LYA DFIEVLKKKH+AGTYK+MV+
Sbjct  156   KGGSGKIVDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAKDFIEVLKKKHAAGTYKEMVL  215

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             Y+EACESGS FEGMMPEDLNIYVTTASNAEESSWGTYCPG +P PPPEYITCLGDLYSVA
Sbjct  216   YIEACESGSVFEGMMPEDLNIYVTTASNAEESSWGTYCPGMDPPPPPEYITCLGDLYSVA  275

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSESHNL +ETI++QYE VK RTSN+N++ AGSHVMEYGS++ IKPEKVYLYQGFDP
Sbjct  276   WMEDSESHNLKKETIKQQYEKVKERTSNFNNYNAGSHVMEYGSKE-IKPEKVYLYQGFDP  334

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             AT NL  N+I       VVNQRDADLLF+WERYK   DN++ KAKL KEITDTMLHR+ L
Sbjct  335   ATANLSANKI-AFAHVEVVNQRDADLLFLWERYKELADNSLEKAKLRKEITDTMLHRKHL  393

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S+D +GV LFGP  GS++L SVR+PGL LVDDW CLKS VR+FE HCGSL QYGMKHM
Sbjct  394   DGSVDAIGVFLFGPTKGSSVLNSVREPGLPLVDDWDCLKSTVRLFELHCGSLTQYGMKHM  453

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             RAFANICN+ +S  AMEEA    C+E K  +YT  ++ +SA
Sbjct  454   RAFANICNNGVSRDAMEEAFMAACNERKREEYTAANRGFSA  494



>ref|XP_009771365.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Nicotiana 
sylvestris]
Length=493

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/461 (77%), Positives = 393/461 (85%), Gaps = 5/461 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WDPLIR PVD +DDE  +  +   RWAVLVAGSNGY NYRHQADVCHAYQILKRGGLKDE
Sbjct  38    WDPLIRSPVD-RDDEVED--SNSVRWAVLVAGSNGYGNYRHQADVCHAYQILKRGGLKDE  94

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA +  NPR GVIINHPNG+DVYAGVPKDYTG+ VTAANLYAVLLGDK  V
Sbjct  95    NIVVFMYDDIAKSELNPRPGVIINHPNGSDVYAGVPKDYTGEHVTAANLYAVLLGDKSAV  154

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKVVDSK +DRIF+YY+DHGGPGVLGMPN+P LYA DFIEVLKKKH+AGTYK+MV+
Sbjct  155   KGGSGKVVDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAKDFIEVLKKKHAAGTYKEMVL  214

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             Y+EACESGS FEGMMPEDLNIYVTTASNA+ESSWGTYCPG +P PPPEYITCLGDLYSVA
Sbjct  215   YIEACESGSVFEGMMPEDLNIYVTTASNADESSWGTYCPGMDPPPPPEYITCLGDLYSVA  274

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSESHNL +ETI++QYE VK RTSN+N++ AGSHVMEYGS++ IKPEKVYLYQGFDP
Sbjct  275   WMEDSESHNLKKETIKQQYEKVKERTSNFNNYNAGSHVMEYGSKE-IKPEKVYLYQGFDP  333

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             AT NLP N+I       VVNQRDADLLF+WERYK   DN++ KAKL KEITDTMLHRQ L
Sbjct  334   ATANLPANKI-DFAHLEVVNQRDADLLFLWERYKKLADNSLEKAKLRKEITDTMLHRQHL  392

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S+D +GV LFGP  GS++L SVRKPGL LVDDW CLKS VR+FE HCGSL QYGMKHM
Sbjct  393   DGSVDAIGVFLFGPTEGSSVLNSVRKPGLPLVDDWDCLKSTVRLFELHCGSLTQYGMKHM  452

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             RAFANICN+ +S  AMEEA    C+E K  +YT   + +SA
Sbjct  453   RAFANICNNGVSRDAMEEAFMAACNEHKIEEYTAADRGFSA  493



>ref|XP_004245733.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Solanum lycopersicum]
Length=498

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/463 (74%), Positives = 388/463 (84%), Gaps = 6/463 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WDPLIR PVD+ DD+  E    G RWAVLVAGSNGY NYRHQADVCHAYQILKRGGL DE
Sbjct  40    WDPLIRSPVDRDDDDETEEGGGGVRWAVLVAGSNGYGNYRHQADVCHAYQILKRGGLNDE  99

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA +  NPR GVIINHPNG+DVYAGVPKDYTG+ VTAANLYAVLLGDK  V
Sbjct  100   NIVVFMYDDIAKSELNPRPGVIINHPNGSDVYAGVPKDYTGEHVTAANLYAVLLGDKSAV  159

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKVV+S  +DRIF+YY+DHGGPGVLGMPN+P+LY  D IEVLKKK++A TYK+MV+
Sbjct  160   KGGSGKVVNSGPNDRIFLYYSDHGGPGVLGMPNMPYLYGKDLIEVLKKKYAARTYKEMVL  219

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             Y+EACESGS FEG+MPE+LNIYV TASNAEESSWGTYCPG +P PP EYITCLGDLYSVA
Sbjct  220   YIEACESGSVFEGLMPENLNIYVMTASNAEESSWGTYCPGMDPPPPSEYITCLGDLYSVA  279

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSESHNL +ETI++QYE VK RTSN N++ AGSHVMEYGS++ IKPEKVYLYQGFDP
Sbjct  280   WMEDSESHNLKKETIKQQYEKVKERTSNSNNYNAGSHVMEYGSKE-IKPEKVYLYQGFDP  338

Query  664   ATINLPGNQI--RRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             AT+NLP N+I   RL    VVNQRDADLLF+WERYK   DN++ KAKL KEIT+TMLHRQ
Sbjct  339   ATVNLPANKIDFARLE---VVNQRDADLLFLWERYKKLEDNSLEKAKLRKEITETMLHRQ  395

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              LD SID +GV LFGP  G ++L SVRKPGL LVDDW+CLKS VR+FE HCGSL QYGMK
Sbjct  396   HLDGSIDAVGVFLFGPIKGGSVLSSVRKPGLPLVDDWECLKSTVRLFEAHCGSLTQYGMK  455

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             HMRAFANICN+ IS  AME+A    C+     +YT  ++ +SA
Sbjct  456   HMRAFANICNNGISSDAMEDAFMAACNGHSLEEYTTANRGFSA  498



>ref|XP_006355496.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Solanum 
tuberosum]
Length=494

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/463 (75%), Positives = 392/463 (85%), Gaps = 8/463 (2%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WDPLIR PVD+ DDE  E +  G RWAVLVAGSNGY NYRHQADVCHAYQILKRGGLKDE
Sbjct  38    WDPLIRSPVDRDDDEM-EEDGGGVRWAVLVAGSNGYGNYRHQADVCHAYQILKRGGLKDE  96

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA +  NPR GVIINHPNG+DVYAGVPKDYTG+ VTAANLYAVLLGDK  V
Sbjct  97    NIVVFMYDDIAKSELNPRPGVIINHPNGSDVYAGVPKDYTGEHVTAANLYAVLLGDKSAV  156

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKVV+S  +DRIF+YY+DHGGPGVLGMPN+P+LY  D IEVLKKK++AGTYK+MV+
Sbjct  157   KGGSGKVVNSGPNDRIFLYYSDHGGPGVLGMPNMPYLYGKDLIEVLKKKYAAGTYKEMVL  216

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             Y+EACESGS FEG+MPE+LNIYVTTASNAEESSWGTYCPG +P PP EYITCLGDLYSVA
Sbjct  217   YIEACESGSVFEGLMPENLNIYVTTASNAEESSWGTYCPGMDPPPPSEYITCLGDLYSVA  276

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSESHNL +ETI++QYE VK RTSN N++ AGSHVMEYGS++ IKPEKVYLYQGFDP
Sbjct  277   WMEDSESHNLKKETIKQQYEKVKERTSNSNNYNAGSHVMEYGSKE-IKPEKVYLYQGFDP  335

Query  664   ATINLPGNQI--RRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             AT+NLP N+I   RL    VVNQRDADLLF+WERYK   DN++ KAKL KEIT+T+ HRQ
Sbjct  336   ATVNLPANKIDFARLE---VVNQRDADLLFLWERYKKLEDNSLEKAKLRKEITETLQHRQ  392

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              LD SID +GV LFGP  G ++L SVRKPGL LVDDW+CLKS VR+FE HCGSL QYGMK
Sbjct  393   HLDGSIDAVGVFLFGPIKGGSVLSSVRKPGLPLVDDWECLKSTVRLFEAHCGSLAQYGMK  452

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             HMRAFANICN+ IS  AMEEA    C+   T +Y+  ++ +SA
Sbjct  453   HMRAFANICNNGISRDAMEEAFMAACNG-HTEEYSAANRGFSA  494



>ref|XP_011069632.1| PREDICTED: vacuolar-processing enzyme [Sesamum indicum]
 gb|AAF89679.1| asparaginyl endopeptidase [Sesamum indicum]
Length=489

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/465 (72%), Positives = 382/465 (82%), Gaps = 6/465 (1%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGG  1397
             ++  WDP+IR P+D++     E E   TRWAVLVAGSNG+ NYRHQADVCHAYQILK+GG
Sbjct  31    RSGPWDPIIRWPLDRR-----ETEDNATRWAVLVAGSNGFGNYRHQADVCHAYQILKKGG  85

Query  1396  LKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgd  1217
             L+DENI+VFMYDDIA N  NPRKGVIINHP G DVYAGVPKDYTG+QVTA NLYAV+LGD
Sbjct  86    LRDENIIVFMYDDIAMNELNPRKGVIINHPTGGDVYAGVPKDYTGEQVTAENLYAVILGD  145

Query  1216  kegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYK  1037
             K  +KGGSGKVVDSK +DRIFIYY+DHGGPGVLGMPN+P+LYANDFIEVLKKKH++GTYK
Sbjct  146   KSAIKGGSGKVVDSKPNDRIFIYYSDHGGPGVLGMPNMPYLYANDFIEVLKKKHASGTYK  205

Query  1036  DMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDL  857
             +MVIYVEACESGS FEG+MP+DL+IYVTTASNAEESSWGTYCPG +P PPPEYITCLGDL
Sbjct  206   EMVIYVEACESGSVFEGLMPDDLDIYVTTASNAEESSWGTYCPGMDPPPPPEYITCLGDL  265

Query  856   YSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQ  677
             YSVAWMEDSESHNL  ET+E+QY+ VK RTSN+N + AGSHVMEYG++  IK EK+YLYQ
Sbjct  266   YSVAWMEDSESHNLKRETVEQQYQQVKERTSNFNTYNAGSHVMEYGNKS-IKSEKLYLYQ  324

Query  676   GFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             GFDPAT N+P ++        VVNQRDADLLF+WERYK     A  K++L K ITDTMLH
Sbjct  325   GFDPATENMPPSENHLKPHMDVVNQRDADLLFLWERYKRLDGGAKKKSELFKLITDTMLH  384

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R+ +D SID +G  LFGPENG +ILKSVR  GL L DDW CLKSMVR+FE HCGSL QYG
Sbjct  385   RKHMDDSIDIIGAFLFGPENGPSILKSVRDRGLPLADDWDCLKSMVRLFEAHCGSLTQYG  444

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MKH RAFANICNS +S A ME+AC   C       ++  ++ YSA
Sbjct  445   MKHTRAFANICNSRVSSADMEDACMAACRGHDFAGWSPLNRGYSA  489



>gb|EYU24761.1| hypothetical protein MIMGU_mgv1a005235mg [Erythranthe guttata]
Length=492

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/461 (72%), Positives = 376/461 (82%), Gaps = 5/461 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WDP+IR P D    E    E  GTRWAVLVAGSNG+ NYRHQADVCHAYQILK+GG+KDE
Sbjct  37    WDPIIRWPSDHPQKE----EEDGTRWAVLVAGSNGFGNYRHQADVCHAYQILKKGGVKDE  92

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NI+VFMYDDIA N  NPRKGV+INHPNG DVYAGVPKDYTG+QVTA N YAV+LGDK  +
Sbjct  93    NIIVFMYDDIAMNDLNPRKGVLINHPNGEDVYAGVPKDYTGEQVTAENFYAVILGDKSAL  152

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKVVDSK  DRIFIYY+DHGGPGVLGMPN+P+LY  DFIEVLKKKHS+GTYK+MVI
Sbjct  153   KGGSGKVVDSKPGDRIFIYYSDHGGPGVLGMPNMPYLYGKDFIEVLKKKHSSGTYKEMVI  212

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             Y+EACESGS FEG+MP++LNIYVTTASNAEESSWGTYCPG +P PPPEYITCLGDLYSVA
Sbjct  213   YIEACESGSVFEGLMPDNLNIYVTTASNAEESSWGTYCPGMDPPPPPEYITCLGDLYSVA  272

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSESHNL  ETIE+QY+ VK RTSNYN + AGSHVMEYG+    K EK+YLYQGFDP
Sbjct  273   WMEDSESHNLKRETIEQQYDQVKERTSNYNTYNAGSHVMEYGNTS-FKWEKLYLYQGFDP  331

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             AT NLP N I+      VVNQRDAD+LF+WERYK   D   +KA+ LK IT+TMLHR+ L
Sbjct  332   ATENLPPNGIKVKERMDVVNQRDADVLFLWERYKKMEDGTKAKAEFLKVITETMLHREHL  391

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S+D +G+ LFGP+ G +ILK+VR+ GL L DDW CLKS VR+FE HCGSL QYGMKHM
Sbjct  392   DGSVDIIGLALFGPDKGPSILKTVRRRGLPLADDWDCLKSTVRLFEAHCGSLTQYGMKHM  451

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             RAFANICNS +  + +EEAC   C      K++  ++ YSA
Sbjct  452   RAFANICNSGVPLSRIEEACMAACGGRDIAKWSPLNRGYSA  492



>ref|XP_010676183.1| PREDICTED: vacuolar-processing enzyme [Beta vulgaris subsp. vulgaris]
Length=483

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/451 (70%), Positives = 371/451 (82%), Gaps = 3/451 (1%)
 Frame = -3

Query  1582  NLQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKR  1403
             N +A+RWD  IR   +++ D   +    GTRWA+LVAGS G+ NYRHQADVCHAYQILK+
Sbjct  20    NCEASRWDSNIRMTTEKEADAGLD--DGGTRWALLVAGSQGFGNYRHQADVCHAYQILKK  77

Query  1402  GGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLL  1223
             GGLKDENIVVFMYDDIA+N  NPRKGVIINHP G DVYAGVPKDYTG+ VTA N+YAVLL
Sbjct  78    GGLKDENIVVFMYDDIADNPLNPRKGVIINHPKGEDVYAGVPKDYTGEHVTAENMYAVLL  137

Query  1222  gdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGT  1043
             G+K  V GGSGKV+DSK +DRIF+YY+DHGGPGVLGMPN+P LY  DFIEVLKKKH++ +
Sbjct  138   GNKSAVNGGSGKVIDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYGKDFIEVLKKKHASKS  197

Query  1042  YKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLG  863
             YK+MVIY+EACESGS FEG+MPEDLNIYVTTASNAEESSWGTYCPG  PAPPPE++TCLG
Sbjct  198   YKEMVIYIEACESGSVFEGLMPEDLNIYVTTASNAEESSWGTYCPGMNPAPPPEFMTCLG  257

Query  862   DLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYL  683
             DLYS+AWMEDSE+HNL +ETI +QY+ VK RTSNYN + AGSHVMEYG++  +KPEK+YL
Sbjct  258   DLYSIAWMEDSETHNLKKETINQQYKKVKERTSNYNTYTAGSHVMEYGNKS-LKPEKLYL  316

Query  682   YQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTM  503
             YQGFDPAT+NLP N++   +  GVVNQRDAD+LF+W++Y+   D    K K+L+EIT+TM
Sbjct  317   YQGFDPATVNLPPNRLPLHSKLGVVNQRDADILFLWKKYERSRDKPEEKCKILQEITETM  376

Query  502   LHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQ  323
              HR  LD+SI+ +G  LFGP NG ++L +  +PG+ LVDDW CLKSMVRVFE  CGSL Q
Sbjct  377   KHRMHLDSSIELIGKLLFGPNNGQSVLSTKPRPGMPLVDDWDCLKSMVRVFEKQCGSLTQ  436

Query  322   YGMKHMRAFANICNSNISEAAMEEACKNTCS  230
             YGMKHMRAFANICN  I   AMEE C   CS
Sbjct  437   YGMKHMRAFANICNEGIPLQAMEEVCVAACS  467



>ref|XP_006391830.1| hypothetical protein EUTSA_v10023430mg [Eutrema salsugineum]
 gb|ESQ29116.1| hypothetical protein EUTSA_v10023430mg [Eutrema salsugineum]
Length=484

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/464 (69%), Positives = 380/464 (82%), Gaps = 5/464 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
              R++P I  P ++      E    GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGLK
Sbjct  25    GRFEPKILMPTEKTKPVEQEEAAIGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLK  84

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             +ENIVV MYDDIAN+  NPR G +INHP+G DVYAGVPKDYTG  VTAAN YAVLLGDK+
Sbjct  85    EENIVVLMYDDIANHPLNPRPGTLINHPDGEDVYAGVPKDYTGHDVTAANFYAVLLGDKK  144

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              VKGGSGKV+ SK +D IF+YY+DHGGPGVLGMPN PHLYA DFIE LKKKH+AGTY++M
Sbjct  145   AVKGGSGKVIASKPNDHIFVYYSDHGGPGVLGMPNTPHLYAADFIETLKKKHAAGTYREM  204

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             VIYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYS
Sbjct  205   VIYVEACESGSVFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYS  264

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGF  671
             VAWMEDSE+HNL +ETI++QY+ VK+RTSNYN +  GSHVMEYG+ + IK EK+YLYQGF
Sbjct  265   VAWMEDSETHNLKKETIKQQYQTVKMRTSNYNSYSEGSHVMEYGN-NTIKAEKLYLYQGF  323

Query  670   DPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             DPAT+NLP N++   +P GVVNQRDADLLF+W  Y+   D +  K ++LKEITD M HR+
Sbjct  324   DPATVNLPPNELPVKSPVGVVNQRDADLLFLWHMYRTSEDGS-RKDEILKEITDQMRHRK  382

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              LDAS++ +G+ LFGP   +N+L SVR+PGL LVDDW+CLKSMVRVFETHCGSL QYGMK
Sbjct  383   HLDASVELIGMILFGPT--TNVLNSVREPGLPLVDDWECLKSMVRVFETHCGSLTQYGMK  440

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKV-YSA  182
             HMRAFAN+CN+ +S+  ME+A    C   ++   +HPS V YSA
Sbjct  441   HMRAFANVCNNGVSKELMEKASAAACGGYESRFMSHPSIVGYSA  484



>gb|EYU34366.1| hypothetical protein MIMGU_mgv1a018579mg [Erythranthe guttata]
Length=491

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/461 (71%), Positives = 375/461 (81%), Gaps = 5/461 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WDP+IR P D    E    E  GTRWAVLVAGSNG+ NYRHQADVCHAYQILK+GG+KDE
Sbjct  36    WDPIIRWPSDHPQKE----EDDGTRWAVLVAGSNGFGNYRHQADVCHAYQILKKGGVKDE  91

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA N  NPRKGV+INHPNG DVYAGVPKDYTG+QVTA N YAV+LGDK  +
Sbjct  92    NIVVFMYDDIAMNDLNPRKGVLINHPNGEDVYAGVPKDYTGEQVTAENFYAVILGDKSAL  151

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKVVDSK  DRIFIYY+DHGGPGVLGMPN+P+LY  DFI+VLKKKH++GTYK+MVI
Sbjct  152   KGGSGKVVDSKPGDRIFIYYSDHGGPGVLGMPNMPYLYGKDFIDVLKKKHTSGTYKEMVI  211

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             Y+EACESGS FEG+MP++LNIYVTTASNAEESSWGTYCPG +P PPPEYITCLGDLYS+A
Sbjct  212   YIEACESGSVFEGLMPDNLNIYVTTASNAEESSWGTYCPGMDPPPPPEYITCLGDLYSIA  271

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSE+HNL  ETIE+QY+ VK RTSNYN + AGSHVMEYG+    K EK+YLYQGFDP
Sbjct  272   WMEDSETHNLKRETIEQQYDQVKERTSNYNTYNAGSHVMEYGNTS-FKWEKLYLYQGFDP  330

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             AT NLP N I       VVNQRDAD+LF+WERYK   D   +KA+ LK IT+TMLHR+ L
Sbjct  331   ATENLPPNGIEVKERMDVVNQRDADVLFLWERYKKMEDGTKAKAEFLKVITETMLHREHL  390

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S+D +G+ LFGP+ G +ILK+VR+ GL L DDW CLKS VR+FE HCGSL QYGMKHM
Sbjct  391   DGSVDIIGLALFGPDKGPSILKTVRRRGLPLADDWDCLKSTVRLFEAHCGSLTQYGMKHM  450

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             RAFANICNS +  + +EEAC   C      K++  ++ YSA
Sbjct  451   RAFANICNSGVPLSRIEEACMAACGGRDIAKWSPLNRGYSA  491



>gb|AES90963.2| vacuolar processing enzyme [Medicago truncatula]
Length=494

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/462 (69%), Positives = 381/462 (82%), Gaps = 5/462 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WDP+IR P +  DD   E +  GTRWAVLVAGS+GY NYRHQADVCHAYQ+L +GG+K+E
Sbjct  37    WDPVIRLPGEVVDD--AEVDEVGTRWAVLVAGSSGYGNYRHQADVCHAYQLLIKGGVKEE  94

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIANN  NPR GVIINHP G +VY GVPKDYTGD VTA NLYAV+LGDK  V
Sbjct  95    NIVVFMYDDIANNELNPRPGVIINHPQGPNVYVGVPKDYTGDNVTAENLYAVILGDKSKV  154

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKV++SK++DRIFIYY+DHGGPGVLGMPN+P++YA DFI+VLKKKH++G YK MV+
Sbjct  155   KGGSGKVINSKSEDRIFIYYSDHGGPGVLGMPNMPYVYAMDFIDVLKKKHASGGYKKMVV  214

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             Y+EACESGS FEG+MP+DLN+YVTTASNA+ESSWGTYCPG EPAPPPEYITCLGDLYSVA
Sbjct  215   YIEACESGSMFEGVMPKDLNVYVTTASNAQESSWGTYCPGVEPAPPPEYITCLGDLYSVA  274

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSESHNL  ET+++QY++VK RTSNYN++  GSHVM+YG  +I   EK+YLYQGFDP
Sbjct  275   WMEDSESHNLKRETVKQQYKSVKERTSNYNNYALGSHVMQYGDTNITD-EKLYLYQGFDP  333

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             AT+NLP +  +  +   VVNQRDA++LFMWE YK        K ++L++I +T+ HR  L
Sbjct  334   ATVNLPPHNDKLESKMEVVNQRDAEILFMWEMYKRLDHQTEKKREILEKIAETVKHRNHL  393

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S++ +GV LFGP  GS++L++VR  GL LVDDW+CLKS VR+FETHCGSL QYGMKHM
Sbjct  394   DGSVELIGVLLFGPTKGSSVLQAVRATGLPLVDDWECLKSRVRLFETHCGSLTQYGMKHM  453

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             RAFANICNS ISE +ME+AC   C   K ++  HPS +VYSA
Sbjct  454   RAFANICNSGISEDSMEKACMVACGGYK-LELLHPSNRVYSA  494



>ref|XP_003608766.1| Vacuolar-processing enzyme [Medicago truncatula]
Length=487

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/462 (69%), Positives = 381/462 (82%), Gaps = 5/462 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WDP+IR P +  DD   E +  GTRWAVLVAGS+GY NYRHQADVCHAYQ+L +GG+K+E
Sbjct  30    WDPVIRLPGEVVDD--AEVDEVGTRWAVLVAGSSGYGNYRHQADVCHAYQLLIKGGVKEE  87

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIANN  NPR GVIINHP G +VY GVPKDYTGD VTA NLYAV+LGDK  V
Sbjct  88    NIVVFMYDDIANNELNPRPGVIINHPQGPNVYVGVPKDYTGDNVTAENLYAVILGDKSKV  147

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKV++SK++DRIFIYY+DHGGPGVLGMPN+P++YA DFI+VLKKKH++G YK MV+
Sbjct  148   KGGSGKVINSKSEDRIFIYYSDHGGPGVLGMPNMPYVYAMDFIDVLKKKHASGGYKKMVV  207

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             Y+EACESGS FEG+MP+DLN+YVTTASNA+ESSWGTYCPG EPAPPPEYITCLGDLYSVA
Sbjct  208   YIEACESGSMFEGVMPKDLNVYVTTASNAQESSWGTYCPGVEPAPPPEYITCLGDLYSVA  267

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSESHNL  ET+++QY++VK RTSNYN++  GSHVM+YG  +I   EK+YLYQGFDP
Sbjct  268   WMEDSESHNLKRETVKQQYKSVKERTSNYNNYALGSHVMQYGDTNITD-EKLYLYQGFDP  326

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             AT+NLP +  +  +   VVNQRDA++LFMWE YK        K ++L++I +T+ HR  L
Sbjct  327   ATVNLPPHNDKLESKMEVVNQRDAEILFMWEMYKRLDHQTEKKREILEKIAETVKHRNHL  386

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S++ +GV LFGP  GS++L++VR  GL LVDDW+CLKS VR+FETHCGSL QYGMKHM
Sbjct  387   DGSVELIGVLLFGPTKGSSVLQAVRATGLPLVDDWECLKSRVRLFETHCGSLTQYGMKHM  446

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             RAFANICNS ISE +ME+AC   C   K ++  HPS +VYSA
Sbjct  447   RAFANICNSGISEDSMEKACMVACGGYK-LELLHPSNRVYSA  487



>gb|KDP25622.1| hypothetical protein JCGZ_20778 [Jatropha curcas]
Length=495

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/471 (67%), Positives = 379/471 (80%), Gaps = 5/471 (1%)
 Frame = -3

Query  1585  QNLQAARWDPL---IRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQ  1415
             Q+  A+R +P    I  P ++   E  + +  GTRWAVLVAGS GY NYRHQADVCHAYQ
Sbjct  27    QSGSASRLNPFEPGILLPTEEDASEVDDDQI-GTRWAVLVAGSRGYGNYRHQADVCHAYQ  85

Query  1414  ILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLY  1235
             +L++GG+K+ENI+VFMYDDIA++  NPRKGVIINHP G DVYAGVPKDYTG+ VTA NLY
Sbjct  86    LLRKGGIKEENIIVFMYDDIAHHQLNPRKGVIINHPQGEDVYAGVPKDYTGEHVTAKNLY  145

Query  1234  AVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKH  1055
             AVLLGDK  + GGSGKVV+S A+DRIF+YY+DHGGPGVLGMPNLP LYA DFIEVLKKKH
Sbjct  146   AVLLGDKSALSGGSGKVVNSTANDRIFVYYSDHGGPGVLGMPNLPFLYAMDFIEVLKKKH  205

Query  1054  SAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYI  875
             +AG+Y+ MVIYVEACESGS FEG+MP+D+N+YVTTASNA+E+SWGTYCPG +P+PPPE+I
Sbjct  206   AAGSYEKMVIYVEACESGSIFEGIMPDDINVYVTTASNAQENSWGTYCPGMDPSPPPEFI  265

Query  874   TCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPE  695
             TCLGDLYSVAWMEDSE+HNL  ETI++QY  VK RTSNYN + AGSHVMEYG+   +K E
Sbjct  266   TCLGDLYSVAWMEDSETHNLKRETIKQQYRTVKERTSNYNTYTAGSHVMEYGNSS-LKTE  324

Query  694   KVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEI  515
             K+YLYQGFDPA +NLP        P  VVNQRDA+LLFMW+ YK   + +  KA++L++I
Sbjct  325   KLYLYQGFDPANVNLPPVNAHVNAPMEVVNQRDAELLFMWQMYKRSDEQSGKKAQILQQI  384

Query  514   TDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCG  335
              +T+ HR  LD SI+ +G  LFGP+ GS +L+SVR+PGL LVDDW CLKSMVRVFET+CG
Sbjct  385   KETIKHRSHLDNSIELIGTLLFGPQKGSTVLQSVREPGLPLVDDWTCLKSMVRVFETYCG  444

Query  334   SLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             SL QYGMKHMRAFAN+CN  +S A+MEEAC   CS     ++   ++ YSA
Sbjct  445   SLTQYGMKHMRAFANVCNGGVSHASMEEACIAACSGHDAGQWQPLNRGYSA  495



>ref|XP_010473493.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Camelina 
sativa]
Length=487

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/465 (68%), Positives = 375/465 (81%), Gaps = 5/465 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
              R++P I  P ++   +  + +  GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGLK
Sbjct  26    GRFEPKILMPTEEAKPDDQDEDGIGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLK  85

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             +ENIVV MYDDIANN  NPR G IINHPNG DVYAGVPKDYTG  VTAAN YAVLLGD++
Sbjct  86    EENIVVMMYDDIANNPLNPRPGTIINHPNGYDVYAGVPKDYTGSNVTAANFYAVLLGDQK  145

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              VKGGSGKV+ SK +D IF+YY DHGGPGVLGMPN PH+YA DFIE LKKKH++GTYK+M
Sbjct  146   AVKGGSGKVIASKPNDHIFVYYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGTYKEM  205

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             VIYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYS
Sbjct  206   VIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYS  265

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGF  671
             VAWMEDSE+HNL +ETI++QY+ VK+RTSNYN + AGSHVMEYG+ D +K EK+YLYQGF
Sbjct  266   VAWMEDSENHNLKKETIKQQYQTVKMRTSNYNTYSAGSHVMEYGN-DSLKSEKLYLYQGF  324

Query  670   DPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             DPAT+NLP N++   +  GVVNQRDAD+LF+W  Y+   D +  K   LKE+T+T  HR+
Sbjct  325   DPATVNLPPNELLVKSQVGVVNQRDADILFLWHMYRTSEDGSRKKDDTLKELTETTRHRK  384

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              LDAS++ +G  LFGP    N+L S+R+PGL LVDDW+CLKS VRVFETHCGSL QYGMK
Sbjct  385   HLDASVELIGTVLFGP--AMNVLNSIREPGLPLVDDWECLKSTVRVFETHCGSLTQYGMK  442

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYT-HPSKV-YSA  182
             HMRAFAN+CN+ IS+  MEEA    C      +Y  HPS + YSA
Sbjct  443   HMRAFANVCNNGISKELMEEASAAACGGYNDARYMLHPSILGYSA  487



>ref|XP_011033921.1| PREDICTED: vacuolar-processing enzyme-like [Populus euphratica]
Length=494

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/455 (69%), Positives = 374/455 (82%), Gaps = 5/455 (1%)
 Frame = -3

Query  1585  QNLQAARWDPL---IRQPVDQKDDE-SPEGETQGTRWAVLVAGSNGYANYRHQADVCHAY  1418
             Q+ QAAR +P+   I  P ++   E   +G+  GTRWAVLVAGSNGY NYRHQADVCHAY
Sbjct  24    QSGQAARLNPVDAGILMPTEKDGPEVDDDGKEIGTRWAVLVAGSNGYGNYRHQADVCHAY  83

Query  1417  QILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANL  1238
             Q+L++GG+K+ENIVVFMYDDIAN+ FNPR GVIINHP G DVYAGVPKDYTG QVT ANL
Sbjct  84    QLLRKGGIKEENIVVFMYDDIANHEFNPRPGVIINHPQGDDVYAGVPKDYTGVQVTTANL  143

Query  1237  YAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKK  1058
             YAVLLG+K  VKGGSGKVVDS  +DRIF+YY+DHGGPGVLGMPN+P LYA DFIEVLKKK
Sbjct  144   YAVLLGNKSAVKGGSGKVVDSMPNDRIFLYYSDHGGPGVLGMPNMPFLYAMDFIEVLKKK  203

Query  1057  HSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEY  878
             H++G YK+MV+Y+EACESGS FEG+MP+D+NIYVTTASNAEESSWGTYCPG EP+PPPEY
Sbjct  204   HASGNYKEMVMYIEACESGSIFEGIMPKDINIYVTTASNAEESSWGTYCPGMEPSPPPEY  263

Query  877   ITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKP  698
             +TCLGDLYSV+WMEDS  HNL  ETIE+QY +VK RTSNYN F +GSHVM+YG+   IK 
Sbjct  264   VTCLGDLYSVSWMEDSGKHNLRRETIEQQYHSVKERTSNYNTFTSGSHVMQYGNES-IKG  322

Query  697   EKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKE  518
             EK+YLYQGFDPA++N P N +       VVNQRDA+L+F+W+ YK   D +  K ++L +
Sbjct  323   EKLYLYQGFDPASVNFPPNNVHIGGRMDVVNQRDAELVFLWQMYKRSEDGSEKKTQILNQ  382

Query  517   ITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHC  338
             I +T+ HR RLD+S++ +G  LFGP+ GS +LKSVR+PG  LVDDW CLKSMVR FETHC
Sbjct  383   IKETVRHRTRLDSSMELIGTLLFGPKKGSAMLKSVREPGSPLVDDWICLKSMVRRFETHC  442

Query  337   GSLGQYGMKHMRAFANICNSNISEAAMEEACKNTC  233
             GSL QYGMKHMRAFANICN  +S+A+MEEAC   C
Sbjct  443   GSLTQYGMKHMRAFANICNGGVSQASMEEACIAAC  477



>gb|KHN09785.1| Vacuolar-processing enzyme [Glycine soja]
Length=495

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/462 (68%), Positives = 379/462 (82%), Gaps = 6/462 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WD +I+ P +  D +S E    GTRWAVLVAGSNGY NYRHQADVCHAYQ+L +GGLK+E
Sbjct  39    WDSVIKLPTEPVDADSDE---VGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGLKEE  95

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA N  NPR GVIINHP G D+YAGVPKDYTGD VT  NL+AV+LGDK  +
Sbjct  96    NIVVFMYDDIATNELNPRHGVIINHPEGEDLYAGVPKDYTGDNVTTENLFAVILGDKSKL  155

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKV++SK +DRIFIYY+DHGGPG+LGMPN+P+LYA DFI+VLKKKH++G+YK+MVI
Sbjct  156   KGGSGKVINSKPEDRIFIYYSDHGGPGILGMPNMPYLYAMDFIDVLKKKHASGSYKEMVI  215

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             YVEACESGS FEG+MP+DLNIYVTTASNA+E+SWGTYCPG +P+PPPEYITCLGDLYSVA
Sbjct  216   YVEACESGSVFEGIMPKDLNIYVTTASNAQENSWGTYCPGMDPSPPPEYITCLGDLYSVA  275

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSE+HNL  E++++QY++VK RTSN+N++  GSHVM+YG  +I   EK+YLYQGFDP
Sbjct  276   WMEDSEAHNLKRESVKQQYKSVKQRTSNFNNYAMGSHVMQYGDTNITA-EKLYLYQGFDP  334

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             AT+N P    R  T   VVNQRDA+LLFMW+ Y+     + +K  +LK+I +T+ HR+ +
Sbjct  335   ATVNFPPQNGRLETKMEVVNQRDAELLFMWQMYQRSNHQSENKTDILKQIAETVKHRKHI  394

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S++ +GV L+GP  GS++L+SVR PG +LVDDW CLKSMVRVFETHCG+L QYGMKHM
Sbjct  395   DGSVELIGVLLYGPGKGSSVLQSVRAPGSSLVDDWTCLKSMVRVFETHCGTLTQYGMKHM  454

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             RAFANICNS +SEA+MEEAC   C E       HPS + YSA
Sbjct  455   RAFANICNSGVSEASMEEACLAAC-EGYNAGLFHPSNRGYSA  495



>ref|XP_008796848.1| PREDICTED: vacuolar-processing enzyme [Phoenix dactylifera]
Length=491

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/464 (68%), Positives = 374/464 (81%), Gaps = 3/464 (1%)
 Frame = -3

Query  1573  AARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGL  1394
             A  WD +IR P +   D+    E  GTRWAVLVAGS GY NYRHQADVCHAYQ+LK+GGL
Sbjct  30    AGGWDSVIRMPAEMGSDDG--DEEIGTRWAVLVAGSFGYGNYRHQADVCHAYQLLKKGGL  87

Query  1393  KDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdk  1214
             K+ENIVV M+DDIANN  NPR GVIINHP+G DVYAGVPKDYTG+QVT  NLYAV+LG+K
Sbjct  88    KEENIVVMMHDDIANNPLNPRPGVIINHPDGEDVYAGVPKDYTGEQVTTKNLYAVILGNK  147

Query  1213  egvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKD  1034
               V+GGSGKVVDSK  DRIFIYY+DHGGPGVLGMPN+P LYA DFI+VLKKKH++G+Y++
Sbjct  148   SAVEGGSGKVVDSKPVDRIFIYYSDHGGPGVLGMPNMPFLYAADFIDVLKKKHASGSYRE  207

Query  1033  MVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLY  854
             MVIYVEACESGS FEG++PE LNIYVTTASNAEESSWGTYCPG +PAPPPEYITCLGDLY
Sbjct  208   MVIYVEACESGSIFEGLLPEGLNIYVTTASNAEESSWGTYCPGMDPAPPPEYITCLGDLY  267

Query  853   SVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQG  674
             SVAWMEDS +HNL EETIE+QYE VK RTSNYN + AGSHVMEYG +   K +K+YL+QG
Sbjct  268   SVAWMEDSATHNLKEETIEKQYEVVKERTSNYNTYSAGSHVMEYGDKS-FKDDKLYLFQG  326

Query  673   FDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHR  494
             FDP+  NL GN +    P G +NQRDADLLF+W+RY+     +  K ++LKEIT+TM+HR
Sbjct  327   FDPSNANLSGNGLPPTMPTGAINQRDADLLFLWKRYEQLDARSEKKTQVLKEITETMMHR  386

Query  493   QRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGM  314
               LD SI+ +G  +FG ENG +IL +VR  G ALVDDW CLK+MV+VF+++CG L Q+GM
Sbjct  387   LHLDNSINLIGKLIFGSENGPSILNAVRPSGQALVDDWNCLKTMVQVFQSYCGPLTQHGM  446

Query  313   KHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             +HMRAFAN+CN  IS  AM EAC NTC    + K++  S+ YSA
Sbjct  447   RHMRAFANLCNRGISNDAMVEACVNTCGSHISAKWSPSSREYSA  490



>ref|XP_007209951.1| hypothetical protein PRUPE_ppa004795mg [Prunus persica]
 gb|EMJ11150.1| hypothetical protein PRUPE_ppa004795mg [Prunus persica]
Length=491

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/462 (69%), Positives = 374/462 (81%), Gaps = 3/462 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WD  IR P D+   E    +  GTRWAVLVAGS+GY NYRHQADVCHAYQ+LK+GGLK+E
Sbjct  32    WDSTIRLPSDKDKPEDANHKEAGTRWAVLVAGSSGYGNYRHQADVCHAYQLLKKGGLKEE  91

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIAN+  NPR GVIINHP G DVYAGVPKDYTG QVTAANLYAVLLGDK+ V
Sbjct  92    NIVVFMYDDIANHEINPRPGVIINHPQGQDVYAGVPKDYTGKQVTAANLYAVLLGDKKAV  151

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKVVDSK +DRIF+YY+DHGGPGVLGMPN+P LYA DFI+VLKKKH++G+YK+MVI
Sbjct  152   KGGSGKVVDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAMDFIQVLKKKHASGSYKEMVI  211

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             YVEACESGS FEG+MP DLNIYVTTASNA+E+S+GTYCPG +P+PPPEYITCLGDLYSVA
Sbjct  212   YVEACESGSIFEGIMPSDLNIYVTTASNAQENSFGTYCPGMDPSPPPEYITCLGDLYSVA  271

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSE HNL +ETI++QY+NVK RTSN N++  GSHVM+YGS++I   EK+YLYQGFDP
Sbjct  272   WMEDSERHNLKKETIKQQYQNVKKRTSNSNNYDVGSHVMQYGSKNITV-EKLYLYQGFDP  330

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             A++N P N  +   P  VVNQRDA+L FMW+ YK     +  K  +L++I +TM HR  L
Sbjct  331   ASLNFPPNNGQLEKPMEVVNQRDAELFFMWQMYKRSEHGSEKKTHILEQIKETMGHRTHL  390

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             DASI+ +G  L+GP  G + L SVR  GL LVDDW+CLKSMVRVFET CG L QYGMKHM
Sbjct  391   DASIEFIGTFLYGPGKGFSTLNSVRALGLPLVDDWECLKSMVRVFETQCGLLTQYGMKHM  450

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             RAFANICNS ++++ MEEAC   C+     +  HPS K YSA
Sbjct  451   RAFANICNSGVTQSEMEEACSAACNGHDPGQ-LHPSNKGYSA  491



>ref|XP_006477253.1| PREDICTED: vacuolar-processing enzyme-like [Citrus sinensis]
Length=529

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/472 (68%), Positives = 390/472 (83%), Gaps = 10/472 (2%)
 Frame = -3

Query  1579  LQAARW---DPLIRQPVDQKDDESPEG-ETQGTRWAVLVAGSNGYANYRHQADVCHAYQI  1412
             +QAAR+   D  I  P ++++  + EG E  GTRWAVLVAGS+GYANYRHQADVCHAYQ+
Sbjct  62    VQAARFNQRDSAILLPSEKQEPPAEEGGEPVGTRWAVLVAGSSGYANYRHQADVCHAYQL  121

Query  1411  LKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYA  1232
             L++GGLK+E+IVVFMYDDIA +  NPR GVIINHP G ++Y GVPKDYTG+ VTA NLYA
Sbjct  122   LRKGGLKEEHIVVFMYDDIAMHELNPRPGVIINHPQGENLYDGVPKDYTGEHVTAQNLYA  181

Query  1231  VLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHS  1052
             VLLGD++ VKGGSGKVV+SKA++RIFI+Y+DHGGPGVLGMPN+P++YA +FI+VLKKKH+
Sbjct  182   VLLGDRKAVKGGSGKVVNSKANERIFIFYSDHGGPGVLGMPNMPYVYAMEFIDVLKKKHA  241

Query  1051  AGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYIT  872
             A +YK+MVIYVEACESGS FEG+MP+DL+IYVTTASNA+ESS+GTYCPG +P+PPPEYIT
Sbjct  242   AKSYKEMVIYVEACESGSIFEGVMPKDLDIYVTTASNAQESSFGTYCPGMDPSPPPEYIT  301

Query  871   CLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEK  692
             CLGDLYSVAWMEDSE+HNL  ETI +QY+ VK RTSN+N++ +GSHVMEYG+   +K EK
Sbjct  302   CLGDLYSVAWMEDSETHNLKRETINQQYQAVKERTSNFNNYNSGSHVMEYGNTS-VKSEK  360

Query  691   VYLYQGFDPATINLPGNQIRRLTPK--GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKE  518
             +YLYQGFDPA+ N P N   +L P   GVVNQRDADLLFMW  YK   + +  K+++LK+
Sbjct  361   LYLYQGFDPASANFPPN---KLLPDQMGVVNQRDADLLFMWHMYKNAAEGSEKKSEMLKQ  417

Query  517   ITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHC  338
             IT+TM HR+ LDASID +GV LFGP+ GS IL SVR  GL LVDDWQCLKSMVRVFETHC
Sbjct  418   ITETMRHRKHLDASIDMIGVILFGPDKGSRILNSVRARGLPLVDDWQCLKSMVRVFETHC  477

Query  337   GSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             GSL QYGMKHMRAFANICNS +S+A MEE  +  CS  +  ++    + YSA
Sbjct  478   GSLTQYGMKHMRAFANICNSGVSQALMEETSEAACSGNELRQWHLAIRGYSA  529



>ref|XP_010418271.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Camelina 
sativa]
Length=487

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/465 (67%), Positives = 373/465 (80%), Gaps = 5/465 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
              R++P I  P ++      + +  GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGLK
Sbjct  26    GRFEPKILMPTEEAKPAEQDEDGIGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLK  85

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             +ENIVV MYDDIANN  NPR G +INHPNG DVYAGVPKDYTG  VTAAN YAVLLGD++
Sbjct  86    EENIVVMMYDDIANNPLNPRPGTLINHPNGDDVYAGVPKDYTGSNVTAANFYAVLLGDQK  145

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              +KGGSGKV+ SK +D IF+YY DHGGPGVLGMPN PH+YA DFIE LKKKH++GTYK+M
Sbjct  146   ALKGGSGKVIASKPNDHIFVYYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGTYKEM  205

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             VIYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYS
Sbjct  206   VIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYS  265

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGF  671
             VAWMEDSE+HNL +ETI++QY+ VK+RTSNYN + AGSHVMEYG+ D IK EK+YLYQGF
Sbjct  266   VAWMEDSENHNLKKETIKQQYQTVKMRTSNYNTYSAGSHVMEYGN-DSIKSEKLYLYQGF  324

Query  670   DPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             DPAT+NLP N++   +  GVVNQRDAD+LF+W  Y+   + +  K   LKE+T+T  HR+
Sbjct  325   DPATVNLPPNELLVKSQVGVVNQRDADILFLWHMYRTSEEGSRKKDDTLKELTETTRHRK  384

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              LDAS++ +G  LFGP    N+L S+R+PGL LVDDW+CLKS VRVFETHCGSL QYGMK
Sbjct  385   HLDASVELIGTVLFGP--AMNVLNSIREPGLPLVDDWECLKSTVRVFETHCGSLTQYGMK  442

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYT-HPSKV-YSA  182
             HMRAFAN+CN+ + +  MEEA    C      +Y  HPS + YSA
Sbjct  443   HMRAFANVCNNGVPKELMEEASAAACGGYNEARYMLHPSILGYSA  487



>ref|XP_010430341.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Camelina 
sativa]
Length=487

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/465 (68%), Positives = 373/465 (80%), Gaps = 5/465 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
              R++P I  P ++      + +  GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGL+
Sbjct  26    GRFEPKILMPTEEAKPADQDEDGIGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLQ  85

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             +ENIVV MYDDIANN  NPR G +INHPNG DVYAGVPKDYTG  VTAAN YAVLLGD++
Sbjct  86    EENIVVMMYDDIANNPLNPRPGTLINHPNGDDVYAGVPKDYTGSNVTAANFYAVLLGDQK  145

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              VKGGSGKV+ SK +D IF+YY DHGGPGVLGMPN PH+YA DFI  LKKKH++GTYK+M
Sbjct  146   AVKGGSGKVIASKPNDHIFVYYADHGGPGVLGMPNTPHIYAADFIGTLKKKHASGTYKEM  205

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             VIYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYS
Sbjct  206   VIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYS  265

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGF  671
             VAWMEDSE+HNL +ETI++QY+ VK+RTSNYN + AGSHVMEYG+ D +K EK+YLYQGF
Sbjct  266   VAWMEDSENHNLKKETIKQQYQKVKMRTSNYNTYSAGSHVMEYGN-DSLKSEKLYLYQGF  324

Query  670   DPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             DPAT+NLP N++   +  GVVNQRDADLLF+W  Y+   D +  K   LKE+T+T  HR+
Sbjct  325   DPATVNLPPNELLVKSQVGVVNQRDADLLFLWHMYRTSEDGSRKKDDTLKELTETTRHRK  384

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              LD+S++ +G  LFGP    NIL S+R+PGL LVDDW+CLKS VRVFETHCGSL QYGMK
Sbjct  385   HLDSSVELIGTVLFGP--AMNILNSIREPGLPLVDDWECLKSTVRVFETHCGSLTQYGMK  442

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYT-HPSKV-YSA  182
             HMRAFAN+CN+ +S+  MEEA    C      +Y  HPS + YSA
Sbjct  443   HMRAFANVCNNGVSKELMEEASAAACGGYNEARYMLHPSILGYSA  487



>ref|NP_001236678.1| vacuolar-processing enzyme precursor [Glycine max]
 sp|P49045.1|VPE_SOYBN RecName: Full=Vacuolar-processing enzyme; Short=VPE; Flags: Precursor 
[Glycine max]
 dbj|BAA06030.1| cysteine proteinase [Glycine max]
Length=495

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/462 (67%), Positives = 377/462 (82%), Gaps = 6/462 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WD +I+ P +  D +S E    GTRWAVLVAGSNGY NYRHQADVCHAYQ+L +GGLK+E
Sbjct  39    WDSVIKLPTEPVDADSDE---VGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGLKEE  95

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA N  NPR GVIINHP G D+YAGVPKDYTGD VT  NL+AV+LGDK  +
Sbjct  96    NIVVFMYDDIATNELNPRHGVIINHPEGEDLYAGVPKDYTGDNVTTENLFAVILGDKSKL  155

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKV++SK +DRIFIYY+DHGGPG+LGMPN+P+LYA DFI+VLKKKH++G+YK+MVI
Sbjct  156   KGGSGKVINSKPEDRIFIYYSDHGGPGILGMPNMPYLYAMDFIDVLKKKHASGSYKEMVI  215

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             YVEACESGS FEG+MP+DLNIYVTTASNA+E+SWGTYCPG +P+PPPEYITCLGDLYSVA
Sbjct  216   YVEACESGSVFEGIMPKDLNIYVTTASNAQENSWGTYCPGMDPSPPPEYITCLGDLYSVA  275

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSE+HNL  E++++QY++VK RTSN+N++  GSHVM+YG  +I   EK+YLYQGFDP
Sbjct  276   WMEDSEAHNLKRESVKQQYKSVKQRTSNFNNYAMGSHVMQYGDTNITA-EKLYLYQGFDP  334

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             AT+N P    R  T   VVNQRDA+L  +W+ Y+     + +K  +LK+I +T+ HR+ +
Sbjct  335   ATVNFPPQNGRLETKMEVVNQRDAELFLLWQMYQRSNHQSENKTDILKQIAETVKHRKHI  394

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S++ +GV L+GP  GS++L+SVR PG +LVDDW CLKSMVRVFETHCG+L QYGMKHM
Sbjct  395   DGSVELIGVLLYGPGKGSSVLQSVRAPGSSLVDDWTCLKSMVRVFETHCGTLTQYGMKHM  454

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             RAFANICNS +SEA+MEEAC   C E       HPS + YSA
Sbjct  455   RAFANICNSGVSEASMEEACLAAC-EGYNAGLFHPSNRGYSA  495



>ref|XP_006440379.1| hypothetical protein CICLE_v10019686mg [Citrus clementina]
 gb|ESR53619.1| hypothetical protein CICLE_v10019686mg [Citrus clementina]
Length=529

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/470 (68%), Positives = 388/470 (83%), Gaps = 6/470 (1%)
 Frame = -3

Query  1579  LQAARW---DPLIRQPVDQKDDESPEG-ETQGTRWAVLVAGSNGYANYRHQADVCHAYQI  1412
             +QAAR+   D  I  P ++++  + EG E  GTRWAVLVAGS+GYANYRHQADVCHAYQ+
Sbjct  62    VQAARFNRRDSAILLPSEKQEPPAEEGGEPVGTRWAVLVAGSSGYANYRHQADVCHAYQL  121

Query  1411  LKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYA  1232
             L++GGLK+E+IVVFMYDDIA +  NPR GVIINHP G ++Y GVPKDYTG+ VTA NLYA
Sbjct  122   LRKGGLKEEHIVVFMYDDIAMHELNPRPGVIINHPQGENLYDGVPKDYTGEHVTAQNLYA  181

Query  1231  VLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHS  1052
             VLLGD++ VKGGSGKVV+SKA+DRIFI+Y+DHGGPGVLGMPN+P++YA +FI+VLKKKH+
Sbjct  182   VLLGDRKAVKGGSGKVVNSKANDRIFIFYSDHGGPGVLGMPNMPYVYAMEFIDVLKKKHA  241

Query  1051  AGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYIT  872
             A +YK MVIYVEACESGS FEG+MP+DL+IYVTTASNA+ESS+GTYCPG +P+PPPEYIT
Sbjct  242   AKSYKGMVIYVEACESGSIFEGVMPKDLDIYVTTASNAQESSFGTYCPGMDPSPPPEYIT  301

Query  871   CLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEK  692
             CLGDLYSVAWMEDSE+HNL  ETI +QY+ VK RTSN+N++ +GSHVMEYG+   +K EK
Sbjct  302   CLGDLYSVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTS-VKSEK  360

Query  691   VYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEIT  512
             +YLYQGFDPA+ N P N+++     GVVNQRDADLLFMW  YK   + +  K+++LK+IT
Sbjct  361   LYLYQGFDPASTNFPPNKLQP-DQMGVVNQRDADLLFMWHMYKNAAEGSEKKSEMLKQIT  419

Query  511   DTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGS  332
             +TM HR+ LDASID +GV LFGP+ GS IL SV   GL LVDDWQCLKSMVRVFETHCGS
Sbjct  420   ETMRHRKHLDASIDMIGVILFGPDKGSRILNSVGARGLPLVDDWQCLKSMVRVFETHCGS  479

Query  331   LGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             L QYGMKHMRAFANICNS +S+A MEE  +  CS  +  ++    + YSA
Sbjct  480   LTQYGMKHMRAFANICNSGVSQALMEETSEAACSGNELRQWHPAIRGYSA  529



>ref|XP_009112700.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Brassica 
rapa]
Length=485

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/463 (67%), Positives = 375/463 (81%), Gaps = 5/463 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             R++P I  P ++      E    GTRWAVL+AGS+GY NYRHQADVCHAYQIL++GGLK+
Sbjct  27    RFEPKILMPSEEAKSNEQEKTMIGTRWAVLIAGSSGYGNYRHQADVCHAYQILRKGGLKE  86

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVV MYDDIAN+  NPR G +INHP+G DVYAGVPKDYTG  VTAAN YAVLLGDKE 
Sbjct  87    ENIVVMMYDDIANHPLNPRPGTLINHPDGEDVYAGVPKDYTGHNVTAANFYAVLLGDKEA  146

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             V GGSGKV+ SKA+D IF+YY+DHGGPGVLGMPN P+LYA DFIE LKKKH+A TYK+MV
Sbjct  147   VTGGSGKVIASKANDHIFVYYSDHGGPGVLGMPNKPYLYATDFIETLKKKHAAETYKEMV  206

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
             IYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYSV
Sbjct  207   IYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYSV  266

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDSE+HNL +ET+++QY+ VK+RTSNYN +  GSHVMEYG+   IK EK+YLYQGFD
Sbjct  267   AWMEDSETHNLKKETVKQQYQTVKMRTSNYNTYSEGSHVMEYGNSS-IKSEKLYLYQGFD  325

Query  667   PATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
             PAT+N P N++   +P GVVNQRDADL+F+W+ Y+ + ++   K +++KE+T+T  HR+ 
Sbjct  326   PATVNYPANELPVKSPVGVVNQRDADLIFLWQMYR-RSEDGPRKDEIMKELTETTRHRKH  384

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             LD S++ +   LFGP   +N+LKSVR+PGL LVDDW+CLKS+VRVFE HCGSL QYGMKH
Sbjct  385   LDTSVELISTVLFGPT--TNVLKSVREPGLPLVDDWECLKSVVRVFEMHCGSLTQYGMKH  442

Query  307   MRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKV-YSA  182
             MRAFANICN+ +S+  M+EA    C   +    +HPS V YSA
Sbjct  443   MRAFANICNNGVSKELMKEASAAACGGYEARFTSHPSVVGYSA  485



>ref|NP_176458.1| vacuolar-processing enzyme beta [Arabidopsis thaliana]
 sp|Q39044.3|VPEB_ARATH RecName: Full=Vacuolar-processing enzyme beta-isozyme; AltName: 
Full=Beta-VPE; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56243.1|AF367254_1 At1g62710/F23N19_8 [Arabidopsis thaliana]
 gb|AAL15381.1| At1g62710/F23N19_8 [Arabidopsis thaliana]
 gb|AEE33996.1| vacuolar-processing enzyme beta [Arabidopsis thaliana]
Length=486

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/465 (67%), Positives = 371/465 (80%), Gaps = 5/465 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
              R++P I  P ++ +    + +  GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGLK
Sbjct  25    GRFEPKILMPTEEANPADQDEDGVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLK  84

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             +ENIVV MYDDIAN+  NPR G +INHP+G DVYAGVPKDYTG  VTAAN YAVLLGD++
Sbjct  85    EENIVVLMYDDIANHPLNPRPGTLINHPDGDDVYAGVPKDYTGSSVTAANFYAVLLGDQK  144

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              VKGGSGKV+ SK +D IF+YY DHGGPGVLGMPN PH+YA DFIE LKKKH++GTYK+M
Sbjct  145   AVKGGSGKVIASKPNDHIFVYYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGTYKEM  204

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             VIYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYS
Sbjct  205   VIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYS  264

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGF  671
             VAWMEDSE+HNL +ETI++QY  VK+RTSNYN +  GSHVMEYG+   IK EK+YLYQGF
Sbjct  265   VAWMEDSETHNLKKETIKQQYHTVKMRTSNYNTYSGGSHVMEYGNNS-IKSEKLYLYQGF  323

Query  670   DPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             DPAT+NLP N++   +  GVVNQRDADLLF+W  Y+   D +  K   LKE+T+T  HR+
Sbjct  324   DPATVNLPLNELPVKSKIGVVNQRDADLLFLWHMYRTSEDGSRKKDDTLKELTETTRHRK  383

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              LDAS++ +   LFGP    N+L  VR+PGL LVDDW+CLKSMVRVFE HCGSL QYGMK
Sbjct  384   HLDASVELIATILFGPT--MNVLNLVREPGLPLVDDWECLKSMVRVFEEHCGSLTQYGMK  441

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYT-HPSKV-YSA  182
             HMRAFAN+CN+ +S+  MEEA    C      +YT HPS + YSA
Sbjct  442   HMRAFANVCNNGVSKELMEEASTAACGGYSEARYTVHPSILGYSA  486



>ref|XP_010933721.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
 ref|XP_010933722.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
Length=490

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/462 (67%), Positives = 372/462 (81%), Gaps = 5/462 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQ-GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             W+ +IR P +   D+   GE + GTRWAVLVAGS GY NYRHQADVCHAYQ+LK+GGLK+
Sbjct  33    WESVIRMPTESGGDD---GEQEIGTRWAVLVAGSFGYGNYRHQADVCHAYQLLKKGGLKE  89

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVV M+DDIANN  NPR GVIINHP G DVYAGVPKDYTG+ VT  NLYAV+LG+K  
Sbjct  90    ENIVVMMHDDIANNPLNPRPGVIINHPQGEDVYAGVPKDYTGEHVTTTNLYAVILGNKSA  149

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             V+GGSGKVVDSK +DRIFIYY+DHGGPGVLGMPN+P LYA DFI+VLKKKH++G YK+MV
Sbjct  150   VEGGSGKVVDSKPNDRIFIYYSDHGGPGVLGMPNMPFLYAADFIDVLKKKHASGGYKEMV  209

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
             IYVEACESGS FEG+MPEDLNIYVTTASNAEESSWGTYCPG +P+PPPE+ITCLGDLYSV
Sbjct  210   IYVEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMDPSPPPEFITCLGDLYSV  269

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDSE+HNL EETI++QYE VK RTSNYN +  GSHVMEYG +   K +K+YL+QGFD
Sbjct  270   AWMEDSETHNLKEETIQKQYEEVKERTSNYNTYNTGSHVMEYGDKS-FKDDKLYLFQGFD  328

Query  667   PATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
             P+  NL GN +    P   +NQRDADLLF+W+RY+   + +  K + L+EIT+T++HR  
Sbjct  329   PSNANLSGNALAPTMPMEAINQRDADLLFLWKRYEQFDEGSKKKTEALREITETLVHRLH  388

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             LD SI+ +G  +FG ENG +IL +VR  G ALVDDW CLK+MV+VF+T+CG L QYGM+H
Sbjct  389   LDNSINLIGKLIFGSENGPSILNAVRPSGQALVDDWNCLKTMVQVFQTYCGPLTQYGMRH  448

Query  307   MRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MRAFANICN   S+ AM EAC N C    + K++  S+ Y+A
Sbjct  449   MRAFANICNRGSSKDAMVEACLNACESHISAKWSSSSQEYNA  490



>ref|XP_006302155.1| hypothetical protein CARUB_v10020164mg, partial [Capsella rubella]
 gb|EOA35053.1| hypothetical protein CARUB_v10020164mg, partial [Capsella rubella]
Length=510

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/457 (69%), Positives = 371/457 (81%), Gaps = 9/457 (2%)
 Frame = -3

Query  1546  QPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFM  1367
             +P DQ +DE    +  GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGLK+ENIVV M
Sbjct  61    KPADQDEDE----DGVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVMM  116

Query  1366  YDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgk  1187
             YDDIAN+  NPR G +INHPNG DVYAGVPKDYTG  VTAAN YAVLLGD++ VKGGSGK
Sbjct  117   YDDIANHQLNPRPGTLINHPNGEDVYAGVPKDYTGSNVTAANFYAVLLGDQKAVKGGSGK  176

Query  1186  vvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACE  1007
             V+ SK +D IF+YY DHGGPGVLGMPN PH+YA DFIE LKKKH++GTYK+MVIYVEACE
Sbjct  177   VIASKPNDHIFVYYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGTYKEMVIYVEACE  236

Query  1006  SGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSE  827
             SGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYSVAWMEDSE
Sbjct  237   SGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYSVAWMEDSE  296

Query  826   SHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLP  647
             +HNL +ETI++QY+ VK+RTSNYN + AGSHVMEYG+ D IK EK+YLYQGFDPAT++LP
Sbjct  297   NHNLKKETIKQQYQTVKMRTSNYNTYSAGSHVMEYGN-DSIKAEKLYLYQGFDPATVSLP  355

Query  646   GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDN  467
              N++   +  GVVNQRDADLLF+W  Y+   D +  K   LKE+T+T  HR+ LDAS++ 
Sbjct  356   PNELPVKSQVGVVNQRDADLLFLWHMYRRSEDGSRKKDDTLKELTETTRHRKHLDASVEL  415

Query  466   LGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANI  287
             +   LFGP    N+L S+R+PGL LVDDW+CLKS VRVFETHCGSL QYGMKHMRAFAN+
Sbjct  416   IDTILFGP--AMNVLNSIREPGLPLVDDWECLKSTVRVFETHCGSLTQYGMKHMRAFANV  473

Query  286   CNSNISEAAMEEACKNTCSEMKTMKYT-HPSKV-YSA  182
             CN+ IS+  MEEA    C      +Y  HPS + YSA
Sbjct  474   CNNGISKELMEEASTAACGGYIEARYMLHPSILDYSA  510



>emb|CDY39808.1| BnaA09g10600D [Brassica napus]
Length=484

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/464 (67%), Positives = 376/464 (81%), Gaps = 6/464 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
              R++P I  P ++      E  T GTRWAVL+AGS+GY NYRHQADVCHAYQIL++GGLK
Sbjct  26    GRFEPKILMPTEEAKSNEQE-STIGTRWAVLIAGSSGYGNYRHQADVCHAYQILRKGGLK  84

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             +ENIVV MYDDIAN+  NPR G +INHP+G DVYAGVPKDYTG  VTAAN YAVLLGDKE
Sbjct  85    EENIVVMMYDDIANHPLNPRPGTLINHPDGEDVYAGVPKDYTGHNVTAANFYAVLLGDKE  144

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              V GGSGKV+ SKA+D IF+YY+DHGGPGVLGMPN P+LYA DFIE LKKKH+A TYK+M
Sbjct  145   AVTGGSGKVIASKANDHIFVYYSDHGGPGVLGMPNKPYLYATDFIETLKKKHAAETYKEM  204

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             VIYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYS
Sbjct  205   VIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYS  264

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGF  671
             VAWMEDSE+HNL +ET+++QY+ VK+RTSNYN +  GSHVMEYG+   IK EK+YLYQGF
Sbjct  265   VAWMEDSETHNLKKETVKQQYQTVKMRTSNYNTYSEGSHVMEYGNSS-IKSEKLYLYQGF  323

Query  670   DPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             DPAT+N P N++   +P GVVNQRDADL+F+W+ Y+ + ++   K +++KE+T+T  HR+
Sbjct  324   DPATVNYPANELPVKSPVGVVNQRDADLIFLWQMYR-RSEDGPRKDEIMKELTETTRHRK  382

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              LD S++ +   LFGP   +N+LKSVR+PGL LVDDW+CLKS+VRVFE HCGSL QYGMK
Sbjct  383   HLDTSVELISTVLFGPT--TNVLKSVREPGLPLVDDWECLKSVVRVFEMHCGSLTQYGMK  440

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKV-YSA  182
             HMRAFANICN+ +S+  M+EA    C   +    +HPS V YSA
Sbjct  441   HMRAFANICNNGVSKELMKEASAAACGGYEARFTSHPSVVGYSA  484



>ref|XP_002304429.2| hypothetical protein POPTR_0003s11280g [Populus trichocarpa]
 gb|EEE79408.2| hypothetical protein POPTR_0003s11280g [Populus trichocarpa]
Length=495

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/457 (68%), Positives = 372/457 (81%), Gaps = 6/457 (1%)
 Frame = -3

Query  1585  QNLQAARWDPL---IRQPVDQKDDE--SPEGETQGTRWAVLVAGSNGYANYRHQADVCHA  1421
             Q+ QAAR +P+   I  P ++   E    +G+  GTRWAVLVAGSNGY NYRHQADVCHA
Sbjct  24    QSSQAARLNPVEAGILMPTEKDGPEVDDDDGKEIGTRWAVLVAGSNGYGNYRHQADVCHA  83

Query  1420  YQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAAN  1241
             YQ+L++GG+K+ENIVVFMYDDIA + FNPR GVIINHP G DVYAGVPKDYTG QVT  N
Sbjct  84    YQLLRKGGIKEENIVVFMYDDIAKHEFNPRPGVIINHPQGDDVYAGVPKDYTGVQVTTEN  143

Query  1240  LYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKK  1061
             LYAVLLG+K  VKGGSGKVVDS  +DRIF+YY+DHGGPGVLGMP +P LYA DFIEVLKK
Sbjct  144   LYAVLLGNKSAVKGGSGKVVDSMPNDRIFLYYSDHGGPGVLGMPTMPFLYAMDFIEVLKK  203

Query  1060  KHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPE  881
             KH++G+YK+MV+Y+EACESGS FEG+MP+D+NIYVTTASNAEE+SWGTYCPG EP+PPPE
Sbjct  204   KHASGSYKEMVMYIEACESGSIFEGIMPKDINIYVTTASNAEENSWGTYCPGMEPSPPPE  263

Query  880   YITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIK  701
             Y TCLGDLYSV+WMEDS  HNL  ETIE+QY +VK RTSNYN F +GSHVM+YG++  IK
Sbjct  264   YFTCLGDLYSVSWMEDSGKHNLRRETIEQQYHSVKERTSNYNTFTSGSHVMQYGNKS-IK  322

Query  700   PEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLK  521
              EK+YLYQGF+PA++N P N +       VVNQRDA+L+F+W+ YK   D +  K ++L 
Sbjct  323   GEKLYLYQGFNPASVNFPPNNVHIGGRMDVVNQRDAELVFLWQMYKRSEDGSEKKTQILN  382

Query  520   EITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETH  341
             +I +TM HR +LD+S++ +G  LFG + GS ILKSVR+PG  LVDDW CLKSMVR FETH
Sbjct  383   QIKETMRHRTQLDSSMELIGTLLFGRKKGSAILKSVREPGSPLVDDWICLKSMVRRFETH  442

Query  340   CGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCS  230
             CGSL QYGMKHMRAFANICN  +S+A+MEEAC   CS
Sbjct  443   CGSLTQYGMKHMRAFANICNGGVSQASMEEACIAACS  479



>ref|XP_006579475.1| PREDICTED: seed maturation protein PM40 isoform X1 [Glycine max]
 gb|KHN04332.1| Vacuolar-processing enzyme [Glycine soja]
Length=495

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/462 (68%), Positives = 372/462 (81%), Gaps = 5/462 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WD +I+ P +  D +S      GTRWAVLVAGSNGY NYRHQADVCHAYQ+L +GGLK+E
Sbjct  38    WDSVIKLPAEPVDADS--DHEVGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGLKEE  95

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA +  NPR GVIINHP G DVYAGVPKDYTG+ VTA NL+AV+LGDK  V
Sbjct  96    NIVVFMYDDIATDELNPRPGVIINHPEGQDVYAGVPKDYTGENVTAQNLFAVILGDKNKV  155

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKV++SK +DRIFIYY+DHGGPGVLGMPN+P+LYA DFIEVLKKKH++G YK MVI
Sbjct  156   KGGSGKVINSKPEDRIFIYYSDHGGPGVLGMPNMPYLYAMDFIEVLKKKHASGGYKKMVI  215

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             YVEACESGS FEG+MP+DL IYVTTASNA+E+SWGTYCPG +P+PPPEYITCLGDLYSVA
Sbjct  216   YVEACESGSMFEGIMPKDLQIYVTTASNAQENSWGTYCPGMDPSPPPEYITCLGDLYSVA  275

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSE+HNL  E++++QY++VK RTSN+N++  GSHVM+YG  +I   EK+YLYQGFDP
Sbjct  276   WMEDSETHNLKRESVKQQYKSVKQRTSNFNNYAMGSHVMQYGDTNITA-EKLYLYQGFDP  334

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             A +N P    R  T   VVNQRDA+L FMW+ Y+        K  +LK+I +T+ HR+ +
Sbjct  335   AAVNFPPQNGRLETKMEVVNQRDAELFFMWQMYQRSNHQPEKKTDILKQIAETVKHRKHI  394

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S++ +GV L+GP  GS++L+S+R PGLALVDDW CLKSMVRVFETHCG+L QYGMKHM
Sbjct  395   DGSVELIGVLLYGPGKGSSVLQSMRAPGLALVDDWTCLKSMVRVFETHCGTLTQYGMKHM  454

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             RAFANICNS +SEA+MEE C   C E       HPS K YSA
Sbjct  455   RAFANICNSGVSEASMEEVCVAAC-EGYDSGLLHPSNKGYSA  495



>ref|XP_011018251.1| PREDICTED: vacuolar-processing enzyme [Populus euphratica]
Length=494

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/458 (67%), Positives = 376/458 (82%), Gaps = 5/458 (1%)
 Frame = -3

Query  1591  QLQNLQAARWDPL---IRQPVDQKDDE-SPEGETQGTRWAVLVAGSNGYANYRHQADVCH  1424
              +Q++QAAR +P+   I  P  + + E   +GE  G+RWAVLVAGS+GY NYRHQADVCH
Sbjct  22    HVQSVQAARLNPVEPRILMPTGKDEPEVDDDGEEIGSRWAVLVAGSSGYGNYRHQADVCH  81

Query  1423  AYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAA  1244
             AYQ+L++GG+K+ENIVVFMYDDIA + FNPR GVIINHP G DVYAGVPKDYTG+QV   
Sbjct  82    AYQLLRKGGIKEENIVVFMYDDIAMHEFNPRPGVIINHPQGDDVYAGVPKDYTGEQVNTE  141

Query  1243  NLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLK  1064
             NLYAVLLG+K  VKGGSGKVVDSK +DRIF+YY+DHGGPGVLGMPN+P LYA DFIEVLK
Sbjct  142   NLYAVLLGNKSAVKGGSGKVVDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAMDFIEVLK  201

Query  1063  KKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPP  884
             KKH++G+YK+MV+Y+EACESGS FEG++P+ +NIYVTTASNAEESSWGTYCPG +P+PP 
Sbjct  202   KKHASGSYKEMVMYIEACESGSIFEGIIPKAINIYVTTASNAEESSWGTYCPGMDPSPPS  261

Query  883   EYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDII  704
             EY+TCLGDLYSVAWMEDSE+HNL +ETI++QY +VK RTSNYN F +GSHVM+YG+   +
Sbjct  262   EYVTCLGDLYSVAWMEDSETHNLKKETIKQQYHSVKERTSNYNTFTSGSHVMQYGNES-L  320

Query  703   KPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLL  524
             + EK++LYQGFDPA++N P N         VVNQRDA+L+F+W+ YK     +  K ++L
Sbjct  321   RGEKLFLYQGFDPASVNFPPNNGHIGAHMNVVNQRDAELVFLWQMYKRAEGGSEKKTQIL  380

Query  523   KEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFET  344
              +I +TM HR  LD+S++ +G  LFGP+ GS ILKSVR+PG  LVDDW+CLKSMVR+FET
Sbjct  381   NQIKETMRHRTHLDSSMELIGTLLFGPKKGSAILKSVREPGSPLVDDWRCLKSMVRLFET  440

Query  343   HCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCS  230
             HCGSL QYGMKHMRAFANICN  +S A+MEEAC   CS
Sbjct  441   HCGSLTQYGMKHMRAFANICNGGVSLASMEEACVAACS  478



>emb|CDY03258.1| BnaC09g10900D [Brassica napus]
Length=490

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/465 (67%), Positives = 377/465 (81%), Gaps = 13/465 (3%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
              R++P I  P ++++       T GTRWAVL+AGS+GY NYRHQADVCHAYQIL++GGLK
Sbjct  27    GRFEPKILMPTEEEN-------TIGTRWAVLIAGSSGYGNYRHQADVCHAYQILRKGGLK  79

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             +ENIVV MYDDIAN+  NPR G +INHP+G DVY GVPKDYTG  VTAAN YAVLLGDKE
Sbjct  80    EENIVVMMYDDIANHPLNPRPGTLINHPDGEDVYTGVPKDYTGHNVTAANFYAVLLGDKE  139

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              V GGSGKV+ SK +D IF+YY+DHGGPGVLGMPN P+LYA DFIE LKKKH+A TYK+M
Sbjct  140   AVTGGSGKVIASKVNDHIFVYYSDHGGPGVLGMPNKPYLYATDFIETLKKKHAAETYKEM  199

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             VIYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYS
Sbjct  200   VIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYS  259

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGF  671
             VAWMEDSE+HNL +ET+++QY+ VK+RTSNYN +  GSHVMEYG+   IK EK+YLYQGF
Sbjct  260   VAWMEDSETHNLKKETVKQQYQTVKMRTSNYNTYSEGSHVMEYGNSS-IKSEKLYLYQGF  318

Query  670   DPATINLPGNQIR-RLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHR  494
             DPAT NLP N++  + +P GVVNQRDADL+F+W+ Y+   D +  K +++KE+T+T  HR
Sbjct  319   DPATANLPSNELPVKSSPVGVVNQRDADLIFLWQMYRTSEDGS-RKDEIMKELTETTRHR  377

Query  493   QRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGM  314
             ++LD S++ +G  LFGP   +N+LKSVR+PGL LVDDW+CLKS+VRVFE HCGSL QYGM
Sbjct  378   KQLDTSVELIGTVLFGPT--TNVLKSVREPGLPLVDDWECLKSVVRVFEMHCGSLTQYGM  435

Query  313   KHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKV-YSA  182
             KHMRAFANICN+ +S+  M+EA    C   +    +HPS V YSA
Sbjct  436   KHMRAFANICNNGVSKELMKEASAAACGGYEARFMSHPSVVGYSA  480



>ref|XP_004515742.1| PREDICTED: vacuolar-processing enzyme-like [Cicer arietinum]
Length=494

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/449 (69%), Positives = 365/449 (81%), Gaps = 4/449 (1%)
 Frame = -3

Query  1579  LQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             L    WD +IR P +  D +S EG   GTRWAVLVAGS+GY NYRHQADVCHAYQ+L +G
Sbjct  33    LNRFEWDSVIRLPTEPVDADSDEG---GTRWAVLVAGSSGYGNYRHQADVCHAYQLLVKG  89

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             G+K+ENIVVFMYDDIA N  NPR GVIINHP G DVYAGVPKDYTGD VTA NLYAV+LG
Sbjct  90    GVKEENIVVFMYDDIAQNELNPRPGVIINHPQGPDVYAGVPKDYTGDSVTAENLYAVILG  149

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             DK  VKGGSGKV++SKA+DRIFIYY+DHGGPGVLGMPN+P+LYA DFI VLKKKH++  Y
Sbjct  150   DKSKVKGGSGKVINSKAEDRIFIYYSDHGGPGVLGMPNMPYLYAMDFINVLKKKHASRGY  209

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K MVIYVEACESGS FEG+MP +LNIYVTTASNA+E+SWGTYCPG +PAPPPE+ITCLGD
Sbjct  210   KKMVIYVEACESGSIFEGIMPNNLNIYVTTASNAQENSWGTYCPGLDPAPPPEFITCLGD  269

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             LYSVAWMEDSE+HNL  ET++ QY++VK RTSN N++  GSHVM+YG  +I   EK+YLY
Sbjct  270   LYSVAWMEDSETHNLKRETVKEQYKSVKERTSNSNNYALGSHVMQYGDTNITD-EKLYLY  328

Query  679   QGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
              GF+PAT+N P +  R  T   VVNQRDA+L FMW+ YK     A  K  +L++I +T+ 
Sbjct  329   HGFNPATVNFPPHNGRLETKMEVVNQRDAELFFMWQLYKRLDHEAEKKRDILEKIAETVK  388

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR  LD S++ +GV LFGPE GS++L+SVR PGL LVDDW+CLKS VRVFETHCGSL QY
Sbjct  389   HRNHLDGSVELVGVLLFGPEKGSSVLQSVRAPGLPLVDDWECLKSRVRVFETHCGSLTQY  448

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTC  233
             GMKHMR+FANICN++ISE + EEAC   C
Sbjct  449   GMKHMRSFANICNNDISETSFEEACLKAC  477



>gb|KHG24041.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=496

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/459 (70%), Positives = 380/459 (83%), Gaps = 5/459 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQ-GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
             +W+  IR P D+ ++     E Q GTRWAVLVAGS+GY NYRHQADVCHAYQ+L++GGLK
Sbjct  35    QWESGIRLPTDKNNEPEELDEQQVGTRWAVLVAGSSGYGNYRHQADVCHAYQLLRKGGLK  94

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             +ENIVVFMYDDIA N  NPR GVIINHP G DVYAGVPKDYTG+ VTAANLYAVLLG+K+
Sbjct  95    EENIVVFMYDDIAMNELNPRPGVIINHPQGDDVYAGVPKDYTGEHVTAANLYAVLLGNKD  154

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              + GGSGKV+DSK +DRIFIYY+DHGGPGVLGMPN+P LYA DF++VLKKKH+AGTYK+M
Sbjct  155   ALSGGSGKVIDSKPNDRIFIYYSDHGGPGVLGMPNMPFLYAMDFLDVLKKKHAAGTYKEM  214

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             V+YVEACESGS FEG+MP+DL++YVTTASNA+ESSWGTYCPG EP PPPE+ITCLGDLYS
Sbjct  215   VLYVEACESGSIFEGIMPKDLDVYVTTASNAQESSWGTYCPGMEPPPPPEFITCLGDLYS  274

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQ-AGSHVMEYGSRDIIKPEKVYLYQG  674
             VAWMEDSE+HNL  ET+E+QYE+VK RTSN+N +   GSHVMEYG+   IK EK+YLYQG
Sbjct  275   VAWMEDSETHNLKRETVEQQYESVKERTSNFNAYAFGGSHVMEYGNTS-IKLEKLYLYQG  333

Query  673   FDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHR  494
             FDPAT+NLP N++   TP   VNQRDAD+LF+W  YK   D +  K ++L++IT+T  HR
Sbjct  334   FDPATVNLPPNELSPNTPMEAVNQRDADILFLWHMYKNSEDGS-KKTEILRQITETKRHR  392

Query  493   QRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGM  314
               LD SID +G  L+GP  GS ILKSVR+ GL LVDDWQCLKS+VR+FETHCGSL QYGM
Sbjct  393   IHLDGSIDLIGTLLYGPAKGSAILKSVRETGLPLVDDWQCLKSVVRLFETHCGSLTQYGM  452

Query  313   KHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS  197
             KHMRAFANICNS +S+A M+EAC   C+    +++ HPS
Sbjct  453   KHMRAFANICNSGVSQALMQEACTAACNGHGPIQW-HPS  490



>ref|XP_010093667.1| Vacuolar-processing enzyme [Morus notabilis]
 gb|EXB54447.1| Vacuolar-processing enzyme [Morus notabilis]
Length=501

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/472 (67%), Positives = 378/472 (80%), Gaps = 8/472 (2%)
 Frame = -3

Query  1600  IACQLQNLQAAR---WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADV  1430
             +   ++N +AAR   W+  IR P D KD+ S + +   TRWAVLVAGS+GY NYRHQADV
Sbjct  28    VVLSVENCRAARFERWESAIRMPTD-KDEYSDQDKELSTRWAVLVAGSSGYGNYRHQADV  86

Query  1429  CHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVT  1250
             CHAYQ+L++GG+K+ENIVVFMYDDIA +  NPR G+IINHP G DVYAGVPKDYTG  VT
Sbjct  87    CHAYQLLRKGGVKEENIVVFMYDDIAMHGLNPRPGIIINHPQGDDVYAGVPKDYTGQYVT  146

Query  1249  AANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEV  1070
               NLYAVLLGDK+ VKGGSGKVVDSK +DRIF+YY+DHGGPGVLGMPN+P LYA DF+EV
Sbjct  147   TENLYAVLLGDKKAVKGGSGKVVDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAMDFVEV  206

Query  1069  LKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAP  890
             LKKKH++GTYK+M+IYVEACESGS FEG+MP D+NIYVTTASNA+E+SWGTYCPG EP+P
Sbjct  207   LKKKHASGTYKEMIIYVEACESGSIFEGIMPRDMNIYVTTASNAQENSWGTYCPGMEPSP  266

Query  889   PPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRD  710
             PPEYITCLGDLYSVAWMEDSE+HNL  ETI++QYE VK RT+N NDF AGSHVMEYG++ 
Sbjct  267   PPEYITCLGDLYSVAWMEDSETHNLKRETIKQQYETVKKRTANANDFTAGSHVMEYGNKS  326

Query  709   IIKPEKVYLYQGFDPATINLPGNQIRRLTPK-GVVNQRDADLLFMWERYKMKGDNAVSKA  533
              IK EK+YLYQGFDPAT+N P N   +L  +  VVNQRDA+L FMW+ YK + ++   K 
Sbjct  327   -IKGEKLYLYQGFDPATLNFPPNDPNKLDMRMEVVNQRDAELFFMWQMYK-RTESRNKKR  384

Query  532   KLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRV  353
             ++L +I +   HR  LD SI+ +G  L+GP+ GS +L SVR PG  LVDDW CLKSMV+ 
Sbjct  385   EILNQIKEATRHRTHLDKSIELIGSLLYGPQKGSLVLNSVRSPGQPLVDDWACLKSMVKS  444

Query  352   FETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS  197
             FE+HCGSL QYGMKHMRAFANICNS +S A+MEEA    CS     ++ HPS
Sbjct  445   FESHCGSLTQYGMKHMRAFANICNSGVSVASMEEAALAVCSGHDVGQW-HPS  495



>ref|XP_009382344.1| PREDICTED: legumain-like [Musa acuminata subsp. malaccensis]
Length=508

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/453 (67%), Positives = 365/453 (81%), Gaps = 7/453 (2%)
 Frame = -3

Query  1573  AARWDPLIRQPVDQKDDESPEG------ETQGTRWAVLVAGSNGYANYRHQADVCHAYQI  1412
             AARWDP+IR P  +   E  EG      E  GT+WA+LVAGS+GY NYRHQADVCHAYQ+
Sbjct  38    AARWDPIIRLPSSRLVPEPGEGGRQDEEEETGTKWALLVAGSSGYGNYRHQADVCHAYQL  97

Query  1411  LKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYA  1232
             L+RGGLK+ENIVV M+DDIA+N  NPR+GVIINHP G DVYAGVPKDYT +QVTA NLYA
Sbjct  98    LRRGGLKEENIVVMMHDDIAHNPLNPRQGVIINHPQGQDVYAGVPKDYTKEQVTAKNLYA  157

Query  1231  VLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHS  1052
             VLLGD+  ++GGSGKV+DSK DDRIFIYY+DHGGPGVLGMPN+P LYA DFIEVLK KH+
Sbjct  158   VLLGDRSAIEGGSGKVIDSKPDDRIFIYYSDHGGPGVLGMPNMPFLYAADFIEVLKMKHA  217

Query  1051  AGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYIT  872
             +  YK+MVIYVEACESGS FEG+MPE+L+IYVTTASNA ESSWGTYCPG +P PP E+ T
Sbjct  218   SNGYKEMVIYVEACESGSIFEGLMPENLDIYVTTASNAVESSWGTYCPGMDPPPPREFTT  277

Query  871   CLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEK  692
             CLGDLYSVAWMEDSE+HNL EET+ +Q+E VK+RTSN++ +  GSHVMEYG +  +K + 
Sbjct  278   CLGDLYSVAWMEDSETHNLKEETVGKQFEEVKMRTSNHDTYNTGSHVMEYGDKS-VKSDV  336

Query  691   VYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEIT  512
             + LYQGF+PA  N+  N +R   P GV+NQRDADLLFMW+ Y+   + +  K ++L+EIT
Sbjct  337   LSLYQGFEPAIANVTENALRLRMPMGVINQRDADLLFMWKMYEQSDERSSKKKEILEEIT  396

Query  511   DTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGS  332
              T++HR  LD+SID +G  +FG E G +IL++VR  G ALVDDW+CLKSMVR FE+HCGS
Sbjct  397   KTLMHRVHLDSSIDYIGNQIFGSEIGPSILRAVRPSGQALVDDWECLKSMVRAFESHCGS  456

Query  331   LGQYGMKHMRAFANICNSNISEAAMEEACKNTC  233
             L QYGMKHMRAFANICN  IS+  ME AC  +C
Sbjct  457   LTQYGMKHMRAFANICNEGISKDVMEAACSRSC  489



>gb|AET08888.1| vacuolar processing enzyme 1 [Triticum monococcum]
 emb|CCC14975.1| VPE2A protein [Triticum urartu]
Length=491

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/468 (66%), Positives = 373/468 (80%), Gaps = 7/468 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQK----DDESPEGETQ-GTRWAVLVAGSNGYANYRHQADVCHAYQILK  1406
              +WDP+IR P +++    D+ S EGE   GTRWAVLVAGS+GY NYRHQAD+CHAYQIL+
Sbjct  26    GKWDPVIRMPGEEEPATGDESSEEGEDGVGTRWAVLVAGSSGYGNYRHQADICHAYQILR  85

Query  1405  RGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVL  1226
             +GG+K+ENIVVFMYDDIANN  NPR GVIINHP G DVYAGVPKDYTG++VTA N YAVL
Sbjct  86    KGGVKEENIVVFMYDDIANNPLNPRPGVIINHPEGEDVYAGVPKDYTGEEVTAKNFYAVL  145

Query  1225  LgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAG  1046
             LG+K  V GGS KV+DSK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VL++KH++ 
Sbjct  146   LGNKTAVTGGSKKVIDSKPNDHIFIYYSDHGGPGVLGMPNLPYLYAADFIKVLQEKHASN  205

Query  1045  TYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCL  866
             TY  MVIYVEACESGS FEG+MP DLNIYVTTASNAEESSWGTYCPG EP+PP EYITCL
Sbjct  206   TYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYITCL  265

Query  865   GDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVY  686
             GDLYS++WMEDSE++NL EETI++QYE VK RTS+ N + AGSHVMEYG +   K EK+Y
Sbjct  266   GDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDK-TFKDEKLY  324

Query  685   LYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDT  506
             LYQGF+PA  N+  N +    PK  +NQRDADLLF+W RY++  + +  K  +L+EI++T
Sbjct  325   LYQGFNPANTNIT-NMLLLQAPKAAINQRDADLLFLWRRYELLHEKSKEKGNVLREISET  383

Query  505   MLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLG  326
             + HR+ LD+SID +G  LFG ENG ++L++VR  G  LVDDW CLK MVR+FE+HCGSL 
Sbjct  384   VTHRKHLDSSIDFIGKLLFGFENGPSVLQAVRPSGKPLVDDWDCLKRMVRIFESHCGSLT  443

Query  325   QYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             QYGMKHMRAFANICN+ IS   M+EA    C    + +++   + YSA
Sbjct  444   QYGMKHMRAFANICNNGISGTTMKEASIGACGVQNSARWSSLIQGYSA  491



>ref|XP_010646818.1| PREDICTED: vacuolar-processing enzyme [Vitis vinifera]
Length=494

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/467 (67%), Positives = 373/467 (80%), Gaps = 4/467 (1%)
 Frame = -3

Query  1579  LQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             L+  RWD  I  P D+ + E  +GE +GTRWAVLVAGS GY NYRHQADVCHAYQ+LKRG
Sbjct  31    LRLNRWDQKIWMPTDKVEAEE-DGEERGTRWAVLVAGSYGYGNYRHQADVCHAYQLLKRG  89

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             GLKDENIVVFMYDDIA + FNPR GVIINHP G DVYAGVPKDYTG+ VTA NL+AVLLG
Sbjct  90    GLKDENIVVFMYDDIATHDFNPRPGVIINHPQGDDVYAGVPKDYTGEDVTAQNLFAVLLG  149

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             DK  +KGGSGKVV+SK +DRIF+YY+DHGG GVLGMPN+P LYA DFI+VLK KH++G+Y
Sbjct  150   DKSLLKGGSGKVVESKPNDRIFLYYSDHGGQGVLGMPNMPFLYAKDFIDVLKMKHASGSY  209

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K+MV+YVEACESGS FEG+MP+DLNIYVTTAS  +E SWGTYCPG EPAPPPEYITCLGD
Sbjct  210   KEMVLYVEACESGSIFEGLMPDDLNIYVTTASGPDEESWGTYCPGMEPAPPPEYITCLGD  269

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             L+SVAW+EDSE+HNL ++TIE QY+ VK+RTSN+N +  GSHVM YG+   IK E +YLY
Sbjct  270   LFSVAWLEDSETHNLKKQTIEDQYQRVKVRTSNHNTYSVGSHVMVYGNES-IKTELLYLY  328

Query  679   QGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
             QGFDPAT  LP N+        V+NQRDADLLF+W+RYK    ++  K ++LK++T TM 
Sbjct  329   QGFDPATDKLPQNKFDLDIRMDVINQRDADLLFLWQRYKRSKADS-EKKEILKQLTQTMQ  387

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR  LD SI+ +G+ L GPENG  +L +VR  GL +VDDW+CLKSMV VFET CGSL QY
Sbjct  388   HRVHLDQSIELIGMLLLGPENGPPLLNAVRPRGLPVVDDWECLKSMVVVFETRCGSLTQY  447

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             GMKHMRAFANICN+ IS  AMEEAC++ CS    +    P+ + YSA
Sbjct  448   GMKHMRAFANICNNGISLTAMEEACRSACSSHTILDQWSPTIRGYSA  494



>gb|AGC54786.1| beta vacuolar processing enzyme [Vitis vinifera]
Length=494

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/467 (67%), Positives = 372/467 (80%), Gaps = 4/467 (1%)
 Frame = -3

Query  1579  LQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             L+ +RWD  I  P D+ + E  +GE +GT+WAVLVAGS GY NYRHQADVCHAYQ+LKRG
Sbjct  31    LRLSRWDQKIWMPTDKVEAEE-DGEERGTKWAVLVAGSYGYGNYRHQADVCHAYQLLKRG  89

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             GLKDENIVVFMYDDIA + FNPR GVIINHP G DVYAGVPKDYTG+ VTA NL+AVLLG
Sbjct  90    GLKDENIVVFMYDDIATHDFNPRPGVIINHPQGDDVYAGVPKDYTGEDVTAQNLFAVLLG  149

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             DK  +KGGSGKVV+SK +DRIF+YY+DHGG GVLGMPN+P LYA DFI+VLK KH++G+Y
Sbjct  150   DKSLLKGGSGKVVESKPNDRIFLYYSDHGGQGVLGMPNMPFLYAKDFIDVLKMKHASGSY  209

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K+MV+YVEACESGS FEG+MP+DLNIYVTTAS  +E SWGTYCPG EPAPPPEYITCLGD
Sbjct  210   KEMVLYVEACESGSIFEGLMPDDLNIYVTTASGPDEESWGTYCPGMEPAPPPEYITCLGD  269

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             L SVAW+EDSE+HNL ++TIE QY+ VK+RTSN+N +  GSHVM YG+   IK E +YLY
Sbjct  270   LLSVAWLEDSETHNLKKQTIEDQYQRVKVRTSNHNTYSVGSHVMVYGNES-IKTELLYLY  328

Query  679   QGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
             QGFDPAT  LP N+        V+NQRDADLLF+W+RYK +      K ++LK++T TM 
Sbjct  329   QGFDPATDKLPQNKFDLDIRMDVINQRDADLLFLWQRYK-RSKAGSEKKEILKQLTQTMQ  387

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR  LD SI+ +G+ L GPENG  +L +VR  GL +VDDW+CLKSMV VFET CGSL QY
Sbjct  388   HRVHLDQSIELIGMLLLGPENGPPLLNAVRPRGLPVVDDWECLKSMVVVFETRCGSLTQY  447

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             GMKHMRAFANICN+ IS  AMEEAC++ CS    +    P+ + YSA
Sbjct  448   GMKHMRAFANICNNGISLTAMEEACRSACSSHTILDQWSPTIRGYSA  494



>ref|XP_002509577.1| Vacuolar-processing enzyme precursor [Ricinus communis]
 sp|P49042.1|VPE_RICCO RecName: Full=Vacuolar-processing enzyme; Short=VPE; Flags: Precursor 
[Ricinus communis]
 dbj|BAA04225.1| precursor of vacuolar processing enzyme [Ricinus communis]
 gb|EEF50964.1| Vacuolar-processing enzyme precursor [Ricinus communis]
Length=497

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/473 (66%), Positives = 375/473 (79%), Gaps = 5/473 (1%)
 Frame = -3

Query  1588  LQNLQAARWDPL---IRQPVDQKDDESPEGETQ-GTRWAVLVAGSNGYANYRHQADVCHA  1421
             +  L A+R +P    I  P ++ +    + + Q GTRWAVLVAGS G+ NYRHQADVCHA
Sbjct  26    IPGLLASRLNPFEPGILMPTEEAEPVQVDDDDQLGTRWAVLVAGSMGFGNYRHQADVCHA  85

Query  1420  YQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAAN  1241
             YQ+L++GGLK+ENI+VFMYDDIA N  NPR GVIINHP G DVYAGVPKDYTG+ VTA N
Sbjct  86    YQLLRKGGLKEENIIVFMYDDIAKNELNPRPGVIINHPQGEDVYAGVPKDYTGEHVTAKN  145

Query  1240  LYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKK  1061
             LYAVLLGDK  V+GGSGKVVDSK +DRIF+YY+DHGGPGVLGMPNLP+LYA DFIEVLKK
Sbjct  146   LYAVLLGDKSAVQGGSGKVVDSKPNDRIFLYYSDHGGPGVLGMPNLPYLYAMDFIEVLKK  205

Query  1060  KHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPE  881
             KH+AG YK MVIYVEACESGS FEG+MP+D++IYVTTASNA+ESSWGTYCPG EP+PPPE
Sbjct  206   KHAAGGYKKMVIYVEACESGSIFEGIMPKDVDIYVTTASNAQESSWGTYCPGMEPSPPPE  265

Query  880   YITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIK  701
             + TCLGDLYSVAWMEDSESHNL +ET+++QY +VK RTSNYN + AGSHVM+YG++  IK
Sbjct  266   FTTCLGDLYSVAWMEDSESHNLKKETVKQQYSSVKARTSNYNTYAAGSHVMQYGNQS-IK  324

Query  700   PEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLK  521
              +K+YL+QGFDPA++N P N      P  VVNQRDA+L FMW+ YK   + +  K ++L+
Sbjct  325   ADKLYLFQGFDPASVNFPPNNAHLNAPMEVVNQRDAELHFMWQLYKRSENGSEKKKEILQ  384

Query  520   EITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETH  341
             +I D + HR  LD+S+  +G  LFGP+  S ILKSVR+PG  LVDDW CLKSMVRVFET 
Sbjct  385   QIKDAIKHRSHLDSSMQLIGDLLFGPKKASAILKSVREPGSPLVDDWGCLKSMVRVFETC  444

Query  340   CGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             CGSL QYGMKHMR FANICN+ +S  +MEEAC   CS     ++   ++ YSA
Sbjct  445   CGSLTQYGMKHMRTFANICNAGVSHTSMEEACNAACSGHDAGQWHPTNQGYSA  497



>ref|XP_010053427.1| PREDICTED: vacuolar-processing enzyme isoform X1 [Eucalyptus 
grandis]
 gb|KCW77726.1| hypothetical protein EUGRSUZ_D02025 [Eucalyptus grandis]
Length=496

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/463 (69%), Positives = 381/463 (82%), Gaps = 9/463 (2%)
 Frame = -3

Query  1561  DPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDEN  1382
             +P+IR P + ++    EG+  GTRWAVLVAGS+GY NYRHQADVCHAYQILK+GGLK+EN
Sbjct  40    EPVIRMPTEGEEAVDEEGQGVGTRWAVLVAGSSGYGNYRHQADVCHAYQILKKGGLKEEN  99

Query  1381  IVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvk  1202
             IVVFMYDDIA +  NPR GVIINHP G DVYAGVPKDYTG  VTAANLYAVLLGDK  VK
Sbjct  100   IVVFMYDDIATHQLNPRPGVIINHPKGDDVYAGVPKDYTGKNVTAANLYAVLLGDKSAVK  159

Query  1201  ggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIY  1022
             GGSGKVV SK +DRIF+YY+DHGGPGVLGMPN+P LYA DFI VLKKKH+A  YK+M+IY
Sbjct  160   GGSGKVVSSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAMDFINVLKKKHAAKGYKEMIIY  219

Query  1021  VEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAW  842
             VEACESGS FEG+MP+DL+IYVTTASNA+ESS+GTYCPG EP PPPEYITCLGDLYS+AW
Sbjct  220   VEACESGSVFEGIMPKDLDIYVTTASNAQESSFGTYCPGMEPPPPPEYITCLGDLYSIAW  279

Query  841   MEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPA  662
             MEDSESHNL +ETI++QY++VK RTSN+N++ AGSHVMEYG++  IK E++YLYQGFDPA
Sbjct  280   MEDSESHNLKKETIKQQYQSVKQRTSNFNNYNAGSHVMEYGNQS-IKDERLYLYQGFDPA  338

Query  661   TINLPGNQIRRLTPK--GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
             T+N P N   R+ P+  G+VNQRDADL F+W+ YK   +N+  K ++  +I+ TM HR  
Sbjct  339   TVNFPPN---RVPPEYMGIVNQRDADLHFLWQMYKKTENNSEKKKEITGQISSTMRHRIH  395

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             LD SI+ +G  LFGPE  S++L + R+PGL LVDDW+CLKSMVRVFETHCGSL QYGMKH
Sbjct  396   LDGSIEMIGALLFGPEKSSSVLNAAREPGLPLVDDWKCLKSMVRVFETHCGSLTQYGMKH  455

Query  307   MRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKV-YSA  182
             MRAFANICNS ++  +MEEAC + C+    +   HPS + YSA
Sbjct  456   MRAFANICNSRVTRESMEEACASACAGHGGL--WHPSNLGYSA  496



>ref|XP_003569976.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Brachypodium 
distachyon]
Length=490

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/473 (64%), Positives = 373/473 (79%), Gaps = 8/473 (2%)
 Frame = -3

Query  1582  NLQAARWDPLIR-----QPVDQKDDESPEGETQ-GTRWAVLVAGSNGYANYRHQADVCHA  1421
             ++   +W+PLIR     +P   +  E PE E   GTRWAVL+AGS+GY NYRHQAD+CHA
Sbjct  20    DVSKGKWEPLIRMPGEKEPATARGFEGPEEEDGVGTRWAVLIAGSSGYGNYRHQADICHA  79

Query  1420  YQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAAN  1241
             YQ+L++GGLK+ENIVVFMYDDIAN+A NPR GVIINHP G DVYAGVPKDYTG+QVTA N
Sbjct  80    YQVLRKGGLKEENIVVFMYDDIANSALNPRPGVIINHPQGEDVYAGVPKDYTGEQVTAKN  139

Query  1240  LYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKK  1061
             LYAVLLG+K  V GGS KV+DS+  D IFIYY+DHGGPGVLGMPNLP+LYA DFI++L++
Sbjct  140   LYAVLLGNKTAVTGGSKKVIDSQPKDHIFIYYSDHGGPGVLGMPNLPYLYAGDFIKILQQ  199

Query  1060  KHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPE  881
             KH++ TY  MVIYVEACESGS FEG+MP DLNIYVTTASNAEESSWGTYCPG EP+PP E
Sbjct  200   KHASNTYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSE  259

Query  880   YITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIK  701
             YITCLGDLYSV+WMEDSE+HNL EETI++QYE VK RTS+ N + AGSHVMEYG +   K
Sbjct  260   YITCLGDLYSVSWMEDSENHNLKEETIKKQYEVVKRRTSDLNSYSAGSHVMEYGDK-TFK  318

Query  700   PEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLK  521
              EK+YLYQGF+PA  N+  N++    P+  +NQRDADLLF+W RY+M  + +  K K+L+
Sbjct  319   DEKLYLYQGFNPANANIT-NKLFWQAPRAAINQRDADLLFLWRRYEMLHEKSKEKVKVLR  377

Query  520   EITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETH  341
             EI++T++HR+ LD S+D +G  LFG ENG ++L++VR  G  LVDDW CLK MVR+FE+H
Sbjct  378   EISETVMHRKHLDNSVDLIGQLLFGFENGPSVLQAVRPSGKPLVDDWDCLKRMVRIFESH  437

Query  340   CGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             CG L QYGMKHMRAFANICN+ I  + M+E   + C      +++   + YSA
Sbjct  438   CGPLTQYGMKHMRAFANICNNGIPGSTMKEGSISACGSRNIARWSPLIQGYSA  490



>emb|CBI28507.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/467 (67%), Positives = 373/467 (80%), Gaps = 4/467 (1%)
 Frame = -3

Query  1579  LQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             L+  RWD  I  P D+ + E  +GE +GTRWAVLVAGS GY NYRHQADVCHAYQ+LKRG
Sbjct  103   LRLNRWDQKIWMPTDKVEAEE-DGEERGTRWAVLVAGSYGYGNYRHQADVCHAYQLLKRG  161

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             GLKDENIVVFMYDDIA + FNPR GVIINHP G DVYAGVPKDYTG+ VTA NL+AVLLG
Sbjct  162   GLKDENIVVFMYDDIATHDFNPRPGVIINHPQGDDVYAGVPKDYTGEDVTAQNLFAVLLG  221

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             DK  +KGGSGKVV+SK +DRIF+YY+DHGG GVLGMPN+P LYA DFI+VLK KH++G+Y
Sbjct  222   DKSLLKGGSGKVVESKPNDRIFLYYSDHGGQGVLGMPNMPFLYAKDFIDVLKMKHASGSY  281

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K+MV+YVEACESGS FEG+MP+DLNIYVTTAS  +E SWGTYCPG EPAPPPEYITCLGD
Sbjct  282   KEMVLYVEACESGSIFEGLMPDDLNIYVTTASGPDEESWGTYCPGMEPAPPPEYITCLGD  341

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             L+SVAW+EDSE+HNL ++TIE QY+ VK+RTSN+N +  GSHVM YG+   IK E +YLY
Sbjct  342   LFSVAWLEDSETHNLKKQTIEDQYQRVKVRTSNHNTYSVGSHVMVYGNES-IKTELLYLY  400

Query  679   QGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
             QGFDPAT  LP N+        V+NQRDADLLF+W+RYK    ++  K ++LK++T TM 
Sbjct  401   QGFDPATDKLPQNKFDLDIRMDVINQRDADLLFLWQRYKRSKADS-EKKEILKQLTQTMQ  459

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR  LD SI+ +G+ L GPENG  +L +VR  GL +VDDW+CLKSMV VFET CGSL QY
Sbjct  460   HRVHLDQSIELIGMLLLGPENGPPLLNAVRPRGLPVVDDWECLKSMVVVFETRCGSLTQY  519

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             GMKHMRAFANICN+ IS  AMEEAC++ CS    +    P+ + YSA
Sbjct  520   GMKHMRAFANICNNGISLTAMEEACRSACSSHTILDQWSPTIRGYSA  566



>gb|AET08895.1| vacuolar processing enzyme 2 [Aegilops tauschii]
 emb|CCC14981.1| VPE2D protein [Aegilops tauschii]
Length=489

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/468 (66%), Positives = 369/468 (79%), Gaps = 7/468 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQK----DDESPEGETQ-GTRWAVLVAGSNGYANYRHQADVCHAYQILK  1406
              +WDP+IR P +++    DD S EGE   GTRWAVLVAGS+GY NYRHQAD+CHAYQIL+
Sbjct  24    GKWDPVIRMPGEEEPATGDDSSEEGEDGVGTRWAVLVAGSSGYGNYRHQADICHAYQILR  83

Query  1405  RGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVL  1226
             +GG+K+ENIVVFMYDDIANN  NPR GVIINHP G DVYAGVPKDYTG+ VTA N YAVL
Sbjct  84    KGGVKEENIVVFMYDDIANNPLNPRPGVIINHPEGEDVYAGVPKDYTGEAVTAKNFYAVL  143

Query  1225  LgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAG  1046
             LG+K  V GGS KV+DSK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VL++KH++ 
Sbjct  144   LGNKTAVTGGSKKVIDSKPNDHIFIYYSDHGGPGVLGMPNLPYLYAADFIKVLQEKHASN  203

Query  1045  TYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCL  866
             TY  MVIYVEACESGS FEG+MP DLNIYVTTASNAEESSWGTYCPG EP+PP EYITCL
Sbjct  204   TYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYITCL  263

Query  865   GDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVY  686
             GDLYS++WMEDSE++NL EETI++QYE VK RTS+ N + AGSHVMEYG     K EK+Y
Sbjct  264   GDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDM-TFKDEKLY  322

Query  685   LYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDT  506
             LYQGF+PA  N+  N++    PK  +NQRDADLLF+W RY++    +  KA +L EI +T
Sbjct  323   LYQGFNPANTNIT-NKLFLQAPKAAINQRDADLLFLWRRYELLHGKSKEKANVLTEIGET  381

Query  505   MLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLG  326
             + HR+ LD SID +G  LFG ENG + L++VR  G  LVDDW CLK MVR+FE+HCGSL 
Sbjct  382   VAHRKHLDNSIDFIGKLLFGFENGPSELQAVRPSGKPLVDDWDCLKRMVRIFESHCGSLT  441

Query  325   QYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             QYGMKHMRAFANICN+ +S   M+EA  NTC    + + +   + YSA
Sbjct  442   QYGMKHMRAFANICNNGVSGTTMKEASINTCGGHNSARLSTLIQGYSA  489



>dbj|BAA09615.1| vacuolar processing enzyme [Arabidopsis thaliana]
Length=484

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/465 (66%), Positives = 369/465 (79%), Gaps = 7/465 (2%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
              R++P I  P ++ +    + +  GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGLK
Sbjct  25    GRFEPKILMPTEEANPADQDEDGVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLK  84

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             +ENIVV MYDDIAN+  NPR G +INHP+G DVYAGVPKDYTG  VTAAN YAVLLGD++
Sbjct  85    EENIVVLMYDDIANHPLNPRPGTLINHPDGDDVYAGVPKDYTGSSVTAANFYAVLLGDQK  144

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              VKGGSGKV+ SK +D IF+YY DHGGPGVLGMPN PH+YA DFIE LKKKH++GTYK+M
Sbjct  145   AVKGGSGKVIASKPNDHIFVYYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGTYKEM  204

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             VIYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYS
Sbjct  205   VIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYS  264

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGF  671
             VAWMEDSE+HNL +ETI++QY    +RTSNYN +  GSHVMEYG+   IK EK+YLYQGF
Sbjct  265   VAWMEDSETHNLKKETIKQQYHT--MRTSNYNTYSGGSHVMEYGNNS-IKSEKLYLYQGF  321

Query  670   DPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             +PAT+NLP N++   +  GVVNQRDADLLF+W  ++   D +  K   LKE+T+T  HR+
Sbjct  322   EPATVNLPLNELPAKSKIGVVNQRDADLLFLWHMHRTSEDGSRKKDDTLKELTETTRHRK  381

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              LDAS++ +   LFGP    N+L  VR+PGL LVDDW+CLKSMVRVFE HCGSL QYGMK
Sbjct  382   HLDASVELIATILFGPT--MNVLNLVREPGLPLVDDWECLKSMVRVFEEHCGSLTQYGMK  439

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYT-HPSKV-YSA  182
             HMRAFAN+CN+ +S+  MEEA    C      +YT HPS + YSA
Sbjct  440   HMRAFANVCNNGVSKELMEEASTAACGGYSEARYTVHPSILGYSA  484



>dbj|BAC41386.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 dbj|BAC41387.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 dbj|BAD25787.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 gb|EAY86869.1| hypothetical protein OsI_08253 [Oryza sativa Indica Group]
 gb|EAZ23976.1| hypothetical protein OsJ_07703 [Oryza sativa Japonica Group]
Length=496

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/473 (65%), Positives = 371/473 (78%), Gaps = 14/473 (3%)
 Frame = -3

Query  1564  WDPLIRQP------------VDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHA  1421
             W+P+IR P               +  E  E +  GTRWAVLVAGS+GY NYRHQADVCHA
Sbjct  26    WEPVIRMPGEVVEEEVATVPRGSEGTEEEEKDGVGTRWAVLVAGSSGYGNYRHQADVCHA  85

Query  1420  YQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAAN  1241
             YQIL++GGLK+ENIVVFMYDDIANN  NPR GVI+NHP G DVYAGVPKDYTGD+VTA N
Sbjct  86    YQILRKGGLKEENIVVFMYDDIANNILNPRPGVIVNHPQGEDVYAGVPKDYTGDEVTAKN  145

Query  1240  LYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKK  1061
              YAVLLG+K  V GGS KV+DSK +D IFI+Y+DHGGPGVLGMPNLP+LYA DF++VL++
Sbjct  146   FYAVLLGNKTAVTGGSRKVIDSKPNDHIFIFYSDHGGPGVLGMPNLPYLYAADFMKVLQE  205

Query  1060  KHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPE  881
             KH++ TY  MVIYVEACESGS FEG+MPEDLNIYVTTASNAEESSWGTYCPG EP+PP E
Sbjct  206   KHASNTYAKMVIYVEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPSPPSE  265

Query  880   YITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIK  701
             YITCLGDLYSV+WMEDSE+HNL EE+I++QYE VK RTS+ N + AGSHVMEYG R   K
Sbjct  266   YITCLGDLYSVSWMEDSETHNLKEESIKKQYEVVKKRTSDMNSYGAGSHVMEYGDR-TFK  324

Query  700   PEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLK  521
              +K+YLYQGFDPA   +  N++    PK  VNQRDADLLF+W RY++  D +  K K L+
Sbjct  325   DDKLYLYQGFDPANAEVK-NKLSWEGPKAAVNQRDADLLFLWRRYELLHDKSEEKLKALR  383

Query  520   EITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETH  341
             EI+DT++HR+ LD+S+D +G  LFG  NG ++L++VR  G  LVDDW CLK MVR+FE+H
Sbjct  384   EISDTVMHRKLLDSSVDLVGKLLFGFGNGPSVLQAVRPSGQPLVDDWDCLKRMVRIFESH  443

Query  340   CGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             CG L QYGMKHMRAFANICN+ IS A+M+EA   TCS   + +++   + YSA
Sbjct  444   CGPLTQYGMKHMRAFANICNNGISGASMKEASIATCSSHNSGRWSSLVQGYSA  496



>ref|NP_001238297.1| seed maturation protein PM40 precursor [Glycine max]
 gb|AAF89646.1|AF169019_1 seed maturation protein PM40 [Glycine max]
Length=496

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/463 (67%), Positives = 371/463 (80%), Gaps = 6/463 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WD +I+ P +  D +S      GTRWAVLVAGSNGY NYRHQADVCHAYQ+L +GGLK+E
Sbjct  38    WDSVIKLPAEPVDADS--DHEVGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGLKEE  95

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA +  NPR GVIINHP G DVYAGVPKDYTG+ VTA NL+AV+LGDK  V
Sbjct  96    NIVVFMYDDIATDELNPRPGVIINHPEGQDVYAGVPKDYTGENVTAQNLFAVILGDKNKV  155

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKV++SK +DRIFIYY+DHGGPGVLGMPN+P+LYA DFIEVLKKKH++G YK MVI
Sbjct  156   KGGSGKVINSKPEDRIFIYYSDHGGPGVLGMPNMPYLYAMDFIEVLKKKHASGGYKKMVI  215

Query  1024  YVEACESGS-FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
             YVEACESG+   +G+MP+DL IYVTTASNA+E+SWGTYCPG +P+PPPEYITCLGDLYSV
Sbjct  216   YVEACESGNHVLKGIMPKDLQIYVTTASNAQENSWGTYCPGMDPSPPPEYITCLGDLYSV  275

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDSE+HNL  E++++QY++VK RTSN+N++  GSHVM+YG  +I   EK+YLYQGFD
Sbjct  276   AWMEDSETHNLKRESVKQQYKSVKQRTSNFNNYAMGSHVMQYGDTNITA-EKLYLYQGFD  334

Query  667   PATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
             PA +N P    R  T   VVNQRDA+L FMW+ Y+        K  +LK+I +T+ HR+ 
Sbjct  335   PAAVNFPPQNGRLETKMEVVNQRDAELFFMWQMYQRSNHQPEKKTDILKQIAETVKHRKH  394

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             +D S++ +GV L+GP  GS++L+S+R PGLALVDDW CLKSMVRVFETHCG+L QYGMKH
Sbjct  395   IDGSVELIGVLLYGPGKGSSVLQSMRAPGLALVDDWTCLKSMVRVFETHCGTLTQYGMKH  454

Query  307   MRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             MRAFANICNS +SEA+MEE C   C E       HPS K YSA
Sbjct  455   MRAFANICNSGVSEASMEEVCVAAC-EGYDSGLLHPSNKGYSA  496



>gb|AET08892.1| vacuolar processing enzyme 2 [Aegilops speltoides]
 emb|CCC14970.1| VPE2B protein [Aegilops speltoides]
Length=491

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/468 (65%), Positives = 370/468 (79%), Gaps = 7/468 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQK----DDESPEGETQ-GTRWAVLVAGSNGYANYRHQADVCHAYQILK  1406
              +WDP+IR P +++    D+ S EGE   GTRWAVLVAGS+GY NYRHQAD+CHAYQIL+
Sbjct  26    GKWDPVIRMPGEEEPATGDESSEEGEDGVGTRWAVLVAGSSGYGNYRHQADICHAYQILR  85

Query  1405  RGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVL  1226
             +GG+K+ENIVVFMYDDIANN  NPR GVIINHP G DVYAGVPKDYTG+ VTA N YAVL
Sbjct  86    KGGVKEENIVVFMYDDIANNPLNPRPGVIINHPEGEDVYAGVPKDYTGEAVTAKNFYAVL  145

Query  1225  LgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAG  1046
             LG+   V GGS KV+DSK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VL++KH++ 
Sbjct  146   LGNNTAVTGGSKKVIDSKPNDHIFIYYSDHGGPGVLGMPNLPYLYAADFIKVLQEKHASN  205

Query  1045  TYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCL  866
             TY  MVIYVEACESGS FEG+MP DLNIYVTTASNAEESSWGTYCPG EP+PP EYITCL
Sbjct  206   TYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYITCL  265

Query  865   GDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVY  686
             GDLYS++WMEDSE++NL EETI++QYE VK RTS+ N + AGSHVMEYG +   K EK+Y
Sbjct  266   GDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDK-TFKDEKLY  324

Query  685   LYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDT  506
             LYQGF+PA  N+  N++    PK  +NQRDADLLF+W RY++  + +  KA +L+EI++T
Sbjct  325   LYQGFNPANTNIT-NKLFLQAPKAAINQRDADLLFLWRRYELLHEKSKEKANVLREISET  383

Query  505   MLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLG  326
             + HR+ LD+SID +G  LFG ENG   L++VR  G  LVDDW CLK MVR+FE+HCGSL 
Sbjct  384   VAHRKHLDSSIDFIGKLLFGFENGPWELQAVRPSGKPLVDDWDCLKRMVRIFESHCGSLT  443

Query  325   QYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             QYGMKHMRAFANICN+ +S   M EA    C    + +++   + YSA
Sbjct  444   QYGMKHMRAFANICNNGVSGTTMNEASIGACGVQNSARWSTLIQGYSA  491



>ref|XP_007039931.1| Beta vacuolar processing enzyme [Theobroma cacao]
 gb|EOY24432.1| Beta vacuolar processing enzyme [Theobroma cacao]
Length=543

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/470 (67%), Positives = 376/470 (80%), Gaps = 11/470 (2%)
 Frame = -3

Query  1576  QAAR---WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILK  1406
             +AAR   W+  IR   D  + +  + +  GTRWAVLVAGS+GYANYRHQADVCHAYQ+L+
Sbjct  80    RAARLNQWESGIRLSTDIDEPQDVDDQQLGTRWAVLVAGSSGYANYRHQADVCHAYQLLR  139

Query  1405  RGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVL  1226
             +GGLK+ENIVVFMYDDIA +  NPR  VIINHP G DVYAGVPKDYTG  VTAANLYAVL
Sbjct  140   KGGLKEENIVVFMYDDIAMHKLNPRPEVIINHPKGDDVYAGVPKDYTGVHVTAANLYAVL  199

Query  1225  LgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAG  1046
             LG+   + GGSGKVVDSK +DRIF++Y+DHGGPGVLGMPNLP LYA DF++VLKKKH+AG
Sbjct  200   LGNNSALSGGSGKVVDSKPNDRIFLFYSDHGGPGVLGMPNLPFLYAMDFLDVLKKKHAAG  259

Query  1045  TYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCL  866
             +YK+MVIYVEACESGS FEG+MP+DLNIYVTTASNA+ESSWGTYCPG EP+PPPEY TCL
Sbjct  260   SYKEMVIYVEACESGSVFEGIMPKDLNIYVTTASNAQESSWGTYCPGMEPSPPPEYTTCL  319

Query  865   GDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQ-AGSHVMEYGSRDIIKPEKV  689
             GDLYSVAWMEDSE+HNL  ET+++QYE V+ RTSN+N +   GSHVMEYG+   IK EK+
Sbjct  320   GDLYSVAWMEDSETHNLKRETVKQQYETVRERTSNFNSYTLGGSHVMEYGNAS-IKAEKL  378

Query  688   YLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITD  509
               YQGFDP++ N P N+   LT    VNQRDAD+LF+W  YK   D +  K ++L++IT+
Sbjct  379   CSYQGFDPSSENFPPNE---LTHMEAVNQRDADILFLWHMYKNSEDGS-KKTEILRQITE  434

Query  508   TMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSL  329
             T+ HR  LD SID +G  L+GP  GS IL SVR+PGL LVDDWQCLKSMVR+FETHCG L
Sbjct  435   TIRHRIHLDGSIDLIGTLLYGPAKGSGILNSVREPGLPLVDDWQCLKSMVRLFETHCGLL  494

Query  328   GQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
              QYGMKHMRAFAN+CNS +S++ ME+AC   CS   T ++ HPS + YSA
Sbjct  495   TQYGMKHMRAFANLCNSGVSQSLMEQACVAACSGHDTRQW-HPSNQGYSA  543



>ref|XP_008369533.1| PREDICTED: legumain [Malus domestica]
Length=501

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/463 (69%), Positives = 372/463 (80%), Gaps = 3/463 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             RWD  IR P ++   E    +  GTRWAVLVAGSNGY NYRHQAD+CHAYQ+LK+GGLK+
Sbjct  41    RWDSGIRLPSEKDKPEDVHHKEPGTRWAVLVAGSNGYGNYRHQADICHAYQLLKKGGLKE  100

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIA +  NPR GVIINHP G DVYAGVPKDYTG+QVTAANLYAVLLGDK+ 
Sbjct  101   ENIVVFMYDDIAKHLMNPRPGVIINHPQGGDVYAGVPKDYTGEQVTAANLYAVLLGDKKA  160

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             VKGGSGKVVDSK +DRIF+YY+DHGGPGVLGMPN+P LYA DFIEVLKKKH++G+YK+MV
Sbjct  161   VKGGSGKVVDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAMDFIEVLKKKHASGSYKEMV  220

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
             IY+EACESGS FEG+MP+DLNIYVTTASNA+E+S+GTYCPG +P PPPEYITCLGDLYSV
Sbjct  221   IYIEACESGSIFEGIMPKDLNIYVTTASNAQENSFGTYCPGMDPPPPPEYITCLGDLYSV  280

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             +WMEDSE HNL +ETIE+QY  VK RTSN N++  GSHVMEYGS++I + EK+YLY GFD
Sbjct  281   SWMEDSERHNLKKETIEQQYLVVKQRTSNSNNYDVGSHVMEYGSKNITQ-EKLYLYLGFD  339

Query  667   PATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
             PA++NLP N  +   P  VVNQRDA++ +MW+ YK     +    ++L EI +TM HR  
Sbjct  340   PASVNLPPNNGQLEKPMEVVNQRDAEIFYMWQMYKRSEHGSGKSREILNEIKETMRHRTH  399

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             LDASI  +G  L+GP  G + L SVR  G  LVDDW CLKSMVRVFETHCGSL QYGMKH
Sbjct  400   LDASIQFIGTFLYGPGKGPSKLNSVRAVGQPLVDDWGCLKSMVRVFETHCGSLTQYGMKH  459

Query  307   MRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             MRAFANICNS +SEA M EAC   C+  +  +  HPS K YSA
Sbjct  460   MRAFANICNSGVSEAKMAEACSAACNGHEVGQ-LHPSNKGYSA  501



>emb|CAQ00096.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26636.1| vacuolar processing enzyme 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=493

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/454 (67%), Positives = 367/454 (81%), Gaps = 10/454 (2%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQK------DDESPEGETQG--TRWAVLVAGSNGYANYRHQADVCHAYQ  1415
              RWDP+IR P +++      D  S E E  G  TRWAVLVAGS+GY NYRHQAD+CHAYQ
Sbjct  24    GRWDPVIRMPGEEEPATARGDGGSQEEEEDGVGTRWAVLVAGSSGYGNYRHQADICHAYQ  83

Query  1414  ILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLY  1235
             IL++GG+K+ENIVVFMYDDIA NA NPR GVIINHP G DVYAGVPKDYTG+ VTA N Y
Sbjct  84    ILRKGGVKEENIVVFMYDDIAKNALNPRPGVIINHPEGEDVYAGVPKDYTGEAVTAKNFY  143

Query  1234  AVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKH  1055
             AVLLG+K  V GGS KV+DSK++D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VL++KH
Sbjct  144   AVLLGNKTAVTGGSKKVIDSKSNDHIFIYYSDHGGPGVLGMPNLPYLYAADFIKVLQEKH  203

Query  1054  SAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYI  875
             ++ TY  MVIYVEACESGS FEG+MP DLNIYVTTASNAEESSWGTYCPG EP+PP EYI
Sbjct  204   ASNTYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYI  263

Query  874   TCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPE  695
             TCLGDLYS++WMEDSE++NL EETI++QYE VK RTS+ N + AGSHVMEYG +   K E
Sbjct  264   TCLGDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDK-TFKDE  322

Query  694   KVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEI  515
             K+YLYQGF+PA  N+  N++     K  +NQRDADLLF+W RY++  + +  K  +L+EI
Sbjct  323   KLYLYQGFNPANTNIT-NKLFWQARKAAINQRDADLLFLWRRYELLHEKSKEKVNVLREI  381

Query  514   TDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCG  335
             ++T+ HR+ LD+SID +G  LFG ENG ++L++VR  G+ LVDDW CLK MVR+FE+HCG
Sbjct  382   SETVTHRKHLDSSIDFIGKLLFGFENGPSMLETVRPSGIPLVDDWDCLKRMVRIFESHCG  441

Query  334   SLGQYGMKHMRAFANICNSNISEAAMEEACKNTC  233
             SL QYGMKHMRAFANICN+ IS  +M+EA  +TC
Sbjct  442   SLTQYGMKHMRAFANICNNGISGTSMKEASISTC  475



>ref|XP_002452849.1| hypothetical protein SORBIDRAFT_04g033520 [Sorghum bicolor]
 gb|EES05825.1| hypothetical protein SORBIDRAFT_04g033520 [Sorghum bicolor]
Length=495

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/476 (64%), Positives = 371/476 (78%), Gaps = 13/476 (3%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQK--------DDESPEGETQ---GTRWAVLVAGSNGYANYRHQADV  1430
             +   WDP+IR P +++          E  EGE     GTRWAVLVAGS+GY NYRHQAD+
Sbjct  22    EKGEWDPVIRMPGEEEPAASSHSHSGEGFEGEEDVAVGTRWAVLVAGSSGYGNYRHQADI  81

Query  1429  CHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVT  1250
             CHAYQIL++GG+K+ENIVVFMYDD+A +A NPR+GVIINHP G DVYAGVPKDYTGDQVT
Sbjct  82    CHAYQILRKGGIKEENIVVFMYDDVATSALNPRQGVIINHPQGEDVYAGVPKDYTGDQVT  141

Query  1249  AANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEV  1070
             A N +AVLLG+K  V GGS KV++SK DD IFI Y+DHGGPGVLGMPNLP+LYA DF++V
Sbjct  142   AKNFFAVLLGNKTAVTGGSRKVINSKPDDHIFICYSDHGGPGVLGMPNLPYLYAGDFMKV  201

Query  1069  LKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAP  890
             L++KH++ +Y  MVIY+EACESGS FEG+MPEDLNIYVTTASNAEESSWGTYCPG EP+P
Sbjct  202   LREKHASNSYAKMVIYIEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPSP  261

Query  889   PPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRD  710
             P EYITCLGDLYSV+WMEDSE+HNL EETI+ QYE VK RTS+ N + AGSHVMEYG + 
Sbjct  262   PSEYITCLGDLYSVSWMEDSETHNLKEETIKEQYEVVKERTSDSNSYGAGSHVMEYGDK-  320

Query  709   IIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAK  530
               K EK+YLYQGFDPA  N+  N++ R   + VVNQRDAD+LF+W+RY++  + +  K +
Sbjct  321   TFKGEKLYLYQGFDPANANVT-NKLLRPGLEAVVNQRDADILFLWKRYELLHEKSEEKQE  379

Query  529   LLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVF  350
             +L+EIT T+ HR+ LD+SID +G  LFG E G   L++VR  G  LVDDW CLK MVR+F
Sbjct  380   VLREITGTVRHRKHLDSSIDFIGKLLFGIEKGPFTLQAVRPSGQPLVDDWDCLKQMVRIF  439

Query  349   ETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             E+HCGSL QYGMKHMRAFANICNS    A+M++A    C    + +++   + YSA
Sbjct  440   ESHCGSLTQYGMKHMRAFANICNSGTPGASMKQASMGACGSYNSARWSPLVQGYSA  495



>ref|NP_001105183.1| vacuolar processing enzyme1 precursor [Zea mays]
 gb|AAL58571.1| vacuolar processing enzyme 1 [Zea mays]
Length=494

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/475 (64%), Positives = 372/475 (78%), Gaps = 12/475 (3%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQK-------DDESPEGETQ---GTRWAVLVAGSNGYANYRHQADVC  1427
             +   WDP+IR P +++         E  +GE     GTRWAVLVAGS+GY NYRHQAD+C
Sbjct  22    EKGEWDPVIRMPGEKEPAGSHSHSGEGFDGEVDDAVGTRWAVLVAGSSGYGNYRHQADIC  81

Query  1426  HAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTA  1247
             HAYQIL++GG+K+ENIVVFMYDDIAN+A NPR+GVIINHP G DVYAGVPKDYTGDQVT 
Sbjct  82    HAYQILQKGGIKEENIVVFMYDDIANSALNPRQGVIINHPEGEDVYAGVPKDYTGDQVTT  141

Query  1246  ANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVL  1067
              N YAVLLG+K  V GGS KV++SK DD IFIYY+DHGGPGVLGMPNLP+LYA DF++VL
Sbjct  142   KNFYAVLLGNKTAVTGGSRKVINSKPDDHIFIYYSDHGGPGVLGMPNLPYLYAGDFMKVL  201

Query  1066  KKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPP  887
             ++KH++ +Y  MVIY+EACESGS FEG+MPEDLNIYVTTASNAEESSWGTYCPG EP PP
Sbjct  202   REKHASNSYAKMVIYIEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPPPP  261

Query  886   PEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDI  707
              EYITCLGDLYSV+WMEDSE++NL EET++ QYE VK RTS++N + AGSHVMEYG +  
Sbjct  262   SEYITCLGDLYSVSWMEDSETNNLKEETVKEQYEVVKKRTSDFNSYGAGSHVMEYGDK-T  320

Query  706   IKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKL  527
              K EK+YLYQGFDPA  N+  N++     + VVNQRDAD+LF+W+RY++  + +  K ++
Sbjct  321   FKEEKLYLYQGFDPANANVT-NKLLWSGQEAVVNQRDADILFLWKRYELLHEKSEEKQEV  379

Query  526   LKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFE  347
             L+EIT T+ HR+ LD SI+ +G  LFG E G + L++VR PG  LVDDW CLK MVR+FE
Sbjct  380   LREITGTVRHRKHLDNSINFIGKLLFGAEKGPSTLEAVRPPGQPLVDDWDCLKQMVRIFE  439

Query  346   THCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             +HCGSL QYGM+HMRAFANICNS    A+M+ A    C    + +++  ++ YSA
Sbjct  440   SHCGSLTQYGMRHMRAFANICNSGTPGASMKRASMGACGGYNSARWSPLAQGYSA  494



>ref|XP_010259032.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=495

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/466 (68%), Positives = 374/466 (80%), Gaps = 5/466 (1%)
 Frame = -3

Query  1579  LQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             ++  RWD  I+    Q+++   +GE  GT WAVLVAGS+G+ NYRHQADVCHAYQ+L++G
Sbjct  35    VRLERWDSGIKMST-QREEGEEDGEGVGTTWAVLVAGSSGFGNYRHQADVCHAYQLLRKG  93

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             GLK+ENIVVFMYDDIA + FNP+ GVIINHP G DVYAGVPKDYTG  VTA NLYAVLLG
Sbjct  94    GLKEENIVVFMYDDIAYSEFNPKPGVIINHPQGPDVYAGVPKDYTGKHVTANNLYAVLLG  153

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             DK  V+GGSGKV+DSK +DRIF+YY+DHGGPGVLGMPN+P LYA DFIEVLKKKH+AGTY
Sbjct  154   DKNAVQGGSGKVIDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAVDFIEVLKKKHAAGTY  213

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K+MVIYVEACESGS FEGMMPEDLNIYVTTASNAEESS+GTYCPG EP+P PE++TCLGD
Sbjct  214   KEMVIYVEACESGSIFEGMMPEDLNIYVTTASNAEESSFGTYCPGMEPSPSPEFLTCLGD  273

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             LYSVAWMEDSE+HNL +ET+ +QY NVK RTSNYN +  GSHVMEYG+R  IK EK+YLY
Sbjct  274   LYSVAWMEDSETHNLKKETLRQQYHNVKDRTSNYNTYFVGSHVMEYGNRS-IKTEKLYLY  332

Query  679   QGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
             QGFDPA  NL  N +       VVNQRDADLLF+W+RYK K ++   K +  K I +T++
Sbjct  333   QGFDPANENLNQNTLHPHME--VVNQRDADLLFLWQRYK-KSEDGSKKKEAFKRIAETVM  389

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR  +D S++ +G  LFG E  ++IL +VR  GL LVDDW CLK+MVR+FE HCGSL QY
Sbjct  390   HRTHIDGSVELIGNILFGTERSASILSAVRPSGLPLVDDWGCLKAMVRLFEYHCGSLTQY  449

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             GM+HMRAFANICNS ISE AME AC+  CS   +  ++  ++ YSA
Sbjct  450   GMRHMRAFANICNSGISEDAMEAACRAACSGPLSAVWSPFTRGYSA  495



>ref|XP_008437131.1| PREDICTED: legumain [Cucumis melo]
Length=495

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/468 (66%), Positives = 367/468 (78%), Gaps = 7/468 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQ----GTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             RW+  IR P ++++     G+      GTRWAVLVAGS+G+ NYRHQAD+CHAYQ+LK+G
Sbjct  29    RWERTIRMPTEEEEVGGSGGDDDDRKVGTRWAVLVAGSSGFGNYRHQADICHAYQLLKKG  88

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             GLKDENIVVFMYDDIA N  NPR G+IINHP G DVYAGVPKDYTG+ VTA NLYAVLLG
Sbjct  89    GLKDENIVVFMYDDIATNVLNPRPGIIINHPQGEDVYAGVPKDYTGEHVTAQNLYAVLLG  148

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             ++  V GGSGKVVDSK +DRIF+YY+DHGGPGVLGMPNLP +YA DFIEVLKKKH+A  Y
Sbjct  149   NRTAVNGGSGKVVDSKPNDRIFVYYSDHGGPGVLGMPNLPFVYAMDFIEVLKKKHAAKGY  208

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K+MVIYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG +PAPPPEY+TCLGD
Sbjct  209   KEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSFGTYCPGMQPAPPPEYMTCLGD  268

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             LYSVAWMEDSE+HNL  ETI++QY+ VK RTSN N+   GSHVMEYG+   IK E++YLY
Sbjct  269   LYSVAWMEDSETHNLKRETIDQQYQTVKERTSNPNNLNTGSHVMEYGNSS-IKAERLYLY  327

Query  679   QGFDPATINLPGNQIR-RLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTM  503
             QGFDPA++NLP    R  +     +NQRDAD+ F+W+ Y+   D    KA++L+EI +T+
Sbjct  328   QGFDPASVNLPPYNGRLEMKSMEAINQRDADIFFLWQMYRKFEDGTNEKAQILEEIRETV  387

Query  502   LHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQ  323
              HR  LD SI  +G  LFGPE GSN+L  VR  GL LVDDW+CLKSMVRV E++CGSL Q
Sbjct  388   THRSHLDGSIRMIGFLLFGPEKGSNVLDDVRASGLPLVDDWECLKSMVRVLESYCGSLTQ  447

Query  322   YGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             YGMKHMRA ANICN  +SEA+M EA    C+        HPS + YSA
Sbjct  448   YGMKHMRALANICNRGVSEASMREASMAACNGGGGYGLWHPSNRGYSA  495



>emb|CDP09908.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/434 (71%), Positives = 353/434 (81%), Gaps = 5/434 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGE-TQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             WDPLIR PVD  D   PE E  +G RWA+LVAGSNG+ANYRHQ+D+CHAYQILKRGGLKD
Sbjct  42    WDPLIRSPVD--DPGKPEAEENEGIRWAILVAGSNGFANYRHQSDICHAYQILKRGGLKD  99

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIANN  NPR G+IIN P+G DVYAGVPKDYTG  V+  NL+AV+LGDK  
Sbjct  100   ENIVVFMYDDIANNKLNPRPGIIINRPDGDDVYAGVPKDYTGKAVSPENLFAVILGDKSA  159

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             VKGG+GKVV+S ++DRIFIYY+DHGGPG+LGMP   +LY  DF+EVLKKKH++GTYK+MV
Sbjct  160   VKGGNGKVVNSSSNDRIFIYYSDHGGPGILGMPQNTYLYGKDFVEVLKKKHASGTYKEMV  219

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
             IYVEACESGSFFEG+MPE+LNIYVTTASNAEESS+ TYCP  +P+PP E+  CLGDLYSV
Sbjct  220   IYVEACESGSFFEGLMPENLNIYVTTASNAEESSYATYCPDMDPSPP-EHFPCLGDLYSV  278

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDSESHNL  ETI +QY+ VK RTSN++ + AGSHVMEYG++ I   EK+YLYQGFD
Sbjct  279   AWMEDSESHNLKRETIVQQYKKVKERTSNHHTYDAGSHVMEYGNKSI-HAEKLYLYQGFD  337

Query  667   PATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
             PAT N P NQI       VVNQR ADL+FMW+RYK   D +  K +LLK+ITDTMLHR  
Sbjct  338   PATENYPANQIDIHPRMDVVNQRSADLVFMWDRYKKMEDGSAEKGELLKQITDTMLHRNH  397

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             LD S+D +G  LFGPE GS +L  VR  GL +VDDW CLKS VR+FETHCGSL QYGMKH
Sbjct  398   LDGSMDIIGAFLFGPERGSAVLNHVRHGGLPIVDDWDCLKSSVRIFETHCGSLTQYGMKH  457

Query  307   MRAFANICNSNISE  266
             MRAFANICN  +S 
Sbjct  458   MRAFANICNRGVSR  471



>ref|XP_002448237.1| hypothetical protein SORBIDRAFT_06g023820 [Sorghum bicolor]
 gb|EES12565.1| hypothetical protein SORBIDRAFT_06g023820 [Sorghum bicolor]
Length=493

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/465 (65%), Positives = 365/465 (78%), Gaps = 6/465 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESP----EGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGG  1397
             W+PLIR P  +  D +     E +  GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GG
Sbjct  31    WEPLIRMPTGKGGDAAARAVEEDDEVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGG  90

Query  1396  LKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgd  1217
             +K+ENIVVFMYDDIA+N  NPR GVIINHP G +VY GVPKDYTGDQVT  N +AVLLG+
Sbjct  91    VKEENIVVFMYDDIAHNILNPRPGVIINHPKGENVYNGVPKDYTGDQVTTENFFAVLLGN  150

Query  1216  kegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYK  1037
             K  + GGS KV+DSK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VLKKKH+  +Y 
Sbjct  151   KSAITGGSKKVIDSKPNDHIFIYYSDHGGPGVLGMPNLPYLYAGDFIKVLKKKHACNSYS  210

Query  1036  DMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDL  857
              MVIYVEACESGS FEG+MPEDLNIYVTTASN  E+SWGTYCPG EP+PPPEYITCLGDL
Sbjct  211   KMVIYVEACESGSIFEGLMPEDLNIYVTTASNPVENSWGTYCPGMEPSPPPEYITCLGDL  270

Query  856   YSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQ  677
             YSV+WMEDS++HNL +ETI+ QYE VK RTSN N ++ GSHVMEYG +   K EK++LYQ
Sbjct  271   YSVSWMEDSQTHNLKKETIKDQYEVVKTRTSNSNKYKEGSHVMEYGDK-TFKDEKLFLYQ  329

Query  676   GFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             GFDPA  N+  N +    PKG VNQRDADLLFMW+RY+     +V K + L EI +T+ H
Sbjct  330   GFDPANANI-ANMLLWPGPKGAVNQRDADLLFMWKRYEQLNGESVEKLRALIEIKETVQH  388

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R+ LD+SID +G  LFG E G ++L++VR  GL LVDDW CLK MVR+FE+ CGSL QYG
Sbjct  389   RKHLDSSIDFIGRLLFGFEKGPSMLEAVRASGLPLVDDWDCLKRMVRIFESQCGSLTQYG  448

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MK+MRAFANICNS ISE  M E+  + CS   + +++  ++ +SA
Sbjct  449   MKYMRAFANICNSGISEMKMRESSISACSSYNSARWSPMAQGHSA  493



>ref|XP_004147613.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
 ref|XP_004162670.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
 gb|KGN50214.1| hypothetical protein Csa_5G160170 [Cucumis sativus]
Length=490

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/464 (66%), Positives = 365/464 (79%), Gaps = 4/464 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             RW+  IR P ++++         GTRWAVL+AGS+G+ NYRHQAD+CHAYQ+LK+GGLKD
Sbjct  29    RWERTIRMPTEKEEMGGAGDRKVGTRWAVLIAGSSGFGNYRHQADICHAYQLLKKGGLKD  88

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIA N  NPR G+IINHP G DVYAGVPKDYTG+ VTA NLYAVLLG++  
Sbjct  89    ENIVVFMYDDIATNVLNPRPGIIINHPQGEDVYAGVPKDYTGEHVTAQNLYAVLLGNRTA  148

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             V GGSGKVVDSK +DRIF+YY+DHGGPGVLGMPNLP +YA DFIEVLKKKH+A  YK+MV
Sbjct  149   VDGGSGKVVDSKPNDRIFVYYSDHGGPGVLGMPNLPFVYAMDFIEVLKKKHAAKGYKEMV  208

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
             IYVEACESGS FEG++P+DLNIYVTTASNA+ESS+GTYCPG EPAPPPEY+TCLGDLYSV
Sbjct  209   IYVEACESGSIFEGILPKDLNIYVTTASNAQESSFGTYCPGMEPAPPPEYMTCLGDLYSV  268

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDSE+HNL  ETI++QY  VK RTSN N+   GSHVMEYG+   IK E++YLYQGFD
Sbjct  269   AWMEDSETHNLKRETIDQQYRTVKERTSNPNNLNTGSHVMEYGNSS-IKAERLYLYQGFD  327

Query  667   PATINLPGNQIR-RLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             PA++NLP    R  +     +NQRDAD+ F+W+ Y+   D    +A++L+EI +T+ HR 
Sbjct  328   PASVNLPPYNGRYEMKSMDAINQRDADIFFLWQMYRKFEDGTNERAQVLEEIRETVTHRT  387

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              LD SI  +G  LFGPE GSNIL  VR  GL LVDDW+CLKSMVRV E++CGSL QYGMK
Sbjct  388   HLDGSIRMIGFLLFGPEKGSNILDDVRASGLPLVDDWECLKSMVRVLESYCGSLTQYGMK  447

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             HMRA ANICN  +S+A+M EA    C+   +    HPS + YSA
Sbjct  448   HMRAIANICNRGVSKASMREASMVACNG-GSYGLWHPSNRGYSA  490



>sp|P49046.1|LEGU_CANEN RecName: Full=Legumain; AltName: Full=Asparaginyl endopeptidase; 
Flags: Precursor [Canavalia ensiformis]
 dbj|BAA06596.1| asparaginyl endopeptidase [Canavalia ensiformis]
Length=475

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/449 (67%), Positives = 358/449 (80%), Gaps = 7/449 (2%)
 Frame = -3

Query  1579  LQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             L    WD +I+ P +  DDE       GTRWAVLVAGSNGY NYRHQADVCHAYQ+L +G
Sbjct  17    LNRREWDSVIQLPTEPVDDEV------GTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKG  70

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             G+K+ENIVVFMYDDIA NA NPR GVIINHP G DVYAGVPKDYTG+ VT  NLYAV+LG
Sbjct  71    GVKEENIVVFMYDDIAYNAMNPRPGVIINHPQGPDVYAGVPKDYTGEDVTPENLYAVILG  130

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             DK  VKGGSGKV++S  +DRIFI+Y+DHGGPGVLGMPN P +YA DFI+VLKKKH++G Y
Sbjct  131   DKSKVKGGSGKVINSNPEDRIFIFYSDHGGPGVLGMPNAPFVYAMDFIDVLKKKHASGGY  190

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K+MVIY+EACESGS FEG+MP+DLNIYVTTASNA+E+S+GTYCPG  P PP EY+TCLGD
Sbjct  191   KEMVIYIEACESGSIFEGIMPKDLNIYVTTASNAQENSFGTYCPGMNPPPPEEYVTCLGD  250

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             LYSV+WMEDSE+HNL  ET+++QY++V+ RTSN N ++ GSHVM+YG  +I   EK+YLY
Sbjct  251   LYSVSWMEDSETHNLKRETVQQQYQSVRKRTSNSNSYRFGSHVMQYGDTNITA-EKLYLY  309

Query  679   QGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
              GFDPAT+N P +         VVNQRDA+LLFMW+ Y+        K  +L++IT+T+ 
Sbjct  310   HGFDPATVNFPPHNGNLEAKMEVVNQRDAELLFMWQMYQRSNHQPEKKTHILEQITETVK  369

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR  LD S++ +GV L+GP   S++L SVR PGL LVDDW CLKSMVRVFETHCGSL QY
Sbjct  370   HRNHLDGSVELIGVLLYGPGKSSSVLHSVRAPGLPLVDDWTCLKSMVRVFETHCGSLTQY  429

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTC  233
             GMKHMRAF N+CNS +S+A+MEEACK  C
Sbjct  430   GMKHMRAFGNVCNSGVSKASMEEACKAAC  458



>ref|XP_008238625.1| PREDICTED: LOW QUALITY PROTEIN: legumain [Prunus mume]
Length=491

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/462 (68%), Positives = 368/462 (80%), Gaps = 3/462 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             WD  IR P D+   E    +  GTRWAVLVAGS+GY NYRHQADVCHAYQ+LK+GGLK+E
Sbjct  32    WDSTIRLPSDKDKPEDANHKEAGTRWAVLVAGSSGYGNYRHQADVCHAYQLLKKGGLKEE  91

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIAN+  NPR GVIIN  +G   +  V  DYTG QVTA NLYAVLLGDK+ V
Sbjct  92    NIVVFMYDDIANHEINPRPGVIINKFSGXLYWFWVMXDYTGKQVTATNLYAVLLGDKKAV  151

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             KGGSGKVVDSK +DRIF+YY+DHGGPGVLGMPN+P LYA DFI+VLKKKH++G+YK+MVI
Sbjct  152   KGGSGKVVDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAMDFIQVLKKKHASGSYKEMVI  211

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             YVEACESGS FEG+MP DLNIYVTTASNA+E+S+GTYCPG +P+PPPEYITCLGDLYSVA
Sbjct  212   YVEACESGSIFEGIMPSDLNIYVTTASNAQENSFGTYCPGMDPSPPPEYITCLGDLYSVA  271

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSE HNL +ETI++QY+NVK RTSN N++  GSHVM+YGS++I   EK+YLYQGFDP
Sbjct  272   WMEDSERHNLKKETIKQQYQNVKKRTSNSNNYDVGSHVMQYGSKNITV-EKLYLYQGFDP  330

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             A++N P N  +   P  VVNQRDA+L FMW+ YK     +  K  +L++I +TM HR  L
Sbjct  331   ASVNFPPNNGQLEKPMEVVNQRDAELFFMWQMYKRSEHRSEKKRHILEQIKETMGHRTHL  390

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             DASI+ +G  L+GP  GS+ L SVR  GL LVDDW+CLKSMVRVFET CGSL QYGMKHM
Sbjct  391   DASIEFIGTFLYGPGKGSSTLNSVRALGLPLVDDWECLKSMVRVFETQCGSLTQYGMKHM  450

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             RAFANICNS ++++ MEEAC   C+     +  HPS K YSA
Sbjct  451   RAFANICNSGVTQSEMEEACSAACNGHDPGQ-LHPSNKGYSA  491



>ref|XP_010553469.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Tarenaya 
hassleriana]
Length=493

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/466 (67%), Positives = 368/466 (79%), Gaps = 3/466 (1%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGG  1397
             +  R+ P I  P ++ + E  +G T GTRWAVLVAGS+GY NYRHQADVCHAYQIL+ GG
Sbjct  30    RLGRFIPKIVMPTEKPEPEEDDGST-GTRWAVLVAGSSGYGNYRHQADVCHAYQILRNGG  88

Query  1396  LKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgd  1217
             LK+ENIVVFMYDDIA++  NPR G +INHP+G DVY GVPKDYTG  VTAANLYAVLLGD
Sbjct  89    LKEENIVVFMYDDIADHGLNPRPGTLINHPHGDDVYDGVPKDYTGTNVTAANLYAVLLGD  148

Query  1216  kegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYK  1037
             K+ VKGGSGKVV SK +DRIF+YY DHGGPGVLGMP  P++YA + IE LKKKH +GTYK
Sbjct  149   KKAVKGGSGKVVASKPEDRIFLYYADHGGPGVLGMPKTPYVYAAELIETLKKKHKSGTYK  208

Query  1036  DMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDL  857
             +MVIYVEACESGS FEG+MP+DLNIYVTTASNA+ESS+GTYCPG +P PPPEYITCLGDL
Sbjct  209   EMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMDPPPPPEYITCLGDL  268

Query  856   YSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQ  677
             YSVAWMEDSESHNL  ET+++QY+ VK RTSNYN +  GSHVMEYG+   IK EK+YLYQ
Sbjct  269   YSVAWMEDSESHNLKRETLKQQYQTVKTRTSNYNTYSGGSHVMEYGNTS-IKSEKLYLYQ  327

Query  676   GFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             GFDPA +N+P N +   +  GVVNQRDADLLF+W  Y+   + +  K ++L+EIT+T  H
Sbjct  328   GFDPANVNIPPNGLWIGSRMGVVNQRDADLLFLWHLYQRSENGSRKKREILREITETTRH  387

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R+ +DAS++ +G  LFGP     IL SVR+PGL LVDDW+CLK+MVRVFETHCGSL QYG
Sbjct  388   RKHIDASVELVGTFLFGPTTVKTILNSVREPGLPLVDDWRCLKTMVRVFETHCGSLTQYG  447

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKV-YSA  182
             MKHMRAFANICN  +S A MEEA    C      +   PS   YSA
Sbjct  448   MKHMRAFANICNDRVSNADMEEASAAACRGYTAHERWQPSTTGYSA  493



>gb|AFW72544.1| vacuolar processing enzyme 1 [Zea mays]
Length=500

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/481 (63%), Positives = 373/481 (78%), Gaps = 18/481 (4%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQK-------DDESPEGETQ---GTRWAVLVAGSNGYANYRHQADVC  1427
             +   WDP+IR P +++         E  +GE     GTRWAVLVAGS+GY NYRHQAD+C
Sbjct  22    EKGEWDPVIRMPGEKEPAGSHSHSGEGFDGEVDDAVGTRWAVLVAGSSGYGNYRHQADIC  81

Query  1426  HAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTA  1247
             HAYQIL++GG+K+ENIVVFMYDDIAN+A NPR+GVIINHP G DVYAGVPKDYTGDQVT 
Sbjct  82    HAYQILQKGGIKEENIVVFMYDDIANSALNPRQGVIINHPEGEDVYAGVPKDYTGDQVTT  141

Query  1246  ANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVL  1067
              N YAVLLG+K  V GGS KV++SKADD IFIYY+DHGGPGVLGMPNLP+LYA DF++VL
Sbjct  142   KNFYAVLLGNKTAVTGGSRKVINSKADDHIFIYYSDHGGPGVLGMPNLPYLYAGDFMKVL  201

Query  1066  KKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPP  887
             ++KH++ +Y  MVIY+EACESGS FEG+MPEDLNIYVTTASNAEESSWGTYCPG EP PP
Sbjct  202   REKHASNSYAKMVIYIEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPPPP  261

Query  886   PEYITCLGDLYSVAWMEDSESHNLMEETIERQYE------NVKLRTSNYNDFQAGSHVME  725
              EYITCLGDLYSV+WMEDSE++NL EETI+ QYE       VK RTS++N + AGSHVME
Sbjct  262   SEYITCLGDLYSVSWMEDSETNNLKEETIKEQYEVSQHCAQVKKRTSDFNSYGAGSHVME  321

Query  724   YGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNA  545
             YG +   K EK+YLYQGFDPA  N+  N++     + VVNQRDAD+LF+W+RY++  + +
Sbjct  322   YGDK-TFKGEKLYLYQGFDPANANVT-NKLLWSGQEAVVNQRDADILFLWKRYELLHEKS  379

Query  544   VSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKS  365
               K ++L+EIT T+ HR+ LD SI+ +G  LFG E G + L++VR PG  LVDDW CLK 
Sbjct  380   EEKQEVLREITGTVRHRKHLDNSINFIGKLLFGAEKGPSTLEAVRPPGQPLVDDWDCLKQ  439

Query  364   MVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYS  185
             MVR+FE+HCGSL QYGM+HMRAFANICNS    A+M+ A    C    + +++  ++ YS
Sbjct  440   MVRIFESHCGSLTQYGMRHMRAFANICNSGTPGASMKRASMGACGGYNSARWSPLAQGYS  499

Query  184   A  182
             A
Sbjct  500   A  500



>ref|XP_004298668.1| PREDICTED: vacuolar-processing enzyme-like [Fragaria vesca subsp. 
vesca]
Length=493

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/469 (68%), Positives = 372/469 (79%), Gaps = 8/469 (2%)
 Frame = -3

Query  1573  AAR---WD-PLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILK  1406
             AAR   WD   IR P  +KD      E  GT WAVLVAGSNGY NYRHQADVCHAYQILK
Sbjct  28    AARLDFWDSAAIRLP-SEKDKTEDAVEQSGTTWAVLVAGSNGYGNYRHQADVCHAYQILK  86

Query  1405  RGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVL  1226
             +GGLK+ENIVVFMYDDIA +  NPRKG+IINHP G DVYAGVPKDYTG+ V AANLYAVL
Sbjct  87    KGGLKEENIVVFMYDDIAMHEMNPRKGIIINHPQGQDVYAGVPKDYTGEHVNAANLYAVL  146

Query  1225  LgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAG  1046
             LGDK+ VKGG+GKVV SK +DRIF++Y+DHGGPGVLGMPN+P LYA DFI VLKKKH++G
Sbjct  147   LGDKKAVKGGTGKVVASKPNDRIFLFYSDHGGPGVLGMPNMPFLYAMDFINVLKKKHASG  206

Query  1045  TYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCL  866
             +YK+MVIYVEACESGS FEG+MP DLNIYV TASNAEE+S+GTYCPG  P PPPEYITCL
Sbjct  207   SYKEMVIYVEACESGSIFEGIMPSDLNIYVATASNAEENSFGTYCPGMNPPPPPEYITCL  266

Query  865   GDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVY  686
             GDLYSVAWMEDSE HNL +ETI+ QY+ VK RTSN+N++  GSHVM+YGS+++ + EK+Y
Sbjct  267   GDLYSVAWMEDSERHNLKKETIKEQYQTVKERTSNFNNYNIGSHVMQYGSKNLTE-EKLY  325

Query  685   LYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDT  506
             LY GFDPA++N P N  +      VVNQRDA++ FMW+ YK     +  K ++LK+I DT
Sbjct  326   LYLGFDPASVNFPPNNGQLEQHMEVVNQRDAEIFFMWQLYKRSEHGSEKKREILKQIRDT  385

Query  505   MLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLG  326
             M HR  +D SI  +G  L+GP+NG+ +L SVR  GL LVDDW+CLKSMVRVFETHCGSL 
Sbjct  386   MNHRNHIDGSIKFIGTFLYGPKNGATVLNSVRPLGLPLVDDWECLKSMVRVFETHCGSLT  445

Query  325   QYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             QYGMKHMRAFANICNS +S+A MEEA    C +   + + HPS K YSA
Sbjct  446   QYGMKHMRAFANICNSGVSQAQMEEASWAAC-DGHDLGHLHPSNKGYSA  493



>gb|EPS73966.1| asparaginyl endopeptidase [Genlisea aurea]
Length=471

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/452 (68%), Positives = 360/452 (80%), Gaps = 10/452 (2%)
 Frame = -3

Query  1582  NLQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKR  1403
             ++   RWDP+IR P  ++   +PE    GTRWAVLVAGSNG+ NYRHQADVCHAYQILKR
Sbjct  21    SVDGRRWDPIIRWPFHRRG--TPE---NGTRWAVLVAGSNGFGNYRHQADVCHAYQILKR  75

Query  1402  GGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLL  1223
             GGLK+ENIVVFMYDDIA++  NPRKG IINHPNG DVY GVPKDYTG+ VTAAN YAV+ 
Sbjct  76    GGLKEENIVVFMYDDIADSEMNPRKGTIINHPNGRDVYEGVPKDYTGENVTAANFYAVIQ  135

Query  1222  gdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGT  1043
             G+K GVKGGSGKVVDSK +D +FIYY+DHGGPGVLGMP +P +Y  D IE LKKKH++GT
Sbjct  136   GNKTGVKGGSGKVVDSKPNDHVFIYYSDHGGPGVLGMPVMPFVYGKDLIEALKKKHASGT  195

Query  1042  YKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLG  863
             Y++M+IYVE+CESGS FEG+MP DLN+YVTTASNAEESSWGTYCPG +PAPPPEY+TCLG
Sbjct  196   YEEMMIYVESCESGSVFEGIMPTDLNVYVTTASNAEESSWGTYCPGMDPAPPPEYMTCLG  255

Query  862   DLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYL  683
             DLYSVAWMEDSE+HNL +ET++ QYE VK RTSN+N + AGSHVMEYG++  IK EK+ L
Sbjct  256   DLYSVAWMEDSETHNLKKETVKEQYERVKERTSNFNSYNAGSHVMEYGNKS-IKAEKLCL  314

Query  682   YQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKE-ITDT  506
             YQGFDP    L G+   R  P  VVNQRDADLLFMWERYK   DN+  K++ LK+ I D 
Sbjct  315   YQGFDPKAETLLGSNGIRRRPLQVVNQRDADLLFMWERYKKLKDNSEEKSEHLKKSIIDA  374

Query  505   MLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLG  326
             + +R+ LD S++ +G  LFGP   +N LKS R  GL LVDDW CLKSMV+VFE  CGSL 
Sbjct  375   IAYRKHLDVSVETIGFILFGP---ANDLKSTRSQGLPLVDDWDCLKSMVQVFEERCGSLT  431

Query  325   QYGMKHMRAFANICNSNISEAAMEEACKNTCS  230
             QYGMKHMRAFANICN+ ++   M EA    CS
Sbjct  432   QYGMKHMRAFANICNNGVTTEDMAEASAVACS  463



>ref|XP_006647602.1| PREDICTED: vacuolar-processing enzyme-like [Oryza brachyantha]
Length=482

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/461 (66%), Positives = 364/461 (79%), Gaps = 3/461 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             W+P+IR P +   +E       GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGLK+E
Sbjct  25    WEPVIRMPGEVVVEEE-VVGGIGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLKEE  83

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIANNA NPR GVI+NHP G DVYAGVPKDYTGD+V   N YAVLLG+K  V
Sbjct  84    NIVVFMYDDIANNALNPRPGVIVNHPQGEDVYAGVPKDYTGDEVNTKNFYAVLLGNKTAV  143

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
              GGS KV+DSK +D IFI+Y+DHGGPGVLGMPNLP+LYA DF++VL++KH + TY  MVI
Sbjct  144   TGGSRKVIDSKPNDHIFIFYSDHGGPGVLGMPNLPYLYAADFMKVLQEKHVSNTYAKMVI  203

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             YVEACESGS FEG+MPEDLN+YVTTASNAEESSWGTYCPG EP+PP EYITCLGDLYSV+
Sbjct  204   YVEACESGSIFEGLMPEDLNVYVTTASNAEESSWGTYCPGMEPSPPAEYITCLGDLYSVS  263

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSE+HNL EE+I+ QYE VK RTS+ N + AGSHVMEYG +   K EK+YLYQGFDP
Sbjct  264   WMEDSETHNLKEESIKEQYEVVKKRTSDMNSYGAGSHVMEYGDK-TFKGEKLYLYQGFDP  322

Query  664   ATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             A   +  N++    PK  VNQRDADLLF+W RY++  + +  K K+L+EI++ + HR+ L
Sbjct  323   ANAEVK-NKLLLDDPKAAVNQRDADLLFLWRRYELLHEKSEEKLKVLREISEAVTHRKHL  381

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D+S+D +G  LFG  NG  +L+ VR  G  LVDDW CLK MVR+FE+HCGSL QYGMKHM
Sbjct  382   DSSVDFVGKLLFGFGNGPTVLQHVRPSGQPLVDDWDCLKRMVRIFESHCGSLTQYGMKHM  441

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             RAFANICN+ I +AAM++A    CS   + +++   + YSA
Sbjct  442   RAFANICNNGIPDAAMKDASIVACSSDNSARWSSLVQGYSA  482



>ref|XP_004953273.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Setaria 
italica]
Length=494

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/471 (64%), Positives = 369/471 (78%), Gaps = 14/471 (3%)
 Frame = -3

Query  1564  WDPLIRQPVDQK----------DDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQ  1415
             WDP+IR P +++          D+E  +G   GTRWAVLVAGS+GY NYRHQAD+CHAYQ
Sbjct  28    WDPVIRMPGEEEPAAARGGEPLDEEEDDG--VGTRWAVLVAGSSGYGNYRHQADICHAYQ  85

Query  1414  ILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLY  1235
             IL +GGLK+ENIVVFMYDD+AN+  NPR+GVIINHP G DVYAGVPKDYTG+QVTA N Y
Sbjct  86    ILLKGGLKEENIVVFMYDDVANSVLNPRQGVIINHPEGEDVYAGVPKDYTGEQVTAKNFY  145

Query  1234  AVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKH  1055
             AVLLG+K+ V GGS KV++SK +D IFIYY+DHGGPGVLGMPNLP++YA DF++VL++KH
Sbjct  146   AVLLGNKDAVTGGSRKVINSKPNDHIFIYYSDHGGPGVLGMPNLPYIYAGDFMKVLREKH  205

Query  1054  SAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYI  875
             ++ +Y  MVIYVEACESGS FEG+MPEDLNIYVTTASNAEESSWGTYCPG  P+PP EYI
Sbjct  206   ASNSYAKMVIYVEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMIPSPPSEYI  265

Query  874   TCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPE  695
             TCLGDLYSV+WMEDSE+HNL EETI+ QYE VK RTS+ N + AGSHVMEYG +   K E
Sbjct  266   TCLGDLYSVSWMEDSETHNLKEETIKEQYEAVKERTSDSNSYGAGSHVMEYGDK-TFKGE  324

Query  694   KVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEI  515
             K+YLYQGF+P   ++    + +   K VVNQRDAD+LF+W+RY++  + +  K ++L+EI
Sbjct  325   KLYLYQGFNPENADITYKLLWQ-GQKSVVNQRDADILFLWKRYELLNEKSKEKLEVLREI  383

Query  514   TDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCG  335
             T T+ HR+ LD+S+D +G  LFG ENG + L +VR PG  LVDDW CLK MVR+FE+HCG
Sbjct  384   TGTVTHRKHLDSSVDFIGKLLFGVENGPSTLGAVRSPGQPLVDDWDCLKRMVRIFESHCG  443

Query  334   SLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             SL QYGMKHMRAFANICN      AM+EA  + C    + +++   + YSA
Sbjct  444   SLTQYGMKHMRAFANICNRGTPATAMKEASISACGSYNSARWSPLVQGYSA  494



>gb|AAF19550.1|AC007190_18 F23N19.7 [Arabidopsis thaliana]
Length=536

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/515 (61%), Positives = 371/515 (72%), Gaps = 55/515 (11%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
              R++P I  P ++ +    + +  GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGLK
Sbjct  25    GRFEPKILMPTEEANPADQDEDGVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLK  84

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPK---------------------  1274
             +ENIVV MYDDIAN+  NPR G +INHP+G DVYAGVPK                     
Sbjct  85    EENIVVLMYDDIANHPLNPRPGTLINHPDGDDVYAGVPKALHNNYSDSDCRDICYGKPNF  144

Query  1273  -----------------------------DYTGDQVTAANLYAVLLgdkegvkggsgkvv  1181
                                          DYTG  VTAAN YAVLLGD++ VKGGSGKV+
Sbjct  145   MCGPFIGIAPRFLIATICSVIYVLKYLFQDYTGSSVTAANFYAVLLGDQKAVKGGSGKVI  204

Query  1180  dsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESG  1001
              SK +D IF+YY DHGGPGVLGMPN PH+YA DFIE LKKKH++GTYK+MVIYVEACESG
Sbjct  205   ASKPNDHIFVYYADHGGPGVLGMPNTPHIYAADFIETLKKKHASGTYKEMVIYVEACESG  264

Query  1000  SFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESH  821
             S FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYSVAWMEDSE+H
Sbjct  265   SIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYSVAWMEDSETH  324

Query  820   NLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGN  641
             NL +ETI++QY  VK+RTSNYN +  GSHVMEYG+   IK EK+YLYQGFDPAT+NLP N
Sbjct  325   NLKKETIKQQYHTVKMRTSNYNTYSGGSHVMEYGNNS-IKSEKLYLYQGFDPATVNLPLN  383

Query  640   QIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLG  461
             ++   +  GVVNQRDADLLF+W  Y+   D +  K   LKE+T+T  HR+ LDAS++ + 
Sbjct  384   ELPVKSKIGVVNQRDADLLFLWHMYRTSEDGSRKKDDTLKELTETTRHRKHLDASVELIA  443

Query  460   VHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICN  281
               LFGP    N+L  VR+PGL LVDDW+CLKSMVRVFE HCGSL QYGMKHMRAFAN+CN
Sbjct  444   TILFGPT--MNVLNLVREPGLPLVDDWECLKSMVRVFEEHCGSLTQYGMKHMRAFANVCN  501

Query  280   SNISEAAMEEACKNTCSEMKTMKYT-HPSKV-YSA  182
             + +S+  MEEA    C      +YT HPS + YSA
Sbjct  502   NGVSKELMEEASTAACGGYSEARYTVHPSILGYSA  536



>ref|XP_002886459.1| F23N19.7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62718.1| F23N19.7 [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/513 (61%), Positives = 372/513 (73%), Gaps = 53/513 (10%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQ-GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGL  1394
              +++P I  P ++    + + E   GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGL
Sbjct  25    GQFEPKILLPTEKTKPTADQDEDGIGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGL  84

Query  1393  KDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPK--------------------  1274
             K+ENIVV MYDDIAN+  NPR G IINHP+G DVYAGVPK                    
Sbjct  85    KEENIVVLMYDDIANHPLNPRPGTIINHPDGDDVYAGVPKVLHNNYSDSDSRDICYGKLN  144

Query  1273  ---------------------------DYTGDQVTAANLYAVLLgdkegvkggsgkvvds  1175
                                        DYTG  VTAAN YAVLLGD++ VKGGSGKV+ S
Sbjct  145   LMCGPLIGIAPRFFIATSYFPFLIVCSDYTGSNVTAANFYAVLLGDQKAVKGGSGKVIAS  204

Query  1174  KADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSF  995
             K +D IF+YY DHGGPGVLGMPN PH+YA DFIE LKKKH++GTYK+MVIYVEACESGS 
Sbjct  205   KPNDHIFVYYADHGGPGVLGMPNTPHIYATDFIETLKKKHASGTYKEMVIYVEACESGSI  264

Query  994   FEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNL  815
             FEG+MP+DLNIYVTTASNA+ESS+GTYCPG  P+PP EYITCLGDLYSVAWMEDSE+HNL
Sbjct  265   FEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYITCLGDLYSVAWMEDSETHNL  324

Query  814   MEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQI  635
              +ETI++QY+ VK+RTSNYN +  GSHVMEYG+   IK EK+Y YQGFDPAT+NLP  ++
Sbjct  325   KKETIKQQYQTVKMRTSNYNTYSGGSHVMEYGNNS-IKSEKLYFYQGFDPATVNLPLKKL  383

Query  634   RRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVH  455
                +  GVVNQRDADLLF+W  Y+   D +  K   LKE+T+T  HR+ LDAS++ +G  
Sbjct  384   PVNSQVGVVNQRDADLLFLWHMYRASEDGSRKKDDTLKELTETTRHRKHLDASVELIGTI  443

Query  454   LFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSN  275
             LFGP    N+L SVR+PGL LVDDW+CLKSMVR FETHCGSL QYGMKHMRAFAN+CN+ 
Sbjct  444   LFGP--AMNVLNSVREPGLPLVDDWECLKSMVRAFETHCGSLTQYGMKHMRAFANVCNNG  501

Query  274   ISEAAMEEACKNTCSEMKTMKYT-HPSKV-YSA  182
             +S+  MEEA    C      +YT HPS + YSA
Sbjct  502   VSKELMEEASAAACGGYNEARYTLHPSVLGYSA  534



>ref|XP_008668185.1| PREDICTED: LOC100286140 isoform X1 [Zea mays]
 tpg|DAA36669.1| TPA: vacuolar processing enzyme, beta-isozyme [Zea mays]
Length=493

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/467 (64%), Positives = 358/467 (77%), Gaps = 6/467 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDES----PEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKR  1403
               W+PLIR P  +  D +     E +  GTRWAVLVAGS GY NYRHQADVCHAYQIL++
Sbjct  29    GEWEPLIRMPTAKGSDAASAPAAEDDEVGTRWAVLVAGSFGYGNYRHQADVCHAYQILQK  88

Query  1402  GGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLL  1223
             GG+K ENIVVFMYDDIA+N  NPR GVIINHP G +VY GVPKDYTGDQVT  N +AVLL
Sbjct  89    GGVKKENIVVFMYDDIAHNILNPRPGVIINHPKGANVYDGVPKDYTGDQVTTENFFAVLL  148

Query  1222  gdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGT  1043
             G++    GGS KV+DSK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VLKKKH++ +
Sbjct  149   GNRSATTGGSKKVIDSKPNDHIFIYYSDHGGPGVLGMPNLPYLYAGDFIKVLKKKHASNS  208

Query  1042  YKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLG  863
             Y  MVIYVEACESGS FEG+MPEDLNIYVTTASN  E+SWGTYCPG EP+PPPEYITCLG
Sbjct  209   YSKMVIYVEACESGSIFEGLMPEDLNIYVTTASNPVENSWGTYCPGMEPSPPPEYITCLG  268

Query  862   DLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYL  683
             DLYSV+WMEDSE+HNL +ETI+ QYE VK RTSN N ++ GSHVMEYG +   K EK+  
Sbjct  269   DLYSVSWMEDSETHNLKKETIKDQYEVVKTRTSNSNKYKEGSHVMEYGDK-TFKDEKLSF  327

Query  682   YQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTM  503
             YQGFDPA  N+  N +    PKG VNQRDADLLFMW+RY+        K + L EI +T+
Sbjct  328   YQGFDPANANI-ANMLLWPGPKGAVNQRDADLLFMWKRYEQLNGGTEEKLRALIEIKETV  386

Query  502   LHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQ  323
              HR+ LD+SID +G  +FG E G ++L++VR  G  LVDDW CLK MVR+FE+ CGSL Q
Sbjct  387   QHRKHLDSSIDFVGRLVFGFEKGPSMLEAVRTSGQPLVDDWDCLKRMVRIFESQCGSLTQ  446

Query  322   YGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             YGMK+MRAFANICNS ISE  M E+  + CS   + +++  ++ +SA
Sbjct  447   YGMKYMRAFANICNSGISEMKMRESSISACSSYNSARWSPMARGHSA  493



>ref|XP_007155624.1| hypothetical protein PHAVU_003G217500g [Phaseolus vulgaris]
 gb|ESW27618.1| hypothetical protein PHAVU_003G217500g [Phaseolus vulgaris]
Length=493

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/475 (65%), Positives = 371/475 (78%), Gaps = 6/475 (1%)
 Frame = -3

Query  1603  AIACQLQNLQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCH  1424
              +  ++Q       D +I+ P  + D ES E    GTRWAVLVAGSNGY NYRHQADVCH
Sbjct  24    VMVMRIQGTNGKEQDSVIKLPTQEVDAESDE---VGTRWAVLVAGSNGYGNYRHQADVCH  80

Query  1423  AYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAA  1244
             AYQ+L +GG+K+ENIVVFMYDDIA +  NPR GVIIN+P G DVYAGVPKDYTG+ VT+ 
Sbjct  81    AYQLLIKGGVKEENIVVFMYDDIATHELNPRPGVIINNPQGPDVYAGVPKDYTGESVTSR  140

Query  1243  NLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLK  1064
             N +AVLLGDK  VKGGSGKV++SK +DRIF+YY+DHGGPGVLGMPN+P+LYA DFI+VLK
Sbjct  141   NFFAVLLGDKSKVKGGSGKVINSKPEDRIFVYYSDHGGPGVLGMPNMPYLYAMDFIDVLK  200

Query  1063  KKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPP  884
             KKH++G YK+MVIYVEACESGS FEG+MP+DLNIYVTTASNA+E+SWGTYCPG  P PPP
Sbjct  201   KKHASGGYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQENSWGTYCPGMYPPPPP  260

Query  883   EYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDII  704
             EYITCLGDLYSVAWMEDSESHNL +E++E+QY++VK RTSN+  +  GSHVM+YG  ++ 
Sbjct  261   EYITCLGDLYSVAWMEDSESHNLKKESVEQQYQSVKQRTSNFEAYAMGSHVMQYGDANMT  320

Query  703   KPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLL  524
               EK+YLY GFDPAT+N P +  R  +   VVNQRDA+LLFMW+ Y+        K  +L
Sbjct  321   -AEKLYLYHGFDPATVNFPPHNGRLKSKMEVVNQRDAELLFMWQMYQRSNHLPEKKTDIL  379

Query  523   KEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFET  344
             K+I + + HR+ LD S++ +GV L+GPE  S++L+SVR  GL LVDDW CLKSMVRV+ET
Sbjct  380   KQIEEIVKHRKHLDGSVELIGVLLYGPEKASSVLRSVRTTGLPLVDDWTCLKSMVRVYET  439

Query  343   HCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKV-YSA  182
             HCGSL QYGMKHMRAFANICNS +SE +ME+AC   C         HPS   YSA
Sbjct  440   HCGSLTQYGMKHMRAFANICNSGVSETSMEKACVAACGGYHA-GLLHPSNTGYSA  493



>sp|O24326.1|VPE2_PHAVU RecName: Full=Vacuolar-processing enzyme; AltName: Full=Pv-VPE; 
Flags: Precursor [Phaseolus vulgaris]
 emb|CAB17079.1| legumain-like proteinase precursor [Phaseolus vulgaris]
Length=493

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/475 (65%), Positives = 371/475 (78%), Gaps = 6/475 (1%)
 Frame = -3

Query  1603  AIACQLQNLQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCH  1424
              +  ++Q       D +I+ P  + D ES E    GTRWAVLVAGSNGY NYRHQADVCH
Sbjct  24    VMVMRIQGTNGKEQDSVIKLPTQEVDAESDE---VGTRWAVLVAGSNGYGNYRHQADVCH  80

Query  1423  AYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAA  1244
             AYQ+L +GG+K+ENIVVFMYDDIA +  NPR GVIIN+P G DVYAGVPKDYTG+ VT+ 
Sbjct  81    AYQLLIKGGVKEENIVVFMYDDIATHELNPRPGVIINNPQGPDVYAGVPKDYTGESVTSH  140

Query  1243  NLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLK  1064
             N +AVLLGDK  VKGGSGKV++SK +DRIF+YY+DHGGPGVLGMPN+P+LYA DFI+VLK
Sbjct  141   NFFAVLLGDKSKVKGGSGKVINSKPEDRIFVYYSDHGGPGVLGMPNMPYLYAMDFIDVLK  200

Query  1063  KKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPP  884
             KKH++G YK+MVIYVEACESGS FEG+MP+DLNIYVTTASNA+E+SWGTYCPG  P PPP
Sbjct  201   KKHASGGYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQENSWGTYCPGMYPPPPP  260

Query  883   EYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDII  704
             EYITCLGDLYSVAWMEDSESHNL +E++E+QY++VK RTSN+  +  GSHVM+YG  ++ 
Sbjct  261   EYITCLGDLYSVAWMEDSESHNLKKESVEQQYQSVKQRTSNFEAYAMGSHVMQYGDANMT  320

Query  703   KPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLL  524
               EK+YLY GFDPAT+N P +  R  +   VVNQRDA+LLFMW+ Y+        K  +L
Sbjct  321   -AEKLYLYHGFDPATVNFPPHNGRLKSKMEVVNQRDAELLFMWQVYQRSNHLPEKKTDIL  379

Query  523   KEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFET  344
             K+I + + HR+ LD S++ +GV L+GPE  S++L+SVR  GL LVDDW CLKSMVRV+ET
Sbjct  380   KQIEEIVKHRKHLDGSVELIGVLLYGPEKASSVLRSVRTTGLPLVDDWTCLKSMVRVYET  439

Query  343   HCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKV-YSA  182
             HCGSL QYGMKHMRAFANICNS +SE +ME+AC   C         HPS   YSA
Sbjct  440   HCGSLTQYGMKHMRAFANICNSGVSETSMEKACVAACGGYHA-GLLHPSNTGYSA  493



>ref|XP_004976374.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=492

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/466 (64%), Positives = 362/466 (78%), Gaps = 7/466 (2%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESP-----EGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             W+PLIR P ++  + +      E +  GTRWAVLVAGS+GY NYRHQADVCHAYQIL +G
Sbjct  29    WEPLIRMPTEKGGNAAAAAPAAEEDEVGTRWAVLVAGSSGYGNYRHQADVCHAYQILLKG  88

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             G+K+ENIVVFMYDDIA+N  NPR GVIINHP G +VY GVPKDYTGDQVT  N +AVLLG
Sbjct  89    GVKEENIVVFMYDDIAHNILNPRPGVIINHPKGENVYPGVPKDYTGDQVTTENFFAVLLG  148

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             ++  + GGS KV+DSK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VLKKKH++ +Y
Sbjct  149   NRSAITGGSKKVIDSKPNDHIFIYYSDHGGPGVLGMPNLPYLYAGDFIKVLKKKHASNSY  208

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
               MVIYVEACESGS FEG+MP+DLNIYVTTASN  E+SWGTYCPG +P+PPPEYITCLGD
Sbjct  209   SKMVIYVEACESGSIFEGLMPQDLNIYVTTASNPVENSWGTYCPGMDPSPPPEYITCLGD  268

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             LYSV+WMEDS++HNLM+ETI+ QYE VK RTSN   ++ GSHVMEYG +     EK++LY
Sbjct  269   LYSVSWMEDSQTHNLMKETIKDQYEVVKTRTSNLKKYKEGSHVMEYGDKTFTN-EKLFLY  327

Query  679   QGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
             QGFDPA  N   N +    PKG VNQRDADLLFMW+RY+     +  K + L+EI +T+ 
Sbjct  328   QGFDPANAN-AANTLLWPGPKGAVNQRDADLLFMWKRYEQLDGGSEEKLRALREIKETVQ  386

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR+ LD+SID +G  +FG ENG  +L++VR  G  LVDDW CLK MVR+FE  CGSL QY
Sbjct  387   HRKHLDSSIDFIGRLVFGFENGPKMLEAVRASGQPLVDDWDCLKRMVRIFEAQCGSLTQY  446

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             GMK+MRAFANICNS ISEA M E+  + C    + +++  ++ +SA
Sbjct  447   GMKYMRAFANICNSGISEAKMRESSISACGGYNSARWSPMAQGHSA  492



>emb|CAB16318.1| cysteine proteinase precursor [Vicia narbonensis]
Length=488

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/463 (66%), Positives = 361/463 (78%), Gaps = 5/463 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
              W+P+IR P +  D +  +    GTRWAVLVAGSNGY NYRHQADVCHAYQ+L +GG+K+
Sbjct  30    EWEPVIRLPGEPVDADVED--EMGTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGVKE  87

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIA N  NPR GVIINHP G +VY GVPKDY GD VTA N YAV+LGDK  
Sbjct  88    ENIVVFMYDDIAYNEMNPRPGVIINHPQGPNVYDGVPKDYNGDFVTAENFYAVILGDKSK  147

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             V+GGSGKV++SKA+DRIFIY +DHGGPGVLGMPN+P++YA DFI+VLKKKH++G YK MV
Sbjct  148   VRGGSGKVINSKAEDRIFIYCSDHGGPGVLGMPNMPYVYAMDFIDVLKKKHASGGYKKMV  207

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
             IYVEACESGS FEG+MP+D+N+YVTTASNA+E+SWGTYCPG +PAPPPEYITCLGDLYSV
Sbjct  208   IYVEACESGSIFEGIMPKDINVYVTTASNAQENSWGTYCPGVDPAPPPEYITCLGDLYSV  267

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDSE+HNL  ET+++QY +V+ RTSNY ++  GSHVM+YG  +I   EK+YLY GFD
Sbjct  268   AWMEDSETHNLKRETVKQQYMSVRERTSNYKNYPLGSHVMQYGDTNITD-EKLYLYHGFD  326

Query  667   PATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
             PA      N         VVNQRDA++LFMW  Y+        K   L++I++T+ HR  
Sbjct  327   PADGEPSSNNDILEAKMEVVNQRDAEILFMWHMYQRLDHQTEKKKDTLEKISETVKHRNH  386

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             LD S++ +GV LFGP  GS++L+SVR  GL LVDDW+CLKS VRVFETHCGSL QYGMKH
Sbjct  387   LDGSVELIGVLLFGPTKGSSVLQSVRASGLPLVDDWECLKSRVRVFETHCGSLTQYGMKH  446

Query  307   MRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             MRAFANICNS ISE +MEEAC   C     +   HPS K YSA
Sbjct  447   MRAFANICNSGISEDSMEEACMAACGGYD-VGLLHPSNKGYSA  488



>emb|CAA07639.1| cysteine proteinase precursor [Vicia sativa]
Length=503

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/463 (66%), Positives = 367/463 (79%), Gaps = 6/463 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             W+P+IR P +  D +  E E  GTRWAVLVAGSNGY NYRHQADVCHAYQ+L +GG+K+E
Sbjct  45    WEPVIRLPGEPVDADV-EDEI-GTRWAVLVAGSNGYGNYRHQADVCHAYQLLIKGGVKEE  102

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA + FNPR GVIINHP G +VY GVPKDYTGD VTA NLYAV+LGDK  V
Sbjct  103   NIVVFMYDDIAYSEFNPRPGVIINHPQGPNVYDGVPKDYTGDFVTADNLYAVILGDKSKV  162

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             +GGSGKV++SKA+DRIFIYY+DHGGPGVLGMPN+P++YA DFI+VLKKKH++  Y+ MVI
Sbjct  163   RGGSGKVINSKAEDRIFIYYSDHGGPGVLGMPNMPYVYAMDFIDVLKKKHASRGYQQMVI  222

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTY-CPGSEPAPPPEYITCLGDLYSV  848
             YVEACESGS F+G+MP+D+++YVTTASNAEESSWGTY  PG  PA PPEYITCLGDLYSV
Sbjct  223   YVEACESGSVFQGIMPKDIDVYVTTASNAEESSWGTYLVPGVYPASPPEYITCLGDLYSV  282

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDSE+HNL  ET+++Q+ +VK RT N N++  GSHV EYG  +I   EK+YLY GFD
Sbjct  283   AWMEDSETHNLKRETLKQQFASVKERTLNNNNYGLGSHVTEYGDTNITD-EKLYLYHGFD  341

Query  667   PATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
             PA++NLP N  R  +   VVNQRDA++LFMW+ Y+     +  K  +LK+I++T+ HR  
Sbjct  342   PASVNLPPNNGRLESKMEVVNQRDAEILFMWQMYQRLDHQSEKKRDILKKISETVKHRNH  401

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             LD S++ +GV LFGP  GS++L+SVR  GL LVDDW+CLKS VRVFETHCGSL QYGMKH
Sbjct  402   LDGSVELIGVLLFGPTRGSSVLQSVRASGLPLVDDWECLKSRVRVFETHCGSLTQYGMKH  461

Query  307   MRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPS-KVYSA  182
             MRAFANICN  ISE  MEE C   C     +   HPS K YSA
Sbjct  462   MRAFANICNRGISEDLMEETCMVACGGYD-VGLLHPSNKGYSA  503



>ref|NP_001152500.1| LOC100286140 [Zea mays]
 gb|ACG47915.1| vacuolar processing enzyme, beta-isozyme precursor [Zea mays]
 tpg|DAA36670.1| TPA: vacuolar processing enzyme, beta-isozyme [Zea mays]
Length=457

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/452 (65%), Positives = 350/452 (77%), Gaps = 2/452 (0%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             D     + E +  GTRWAVLVAGS GY NYRHQADVCHAYQIL++GG+K ENIVVFMYDD
Sbjct  8     DAASAPAAEDDEVGTRWAVLVAGSFGYGNYRHQADVCHAYQILQKGGVKKENIVVFMYDD  67

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA+N  NPR GVIINHP G +VY GVPKDYTGDQVT  N +AVLLG++    GGS KV+D
Sbjct  68    IAHNILNPRPGVIINHPKGANVYDGVPKDYTGDQVTTENFFAVLLGNRSATTGGSKKVID  127

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             SK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VLKKKH++ +Y  MVIYVEACESGS
Sbjct  128   SKPNDHIFIYYSDHGGPGVLGMPNLPYLYAGDFIKVLKKKHASNSYSKMVIYVEACESGS  187

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG+MPEDLNIYVTTASN  E+SWGTYCPG EP+PPPEYITCLGDLYSV+WMEDSE+HN
Sbjct  188   IFEGLMPEDLNIYVTTASNPVENSWGTYCPGMEPSPPPEYITCLGDLYSVSWMEDSETHN  247

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L +ETI+ QYE VK RTSN N ++ GSHVMEYG +   K EK+  YQGFDPA  N+  N 
Sbjct  248   LKKETIKDQYEVVKTRTSNSNKYKEGSHVMEYGDK-TFKDEKLSFYQGFDPANANI-ANM  305

Query  637   IRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGV  458
             +    PKG VNQRDADLLFMW+RY+        K + L EI +T+ HR+ LD+SID +G 
Sbjct  306   LLWPGPKGAVNQRDADLLFMWKRYEQLNGGTEEKLRALIEIKETVQHRKHLDSSIDFVGR  365

Query  457   HLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNS  278
              +FG E G ++L++VR  G  LVDDW CLK MVR+FE+ CGSL QYGMK+MRAFANICNS
Sbjct  366   LVFGFEKGPSMLEAVRTSGQPLVDDWDCLKRMVRIFESQCGSLTQYGMKYMRAFANICNS  425

Query  277   NISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              ISE  M E+  + CS   + +++  ++ +SA
Sbjct  426   GISEMKMRESSISACSSYNSARWSPMARGHSA  457



>ref|XP_010695188.1| PREDICTED: vacuolar-processing enzyme-like [Beta vulgaris subsp. 
vulgaris]
Length=430

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/403 (72%), Positives = 335/403 (83%), Gaps = 1/403 (0%)
 Frame = -3

Query  1438  ADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGD  1259
             ADVCHAYQILK+GGLKDENIVVFMYDDIA+N  NPRKGVIINHP G DVYAGVPKDYTG+
Sbjct  13    ADVCHAYQILKKGGLKDENIVVFMYDDIADNPLNPRKGVIINHPKGEDVYAGVPKDYTGE  72

Query  1258  QVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDF  1079
              VTA N+YAVLLG+K  V GGSGKV+DSK +DRIF+YY+DHGGPGVLGMPN+P LY  DF
Sbjct  73    HVTAENMYAVLLGNKSAVNGGSGKVIDSKPNDRIFLYYSDHGGPGVLGMPNMPFLYGKDF  132

Query  1078  IEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSE  899
             IEVLKKKH++ +YK+M+IY+EACESGS FEG+MPEDLNIYVTTASNAEESSWGTYCPG  
Sbjct  133   IEVLKKKHASKSYKEMLIYIEACESGSVFEGLMPEDLNIYVTTASNAEESSWGTYCPGMN  192

Query  898   PAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYG  719
             PAPPPE++TCLGDLYS+AWME SE+HNL +ETI +QYE VK RTSNYN + AGSHVMEYG
Sbjct  193   PAPPPEFMTCLGDLYSIAWMEASETHNLKKETINQQYEKVKERTSNYNTYTAGSHVMEYG  252

Query  718   SRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVS  539
             ++  +KPEK+YLYQGFDPAT+NLP N++      GVVNQRDAD+LF+W +Y+   D    
Sbjct  253   NKS-LKPEKLYLYQGFDPATVNLPPNRLPLDFKLGVVNQRDADILFLWNKYERSRDKPEE  311

Query  538   KAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMV  359
             K K+L+EIT+TM HR  LD+SI+ +G  LFGP NG ++L +  +PG+ LVDDW CLKSMV
Sbjct  312   KHKILQEITETMKHRIHLDSSIELIGKLLFGPNNGQSVLSTKPRPGMPLVDDWDCLKSMV  371

Query  358   RVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCS  230
              VFE  CGSL QYGMKHMRAFANICN  I   AMEE C   CS
Sbjct  372   HVFEKQCGSLTQYGMKHMRAFANICNEGILLQAMEEVCVAACS  414



>ref|XP_010264202.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=498

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/445 (66%), Positives = 356/445 (80%), Gaps = 4/445 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             RW+  IR P ++++ E    E  GTRWAVLVAGS+G+ NYRHQADVCHAYQ+L++GGLK+
Sbjct  41    RWEAGIRMPTEKEEREENGEEI-GTRWAVLVAGSSGFGNYRHQADVCHAYQLLRKGGLKE  99

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIA + FNPR G+IINHP G DVYAGVPKDYTG+ VTA NLYAVLLGDK  
Sbjct  100   ENIVVFMYDDIAYSEFNPRPGIIINHPQGQDVYAGVPKDYTGENVTAKNLYAVLLGDKRA  159

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             V+GGSGKV+DSK +DRIF YY+DHGGPGVLGMPNLP +YA +FIEVLKKKH+A  YK+MV
Sbjct  160   VRGGSGKVIDSKPNDRIFFYYSDHGGPGVLGMPNLPFIYAVNFIEVLKKKHAARGYKEMV  219

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
             IYVEACESGS FEG+M EDL+IYVTTASNA+E SWGTYCPG  P+PPPE++TCLGDLYSV
Sbjct  220   IYVEACESGSIFEGLMTEDLDIYVTTASNAQELSWGTYCPGMVPSPPPEFLTCLGDLYSV  279

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDSE H+L EETI++QY+NVK R SNYN +  GSHVMEYG++  IK EK+YLYQGF 
Sbjct  280   AWMEDSEIHSLKEETIQQQYQNVKYRASNYNTYDVGSHVMEYGNKS-IKFEKLYLYQGFS  338

Query  667   PATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
               T  +  N ++      VVNQRDADLLF+W+RYK   + +  K ++ K+I +T+ HR  
Sbjct  339   QDTEKINQNSLQ--FHMDVVNQRDADLLFLWQRYKKSEEGSKKKKEIFKQIAETIKHRIH  396

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             LD S++ +G  LFGPE  ++IL +VR  G  LVD+W CLK++VR+ E+HCGSL QYGMKH
Sbjct  397   LDGSVELIGNLLFGPERAASILSAVRPSGWPLVDNWDCLKALVRLLESHCGSLTQYGMKH  456

Query  307   MRAFANICNSNISEAAMEEACKNTC  233
             MR  ANICNS IS+ AM+EAC   C
Sbjct  457   MRTLANICNSGISQDAMKEACMAAC  481



>ref|NP_001047562.1| Os02g0644000 [Oryza sativa Japonica Group]
 dbj|BAF09476.1| Os02g0644000, partial [Oryza sativa Japonica Group]
Length=446

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/419 (68%), Positives = 341/419 (81%), Gaps = 2/419 (0%)
 Frame = -3

Query  1438  ADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGD  1259
             ADVCHAYQIL++GGLK+ENIVVFMYDDIANN  NPR GVI+NHP G DVYAGVPKDYTGD
Sbjct  30    ADVCHAYQILRKGGLKEENIVVFMYDDIANNILNPRPGVIVNHPQGEDVYAGVPKDYTGD  89

Query  1258  QVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDF  1079
             +VTA N YAVLLG+K  V GGS KV+DSK +D IFI+Y+DHGGPGVLGMPNLP+LYA DF
Sbjct  90    EVTAKNFYAVLLGNKTAVTGGSRKVIDSKPNDHIFIFYSDHGGPGVLGMPNLPYLYAADF  149

Query  1078  IEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSE  899
             ++VL++KH++ TY  MVIYVEACESGS FEG+MPEDLNIYVTTASNAEESSWGTYCPG E
Sbjct  150   MKVLQEKHASNTYAKMVIYVEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGME  209

Query  898   PAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYG  719
             P+PP EYITCLGDLYSV+WMEDSE+HNL EE+I++QYE VK RTS+ N + AGSHVMEYG
Sbjct  210   PSPPSEYITCLGDLYSVSWMEDSETHNLKEESIKKQYEVVKKRTSDMNSYGAGSHVMEYG  269

Query  718   SRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVS  539
              R   K +K+YLYQGFDPA   +  N++    PK  VNQRDADLLF+W RY++  D +  
Sbjct  270   DR-TFKDDKLYLYQGFDPANAEVK-NKLSWEGPKAAVNQRDADLLFLWRRYELLHDKSEE  327

Query  538   KAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMV  359
             K K L+EI+DT++HR+ LD+S+D +G  LFG  NG ++L++VR  G  LVDDW CLK MV
Sbjct  328   KLKALREISDTVMHRKLLDSSVDLVGKLLFGFGNGPSVLQAVRPSGQPLVDDWDCLKRMV  387

Query  358   RVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             R+FE+HCG L QYGMKHMRAFANICN+ IS A+M+EA   TCS   + +++   + YSA
Sbjct  388   RIFESHCGPLTQYGMKHMRAFANICNNGISGASMKEASIATCSSHNSGRWSSLVQGYSA  446



>ref|XP_010053430.1| PREDICTED: vacuolar-processing enzyme isoform X2 [Eucalyptus 
grandis]
Length=418

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/423 (70%), Positives = 351/423 (83%), Gaps = 9/423 (2%)
 Frame = -3

Query  1441  QADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTG  1262
             QADVCHAYQILK+GGLK+ENIVVFMYDDIA +  NPR GVIINHP G DVYAGVPKDYTG
Sbjct  2     QADVCHAYQILKKGGLKEENIVVFMYDDIATHQLNPRPGVIINHPKGDDVYAGVPKDYTG  61

Query  1261  DQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYAND  1082
               VTAANLYAVLLGDK  VKGGSGKVV SK +DRIF+YY+DHGGPGVLGMPN+P LYA D
Sbjct  62    KNVTAANLYAVLLGDKSAVKGGSGKVVSSKPNDRIFLYYSDHGGPGVLGMPNMPFLYAMD  121

Query  1081  FIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGS  902
             FI VLKKKH+A  YK+M+IYVEACESGS FEG+MP+DL+IYVTTASNA+ESS+GTYCPG 
Sbjct  122   FINVLKKKHAAKGYKEMIIYVEACESGSVFEGIMPKDLDIYVTTASNAQESSFGTYCPGM  181

Query  901   EPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEY  722
             EP PPPEYITCLGDLYS+AWMEDSESHNL +ETI++QY++VK RTSN+N++ AGSHVMEY
Sbjct  182   EPPPPPEYITCLGDLYSIAWMEDSESHNLKKETIKQQYQSVKQRTSNFNNYNAGSHVMEY  241

Query  721   GSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPK--GVVNQRDADLLFMWERYKMKGDN  548
             G++  IK E++YLYQGFDPAT+N P N   R+ P+  G+VNQRDADL F+W+ YK   +N
Sbjct  242   GNQS-IKDERLYLYQGFDPATVNFPPN---RVPPEYMGIVNQRDADLHFLWQMYKKTENN  297

Query  547   AVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLK  368
             +  K ++  +I+ TM HR  LD SI+ +G  LFGPE  S++L + R+PGL LVDDW+CLK
Sbjct  298   SEKKKEITGQISSTMRHRIHLDGSIEMIGALLFGPEKSSSVLNAAREPGLPLVDDWKCLK  357

Query  367   SMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKV-  191
             SMVRVFETHCGSL QYGMKHMRAFANICNS ++  +MEEAC + C+    +   HPS + 
Sbjct  358   SMVRVFETHCGSLTQYGMKHMRAFANICNSRVTRESMEEACASACAGHGGL--WHPSNLG  415

Query  190   YSA  182
             YSA
Sbjct  416   YSA  418



>ref|XP_006838617.1| hypothetical protein AMTR_s00002p00230280 [Amborella trichopoda]
 gb|ERN01186.1| hypothetical protein AMTR_s00002p00230280 [Amborella trichopoda]
Length=452

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/428 (69%), Positives = 343/428 (80%), Gaps = 4/428 (1%)
 Frame = -3

Query  1510  GETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPR  1331
             GE  GTRWAVLVAGS+G+ NYRHQADVCHAYQ+L +GGLK+ENIVVFM+DDIA N FNP+
Sbjct  8     GEGVGTRWAVLVAGSSGFGNYRHQADVCHAYQLLLKGGLKEENIVVFMHDDIAYNEFNPK  67

Query  1330  KGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFI  1151
             KG+IINHP G DVYAGVPKDYTG QV   NLYAVLLG+   V GGSGKV++SKA+DRIFI
Sbjct  68    KGIIINHPQGEDVYAGVPKDYTGKQVHTKNLYAVLLGNNSAVTGGSGKVINSKAEDRIFI  127

Query  1150  YYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPED  971
             YY+DHGGPGVLGMPN+P LYAND +EVLKKKH +  YK+MVIYVEACESGS FEG+M ED
Sbjct  128   YYSDHGGPGVLGMPNMPFLYANDLMEVLKKKHKSKGYKEMVIYVEACESGSIFEGLMTED  187

Query  970   LNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQ  791
             LNIYVTTASNA+ESSWGTYCPG +P PPPE++TCLGDLYSVAWMEDSE+HNL EETI++Q
Sbjct  188   LNIYVTTASNAQESSWGTYCPGMDPPPPPEFMTCLGDLYSVAWMEDSETHNLKEETIQKQ  247

Query  790   YENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPK--  617
             Y  VK RTSNYN + AGSHVMEYG +  IK E++YLYQGFDPA  NL  N +  L P   
Sbjct  248   YVRVKSRTSNYNTYTAGSHVMEYGDKS-IKSERLYLYQGFDPANANLSDNSL-PLQPNRM  305

Query  616   GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPEN  437
              VVNQRDADLLF+W+RY+   + +  K  +  E+T+ M HR+ LD S+D +G  LFG + 
Sbjct  306   DVVNQRDADLLFLWQRYERSTEGSEEKVAIRNEMTEKMAHREHLDKSVDLIGRLLFGWDK  365

Query  436   GSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAM  257
             GSN+L + R  G ALVDDW CLKSMVR FE  CG L QYGMKHMRAFANICN  IS   M
Sbjct  366   GSNVLGAKRPSGKALVDDWSCLKSMVRAFEEKCGPLTQYGMKHMRAFANICNEGISLEVM  425

Query  256   EEACKNTC  233
              +AC+  C
Sbjct  426   SKACEEVC  433



>emb|CBX26639.1| vacuolar processing enzyme 2c [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/467 (61%), Positives = 349/467 (75%), Gaps = 16/467 (3%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPE----------GETQGTRWAVLVAGSNGYANYRHQADVCHA  1421
             A W+PLIR P D+                  E   T+WAVLVAGS+GY NYRHQADVCHA
Sbjct  28    ASWEPLIRLPTDKGAAAPAPAPAPAAAAPVAEEGVTKWAVLVAGSSGYGNYRHQADVCHA  87

Query  1420  YQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAAN  1241
             YQIL++GGLK+ENIVVFM+DDIA N  NPR GVIINHP G DVYAGVPKDYTG QVTA N
Sbjct  88    YQILRQGGLKEENIVVFMFDDIAKNHLNPRPGVIINHPKGEDVYAGVPKDYTGGQVTAKN  147

Query  1240  LYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKK  1061
              +AVLLG+K  V GGSGKV++SK  D IFIYY DHGGPGVLGMPN P+LYA DFI VL++
Sbjct  148   FFAVLLGNKTAVTGGSGKVINSKPKDHIFIYYADHGGPGVLGMPNTPYLYAGDFIRVLRE  207

Query  1060  KHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPE  881
             KH++ +Y  M+IYVEACESGS FEG++PEDLNIYVTTASNA E+SWG YCPG + +PP E
Sbjct  208   KHASKSYSKMIIYVEACESGSIFEGLLPEDLNIYVTTASNAVENSWGAYCPGMKSSPPTE  267

Query  880   YITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIK  701
             Y TC+GD+YSV+WMEDSE+HNL +ET+++QYE VK RTS   +F  GSHVMEYG +   K
Sbjct  268   YDTCIGDIYSVSWMEDSETHNLKKETLKQQYEVVKSRTSKSKEFDKGSHVMEYGDK-TFK  326

Query  700   PEKVYLYQGFDPATINLPGNQIRRLTP--KGVVNQRDADLLFMWERYKMKGDNAVSKAKL  527
              EK++ YQGF+PA  N+     R L P  +G +NQRDAD+LFMW+RY+     +  K  +
Sbjct  327   DEKLFHYQGFNPANSNVAN---RLLLPDLEGAINQRDADILFMWKRYEKLNGGSEEKLGV  383

Query  526   LKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFE  347
             L+EI +T+ HR+ LD+SID +G  +FG ENG ++L++ R  G  LVDDW CLK MVRVFE
Sbjct  384   LREIKETVAHRKHLDSSIDFIGKLVFGFENGPSVLEAARSSGQPLVDDWDCLKRMVRVFE  443

Query  346   THCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYT  206
             + CGSL QYGMKHMRAFANICN+ +SEA M EA  + C      K++
Sbjct  444   SQCGSLTQYGMKHMRAFANICNNGVSEAQMREASISACGGYNLAKWS  490



>ref|NP_001053428.1| Os04g0537900 [Oryza sativa Japonica Group]
 dbj|BAC76418.1| vacuolar processing enzyme [Oryza sativa Japonica Group]
 dbj|BAF15342.1| Os04g0537900 [Oryza sativa Japonica Group]
 gb|EEE61412.1| hypothetical protein OsJ_15605 [Oryza sativa Japonica Group]
Length=497

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/462 (65%), Positives = 357/462 (77%), Gaps = 10/462 (2%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQ--------GTRWAVLVAGSNGYANYRHQADVCHAYQI  1412
             +W+PLIR P ++ DD                GTRWAVLVAGS+GY NYRHQADVCHAYQI
Sbjct  29    KWEPLIRMPTEEGDDAEAAAPAPAPAAADYGGTRWAVLVAGSSGYGNYRHQADVCHAYQI  88

Query  1411  LKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYA  1232
             L++GG+K+ENIVVFMYDDIA+N  NPR G IINHP G DVYAGVPKDYTG QVT  N +A
Sbjct  89    LQKGGVKEENIVVFMYDDIAHNILNPRPGTIINHPKGGDVYAGVPKDYTGHQVTTENFFA  148

Query  1231  VLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHS  1052
             VLLG+K  V GGSGKV+DSK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VL+KKH+
Sbjct  149   VLLGNKTAVTGGSGKVIDSKPEDHIFIYYSDHGGPGVLGMPNLPYLYAGDFIKVLQKKHA  208

Query  1051  AGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYIT  872
             + +Y  MVIYVEACESGS FEG+MPE+LNIYVTTASNA E+SWGTYCPG EP+PPPEYIT
Sbjct  209   SNSYSKMVIYVEACESGSIFEGLMPENLNIYVTTASNAVENSWGTYCPGEEPSPPPEYIT  268

Query  871   CLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEK  692
             CLGD+YSVAWMEDSE+HNL +ETIE QYE VK RTSN N    GSHVMEYG +   K EK
Sbjct  269   CLGDMYSVAWMEDSETHNLKKETIEDQYELVKKRTSNANKLNEGSHVMEYGDK-TFKDEK  327

Query  691   VYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEIT  512
             ++LYQGF+PA  N+  N++    PK  VNQRDADLLFMW+RY+     +  K + L+EI 
Sbjct  328   LFLYQGFNPANGNIT-NELIWPVPKATVNQRDADLLFMWKRYEQLNGVSEDKLRALREIE  386

Query  511   DTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGS  332
             DT+ HR+ LD+SID +G  +FG ENG   L++ R  G  LVD+W CLK MVR+FE+ CGS
Sbjct  387   DTIAHRKHLDSSIDFIGKLVFGFENGPLALEAARSSGQPLVDNWDCLKKMVRIFESQCGS  446

Query  331   LGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYT  206
             L QYGMK+MRAFANICN+ +SEA M EA  N C    + +++
Sbjct  447   LTQYGMKYMRAFANICNNGVSEAKMMEASINACGRYNSARWS  488



>gb|EMS56335.1| Vacuolar-processing enzyme beta-isozyme [Triticum urartu]
Length=479

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/479 (59%), Positives = 348/479 (73%), Gaps = 45/479 (9%)
 Frame = -3

Query  1567  RWDPLIRQPVDQK----DDESPEGETQGTRWAVLVAGSNGYANYRHQ-------------  1439
             +WDP+IR P +++    D+ S E +  GTRWAVLVAGS+GY NYRHQ             
Sbjct  29    KWDPVIRMPGEEEPATGDESSEEEDGVGTRWAVLVAGSSGYGNYRHQITSAHWNFGAALK  88

Query  1438  ADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGD  1259
             AD+CHAYQIL++GG+K+ENIVVFMYDDIANN  NPR GVIINHP G DVYAGVPKDYTG+
Sbjct  89    ADICHAYQILRKGGVKEENIVVFMYDDIANNPLNPRPGVIINHPEGEDVYAGVPKDYTGE  148

Query  1258  QVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDF  1079
              VTA N YAVLLG+K  V                       GG     MPNLP+LYA DF
Sbjct  149   AVTAKNFYAVLLGNKTAVT----------------------GG----SMPNLPYLYAADF  182

Query  1078  IEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSE  899
             I+VL++KH++ TY  MVIYVEACESGS FEG+MP DLNIYVTTASNAEESSWGTYCPG E
Sbjct  183   IKVLQEKHASNTYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGME  242

Query  898   PAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYG  719
             P+PP EYITCLGDLYS++WMEDSE++NL EETI++QYE VK RTS+ N + AGSHVMEYG
Sbjct  243   PSPPSEYITCLGDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYG  302

Query  718   SRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVS  539
              +   K EK+YLYQGF+PA  N+  N++    PK  +NQRDADLLF+W RY++  + +  
Sbjct  303   DK-TFKDEKLYLYQGFNPANTNIT-NKLFLQAPKAAINQRDADLLFLWRRYELLHEKSKE  360

Query  538   KAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMV  359
             K  +L+EI++T+ HR+ LD+SID +G  LFG ENG ++L++VR  G  LVDDW CLK MV
Sbjct  361   KTNVLREISETVTHRKHLDSSIDFIGKLLFGYENGPSVLQAVRPSGKPLVDDWDCLKRMV  420

Query  358   RVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             R+FE+HCGSL QYGMKHMRAFANICN+ IS   M+EA    C    + +++   + YSA
Sbjct  421   RIFESHCGSLTQYGMKHMRAFANICNNGISGTTMKEASIGACGVQNSARWSSLIQGYSA  479



>ref|XP_006652582.1| PREDICTED: vacuolar-processing enzyme-like [Oryza brachyantha]
Length=500

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/465 (64%), Positives = 358/465 (77%), Gaps = 10/465 (2%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQKDDESPEGETQ--------GTRWAVLVAGSNGYANYRHQADVCHA  1421
             +  +W+PLIR P ++ +D                GTRWAVLVAGS+GY NYRHQADVCHA
Sbjct  29    EEGKWEPLIRMPTEEGEDAEAAAPAPAPAAPERVGTRWAVLVAGSSGYGNYRHQADVCHA  88

Query  1420  YQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAAN  1241
             YQIL++GG+++ENIVVFMYDDIA+N  NPR G+IINHP G DVYAGVPKDYTG  VT  N
Sbjct  89    YQILRKGGVEEENIVVFMYDDIAHNILNPRPGIIINHPIGGDVYAGVPKDYTGHHVTTEN  148

Query  1240  LYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKK  1061
              YAVLLG+K  V GGSGKV+DSK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VL+ 
Sbjct  149   FYAVLLGNKTAVTGGSGKVIDSKPEDHIFIYYSDHGGPGVLGMPNLPYLYAGDFIKVLQN  208

Query  1060  KHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPE  881
             KH++ +Y  MVIYVEACESGS FEG+MP++LNIYVTTASNA E+SWGTYCPG EP+PPPE
Sbjct  209   KHASNSYSKMVIYVEACESGSIFEGLMPDNLNIYVTTASNAVENSWGTYCPGEEPSPPPE  268

Query  880   YITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIK  701
             YITCLGD+YSVAWMEDSE+HNL  ETIE QYE VK RTSN N    GSHVMEYG +   K
Sbjct  269   YITCLGDMYSVAWMEDSETHNLKRETIEDQYEVVKKRTSNANKLNEGSHVMEYGDK-TFK  327

Query  700   PEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLK  521
              EK++LYQGF+PA  N+  N++    PK  VNQRDADLLFMW+RY+     +  K K+L+
Sbjct  328   DEKLFLYQGFNPANGNIT-NELIWPVPKAAVNQRDADLLFMWKRYEQLNGGSEDKLKVLR  386

Query  520   EITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETH  341
             EI DT+ HR+ LD+SID +G  +FG ENG  IL++ R  G +LVDDW CLK MVR+FE+ 
Sbjct  387   EIEDTIAHRKHLDSSIDFIGKLVFGFENGPLILEAARSSGQSLVDDWDCLKKMVRIFESQ  446

Query  340   CGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYT  206
             CGSL QYGMKHMRAFAN+CN+ +SEA M E   N C    + +++
Sbjct  447   CGSLTQYGMKHMRAFANMCNNGVSEAKMMETSINACGSYNSARWS  491



>gb|EEC77714.1| hypothetical protein OsI_16797 [Oryza sativa Indica Group]
Length=497

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/462 (65%), Positives = 356/462 (77%), Gaps = 10/462 (2%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQ--------GTRWAVLVAGSNGYANYRHQADVCHAYQI  1412
             +W+PLIR P ++ DD                GTRWAVLVAGS+GY NYRHQADVCHA QI
Sbjct  29    KWEPLIRMPTEEGDDAEAAAPAPAPAAADYGGTRWAVLVAGSSGYGNYRHQADVCHACQI  88

Query  1411  LKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYA  1232
             L++GG+K+ENIVVFMYDDIA+N  NPR G IINHP G DVYAGVPKDYTG QVT  N +A
Sbjct  89    LQKGGVKEENIVVFMYDDIAHNILNPRPGTIINHPKGGDVYAGVPKDYTGHQVTTENFFA  148

Query  1231  VLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHS  1052
             VLLG+K  V GGSGKV+DSK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VL+KKH+
Sbjct  149   VLLGNKTAVTGGSGKVIDSKPEDHIFIYYSDHGGPGVLGMPNLPYLYAGDFIKVLQKKHA  208

Query  1051  AGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYIT  872
             + +Y  MVIYVEACESGS FEG+MPE+LNIYVTTASNA E+SWGTYCPG EP+PPPEYIT
Sbjct  209   SNSYSKMVIYVEACESGSIFEGLMPENLNIYVTTASNAVENSWGTYCPGEEPSPPPEYIT  268

Query  871   CLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEK  692
             CLGD+YSVAWMEDSE+HNL +ETIE QYE VK RTSN N    GSHVMEYG +   K EK
Sbjct  269   CLGDMYSVAWMEDSETHNLKKETIEDQYELVKKRTSNANKLNEGSHVMEYGDK-TFKDEK  327

Query  691   VYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEIT  512
             ++LYQGF+PA  N+  N++    PK  VNQRDADLLFMW+RY+     +  K + L+EI 
Sbjct  328   LFLYQGFNPANGNIT-NELIWPVPKATVNQRDADLLFMWKRYEQLNGVSEDKLRALREIE  386

Query  511   DTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGS  332
             DT+ HR+ LD+SID +G  +FG ENG   L++ R  G  LVD+W CLK MVR+FE+ CGS
Sbjct  387   DTIAHRKHLDSSIDFIGKLVFGFENGPLALEAARSSGQPLVDNWDCLKKMVRIFESQCGS  446

Query  331   LGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYT  206
             L QYGMK+MRAFANICN+ +SEA M EA  N C    + +++
Sbjct  447   LTQYGMKYMRAFANICNNGVSEAKMMEASINACGRYNSARWS  488



>gb|KHG28226.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=454

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/407 (69%), Positives = 334/407 (82%), Gaps = 9/407 (2%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
             +IR P  +KDD+       GTRWAVLVAGS+GY NYRHQADVCHAYQ+L++GGLK+ENI+
Sbjct  40    IIRLP-SEKDDQQ-----LGTRWAVLVAGSSGYGNYRHQADVCHAYQLLRKGGLKEENII  93

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA N  NPR G+IINHP G DVYAGVPKDYTG+ VTAANLYAVLLG++  + GG
Sbjct  94    VFMYDDIAMNELNPRPGIIINHPQGDDVYAGVPKDYTGEHVTAANLYAVLLGNRSALSGG  153

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVVDSK DDRIF+YY+DHGGPGVLGMPNLP LYA DF++VLKKKH+AG+Y++MVIYVE
Sbjct  154   SGKVVDSKPDDRIFLYYSDHGGPGVLGMPNLPFLYAMDFLDVLKKKHAAGSYREMVIYVE  213

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG+MPEDLNIYVTTASNA+ESSWGTYCPG EP+PPPE+ITCLGDLYSVAWME
Sbjct  214   ACESGSIFEGIMPEDLNIYVTTASNAQESSWGTYCPGMEPSPPPEFITCLGDLYSVAWME  273

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQA-GSHVMEYGSRDIIKPEKVYLYQGFDPAT  659
             DSE+HNL  ETIE+QY+ V+ RTSN+N + + GSHVMEYGSR  IK EK+YLYQGFDPA+
Sbjct  274   DSETHNLKRETIEQQYKTVRERTSNFNSYTSGGSHVMEYGSRS-IKAEKLYLYQGFDPAS  332

Query  658   INLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDA  479
             +N P ++         VNQRDAD+LF+W  YK   D +  K ++LK+I++TM HR  LD 
Sbjct  333   VNFPPDEFSHDVQMEAVNQRDADILFLWHMYKNSEDGS-KKKEILKQISETMRHRTHLDG  391

Query  478   SIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHC  338
             SID +G  L+GP  GS IL ++R+P L LVDDWQCLKSM  + E+ C
Sbjct  392   SIDLIGTVLYGPAKGSVILNTIREPSLPLVDDWQCLKSMRLIEESMC  438



>gb|EMT33588.1| Vacuolar-processing enzyme beta-isozyme [Aegilops tauschii]
Length=432

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/450 (63%), Positives = 335/450 (74%), Gaps = 29/450 (6%)
 Frame = -3

Query  1528  DDESPEGETQ-GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIA  1352
             D+ S EGE   GTRWAVLVAGS+GY NYRHQAD+CHAYQIL++GG+K+ENIVVFMYDDIA
Sbjct  11    DNSSEEGEDGVGTRWAVLVAGSSGYGNYRHQADICHAYQILRKGGVKEENIVVFMYDDIA  70

Query  1351  NNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsK  1172
             NN  NPR GVIINHP G DVYAGVPKDYTG+ VTA N YAVLLG+K  V           
Sbjct  71    NNPLNPRPGVIINHPEGEDVYAGVPKDYTGEAVTAKNFYAVLLGNKTAVT----------  120

Query  1171  ADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFF  992
                         GG     MPNLP+LYA DFI+VL++KH++ TY  MVIYVEACESGS F
Sbjct  121   ------------GG----SMPNLPYLYAADFIKVLQEKHASNTYAKMVIYVEACESGSIF  164

Query  991   EGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLM  812
             EG+MP DLNIYVTTASNAEESSWGTYCPG EP+PP EYITCLGDLYS++WMEDSE++NL 
Sbjct  165   EGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYITCLGDLYSISWMEDSETNNLK  224

Query  811   EETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIR  632
             EETI++QYE VK RTS+ N + AGSHVMEYG     K EK+YLYQGF+PA  N+  N++ 
Sbjct  225   EETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDM-TFKDEKLYLYQGFNPANTNIT-NKLF  282

Query  631   RLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHL  452
                PK  +NQRDADLLF+W RY++    +  KA +L EI++T+ HR+ LD SID +G  L
Sbjct  283   LQAPKAAINQRDADLLFLWRRYELLHGKSKEKANVLTEISETVAHRKHLDNSIDFIGKLL  342

Query  451   FGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNI  272
             FG ENG + L++VR  G  LVDDW CLK MVR+FE+HCGSL QYGMKHMRAFANICN+ +
Sbjct  343   FGFENGPSELQAVRPSGKPLVDDWDCLKRMVRIFESHCGSLTQYGMKHMRAFANICNNGV  402

Query  271   SEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             S   M+EA  NTC    + + +   + YSA
Sbjct  403   SGTTMKEASINTCGGHNSARLSTLIQGYSA  432



>ref|XP_003580236.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Brachypodium 
distachyon]
Length=494

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/466 (62%), Positives = 355/466 (76%), Gaps = 5/466 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQ---KDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
              +WDPL+R P ++           +   T+WAVLVAGS+GY NYRHQADVCHAYQILKRG
Sbjct  31    GKWDPLLRMPTEKGCAPAPAPAAADEGVTKWAVLVAGSSGYGNYRHQADVCHAYQILKRG  90

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             GLK+ENIVVFMYDDIA N  NPR GVIINHP G DVYAGVPKDYT DQVT  N +AVLLG
Sbjct  91    GLKEENIVVFMYDDIAKNVLNPRPGVIINHPKGKDVYAGVPKDYTRDQVTTENFFAVLLG  150

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             +K  V GGSGKV+DSK +D IFI+Y+DHGGPG+LGMPN+P+LYA DFI+VL++KH++ +Y
Sbjct  151   NKTAVTGGSGKVIDSKPNDHIFIFYSDHGGPGILGMPNMPYLYAGDFIKVLREKHASNSY  210

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
               MVIYVEACESGS FEG+MPEDLNIYVTTA+NA E+SWG YCP  EP PPPEYITCLGD
Sbjct  211   SKMVIYVEACESGSIFEGLMPEDLNIYVTTAANAVENSWGAYCPEMEPPPPPEYITCLGD  270

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             LYSV+WMEDS++H+L +ETI+ QYE VK RTSN N    GSHVMEYG +   K EK++LY
Sbjct  271   LYSVSWMEDSDAHDLKKETIKDQYEVVKNRTSNSNKSDRGSHVMEYGDK-TFKEEKLFLY  329

Query  679   QGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
             QGF+PA  N+  N++    P   VNQRDAD+LFMW+RY+     +  K + L EI +TM 
Sbjct  330   QGFNPANANV-ANRLIWPGPSAAVNQRDADILFMWKRYEQLNVGSEEKLRALMEIKETMA  388

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR+ LD+SID +G  +FG  NG ++L++ R PG  LVD+W CLK MVR+FE+ CGSL QY
Sbjct  389   HRKHLDSSIDFIGKLVFGFANGPSVLEAARSPGQPLVDNWDCLKRMVRIFESQCGSLTQY  448

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             GMKHMRAFANICN+ +SE  M EA  + C      +++  ++ +SA
Sbjct  449   GMKHMRAFANICNNGVSEDKMMEASTSACGSYDLARWSSVAQGHSA  494



>gb|EMS56147.1| Vacuolar-processing enzyme [Triticum urartu]
Length=459

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/442 (62%), Positives = 342/442 (77%), Gaps = 1/442 (0%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             E + T+WAVLVAGS+GY NYRHQADVCHAYQILK+GGLKDENIVVFMYDDIAN+  NPR+
Sbjct  19    EERVTKWAVLVAGSSGYENYRHQADVCHAYQILKKGGLKDENIVVFMYDDIANSPENPRR  78

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GV+INHP G DVY GVPKDYTG+ VTA NLYAVLLG+K  V GGS KV++SK +D IFIY
Sbjct  79    GVVINHPKGKDVYHGVPKDYTGEHVTAKNLYAVLLGNKTAVTGGSRKVINSKPNDHIFIY  138

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             YTDHGG G LGMPN+P +YA DFI+VL++KH++ +Y  M+IYVEACESGS FEG+MP+D 
Sbjct  139   YTDHGGAGSLGMPNVPFVYAGDFIKVLRQKHASKSYSKMIIYVEACESGSIFEGLMPQDH  198

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIYVTTA+NAEESSW  YCPG E  PP EY TCLGD YSV+WMEDSE+HNL +E+I++QY
Sbjct  199   NIYVTTAANAEESSWAAYCPGMEVPPPSEYKTCLGDAYSVSWMEDSETHNLKKESIKQQY  258

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVV  608
             E VK RT+  N+   GSHVMEYG +   K + ++LYQGFDPA       + R  + KG +
Sbjct  259   EVVKARTAPPNESSIGSHVMEYGDK-TFKGDMLFLYQGFDPAKSYSSYFRQRLPSLKGAI  317

Query  607   NQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSN  428
             NQRDAD+LFMW++Y+     +  K + L EI +T+LHR+ LD+SID +G  +FG E G +
Sbjct  318   NQRDADILFMWKKYEQLNGGSEEKQRALTEIKETVLHRKHLDSSIDFIGKLVFGFEKGPS  377

Query  427   ILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEA  248
             +L + R  G  LVDDW CLK+MVR+FE+ CGSL QYGMKHMRAFANICN+ +SEA M+EA
Sbjct  378   VLDAARGSGQPLVDDWDCLKTMVRIFESQCGSLTQYGMKHMRAFANICNNGVSEAEMKEA  437

Query  247   CKNTCSEMKTMKYTHPSKVYSA  182
               + C +    K++   + +SA
Sbjct  438   SISACDDYDMGKWSPLVRGHSA  459



>emb|CAE03020.3| OSJNBa0091D06.13 [Oryza sativa Japonica Group]
Length=517

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/482 (62%), Positives = 357/482 (74%), Gaps = 30/482 (6%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQ--------GTRWAVLVAGSNGYANYRHQADVCHAYQI  1412
             +W+PLIR P ++ DD                GTRWAVLVAGS+GY NYRHQADVCHAYQI
Sbjct  29    KWEPLIRMPTEEGDDAEAAAPAPAPAAADYGGTRWAVLVAGSSGYGNYRHQADVCHAYQI  88

Query  1411  LKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYA  1232
             L++GG+K+ENIVVFMYDDIA+N  NPR G IINHP G DVYAGVPKDYTG QVT  N +A
Sbjct  89    LQKGGVKEENIVVFMYDDIAHNILNPRPGTIINHPKGGDVYAGVPKDYTGHQVTTENFFA  148

Query  1231  VLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHS  1052
             VLLG+K  V GGSGKV+DSK +D IFIYY+DHGGPGVLGMPNLP+LYA DFI+VL+KKH+
Sbjct  149   VLLGNKTAVTGGSGKVIDSKPEDHIFIYYSDHGGPGVLGMPNLPYLYAGDFIKVLQKKHA  208

Query  1051  AGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYIT  872
             + +Y  MVIYVEACESGS FEG+MPE+LNIYVTTASNA E+SWGTYCPG EP+PPPEYIT
Sbjct  209   SNSYSKMVIYVEACESGSIFEGLMPENLNIYVTTASNAVENSWGTYCPGEEPSPPPEYIT  268

Query  871   CLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEK  692
             CLGD+YSVAWMEDSE+HNL +ETIE QYE VK RTSN N    GSHVMEYG +   K EK
Sbjct  269   CLGDMYSVAWMEDSETHNLKKETIEDQYELVKKRTSNANKLNEGSHVMEYGDK-TFKDEK  327

Query  691   VYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWER-------------------  569
             ++LYQGF+PA  N+  N++    PK  VNQRDADLLFMW+R                   
Sbjct  328   LFLYQGFNPANGNIT-NELIWPVPKATVNQRDADLLFMWKRDNGVEFARVVSFMLIWLTS  386

Query  568   -YKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLAL  392
              Y+     +  K + L+EI DT+ HR+ LD+SID +G  +FG ENG   L++ R  G  L
Sbjct  387   PYEQLNGVSEDKLRALREIEDTIAHRKHLDSSIDFIGKLVFGFENGPLALEAARSSGQPL  446

Query  391   VDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMK  212
             VD+W CLK MVR+FE+ CGSL QYGMK+MRAFANICN+ +SEA M EA  N C    + +
Sbjct  447   VDNWDCLKKMVRIFESQCGSLTQYGMKYMRAFANICNNGVSEAKMMEASINACGRYNSAR  506

Query  211   YT  206
             ++
Sbjct  507   WS  508



>emb|CAQ00098.1| legumain [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/421 (65%), Positives = 333/421 (79%), Gaps = 2/421 (0%)
 Frame = -3

Query  1495  TRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVII  1316
             T+WAVLVAGS+GY NYRHQADVCHAYQILK+GGLKDENIVVFMYDDIAN+  NPR+GV+I
Sbjct  52    TKWAVLVAGSSGYENYRHQADVCHAYQILKKGGLKDENIVVFMYDDIANSPENPRRGVVI  111

Query  1315  NHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDH  1136
             NHP G DVY GVPKDYTGDQVTA N YAVLLG+K  V GGS KV++SK +D IFIYYTDH
Sbjct  112   NHPKGKDVYHGVPKDYTGDQVTAKNFYAVLLGNKTAVTGGSRKVINSKPEDHIFIYYTDH  171

Query  1135  GGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYV  956
             GG G LGMPN+P +YA DFI+VL++KH++ +Y  MV+YVEACESGS FEG+MP D NIYV
Sbjct  172   GGAGSLGMPNVPFVYAGDFIKVLRQKHASKSYSKMVVYVEACESGSIFEGLMPRDHNIYV  231

Query  955   TTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVK  776
             TTA+NAEESSW  YCPG E  PP EY TCLGD YSV+WMEDSE+HNL +ETI++QYE VK
Sbjct  232   TTAANAEESSWAAYCPGMEIPPPSEYYTCLGDAYSVSWMEDSETHNLKKETIKQQYEVVK  291

Query  775   LRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRD  596
              RT+  N    GSHVMEYG +   K E ++LYQGFDPA  ++  N++     KG +NQRD
Sbjct  292   ARTAPRNKSSIGSHVMEYGDK-TFKDEMLFLYQGFDPAKSSIT-NRLPLPILKGAINQRD  349

Query  595   ADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKS  416
             AD+LFMW++Y+     +  K + L++I +T+LHR+ LD+SID +G  +FG + G ++L++
Sbjct  350   ADVLFMWKKYEQLNGGSEEKHRALRDIKETVLHRKHLDSSIDFIGKLVFGFDKGPSMLQA  409

Query  415   VRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNT  236
              R  G  LVDDW CLK MVRVFE+ CGSL QYGMKHMRAFANICN+ +SEA M+EA  + 
Sbjct  410   ARGSGQPLVDDWDCLKRMVRVFESQCGSLTQYGMKHMRAFANICNNGVSEAEMKEASISA  469

Query  235   C  233
             C
Sbjct  470   C  470



>emb|CBX26640.1| vacuolar processing enzyme 2d [Hordeum vulgare subsp. vulgare]
Length=493

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/421 (65%), Positives = 333/421 (79%), Gaps = 2/421 (0%)
 Frame = -3

Query  1495  TRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVII  1316
             T+WAVLVAGS+GY NYRHQADVCHAYQILK+GGLKDENIVVFMYDDIAN+  NPR+GV+I
Sbjct  58    TKWAVLVAGSSGYENYRHQADVCHAYQILKKGGLKDENIVVFMYDDIANSPENPRRGVVI  117

Query  1315  NHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDH  1136
             NHP G DVY GVPKDYTGDQVTA N YAVLLG+K  V GGS KV++SK +D IFIYYTDH
Sbjct  118   NHPKGKDVYHGVPKDYTGDQVTAKNFYAVLLGNKTAVTGGSRKVINSKPEDHIFIYYTDH  177

Query  1135  GGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYV  956
             GG G LGMPN+P +YA DFI+VL++KH++ +Y  MV+YVEACESGS FEG+MP+D NIYV
Sbjct  178   GGAGSLGMPNVPFVYAGDFIKVLRQKHASKSYSKMVVYVEACESGSIFEGLMPQDHNIYV  237

Query  955   TTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVK  776
             TTA+NAEESSW  YCPG E  PP EY TCLGD YSV+WMEDSE+HNL +ETI++QYE VK
Sbjct  238   TTAANAEESSWAAYCPGMEIPPPSEYYTCLGDAYSVSWMEDSETHNLKKETIKQQYEVVK  297

Query  775   LRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRD  596
              RT+  N    GSHVMEYG +   K E ++LYQGFDPA  ++  N++     KG +NQRD
Sbjct  298   ARTAPGNKSSIGSHVMEYGDK-TFKDEMLFLYQGFDPAKSSIT-NRLPLPILKGAINQRD  355

Query  595   ADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKS  416
             AD+LFMW++Y+     +  K + L++I +T+LHR+ LD+SID +G  +FG + G ++L++
Sbjct  356   ADVLFMWKKYEQLNGGSEEKHRALRDIKETVLHRKHLDSSIDFIGKLVFGFDKGPSMLQA  415

Query  415   VRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNT  236
              R  G  LVDDW CLK MVRVFE+ CGSL QYGMKHMRAFANICN+ + EA M+EA  N 
Sbjct  416   ARGSGQPLVDDWDCLKRMVRVFESQCGSLTQYGMKHMRAFANICNNGVPEAEMKEASINA  475

Query  235   C  233
             C
Sbjct  476   C  476



>gb|AAL40390.1| C13 cysteine proteinase precursor [Oryza sativa Indica Group]
Length=465

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/454 (62%), Positives = 342/454 (75%), Gaps = 2/454 (0%)
 Frame = -3

Query  1543  PVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMY  1364
             P   +  E  E +  GTRWAVLVAGS+GY NYRHQADVCHAYQIL++GGLK+ENIVVFMY
Sbjct  14    PRGSEGTEEEEKDGVGTRWAVLVAGSSGYGNYRHQADVCHAYQILRKGGLKEENIVVFMY  73

Query  1363  DDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkv  1184
             DDIANN  NPR G++              +     +    N YAVLLG+K  V GGS KV
Sbjct  74    DDIANNILNPRPGLLSIIHRVKMFMQEFRRITLETKSLQKNFYAVLLGNKTAVTGGSRKV  133

Query  1183  vdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACES  1004
             +DSK +D IFI+Y+DHGGPGVLGMPNLP+LYA DF++VL++KH++ TY  MVIYVEACES
Sbjct  134   IDSKPNDHIFIFYSDHGGPGVLGMPNLPYLYAADFMKVLQEKHASNTYAKMVIYVEACES  193

Query  1003  GSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSES  824
             GS FEG+MPEDLNIYVTTASNAEESSWGTYCPG EP+PP EYITCLGDLYSV+WMEDSE+
Sbjct  194   GSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPSPPSEYITCLGDLYSVSWMEDSET  253

Query  823   HNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPG  644
             HNL EE+I++QYE VK RTS+ N + AGSHVMEYG R   K +K+YLYQGFDPA   +  
Sbjct  254   HNLKEESIKKQYEVVKKRTSDMNSYGAGSHVMEYGDR-TFKDDKLYLYQGFDPANAEVK-  311

Query  643   NQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNL  464
             N++    PK   NQRDADLLF+W RY++  D +  K K L+EI+DT++HR+ LD+S+D +
Sbjct  312   NKLSWEGPKAAANQRDADLLFLWRRYELLHDKSEEKLKALREISDTVMHRKLLDSSVDLV  371

Query  463   GVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANIC  284
             G  L G  NG ++L++V   G  LVDDW CLK MVR+FE+HCG L QYGMKHMRAFANIC
Sbjct  372   GKLLLGFGNGPSVLQAVSPSGQPLVDDWDCLKRMVRIFESHCGPLTQYGMKHMRAFANIC  431

Query  283   NSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             N+ IS A+M+EA   TCS   + +++   + YSA
Sbjct  432   NNGISGASMKEASIATCSSHNSGRWSSLVQGYSA  465



>gb|KDO48391.1| hypothetical protein CISIN_1g016176mg [Citrus sinensis]
Length=394

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/396 (69%), Positives = 329/396 (83%), Gaps = 2/396 (1%)
 Frame = -3

Query  1369  MYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsg  1190
             MYDDIA +  NPR GVIINHP G ++Y GVPKDYTG+ VTA NLYAVLLGD++ VKGGSG
Sbjct  1     MYDDIAMHELNPRPGVIINHPQGENLYDGVPKDYTGEHVTAQNLYAVLLGDRKAVKGGSG  60

Query  1189  kvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEAC  1010
             KVV+SKA+DRIFI+Y+DHGGPGVLGMPN+P++YA +FI+VLKKKH+A +YK MVIYVEAC
Sbjct  61    KVVNSKANDRIFIFYSDHGGPGVLGMPNMPYVYAMEFIDVLKKKHAAKSYKGMVIYVEAC  120

Query  1009  ESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDS  830
             ESGS FEG+MP+DL+IYVTTASNA+ESS+GTYCPG +P+PPPEYITCLGDLYSVAWMEDS
Sbjct  121   ESGSIFEGVMPKDLDIYVTTASNAQESSFGTYCPGMDPSPPPEYITCLGDLYSVAWMEDS  180

Query  829   ESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINL  650
             E+HNL  ETI +QY+ VK RTSN+N++ +GSHVMEYG+   +K EK+YLYQGFDPA+ N 
Sbjct  181   ETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTS-VKSEKLYLYQGFDPASTNF  239

Query  649   PGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASID  470
             P N+++     GVVNQRDADLLFMW  YK   + +  K+++LK+IT+TM HR+ LDASID
Sbjct  240   PPNKLQP-DQMGVVNQRDADLLFMWHMYKNAAEGSEKKSEMLKQITETMRHRKHLDASID  298

Query  469   NLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFAN  290
              +GV LFGP+ GS IL SVR  GL LVDDWQCLKSMVRVFETHCGSL QYGMKHMRAFAN
Sbjct  299   MIGVILFGPDKGSRILNSVRARGLPLVDDWQCLKSMVRVFETHCGSLTQYGMKHMRAFAN  358

Query  289   ICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             ICNS +S+A MEE  +  CS  +  ++    + YSA
Sbjct  359   ICNSGVSQALMEETSEAACSGNELRQWHPAIRGYSA  394



>ref|XP_008797891.1| PREDICTED: vacuolar-processing enzyme [Phoenix dactylifera]
Length=486

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/461 (59%), Positives = 339/461 (74%), Gaps = 7/461 (2%)
 Frame = -3

Query  1552  IRQPVDQKDDE-SPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
             IR P D++D E + + +  GTRWAVL+AGS+GY NYRHQADVCHAYQI+K+GGLKDENI+
Sbjct  29    IRLPSDREDQEFNGDDDAVGTRWAVLIAGSSGYGNYRHQADVCHAYQIMKKGGLKDENII  88

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA+N  NPR+G+IINHP G DVYAGVPKDY GD V   N +AVLLG+K  + GG
Sbjct  89    VFMYDDIAHNEENPRRGIIINHPEGEDVYAGVPKDYVGDDVNVNNFFAVLLGNKTALTGG  148

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKV+DS  DD IFI+Y+DHGGPGVLGMP  P+LYA+D I VLKKKH+AGTYK MV Y+E
Sbjct  149   SGKVLDSGPDDHIFIFYSDHGGPGVLGMPTYPYLYADDLIAVLKKKHAAGTYKSMVFYLE  208

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++P D+NIY TTASNA ESSWGTYCPG  P+PPPEY TCLGDLYSVAWME
Sbjct  209   ACESGSIFEGLLPADINIYATTASNAVESSWGTYCPGEYPSPPPEYYTCLGDLYSVAWME  268

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATI  656
             DSE HNL  ET+++QY+ VK RT+ +N +  GSHVM+YG  D +   +++LY G +PA  
Sbjct  269   DSEVHNLRTETLKQQYQLVKARTAVHNTYSFGSHVMQYGDLD-LNAHQLFLYMGSNPANE  327

Query  655   N---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             N   +  N +   +    VNQRDADLL+ W +Y+   + +  K +  K++ + M HR  +
Sbjct  328   NATFIDDNALPSFSR--AVNQRDADLLYFWHKYRKSPEGSSKKLEAQKQLLEVMSHRLHV  385

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D+S++ +G  LFG E G  +L +VR  G  LVDDW CLKSMVR FETHCGSL QYGMKHM
Sbjct  386   DSSMELIGKLLFGSEEGPKVLGTVRPAGQPLVDDWDCLKSMVRTFETHCGSLAQYGMKHM  445

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             R+ ANICN+ I +  M E     C  + +  ++     +SA
Sbjct  446   RSLANICNTGIKKETMAEVSAQACFRVPSNSWSSLHGGFSA  486



>gb|ABS57371.1| VPE1 [Triticum aestivum]
Length=494

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/467 (59%), Positives = 341/467 (73%), Gaps = 8/467 (2%)
 Frame = -3

Query  1561  DPLIRQPVDQ-------KDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKR  1403
             +PLIR P +            +     + T+WAVLVAGS+GY NYRHQADVCHAYQILK+
Sbjct  29    EPLIRLPTENGHAPAPAPGPAASAAGEEVTKWAVLVAGSSGYENYRHQADVCHAYQILKK  88

Query  1402  GGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLL  1223
             GGLKDENIVVFMYDDIAN+  NPR+G +INHP G DVY GVPKDYTGDQVTA N YAVLL
Sbjct  89    GGLKDENIVVFMYDDIANSPDNPRRGTVINHPKGKDVYHGVPKDYTGDQVTAKNFYAVLL  148

Query  1222  gdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGT  1043
             G+K  V GGS KV++SK +D IFI+Y+DHG PG LGMPN P +YA+DFI+VL++KH++ +
Sbjct  149   GNKTAVTGGSRKVINSKPEDHIFIFYSDHGSPGSLGMPNGPDVYADDFIKVLRQKHASKS  208

Query  1042  YKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLG  863
             Y  MVIYVEACESGS FEG+MP+D NIYVT ASNA ESSW  YCP     PPPEY TCLG
Sbjct  209   YSKMVIYVEACESGSIFEGLMPQDYNIYVTAASNAVESSWAAYCPDDGTPPPPEYFTCLG  268

Query  862   DLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYL  683
             DLYSV+WMEDSE+ NL  ETI++QYE VK RT+  N+   GSHVMEYG +   K + ++L
Sbjct  269   DLYSVSWMEDSETQNLKNETIKQQYEVVKARTAPRNESIRGSHVMEYGDK-TFKEDMLFL  327

Query  682   YQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTM  503
             YQGFDPA  ++    +   + KG + QRDAD+LFMW++Y      +  K + L+E+ +T+
Sbjct  328   YQGFDPAKSSIRNRPLPMPSLKGAIKQRDADILFMWKKYGKLNGGSEEKQRALREVKETV  387

Query  502   LHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQ  323
             LHR+ LD+SID +G  +FG + G  +L++ R  G  LVDDW CLK+MVRVFE+ CGSL Q
Sbjct  388   LHRKHLDSSIDFIGKLVFGFDKGPLVLEAARGSGQPLVDDWDCLKTMVRVFESQCGSLTQ  447

Query  322   YGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             YGMKH RAFAN+CN+  SEA M+EA  + C      K++   + YSA
Sbjct  448   YGMKHTRAFANMCNNGASEAEMKEASISACDGYDMGKWSPLVRGYSA  494



>emb|CAQ00097.1| legumain [Hordeum vulgare subsp. vulgare]
Length=486

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/421 (62%), Positives = 330/421 (78%), Gaps = 1/421 (0%)
 Frame = -3

Query  1495  TRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVII  1316
             T+WAVLVAGS+GY NYRHQADVCHAYQILK+GGLKDENIVVFMYDDIANN  NPR G++I
Sbjct  52    TKWAVLVAGSSGYGNYRHQADVCHAYQILKKGGLKDENIVVFMYDDIANNPDNPRPGIVI  111

Query  1315  NHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDH  1136
             NHP G DVYAGVPKDYTGDQVTA N YAVLLG+K  V GGS KV++SK +D IFIYYTDH
Sbjct  112   NHPKGKDVYAGVPKDYTGDQVTADNFYAVLLGNKTAVTGGSRKVINSKPNDHIFIYYTDH  171

Query  1135  GGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYV  956
             G  G+LGMPN P +YA++FIEVL++KH++ +Y  M+IYVEACESGS FEG++P+D NIYV
Sbjct  172   GAAGLLGMPNPPDVYADNFIEVLRQKHASKSYSKMIIYVEACESGSIFEGLLPQDHNIYV  231

Query  955   TTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVK  776
             TTA+NA E SW  YCP  E  PPPEY TCLGD YSV+WMEDSE+ +L +E+I++QYE VK
Sbjct  232   TTAANAVEDSWAAYCPKMEIPPPPEYCTCLGDAYSVSWMEDSETQDLKKESIKQQYEVVK  291

Query  775   LRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRD  596
              RT+  N+   GSHVMEYG +   K + ++LYQGFDPA  ++    +   + KG +NQRD
Sbjct  292   ARTAPRNESSIGSHVMEYGDK-TFKEDMLFLYQGFDPAKSSIRNRPLPMPSLKGAINQRD  350

Query  595   ADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKS  416
             AD+LFMW +Y+     +  K + L+E+ +T+LHR+ LD+SID +G  +FG + G ++L++
Sbjct  351   ADILFMWRKYEKLNAGSEEKQRALREVKETVLHRKHLDSSIDFIGKLVFGFDKGPSVLQA  410

Query  415   VRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNT  236
              R  G  LVDDW CL++MVRVFE+ CGSL QYG +HMRAFANICN+ +SEA M+EA  + 
Sbjct  411   ARGSGQPLVDDWDCLRTMVRVFESQCGSLTQYGTRHMRAFANICNNGVSEAEMKEASISA  470

Query  235   C  233
             C
Sbjct  471   C  471



>gb|ABR18199.1| unknown [Picea sitchensis]
Length=493

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/465 (60%), Positives = 342/465 (74%), Gaps = 8/465 (2%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             W+ L++ P +  D +S   +  GT WAVL+AGS+GY NYRHQADVCHAYQIL+RGGLK+E
Sbjct  33    WNSLLKLPTNHVDADS---DRIGTEWAVLLAGSSGYWNYRHQADVCHAYQILRRGGLKEE  89

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NIVVFMYDDIA +  NP  G IINHP G+DVYAGVPKDYTG+ VT  N +A +LG+K  V
Sbjct  90    NIVVFMYDDIAYDEENPHPGTIINHPQGSDVYAGVPKDYTGEDVTVNNFFAAILGNKSLV  149

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
              GGSGKVV+S  +DRIFIYY+DHGGPGVLGMP  P+LYANDF++VLKKKH AG+Y++MVI
Sbjct  150   TGGSGKVVESGPNDRIFIYYSDHGGPGVLGMPLPPYLYANDFVQVLKKKHDAGSYREMVI  209

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             YVEACESGS FEG++P DLNIYVTTASNAEE+SWGTYCPG +P PPPEY TCLGDLYSVA
Sbjct  210   YVEACESGSIFEGLLPTDLNIYVTTASNAEENSWGTYCPGMDPPPPPEYDTCLGDLYSVA  269

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDSE +NL EET+ +QY+ VKLRTSN+N + +GSHVM+YG+   I  E++YLY GFD 
Sbjct  270   WMEDSEINNLKEETLLQQYDLVKLRTSNHNTYMSGSHVMQYGNI-TISQEELYLYMGFDS  328

Query  664   ATIN----LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             A  N    L  + +   T    +NQRDADLL+MW++YK   +++  +     ++ + M H
Sbjct  329   ANSNASLVLENSPLLEKTEAKAINQRDADLLYMWQKYKKSKEDSPERLTAQTQLLEFMAH  388

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R  +D S+  +G  LFGPE G  +  +VR  G  LVDDW CLK MVR FE HCGSL QYG
Sbjct  389   RMHVDKSVKLVGNLLFGPEKGPAVFNAVRPQGEPLVDDWDCLKKMVRTFEGHCGSLAQYG  448

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MKHMRA ANICN  IS   M       C++     ++   + +SA
Sbjct  449   MKHMRALANICNEGISMDTMATVSAEACTQFPAGSWSSLQRGFSA  493



>emb|CBX26638.1| vacuolar processing enzyme 2b [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/422 (62%), Positives = 330/422 (78%), Gaps = 1/422 (0%)
 Frame = -3

Query  1495  TRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVII  1316
             T+WAVLVAGS+GY NYRHQADVCHAYQILK+GGLKDENIVVFMYDDIANN  NPR G++I
Sbjct  52    TKWAVLVAGSSGYGNYRHQADVCHAYQILKKGGLKDENIVVFMYDDIANNPDNPRPGIVI  111

Query  1315  NHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDH  1136
             NHP G DVYAGVPKDYTGDQVTA N YAVLLG+K  V GGS KV++SK +D IFIYYTDH
Sbjct  112   NHPKGKDVYAGVPKDYTGDQVTADNFYAVLLGNKTAVTGGSRKVINSKPNDHIFIYYTDH  171

Query  1135  GGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYV  956
             G  G+LGMPN P +YA++FIEVL++KH++ +Y  M+IYVEACESGS FEG++P+D NIYV
Sbjct  172   GAAGLLGMPNPPDVYADNFIEVLRQKHASKSYSKMIIYVEACESGSIFEGLLPQDHNIYV  231

Query  955   TTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVK  776
             TTA+NA E SW  YCP  E  PPPEY TCLGD YSV+WMEDSE+ +L +E+I++QYE VK
Sbjct  232   TTAANAVEDSWAAYCPKMEIPPPPEYCTCLGDAYSVSWMEDSETQDLKKESIKQQYEVVK  291

Query  775   LRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRD  596
              RT+  N+   GSHVMEYG +   K + ++LYQGFDPA  ++    +   + KG +NQRD
Sbjct  292   ARTAPRNESSIGSHVMEYGDQ-TFKEDMLFLYQGFDPAKSSIRNRPLPMPSLKGAINQRD  350

Query  595   ADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKS  416
             AD+LFMW +Y+     +  K + L+E+ +T+LHR+ LD+ ID +G  +FG + G ++L++
Sbjct  351   ADILFMWRKYEKLNAGSEEKQRALREVKETVLHRKHLDSRIDFIGKLVFGFDKGPSVLQA  410

Query  415   VRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNT  236
              R  G  LVDDW CL++MVRVFE+ CGSL QYG +HMRAFANICN+ +SEA M+EA  + 
Sbjct  411   ARGSGQPLVDDWDCLRTMVRVFESQCGSLTQYGTRHMRAFANICNNGVSEAEMKEASISA  470

Query  235   CS  230
             C+
Sbjct  471   CN  472



>ref|XP_002455802.1| hypothetical protein SORBIDRAFT_03g025440 [Sorghum bicolor]
 gb|EES00922.1| hypothetical protein SORBIDRAFT_03g025440 [Sorghum bicolor]
Length=481

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/465 (58%), Positives = 345/465 (74%), Gaps = 12/465 (3%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             R +P IR P D+ DD        GTRWAVLVAGSNGY NYRHQAD+CHAYQI+K+GGLKD
Sbjct  26    RLEPTIRLPSDRADD------AVGTRWAVLVAGSNGYYNYRHQADICHAYQIMKKGGLKD  79

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENI+VFMYDDIA++  NPR GV+INHP G DVYAGVPKDYTG +V+  N +AVLLG+K  
Sbjct  80    ENIIVFMYDDIAHSPENPRPGVLINHPQGGDVYAGVPKDYTGREVSVNNFFAVLLGNKTA  139

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             +KGGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AGTYK +V
Sbjct  140   LKGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKSLV  199

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
              Y+EACESGS FEG++P+D+N+Y TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSV
Sbjct  200   FYLEACESGSIFEGLLPDDINVYATTASNAEESSWGTYCPGEFPSPPPEYDTCLGDLYSV  259

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             +WMEDS+ HNL  E++++QY+ VK RT+  + F  GSHVM+YGS + +  +K++ Y G +
Sbjct  260   SWMEDSDFHNLRTESLKQQYKLVKDRTAVQDTFSYGSHVMQYGSLE-LNVQKLFSYIGTN  318

Query  667   PA---TINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             PA      +  N +   +    VNQRDADL++ W++Y+   D++  K +  KE+ + M H
Sbjct  319   PANDGNTFVEDNSLPSFSK--AVNQRDADLVYFWQKYRKLADDSSKKNEARKELLEVMAH  376

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R  +D S++ +G  LFG E+G  +LK+VR  G  LVDDW CLKSMVR FE  CGSL QYG
Sbjct  377   RSHVDNSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSMVRTFEAQCGSLAQYG  436

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MKHMR+FANICN+ I   A+ +     C+ + +  ++   K +SA
Sbjct  437   MKHMRSFANICNAGILPEAVSKVAAQACTSIPSNPWSSIDKGFSA  481



>ref|XP_010911246.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
Length=491

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/461 (59%), Positives = 338/461 (73%), Gaps = 7/461 (2%)
 Frame = -3

Query  1552  IRQPVDQKDDE-SPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
             IR P D++D E + + +T GTRWAVL+AGS+GY NYRHQADVCHAYQI+K+GGLKDENI+
Sbjct  34    IRLPSDREDHEFNGDDDTVGTRWAVLIAGSSGYGNYRHQADVCHAYQIMKKGGLKDENII  93

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA N  NPR+G+IINHP G DVYAGVPKDY G+ V   N +AVLLG+K  + GG
Sbjct  94    VFMYDDIAYNEENPRRGIIINHPQGEDVYAGVPKDYVGEDVNVNNFFAVLLGNKTALTGG  153

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVVDS  DD IFI+Y+DHGGPGVLGMP  P+LYA+D I VLKKKH+AGTYK MV Y+E
Sbjct  154   SGKVVDSGPDDHIFIFYSDHGGPGVLGMPTYPYLYADDLIAVLKKKHAAGTYKSMVFYLE  213

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++P D+NIY TTASNA ESSWGTYCPG  P+PPPEY TCLGDLYSVAWME
Sbjct  214   ACESGSIFEGLLPADINIYATTASNAVESSWGTYCPGEYPSPPPEYYTCLGDLYSVAWME  273

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATI  656
             DS+ HNL  ET+++QY+ VK R + +N +  GSHVM+YG  D +  E+++LY G +PA  
Sbjct  274   DSDIHNLRTETLKQQYQLVKARAAVHNTYSFGSHVMQYGDLD-LNAEQLFLYIGSNPAND  332

Query  655   N---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             N   +  N +   +    VNQRDADLL+ W +Y+   + +  K +  K++ + M HR  +
Sbjct  333   NATFIDDNALPSFSR--AVNQRDADLLYFWHKYRESPEGSSKKLEAQKQLLEVMSHRLHV  390

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S++ +G  LFG E G  +L +VR  G  LVDDW CLKS+VR FETHCGSL QYGMKHM
Sbjct  391   DNSMELIGKLLFGSEEGPKVLSTVRPTGQPLVDDWDCLKSLVRTFETHCGSLAQYGMKHM  450

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             R+ ANICN+ I +  M E     C  + +  ++     +SA
Sbjct  451   RSLANICNAGIKKETMAEVSAQACFRVPSNPWSSLHGGFSA  491



>ref|XP_007012236.1| Gamma vacuolar processing enzyme [Theobroma cacao]
 gb|EOY29855.1| Gamma vacuolar processing enzyme [Theobroma cacao]
Length=487

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/447 (61%), Positives = 327/447 (73%), Gaps = 3/447 (1%)
 Frame = -3

Query  1519  SPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAF  1340
             S + E +GTRWAVL+AGSNGY NYRHQADVCHAYQ+LK+GGLKDENI+VFMYDDIA N  
Sbjct  43    SNDDEVEGTRWAVLIAGSNGYWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIAFNEE  102

Query  1339  NPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDR  1160
             NPR G+IIN P+G DVY GVPKDYTG+ VT  NL A +LG+K  + GGSGKVVDS  +D 
Sbjct  103   NPRPGIIINSPHGDDVYEGVPKDYTGEDVTVNNLLAAILGNKTALTGGSGKVVDSGPNDH  162

Query  1159  IFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMM  980
             IFIYYTDHGGPGVLGMP  P+LYA+D IEVLKKKH++GTYK +V Y+EACESGS FEG++
Sbjct  163   IFIYYTDHGGPGVLGMPTFPYLYADDLIEVLKKKHASGTYKSLVFYLEACESGSIFEGLL  222

Query  979   PEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETI  800
             PE LNIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  ET+
Sbjct  223   PEGLNIYATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDIHNLQTETL  282

Query  799   ERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLT-  623
              +QYE VK RT N N    GSHVM+YG   + K + V++Y G +PA  N        L  
Sbjct  283   HQQYELVKRRTINGNS-AYGSHVMQYGDIGLSK-DIVFVYLGTNPANDNFTFVDENSLQP  340

Query  622   PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGP  443
             P   VNQRDADL+  W++Y+   D +V K +  K+  + M HR  +D S+  +G  LFG 
Sbjct  341   PTKAVNQRDADLVHFWDKYRKAPDGSVRKLEAQKQFVEAMSHRMHIDNSMKLIGKLLFGI  400

Query  442   ENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEA  263
             E G  ++K+VR  G  LVDDW+CLK MVR FETHCGSL QYGMKHMR+ ANICN+ I   
Sbjct  401   EKGPEVMKTVRPAGQPLVDDWKCLKKMVRTFETHCGSLAQYGMKHMRSLANICNAGIQTE  460

Query  262   AMEEACKNTCSEMKTMKYTHPSKVYSA  182
              M EA    C  + +  ++   K +SA
Sbjct  461   QMAEASAQACVSIPSGHWSSVQKGFSA  487



>ref|XP_009398114.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=396

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/397 (68%), Positives = 318/397 (80%), Gaps = 1/397 (0%)
 Frame = -3

Query  1372  FMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggs  1193
              MYDDIAN+  NPR GVIINHP G DVYAGVPKDYTG QVT+ NLYAVLLG K  V GGS
Sbjct  1     MMYDDIANSPLNPRPGVIINHPQGHDVYAGVPKDYTGKQVTSKNLYAVLLGIKSAVTGGS  60

Query  1192  gkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEA  1013
             GKV+DSK +DRIFIYY+DHGGPGVLGMPN+P+LYA DFIEVLKKKH+  +YK+MVIYVEA
Sbjct  61    GKVIDSKPNDRIFIYYSDHGGPGVLGMPNMPYLYAVDFIEVLKKKHAMNSYKEMVIYVEA  120

Query  1012  CESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMED  833
             CESGS FEG+MP+DLNIYVTTASNAEESSWGTYCPG +P PPPEYITCLGDLYSVAWMED
Sbjct  121   CESGSIFEGLMPKDLNIYVTTASNAEESSWGTYCPGMDPPPPPEYITCLGDLYSVAWMED  180

Query  832   SESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN  653
             SE+HNL EET+ +QYE VK+RTSNYN +  GSHVMEYG ++ IKPEK+YLYQGFDPA  N
Sbjct  181   SETHNLKEETVSKQYEAVKVRTSNYNTYSVGSHVMEYGDKN-IKPEKLYLYQGFDPANAN  239

Query  652   LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASI  473
             +  N + +    G +NQRDADLLF+W+RY+   +++  K + + EIT+TM+HR  LD SI
Sbjct  240   ITENGLSQRMQMGTINQRDADLLFLWKRYERLAESSEDKRRTVMEITETMMHRTHLDRSI  299

Query  472   DNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFA  293
             D +G  +FG  +G  IL++VR  G ALVDDW CLKSMVR FE+HCGSL QYGMKHMRAFA
Sbjct  300   DLIGKLIFGSNSGPAILRAVRPYGQALVDDWDCLKSMVRSFESHCGSLTQYGMKHMRAFA  359

Query  292   NICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             NICN  IS  A++EA  + C    +  ++   + YSA
Sbjct  360   NICNRGISRDAIKEASASACGNYNSAMWSSSMRGYSA  396



>ref|XP_009361606.1| PREDICTED: vacuolar-processing enzyme-like [Pyrus x bretschneideri]
Length=494

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/453 (60%), Positives = 332/453 (73%), Gaps = 8/453 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             DQ+DD      T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  49    DQQDDG-----TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  103

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR+GVIIN+P G+DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVVD
Sbjct  104   IAYNEENPRQGVIINNPQGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVD  163

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFIYYTDHGGPGVLGMP  P++YAND IEVLKKKH+AGTYK +V Y+EACESGS
Sbjct  164   SGPNDHIFIYYTDHGGPGVLGMPTSPYIYANDLIEVLKKKHAAGTYKSLVFYLEACESGS  223

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HN
Sbjct  224   IFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDIHN  283

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  ET+ +QYE VK RT+N +++  GSHVM+YG   + K   +++Y G +PA  N     
Sbjct  284   LRSETLHQQYELVKTRTAN-DNYGFGSHVMQYGDVGLSK-NNLFVYMGTNPANDNYTFLG  341

Query  637   IRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLG  461
                L P    VNQRDADLL  W +Y+   + +  K +  K+  + M HR  +D ++  +G
Sbjct  342   ENSLRPSSKAVNQRDADLLHFWHKYRKAPEGSARKVQAQKDFVEAMSHRMHIDQTMKLIG  401

Query  460   VHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICN  281
               LFG E G  +L +VR  G  LVDDW CLK+MVR FETHCGSL QYGMKHMR+ ANICN
Sbjct  402   KLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANICN  461

Query  280   SNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             + +++  M EA    C    + +++   + +SA
Sbjct  462   AGMTQEQMAEASAQACVSAPSSRWSSLHRGFSA  494



>emb|CDP08231.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/467 (60%), Positives = 333/467 (71%), Gaps = 9/467 (2%)
 Frame = -3

Query  1561  DPLIRQPVDQKDDESPE------GETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             D  ++ P +  D   P+      G++ GTRWAVL+AGSNGY NYRHQADVCHAYQILKRG
Sbjct  24    DNFLKLPSEIADFFHPKERSDAGGDSVGTRWAVLIAGSNGYWNYRHQADVCHAYQILKRG  83

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             GLKDENIVVFMYDDIA N  NPR GVIIN P+G DVY GVPKDYTGD V A N  A +LG
Sbjct  84    GLKDENIVVFMYDDIAYNEENPRPGVIINSPHGADVYQGVPKDYTGDDVNAKNFLAAILG  143

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             DK  + GGSGKVVDS  +D IFIYYTDHGGPGVLG P+ P+LYA+D  EVLKKKH++GTY
Sbjct  144   DKTAITGGSGKVVDSGPNDHIFIYYTDHGGPGVLGTPSGPYLYADDLNEVLKKKHASGTY  203

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K +V Y+EACESGS FEG++PEDLNIY TTASNAEESSWGTYCPG  P+PPPEY TCLGD
Sbjct  204   KSLVFYLEACESGSIFEGLLPEDLNIYATTASNAEESSWGTYCPGEYPSPPPEYETCLGD  263

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             LYSVAWMEDSE HNL  ET+++QY  VK RTS+ N    GSHVM+YG    +  E ++LY
Sbjct  264   LYSVAWMEDSEIHNLHTETLKQQYHLVKKRTSSSNS-AYGSHVMQYGDLK-LSLEDLFLY  321

Query  679   QGFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTM  503
              G +PA  N        L P    VNQRDADLL  W++++   + +  K +  K++ + M
Sbjct  322   MGTNPANDNYTFVDENSLRPSSKAVNQRDADLLHFWDKFRKAPEGSARKVEAQKQVVEAM  381

Query  502   LHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQ  323
              HR  +D S+  +G  LFG E GS IL SVR  G  L DDW CLKS+VR FETHCGSL Q
Sbjct  382   SHRMHIDNSVKLIGKLLFGIEKGSEILNSVRPAGHPLADDWDCLKSLVRTFETHCGSLSQ  441

Query  322   YGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             YGMKHMR+ ANICN+ I +  M EA    C  + +  ++   + +SA
Sbjct  442   YGMKHMRSIANICNAGIKKDQMAEAAAQACVSLPSNSWSSLHRGFSA  488



>gb|ACG34144.1| vacuolar processing enzyme precursor [Zea mays]
Length=486

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/476 (56%), Positives = 348/476 (73%), Gaps = 9/476 (2%)
 Frame = -3

Query  1594  CQLQNLQAARWDPLIRQPVDQKD--DESPEGETQGTRWAVLVAGSNGYANYRHQADVCHA  1421
             C        R +  IR P  +    DE+ +G   GTRWAVL+AGS+GY NYRHQAD+CHA
Sbjct  15    CLCSAWARPRLETAIRLPSQRAAAADETDDGAV-GTRWAVLIAGSSGYYNYRHQADICHA  73

Query  1420  YQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAAN  1241
             YQI+K+GGLKDENI+VFMYDDIA++  NPR GVIINHP G DVYAGVPKDYTG  V   N
Sbjct  74    YQIMKKGGLKDENIIVFMYDDIAHSPENPRPGVIINHPQGGDVYAGVPKDYTGRDVNVDN  133

Query  1240  LYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKK  1061
              +AVLLG+K  ++GGSGKVVDS  DD IF++Y+DHGGPGVLGMP  P+LY +D ++VLKK
Sbjct  134   FFAVLLGNKTALRGGSGKVVDSGPDDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKK  193

Query  1060  KHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPE  881
             KH+AGTYK +V Y+EACESGS FEG++P D+N+Y TTASNAEESSWGTYCPG  P+PPPE
Sbjct  194   KHAAGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPE  253

Query  880   YITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIK  701
             Y TCLGDLYSVAWMEDS+ HNL  E++++QY+ VK RT+ ++ F  GSHVM+YG+ + + 
Sbjct  254   YDTCLGDLYSVAWMEDSDFHNLRTESLKQQYKLVKDRTAVHDTFSYGSHVMQYGALE-LN  312

Query  700   PEKVYLYQGFDPA---TINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAK  530
              ++++ Y G DPA      +  N +   +    VNQRDADL++ W++Y+   D++  K++
Sbjct  313   VQRLFSYIGTDPANDGNTFIEDNSLPSFSK--AVNQRDADLVYFWQKYRKLADSSPPKSE  370

Query  529   LLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVF  350
               KE+ + M HR  +D+S++ +G  LFG E+G  +LK+VR PG  LVDDW CLKS+VR F
Sbjct  371   ARKELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAPGEPLVDDWSCLKSIVRTF  430

Query  349   ETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             E  CGSL QYGMKHMR+FAN+CN+ I   A+ +     CS + +  ++   K +SA
Sbjct  431   EARCGSLAQYGMKHMRSFANMCNAGILPEAVSKVTAQACSSIPSNPWSSIHKGFSA  486



>gb|AGC94756.1| vacuolar processing enzyme [Malus sieversii]
Length=494

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/453 (60%), Positives = 331/453 (73%), Gaps = 8/453 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             DQ+DD      T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  49    DQQDDG-----TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  103

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR+GVIIN P+G+DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVVD
Sbjct  104   IAYNEENPRQGVIINSPHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVD  163

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFIYYTDHGGPG+LGMP  P++YAND IEVLKKKH+AGTYK +V Y+EACESGS
Sbjct  164   SGPNDHIFIYYTDHGGPGILGMPTSPYIYANDLIEVLKKKHAAGTYKSLVFYLEACESGS  223

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HN
Sbjct  224   IFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYDTCLGDLYSVAWMEDSDVHN  283

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  ET+ +QYE VK+RT+N N    GSHVM+YG   + K   +++Y G +PA  N     
Sbjct  284   LRSETLHQQYELVKMRTANDNS-GFGSHVMQYGDVGLSK-NNLFVYMGTNPANDNYTFLG  341

Query  637   IRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLG  461
                L P    VNQRDADLL  W +Y+   + +  K +  K+  + M HR  +D ++  +G
Sbjct  342   ENSLRPSSKAVNQRDADLLHFWHKYRKAPEGSARKIQAQKDFVEVMSHRMHIDQTMKLIG  401

Query  460   VHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICN  281
               LFG E G  +L +VR  G  LVDDW CLK+MVR FETHCGSL QYGMKHMR+ ANICN
Sbjct  402   KLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANICN  461

Query  280   SNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             + +++  M EA    C    + +++   + +SA
Sbjct  462   AGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA  494



>ref|NP_001241716.1| uncharacterized protein LOC100856894 precursor [Zea mays]
 emb|CAC18099.1| putative legumain [Zea mays]
 gb|ACF88247.1| unknown [Zea mays]
 gb|AFW83035.1| putative uncharacterized protein Precursor [Zea mays]
Length=486

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/467 (57%), Positives = 349/467 (75%), Gaps = 9/467 (2%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKD--DESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGL  1394
             R +P IR P  +    DE+ +G+  GTRWAVL+AGS+GY NYRHQAD+CHAYQI+K+GGL
Sbjct  24    RLEPAIRLPSQRAAAADETDDGDV-GTRWAVLIAGSSGYYNYRHQADICHAYQIMKKGGL  82

Query  1393  KDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdk  1214
             KDENI+VFMYDDIA++  NPR GVIINHP G DVYAGVPKDYTG  V   N +AVLLG+K
Sbjct  83    KDENIIVFMYDDIAHSPENPRPGVIINHPQGGDVYAGVPKDYTGRDVNVDNFFAVLLGNK  142

Query  1213  egvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKD  1034
               ++GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AGTYK 
Sbjct  143   TALRGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKS  202

Query  1033  MVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLY  854
             +V Y+EACESGS FEG++P D+N+Y TTASNA+ESSWGTYCPG  P+PPPEY TCLGDLY
Sbjct  203   LVFYLEACESGSIFEGLLPNDINVYATTASNADESSWGTYCPGEFPSPPPEYDTCLGDLY  262

Query  853   SVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQG  674
             SVAWMEDS+ HNL  E++++QY+ VK RT+ ++ F  GSHVM+YG+ + +  ++++ Y G
Sbjct  263   SVAWMEDSDFHNLRTESLKQQYKLVKDRTAVHDTFSYGSHVMQYGALE-LNVQRLFSYIG  321

Query  673   FDPA---TINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTM  503
              DPA      +  N +   +    VNQRDADL++ W++Y+   D++ +K +  KE+ + M
Sbjct  322   TDPANDGNTFIEDNSLPSFSK--AVNQRDADLVYFWQKYRKLADSSHAKNEARKELLEVM  379

Query  502   LHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQ  323
              HR  +D+S++ +G  LFG E+G  +LK+VR PG  LVDDW CLKS+VR FE  CGSL Q
Sbjct  380   AHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAPGEPLVDDWSCLKSIVRTFEARCGSLAQ  439

Query  322   YGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             YGMKHMR+FAN+CN+ I   A+ +     CS + +  ++   K +SA
Sbjct  440   YGMKHMRSFANMCNAGILPEAVSKVAAQACSSIPSNPWSSIHKGFSA  486



>ref|XP_008393660.1| PREDICTED: vacuolar-processing enzyme [Malus domestica]
 ref|XP_008360960.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
Length=494

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/453 (60%), Positives = 331/453 (73%), Gaps = 8/453 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             DQ+DD      T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  49    DQQDDG-----TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  103

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR+GVIIN P+G+DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVVD
Sbjct  104   IAYNEENPRQGVIINSPHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVD  163

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFIYYTDHGGPG+LGMP  P++YAND IEVLKKKH+AGTYK +V Y+EACESGS
Sbjct  164   SGPNDHIFIYYTDHGGPGILGMPTSPYIYANDLIEVLKKKHAAGTYKSLVFYLEACESGS  223

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HN
Sbjct  224   IFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYDTCLGDLYSVAWMEDSDVHN  283

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  ET+ +QYE VK+RT+N N    GSHVM+YG   + K   +++Y G +PA  N     
Sbjct  284   LRSETLHQQYELVKMRTANDNS-GFGSHVMQYGDVGLSK-NNLFVYMGTNPANDNYTFLG  341

Query  637   IRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLG  461
                L P    VNQRDADLL  W +Y+   + +  K +  K+  + M HR  +D ++  +G
Sbjct  342   ENSLRPSSKAVNQRDADLLHFWHKYRKAPEGSARKIQAQKDFVEAMSHRMHIDQTMKLIG  401

Query  460   VHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICN  281
               LFG E G  +L +VR  G  LVDDW CLK+MVR FETHCGSL QYGMKHMR+ ANICN
Sbjct  402   KLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANICN  461

Query  280   SNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             + +++  M EA    C    + +++   + +SA
Sbjct  462   AGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA  494



>gb|ACR24644.1| vacuolar processing enzyme [Malus hupehensis var. mengshanensis]
Length=494

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/453 (60%), Positives = 330/453 (73%), Gaps = 8/453 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             DQ+DD      T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  49    DQQDDG-----TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  103

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR+GVIIN P+G+DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVVD
Sbjct  104   IAYNEENPRQGVIINSPHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVD  163

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFIYYTDHGGPG+LGMP  P++YAND IEVLKKKH+AGTYK +V Y+EACESGS
Sbjct  164   SGPNDHIFIYYTDHGGPGILGMPTSPYIYANDLIEVLKKKHAAGTYKSLVFYLEACESGS  223

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSV WMEDS+ HN
Sbjct  224   IFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYXTCLGDLYSVVWMEDSDVHN  283

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  ET+ +QYE VK+RT+N N    GSHVM+YG   + K   +++Y G +PA  N     
Sbjct  284   LRSETLHQQYELVKMRTANDNS-GFGSHVMQYGDVGLSK-NNLFVYMGTNPANDNYTFLG  341

Query  637   IRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLG  461
                L P    VNQRDADLL  W +Y+   + +  K +  K+  + M HR  +D ++  +G
Sbjct  342   ENSLRPSSKAVNQRDADLLRFWHKYRKAPEGSARKIQAQKDFVEAMSHRMHIDQTMKLIG  401

Query  460   VHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICN  281
               LFG E G  +L +VR  G  LVDDW CLK+MVR FETHCGSL QYGMKHMR+ ANICN
Sbjct  402   KLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANICN  461

Query  280   SNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             + +++  M EA    C    + +++   + +SA
Sbjct  462   AGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA  494



>ref|NP_001105119.1| legumain-like protease precursor [Zea mays]
 emb|CAB64544.1| legumain-like protease [Zea mays]
Length=486

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/476 (56%), Positives = 347/476 (73%), Gaps = 9/476 (2%)
 Frame = -3

Query  1594  CQLQNLQAARWDPLIRQPVDQKD--DESPEGETQGTRWAVLVAGSNGYANYRHQADVCHA  1421
             C        R +  IR P  +    DE+ +G   GTRWAVL+AGS+GY NYRHQAD+CHA
Sbjct  15    CLCSAWARPRLETAIRLPSQRAAAADETDDGAV-GTRWAVLIAGSSGYYNYRHQADICHA  73

Query  1420  YQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAAN  1241
             YQI+K+GGLKDENI+VFMYDDIA++  NPR GVIINHP G DVYAGVPKDYTG  V   N
Sbjct  74    YQIMKKGGLKDENIIVFMYDDIAHSPENPRPGVIINHPQGGDVYAGVPKDYTGRDVNVDN  133

Query  1240  LYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKK  1061
              +AVLLG+K  ++GGSGKVVDS  DD IF++Y+DHGGPGVLGMP  P+LY +D ++VLKK
Sbjct  134   FFAVLLGNKTALRGGSGKVVDSGPDDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKK  193

Query  1060  KHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPE  881
             KH+AGTYK +V Y+EACESGS FEG++P D+N+Y TTASNAEESSWGTYCPG  P+PPPE
Sbjct  194   KHAAGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPE  253

Query  880   YITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIK  701
             Y TCLGDLYSVAWMEDS+ HNL  E++++QY+ VK RT+ ++ F  GSHVM+YG+ + + 
Sbjct  254   YDTCLGDLYSVAWMEDSDFHNLRTESLKQQYKLVKDRTAVHDTFSYGSHVMQYGALE-LN  312

Query  700   PEKVYLYQGFDPA---TINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAK  530
              + ++ Y G DPA      +  N +   +    VNQRDADL++ W++Y+   D+  +K++
Sbjct  313   VQHLFSYIGTDPANDGNTFIEDNSLPSFSK--AVNQRDADLVYFWQKYRKFADSPPAKSE  370

Query  529   LLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVF  350
               KE+ + M HR  +D+S++ +G  LFG E+G  +LK+VR PG  LVDDW CLKS+VR F
Sbjct  371   ARKELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAPGEPLVDDWSCLKSIVRTF  430

Query  349   ETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             E  CGSL QYGMKHMR+FAN+CN+ I   A+ +     CS + +  ++   K +SA
Sbjct  431   EARCGSLAQYGMKHMRSFANMCNAGILPEAVSKVAAQACSSIPSNPWSSIHKGFSA  486



>gb|ABF00019.1| legumain precursor [Saccharum officinarum]
Length=488

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/469 (57%), Positives = 345/469 (74%), Gaps = 12/469 (3%)
 Frame = -3

Query  1567  RWDPLIRQPVDQK----DDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             R +P IR P ++      DE+   +  GTRWAVLVAGS+GY NYRHQAD+CHAYQI+K+G
Sbjct  25    RLEPTIRLPSERAAAAAGDET--DDAVGTRWAVLVAGSSGYYNYRHQADICHAYQIMKKG  82

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             GLKDENI+VFMYDDIA++A NPR GV+INHP G DVYAGVPKDYTG QV+  N +AVLLG
Sbjct  83    GLKDENIIVFMYDDIAHSAENPRPGVVINHPQGGDVYAGVPKDYTGRQVSVNNFFAVLLG  142

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             +K  + GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AG+Y
Sbjct  143   NKTALTGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGSY  202

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K +V Y+EACESGS FEG++P+D+N+Y TTASNAEESSWGTYCPG  P+PPPEY TCLGD
Sbjct  203   KSLVFYLEACESGSIFEGLLPDDINVYATTASNAEESSWGTYCPGEFPSPPPEYDTCLGD  262

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             LYSV+WMEDS+ HNL  E++++QY+ VK RT+  + F  GSHVM+YGS + +  +K++ Y
Sbjct  263   LYSVSWMEDSDFHNLRTESLKQQYKLVKDRTAAQDTFSYGSHVMQYGSLE-LNVQKLFSY  321

Query  679   QGFDPA---TINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITD  509
              G +PA      +  N +   +    VNQRDADL++ W++Y+   D +  K +  KE+ +
Sbjct  322   IGTNPANDGNTFVEDNSLPSFSK--AVNQRDADLVYFWQKYRKLADGSSKKNEARKELLE  379

Query  508   TMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSL  329
              M HR  +D S++ +G  LFG E+G  +LK+VR  G  LVDDW CLKSMVR FE  CGSL
Sbjct  380   VMSHRSHVDNSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSMVRTFEAQCGSL  439

Query  328   GQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              QYGMKHMR FANICN+ I   A+ +     C+ + +  ++   K +SA
Sbjct  440   AQYGMKHMRTFANICNAGILPEAVSKVAAQACTSIPSNPWSSIDKGFSA  488



>gb|AGC94757.1| vacuolar processing enzyme [Malus sikkimensis]
Length=494

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/454 (60%), Positives = 332/454 (73%), Gaps = 10/454 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             DQ+DD      T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  49    DQQDDG-----TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  103

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR+GVIIN P+G+DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVVD
Sbjct  104   IAYNEENPRQGVIINSPHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVD  163

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFIYYTDHGGPG+LGMP  P++YAND IEVLKKKH+AGTYK +V Y+EACESGS
Sbjct  164   SGPNDHIFIYYTDHGGPGILGMPTSPYIYANDLIEVLKKKHAAGTYKSLVFYLEACESGS  223

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HN
Sbjct  224   IFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYDTCLGDLYSVAWMEDSDVHN  283

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN--LPG  644
             L  ET+ +QYE VK RT+N N    GSHVM+YG   + K   +++Y G +PA  N    G
Sbjct  284   LRSETLHQQYELVKTRTANDNS-GFGSHVMQYGDVGLSK-NNLFVYMGTNPANDNHTFLG  341

Query  643   NQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNL  464
                 R + K  VNQRDADLL  W +Y+   + +  K +  K+  + M HR  +D ++  +
Sbjct  342   ENSLRPSSK-AVNQRDADLLHFWHKYRKAPEGSARKIQAQKDFVEAMSHRMHIDQTMKLI  400

Query  463   GVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANIC  284
             G  LFG E G  +L +VR  G  LVDDW CLK+MVR FETHCGSL QYGMKHMR+ ANIC
Sbjct  401   GKLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANIC  460

Query  283   NSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             N+ +++  M EA    C    + +++   + +SA
Sbjct  461   NAGMTQDQMAEASAQACVSAPSGRWSSLHRGFSA  494



>dbj|BAD25788.1| putative asparaginyl endopeptidase REP-2 [Oryza sativa Japonica 
Group]
 dbj|BAG91757.1| unnamed protein product [Oryza sativa Japonica Group]
Length=394

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/396 (67%), Positives = 318/396 (80%), Gaps = 2/396 (1%)
 Frame = -3

Query  1369  MYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsg  1190
             MYDDIANN  NPR GVI+NHP G DVYAGVPKDYTGD+VTA N YAVLLG+K  V GGS 
Sbjct  1     MYDDIANNILNPRPGVIVNHPQGEDVYAGVPKDYTGDEVTAKNFYAVLLGNKTAVTGGSR  60

Query  1189  kvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEAC  1010
             KV+DSK +D IFI+Y+DHGGPGVLGMPNLP+LYA DF++VL++KH++ TY  MVIYVEAC
Sbjct  61    KVIDSKPNDHIFIFYSDHGGPGVLGMPNLPYLYAADFMKVLQEKHASNTYAKMVIYVEAC  120

Query  1009  ESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDS  830
             ESGS FEG+MPEDLNIYVTTASNAEESSWGTYCPG EP+PP EYITCLGDLYSV+WMEDS
Sbjct  121   ESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPSPPSEYITCLGDLYSVSWMEDS  180

Query  829   ESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINL  650
             E+HNL EE+I++QYE VK RTS+ N + AGSHVMEYG R   K +K+YLYQGFDPA   +
Sbjct  181   ETHNLKEESIKKQYEVVKKRTSDMNSYGAGSHVMEYGDR-TFKDDKLYLYQGFDPANAEV  239

Query  649   PGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASID  470
               N++    PK  VNQRDADLLF+W RY++  D +  K K L+EI+DT++HR+ LD+S+D
Sbjct  240   K-NKLSWEGPKAAVNQRDADLLFLWRRYELLHDKSEEKLKALREISDTVMHRKLLDSSVD  298

Query  469   NLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFAN  290
              +G  LFG  NG ++L++VR  G  LVDDW CLK MVR+FE+HCG L QYGMKHMRAFAN
Sbjct  299   LVGKLLFGFGNGPSVLQAVRPSGQPLVDDWDCLKRMVRIFESHCGPLTQYGMKHMRAFAN  358

Query  289   ICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             ICN+ IS A+M+EA   TCS   + +++   + YSA
Sbjct  359   ICNNGISGASMKEASIATCSSHNSGRWSSLVQGYSA  394



>ref|XP_002516472.1| Vacuolar-processing enzyme precursor, putative [Ricinus communis]
 gb|EEF45813.1| Vacuolar-processing enzyme precursor, putative [Ricinus communis]
Length=492

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/456 (58%), Positives = 331/456 (73%), Gaps = 6/456 (1%)
 Frame = -3

Query  1546  QPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFM  1367
             +P D K+ +    ++ GTRWA+L+AGSNGY NYRHQADVCHAYQ+L++GGLK+ENI+VFM
Sbjct  42    RPADGKNGDD---DSAGTRWAILIAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFM  98

Query  1366  YDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgk  1187
             YDDIA N  NPR+G+IIN+P+G DVY GVPKDYTG+ VT  N +A +LG++  + GG GK
Sbjct  99    YDDIAYNEENPRQGIIINNPHGEDVYKGVPKDYTGENVTVGNFFAAILGNRTALTGGRGK  158

Query  1186  vvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACE  1007
             VVDS  +D IF+YYTDHGGPGVLGMP  P+LYAND I+VLKKKH++GTYK +V Y+EACE
Sbjct  159   VVDSGPNDHIFVYYTDHGGPGVLGMPTNPYLYANDLIDVLKKKHASGTYKSLVFYLEACE  218

Query  1006  SGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSE  827
             SGS FEG++PE LNIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYS+AWMEDS+
Sbjct  219   SGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSIAWMEDSD  278

Query  826   SHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLP  647
              HNL  ET+ +QYE VK RTSN N    GSHVM+YG   + + E ++LY G +PA  N  
Sbjct  279   VHNLQTETLHQQYELVKRRTSNGNS-AYGSHVMQYGDVGLSR-ENLFLYMGTNPANDNYT  336

Query  646   GNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASID  470
                   LTP    VNQRDADL+  W++Y+   D +  K +  K+  + M HR  +D S+ 
Sbjct  337   FVDENSLTPPSKAVNQRDADLVHFWDKYRKAPDGSARKDQAQKQFVEAMSHRMHIDHSVK  396

Query  469   NLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFAN  290
              +G  LFG E  S +L +VR  G  LVDDW CLK +VR FETHCGS+ QYGMKHMR+ AN
Sbjct  397   LIGKLLFGLEKASEVLSTVRPAGQPLVDDWDCLKKLVRTFETHCGSISQYGMKHMRSLAN  456

Query  289   ICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             +CN+ I E  M EA    C    +  ++   K +SA
Sbjct  457   LCNAGIREEQMAEASAQACITFPSGPWSSLHKGFSA  492



>gb|AGC94759.1| vacuolar processing enzyme [Malus micromalus]
Length=494

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/453 (60%), Positives = 330/453 (73%), Gaps = 8/453 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             DQ+DD      T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  49    DQQDDG-----TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  103

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR+GVIIN P+G+DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVVD
Sbjct  104   IAYNEENPRQGVIINSPHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVD  163

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFIYYTDHGGPG+LGMP  P++YAND IEVLKKKH+AGTYK +V Y+EACESGS
Sbjct  164   SGPNDHIFIYYTDHGGPGILGMPTSPYIYANDLIEVLKKKHAAGTYKSLVFYLEACESGS  223

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWME S+ HN
Sbjct  224   IFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYDTCLGDLYSVAWMEGSDVHN  283

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  ET+ +QYE VK+RT+N N    GSHVM+YG   + K   +++Y G +PA  N     
Sbjct  284   LRSETLHQQYELVKMRTANDNS-GFGSHVMQYGDVGLSK-NNLFVYMGTNPANDNYTFLG  341

Query  637   IRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLG  461
                L P    VNQRDADLL  W +Y+   + +  K +  K+  + M HR  +D ++  +G
Sbjct  342   ENSLRPSSKAVNQRDADLLHFWHKYRKAPEGSARKIQAQKDFVEAMSHRMHIDQTMKLIG  401

Query  460   VHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICN  281
               LFG E G  +L +VR  G  LVDDW CLK+MVR FETHCGSL QYGMKHMR+ ANICN
Sbjct  402   KLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANICN  461

Query  280   SNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             + +++  M EA    C    + +++   + +SA
Sbjct  462   AGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA  494



>gb|AGC94758.1| vacuolar processing enzyme [Malus hupehensis]
Length=494

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/453 (59%), Positives = 330/453 (73%), Gaps = 8/453 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             DQ+DD      T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  49    DQQDDG-----TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  103

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR+GVIIN P+G+DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVVD
Sbjct  104   IAYNEENPRQGVIINSPHGSDVYEGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVD  163

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFIYYTDHGGPG+LGMP  P++YAND IEVLKKKH+AGTY+ +V Y+EACESGS
Sbjct  164   SGPNDHIFIYYTDHGGPGILGMPTSPYIYANDLIEVLKKKHAAGTYRSLVFYLEACESGS  223

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HN
Sbjct  224   IFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYDTCLGDLYSVAWMEDSDVHN  283

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  ET+ +QYE VK R +N N   +GSHVM+YG   + K   +++Y G +PA  N     
Sbjct  284   LRSETLHQQYELVKTRAANDNS-GSGSHVMQYGDVGLSK-NNLFVYMGTNPANDNYTFLG  341

Query  637   IRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLG  461
                L P    VNQRDADLL  W +Y+   + +  K +  K+  + M HR  +D ++  +G
Sbjct  342   ENSLRPSSKAVNQRDADLLHFWHKYRKAPEGSARKIQAQKDFVEAMSHRMHIDQTMKLIG  401

Query  460   VHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICN  281
               LFG E G  +L +VR  G  LVDDW CLK+MVR FETHCGSL QYGMKHMR+ ANICN
Sbjct  402   KLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANICN  461

Query  280   SNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             + +++  M EA    C    + +++   + +SA
Sbjct  462   AGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA  494



>gb|AET08893.1| vacuolar processing enzyme 4 [Aegilops speltoides]
 emb|CCC14971.1| VPE4B protein [Aegilops speltoides]
Length=493

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/478 (56%), Positives = 342/478 (72%), Gaps = 11/478 (2%)
 Frame = -3

Query  1600  IACQLQNLQAARWDPLIRQP----VDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQAD  1433
             +   + + +  R +P IR P      Q+DD+S      GTRWAVL+AGSNGY NYRHQAD
Sbjct  22    LVLAVAHARTPRLEPTIRLPSQRAAGQEDDDS-----VGTRWAVLIAGSNGYYNYRHQAD  76

Query  1432  VCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQV  1253
             +CHAYQI+K+GGLKDENI++FMYDDIA+N  NPR GVIINHP G DVYAGVPKDYTG +V
Sbjct  77    ICHAYQIMKKGGLKDENIIIFMYDDIAHNPENPRPGVIINHPQGGDVYAGVPKDYTGKEV  136

Query  1252  TAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIE  1073
                N +AVLLG++  V GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++
Sbjct  137   NVKNFFAVLLGNRTAVSGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVD  196

Query  1072  VLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPA  893
             VLKKKH+AGTYK +V Y+EACESGS FEG++P D+ +Y TTASNAEESSWGTYCPG  P+
Sbjct  197   VLKKKHAAGTYKSLVFYLEACESGSIFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPS  256

Query  892   PPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSR  713
             PPPEY TCLGDLYS++WMEDS+ HNL  E++++QY  VK RT+  + +  GSHVM+YGS 
Sbjct  257   PPPEYDTCLGDLYSISWMEDSDVHNLRTESLKQQYNLVKKRTAAQDSYSYGSHVMQYGSL  316

Query  712   DIIKPEKVYLYQGFDPATINLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSK  536
             D +  E ++ Y G +PA  N    +   L +  G VNQRDADL++ W++Y+   +++  K
Sbjct  317   D-LNAEHLFSYIGSNPANENTTFVEDNALPSFSGAVNQRDADLVYFWQKYRKLAESSPEK  375

Query  535   AKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVR  356
                 K++ + M HR  +D S++ +G  LFG   G  +LK+VR  G  LVDDW CLKS VR
Sbjct  376   NDARKQLLEMMGHRSHIDNSVELIGNLLFGSAGGPMVLKAVRPAGEPLVDDWSCLKSTVR  435

Query  355   VFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              FE+ CGSL QYGMKHMR+FANICN  I   AM +     C+ + T  ++   K +SA
Sbjct  436   TFESQCGSLAQYGMKHMRSFANICNVGIVPEAMAKVAAQACTNIPTNPWSATHKGFSA  493



>gb|EEE54813.1| hypothetical protein OsJ_02232 [Oryza sativa Japonica Group]
Length=503

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/439 (60%), Positives = 331/439 (75%), Gaps = 2/439 (0%)
 Frame = -3

Query  1495  TRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVII  1316
             TRWAVL+AGSNGY NYRHQADVCHAYQI+KRGGLKDENI+VFMYDDIA+N  NPR GVII
Sbjct  66    TRWAVLIAGSNGYYNYRHQADVCHAYQIMKRGGLKDENIIVFMYDDIAHNPENPRPGVII  125

Query  1315  NHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDH  1136
             NHP G DVYAGVPKDYTG +V   NL+AVLLG+K  VKGGSGKV+DS  +D IFI+Y+DH
Sbjct  126   NHPQGGDVYAGVPKDYTGKEVNVKNLFAVLLGNKTAVKGGSGKVLDSGPNDHIFIFYSDH  185

Query  1135  GGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYV  956
             GGPGVLGMP  P+LY +D ++VLKKKH+AGTYK +V Y+EACESGS FEG++P  +N+Y 
Sbjct  186   GGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKSLVFYLEACESGSIFEGLLPNGINVYA  245

Query  955   TTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVK  776
             TTASNA+ESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  E++++QY  VK
Sbjct  246   TTASNADESSWGTYCPGEYPSPPPEYDTCLGDLYSVAWMEDSDVHNLRTESLKQQYNLVK  305

Query  775   LRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRL-TPKGVVNQR  599
              RTS  + + +GSHVMEYGS + +    V++Y G +PA  N    +   L +    VNQR
Sbjct  306   ERTSVQHTYYSGSHVMEYGSLE-LNAHHVFMYMGSNPANDNATFVEDNSLPSFSRAVNQR  364

Query  598   DADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILK  419
             DADL++ W++Y+   +++  K +  K++ + M HR  +D S++ +G  LFG E G  +LK
Sbjct  365   DADLVYFWQKYRKLPESSPEKNEARKQLLEMMAHRSHVDNSVELIGNLLFGSEEGPRVLK  424

Query  418   SVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKN  239
             +VR  G  LVDDW CLKSMVR FE  CGSL QYGMKHMR+FANICN+ IS  AM +    
Sbjct  425   AVRATGEPLVDDWSCLKSMVRTFEAQCGSLAQYGMKHMRSFANICNAGISAEAMAKVAAQ  484

Query  238   TCSEMKTMKYTHPSKVYSA  182
              C+ + +  ++   + +SA
Sbjct  485   ACTSIPSNPWSSTHRGFSA  503



>ref|XP_003550283.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
Length=481

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/460 (59%), Positives = 335/460 (73%), Gaps = 9/460 (2%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
              +R P +  +D++     QGTRWAVL+AGSNGY NYRHQADVCHAYQIL++GGLK+ENI+
Sbjct  29    FLRLPSETDNDDN----VQGTRWAVLLAGSNGYWNYRHQADVCHAYQILRKGGLKEENII  84

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA N  NPR GVIIN P+G DVY GVPKDYTG+ VT  N +A LLG+K  + GG
Sbjct  85    VFMYDDIAFNGENPRPGVIINKPDGGDVYEGVPKDYTGEDVTVGNFFAALLGNKSALTGG  144

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVVDS  DD IF+YYTDHGGPGVLGMP  P+LYA+D IEVLKKKH++GTYK++V Y+E
Sbjct  145   SGKVVDSGPDDHIFVYYTDHGGPGVLGMPAGPYLYADDLIEVLKKKHASGTYKNLVFYLE  204

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++PED+NIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWME
Sbjct  205   ACESGSIFEGLLPEDINIYATTASNAEESSWGTYCPGEYPSPPPEYSTCLGDLYSVAWME  264

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDI-IKPEKVYLYQGFDPAT  659
             DS+ HNL  ET+ +QY+ VK RT +  D   GSHVM+YG  D+ +  + ++ Y G DPA 
Sbjct  265   DSDRHNLRTETLHQQYKLVKERTIS-GDSYYGSHVMQYG--DVRLSSDVLFHYLGTDPAN  321

Query  658   INLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLD  482
              N        L +P   VNQRDADL+  W++++   + ++ K    K++ + M HR  +D
Sbjct  322   DNFTFVDENSLWSPSKPVNQRDADLIHFWDKFRKAPEGSLRKNAAQKQVLEAMSHRMHVD  381

Query  481   ASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMR  302
              S+  +G  LFG E G  +L +VR  G ALVDDW CLK+MVR FETHCGSL QYGMKHMR
Sbjct  382   NSVKLIGKLLFGIEKGPEVLNAVRPAGSALVDDWHCLKTMVRTFETHCGSLSQYGMKHMR  441

Query  301   AFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             +FANICN  I    M EA    C  + +  ++   + +SA
Sbjct  442   SFANICNVGIKNEQMAEASAQACVSIPSNPWSSLQRGFSA  481



>ref|XP_009420869.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/460 (57%), Positives = 332/460 (72%), Gaps = 6/460 (1%)
 Frame = -3

Query  1552  IRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVV  1373
             IR P+    D  P  +  G +WAVL+AGS G+ NYRHQAD+CHAYQI+K GGLKDENI++
Sbjct  23    IRNPIRLPSDR-PADDAVGAKWAVLIAGSRGFYNYRHQADICHAYQIMKNGGLKDENIII  81

Query  1372  FMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggs  1193
             FMYDDIA +  NPR G+IINHP G DVYAGVPKDY GD V   N +AVLLG++  + GGS
Sbjct  82    FMYDDIAKHVENPRPGIIINHPEGGDVYAGVPKDYVGDDVNVNNFFAVLLGNRTALTGGS  141

Query  1192  gkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEA  1013
             GKVVDS  +D IFI+Y+DHGGPGVLGMP  P+LYA+D I+VLKKKH++GTY+ MV Y+EA
Sbjct  142   GKVVDSGPNDHIFIFYSDHGGPGVLGMPTFPYLYADDLIDVLKKKHASGTYRSMVFYLEA  201

Query  1012  CESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMED  833
             CESGS FEG++PED+NIY TTASNA ESSWGTYCPG  P+PPPE+ TCLGDLYSVAWMED
Sbjct  202   CESGSIFEGLLPEDINIYATTASNAYESSWGTYCPGQHPSPPPEFYTCLGDLYSVAWMED  261

Query  832   SESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN  653
             S+ HNL  ET+++QY+ VK RT+  + +  GSHVMEYG  + +  + ++LY G +PA  N
Sbjct  262   SDKHNLRTETLKQQYQLVKTRTAVNDTYLFGSHVMEYGELE-LNMQNLFLYVGSNPANEN  320

Query  652   ---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLD  482
                +  N +   +    VNQRDADL++ W +Y+   + +  K    KE+ + + HR  +D
Sbjct  321   ATFIDDNSLSSFS-NAAVNQRDADLIYFWHKYQKAREGSSHKRNAQKELLEVISHRLHID  379

Query  481   ASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMR  302
              SI+ +G  LFG + GS +LK+VR  G  LVDDW CLKSMVR FE HCGSL QYGMKHMR
Sbjct  380   NSIEFIGKLLFGSKQGSEVLKTVRPAGQPLVDDWSCLKSMVRTFEAHCGSLSQYGMKHMR  439

Query  301   AFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             + ANICN+ IS+  M E     C  +   +++   K +SA
Sbjct  440   SLANICNAGISKEMMAEVSAEACISIPAGQWSSLQKGFSA  479



>emb|CAN70603.1| hypothetical protein VITISV_040193 [Vitis vinifera]
Length=493

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/458 (59%), Positives = 336/458 (73%), Gaps = 8/458 (2%)
 Frame = -3

Query  1546  QPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFM  1367
             +P    DD++  GE+ GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENI+VFM
Sbjct  41    RPGGAADDDT-GGESAGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIIVFM  99

Query  1366  YDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgk  1187
             YDDI+ N  NPR G+IIN P+G DVY GVPKDYTG+ VT  N +AV+LG+K  + GGSGK
Sbjct  100   YDDISFNEENPRPGIIINSPHGEDVYEGVPKDYTGEDVTVDNFFAVILGNKTALSGGSGK  159

Query  1186  vvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACE  1007
             V+DS  +D IFIYY+DHGGPGVLGMP  P+LYAND IEVLKKKH++GTY  +V Y+EACE
Sbjct  160   VLDSGPNDHIFIYYSDHGGPGVLGMPTSPYLYANDLIEVLKKKHASGTYNSLVFYLEACE  219

Query  1006  SGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSE  827
             SGS FEG++PE LNIY TTA+NAEESSWGTYCPG +P+PPPEY TCLGDLYSVAWMEDS+
Sbjct  220   SGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGEDPSPPPEYETCLGDLYSVAWMEDSD  279

Query  826   SHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN--  653
              HNL  ET+ +QYE VK RT+N N    GSHVM+YG   + K E + LY G +PA  N  
Sbjct  280   VHNLRTETLRQQYELVKKRTANDNSVY-GSHVMQYGDLGLNK-EDLVLYMGTNPANDNYT  337

Query  652   -LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDAS  476
              +  N +R   P   VNQRDADL+  W++++   + +  KA+  K+  + M HR  +D +
Sbjct  338   FVDNNSLR--LPSKAVNQRDADLVHFWDKFRKAPEGSPRKAEAQKQFLEAMSHRTHIDHA  395

Query  475   IDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAF  296
             I  +G  LFG + GS +LK+VR  G  LVDDW CLK++VR FE HCGSL QYGMKHMR+ 
Sbjct  396   IKLVGRLLFGMKKGSEVLKTVRPAGQPLVDDWHCLKTLVRTFEAHCGSLSQYGMKHMRSI  455

Query  295   ANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             ANICN+ I +  M EA    C  +    ++   K +SA
Sbjct  456   ANICNAGIEKEQMAEASAQACVTIPPGPWSSLDKGFSA  493



>emb|CAQ00099.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26641.1| vacuolar processing enzyme 3 [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/469 (57%), Positives = 340/469 (72%), Gaps = 15/469 (3%)
 Frame = -3

Query  1567  RWDPLIRQP----VDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             R +P IR P      Q+DD+S      GTRWAVL+AGSNGY NYRHQAD+CHAYQI+K+G
Sbjct  24    RLEPTIRLPSQRAAGQEDDDS-----VGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKG  78

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             GLKDENI+VFMYDDIA N  NPR GVIINHP G DVYAGVPKDYTG +V   N +AVLLG
Sbjct  79    GLKDENIIVFMYDDIARNPENPRPGVIINHPQGGDVYAGVPKDYTGKEVNVKNFFAVLLG  138

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             +K  V GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AGTY
Sbjct  139   NKTAVNGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTY  198

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K +V Y+EACESGS FEG++P D+ +Y TTASNAEESSWGTYCPG  P+PPPEY TCLGD
Sbjct  199   KSLVFYLEACESGSIFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPPEYDTCLGD  258

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             LYS++WMEDS+ HNL  E++++QY  VK RT+  + +  GSHVM+YGS D +  E ++ Y
Sbjct  259   LYSISWMEDSDVHNLRTESLKQQYNLVKKRTAAQDSYSYGSHVMQYGSLD-LNAEHLFSY  317

Query  679   QGFDPATIN---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITD  509
              G +PA  N   +  N +  L+    VNQRDADL++ W++Y+   +++ +K    K++ +
Sbjct  318   IGSNPANENTTFVEDNALPSLS--RAVNQRDADLVYFWQKYRKLAESSPAKNNARKQLLE  375

Query  508   TMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSL  329
              M HR  +D+S++ +G  LFG   G  +LK+VR  G  LVDDW CLKS VR FE+ CGSL
Sbjct  376   MMGHRSHIDSSVELIGNLLFGSAGGPMVLKTVRPAGEPLVDDWSCLKSTVRTFESQCGSL  435

Query  328   GQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              QYGMKHMR+FAN+CN+ I   AM +     C+   T  ++   K +SA
Sbjct  436   AQYGMKHMRSFANMCNAGIVPEAMAKVAAQACTSFPTNPWSATHKGFSA  484



>gb|AEY68248.1| legumain [Saccharum hybrid cultivar SP80-3280]
Length=488

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/469 (57%), Positives = 343/469 (73%), Gaps = 12/469 (3%)
 Frame = -3

Query  1567  RWDPLIRQPVDQK----DDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRG  1400
             R +P IR P ++      DE+   +  GTRWAVLVAGS+GY NYRHQAD+CHAYQI+K+G
Sbjct  25    RLEPTIRLPSERAAAAAGDET--DDAVGTRWAVLVAGSSGYYNYRHQADICHAYQIMKKG  82

Query  1399  GLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLg  1220
             GLKDENI+VFMYDDIA++A NPR GV+INHP G DVYAGVPKDYTG QV+  N +AVLLG
Sbjct  83    GLKDENIIVFMYDDIAHSAENPRPGVVINHPQGGDVYAGVPKDYTGRQVSVNNFFAVLLG  142

Query  1219  dkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTY  1040
             +K  + GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AGTY
Sbjct  143   NKTALTGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTY  202

Query  1039  KDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGD  860
             K +V Y+EACESGS FEG++P+D+N+Y TTASNAEESSWGTYCPG  P+PPPEY TCLGD
Sbjct  203   KSLVFYLEACESGSIFEGLLPDDINVYATTASNAEESSWGTYCPGEFPSPPPEYDTCLGD  262

Query  859   LYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLY  680
             LYSV+WMEDS+ HNL  E++++QY+ VK RT+  + F  GSHVM+YGS + +  +K++ Y
Sbjct  263   LYSVSWMEDSDFHNLRTESLKQQYKLVKDRTAAQDTFSYGSHVMQYGSLE-LNVQKLFSY  321

Query  679   QGFDPA---TINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITD  509
              G +PA      +  N +         NQRDADL++ W++Y+   D +  K +  KE+ +
Sbjct  322   IGTNPANDGNTFVEDNSLPSFFKS--CNQRDADLVYFWQKYRKLADGSSKKNEARKELLE  379

Query  508   TMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSL  329
              M HR  +D S++ +G  LFG E+G  +LK+VR  G  LVDDW CLKSMVR FE  CGSL
Sbjct  380   VMSHRSHVDNSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSMVRTFEAQCGSL  439

Query  328   GQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              QYGMKHMR FANICN+ I   A+ +     C+ + +  ++   K +SA
Sbjct  440   AQYGMKHMRTFANICNAGILPEAVSKVAAQACTSIPSNPWSSIDKGFSA  488



>ref|NP_001043344.1| Os01g0559600 [Oryza sativa Japonica Group]
 dbj|BAA84650.1| asparaginyl endopeptidase [Oryza sativa]
 dbj|BAB85400.1| putative C13 endopeptidase NP1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF05258.1| Os01g0559600 [Oryza sativa Japonica Group]
 dbj|BAG90492.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70891.1| hypothetical protein OsI_02429 [Oryza sativa Indica Group]
Length=501

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/439 (60%), Positives = 331/439 (75%), Gaps = 2/439 (0%)
 Frame = -3

Query  1495  TRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVII  1316
             TRWAVL+AGSNGY NYRHQADVCHAYQI+KRGGLKDENI+VFMYDDIA+N  NPR GVII
Sbjct  64    TRWAVLIAGSNGYYNYRHQADVCHAYQIMKRGGLKDENIIVFMYDDIAHNPENPRPGVII  123

Query  1315  NHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDH  1136
             NHP G DVYAGVPKDYTG +V   NL+AVLLG+K  VKGGSGKV+DS  +D IFI+Y+DH
Sbjct  124   NHPQGGDVYAGVPKDYTGKEVNVKNLFAVLLGNKTAVKGGSGKVLDSGPNDHIFIFYSDH  183

Query  1135  GGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYV  956
             GGPGVLGMP  P+LY +D ++VLKKKH+AGTYK +V Y+EACESGS FEG++P  +N+Y 
Sbjct  184   GGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKSLVFYLEACESGSIFEGLLPNGINVYA  243

Query  955   TTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVK  776
             TTASNA+ESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  E++++QY  VK
Sbjct  244   TTASNADESSWGTYCPGEYPSPPPEYDTCLGDLYSVAWMEDSDVHNLRTESLKQQYNLVK  303

Query  775   LRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRL-TPKGVVNQR  599
              RTS  + + +GSHVMEYGS + +    V++Y G +PA  N    +   L +    VNQR
Sbjct  304   ERTSVQHTYYSGSHVMEYGSLE-LNAHHVFMYMGSNPANDNATFVEDNSLPSFSRAVNQR  362

Query  598   DADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILK  419
             DADL++ W++Y+   +++  K +  K++ + M HR  +D S++ +G  LFG E G  +LK
Sbjct  363   DADLVYFWQKYRKLPESSPEKNEARKQLLEMMAHRSHVDNSVELIGNLLFGSEEGPRVLK  422

Query  418   SVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKN  239
             +VR  G  LVDDW CLKSMVR FE  CGSL QYGMKHMR+FANICN+ IS  AM +    
Sbjct  423   AVRATGEPLVDDWSCLKSMVRTFEAQCGSLAQYGMKHMRSFANICNAGISAEAMAKVAAQ  482

Query  238   TCSEMKTMKYTHPSKVYSA  182
              C+ + +  ++   + +SA
Sbjct  483   ACTSIPSNPWSSTHRGFSA  501



>ref|NP_001105613.1| LOC542609 precursor [Zea mays]
 gb|AAD04883.1| C13 endopeptidase NP1 precursor [Zea mays]
Length=485

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/465 (57%), Positives = 343/465 (74%), Gaps = 6/465 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             R +P IR P ++   +  + +  GTRWAVL+AGSNGY NYRHQAD+CHAYQI+K+GGLKD
Sbjct  24    RLEPTIRLPSERAAADETDDDAVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKD  83

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIA++  NPR GVIINHP G DVYAGVPKDYTG  V   N +AVLLG+K  
Sbjct  84    ENIVVFMYDDIAHSPENPRPGVIINHPQGGDVYAGVPKDYTGRDVNVDNFFAVLLGNKTA  143

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             ++GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AGTYK +V
Sbjct  144   LRGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKSLV  203

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
              Y+EACESGS FEG++P D+N+Y TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSV
Sbjct  204   FYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPEYDTCLGDLYSV  263

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDS+ HNL  E++++QY  VK RT+  + F  GSHVM+YGS + +  + ++ Y G +
Sbjct  264   AWMEDSDFHNLRTESLKQQYNLVKDRTAVQDTFSYGSHVMQYGSLE-LNVKHLFSYIGTN  322

Query  667   PATIN---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             PA  +   +  N +  L+    VNQRDADL++ W++Y+   D++  K +  +E+ + M H
Sbjct  323   PANDDNTFIEDNSLPSLSK--AVNQRDADLVYFWQKYRKLADSSPEKNEARRELLEVMAH  380

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R  +D+S++ +G  LFG E+G  +LK+VR  G  LVDDW CLKS VR FE  CGSL QYG
Sbjct  381   RSHVDSSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSTVRTFEAQCGSLAQYG  440

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MKHMR+FANICN+ I   A+ +     C+ + +  ++   K +SA
Sbjct  441   MKHMRSFANICNAGILPEAVSKVAAQACTSIPSNPWSSIHKGFSA  485



>ref|XP_010526156.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Tarenaya 
hassleriana]
Length=496

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/449 (60%), Positives = 327/449 (73%), Gaps = 3/449 (1%)
 Frame = -3

Query  1525  DESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANN  1346
             D   +G T GTRWAVLVAGSNGY NYRHQADVCHAYQ+LK+GGLK+ENIVVFMYDDIANN
Sbjct  50    DSGDDGSTVGTRWAVLVAGSNGYWNYRHQADVCHAYQLLKKGGLKEENIVVFMYDDIANN  109

Query  1345  AFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKAD  1166
               NPR G+IIN P+G DVY GVPKDYTGD+V   NL+AV+LG+K  +KGGSGKVVDS  +
Sbjct  110   EENPRPGIIINSPHGEDVYEGVPKDYTGDEVNVDNLFAVILGNKTALKGGSGKVVDSGPN  169

Query  1165  DRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEG  986
             D IFIYYTDHGGPGVLGMP  P+LYA D I+ LKKKH++GTYK MV Y+EACESGS F+G
Sbjct  170   DHIFIYYTDHGGPGVLGMPTSPYLYAKDLIDTLKKKHASGTYKSMVFYLEACESGSIFQG  229

Query  985   MMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEE  806
             ++PE LNIY TTASNAEESSWGTYCPG +P+PPPEY TCLGDLYSVAWMEDS  HNL  E
Sbjct  230   LLPEGLNIYATTASNAEESSWGTYCPGEDPSPPPEYETCLGDLYSVAWMEDSGLHNLRTE  289

Query  805   TIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRL  626
             ++ +QYE VK RT+N      GSHVM++G   + K + +YLY G +PA  N    +   L
Sbjct  290   SLHQQYELVKRRTANVGA-AYGSHVMQFGDIGLSK-DHLYLYMGTNPANDNFTFVEENSL  347

Query  625   T-PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLF  449
               P  V NQRDADL+  W++Y+   + +V K +  KE+ + M HR  +D S+  +G  LF
Sbjct  348   KLPSRVTNQRDADLVHFWDKYRKAPEGSVRKVQAQKEVLEAMAHRLHIDNSVKLIGKLLF  407

Query  448   GPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNIS  269
             G   G  +L  VR  G  LVDDW CLK+MVR FE HCGSL QYGMKHMR+ ANICN+ + 
Sbjct  408   GMIKGPEVLDHVRPSGQPLVDDWDCLKTMVRAFERHCGSLSQYGMKHMRSIANICNAGVQ  467

Query  268   EAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
                ME+A    C  +    ++   + +SA
Sbjct  468   VTQMEDAAAQACPTLPAGPWSSLRRGFSA  496



>ref|XP_003569218.1| PREDICTED: vacuolar-processing enzyme-like [Brachypodium distachyon]
Length=488

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/445 (59%), Positives = 331/445 (74%), Gaps = 6/445 (1%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GTRWAVL+AGSNGY NYRHQAD+CHAYQI+K+GGLKDENI+VFMYDDIA+N  NPR 
Sbjct  47    DSVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKDENIIVFMYDDIAHNPENPRP  106

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIINHP G DVYAGVPKDYTG +V   N +AVLLG+K  V GGSGKVVDS  +D IF++
Sbjct  107   GVIINHPQGGDVYAGVPKDYTGKEVNVKNFFAVLLGNKAAVSGGSGKVVDSGPNDHIFVF  166

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AGTYK +V Y+EACESGS FEG++P D+
Sbjct  167   YSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKSLVFYLEACESGSIFEGLLPNDI  226

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
              IY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYS+AWMEDS+ HNL  E++++QY
Sbjct  227   GIYATTASNAEESSWGTYCPGEYPSPPPEYDTCLGDLYSIAWMEDSDVHNLRTESLKQQY  286

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPK  617
             + VK RT+  N +  GSHVM+YGS D +  E ++LY G +PA  N   + GN +   +  
Sbjct  287   DLVKKRTAPENSYSYGSHVMQYGSLD-LNAEHLFLYIGSNPANDNTTFVEGNSLPSFSR-  344

Query  616   GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPEN  437
               VNQRDADL++ W++Y+   +++ +K    KE+ + M HR  +D S++  G  LFG E+
Sbjct  345   -AVNQRDADLVYFWQKYRKLAESSPAKNDARKELLEMMAHRSHVDNSVELTGNLLFGSED  403

Query  436   GSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAM  257
             G  +LK+VR  G  LVDDW CLKS VR FE+ CGSL QYGMKHMR+FANICN+ I   A 
Sbjct  404   GPMVLKTVRTAGEPLVDDWGCLKSTVRAFESQCGSLAQYGMKHMRSFANICNAGILPEAT  463

Query  256   EEACKNTCSEMKTMKYTHPSKVYSA  182
              +     C  +    ++   K +SA
Sbjct  464   AKVAAQACPSIPANPWSATHKGFSA  488



>emb|CBI20614.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/458 (59%), Positives = 335/458 (73%), Gaps = 8/458 (2%)
 Frame = -3

Query  1546  QPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFM  1367
             +P    DD++   E+ GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENI+VFM
Sbjct  41    RPGGAADDDT-GAESAGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIIVFM  99

Query  1366  YDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgk  1187
             YDDI+ N  NPR G+IIN P+G DVY GVPKDYTG+ VT  N +AV+LG+K  + GGSGK
Sbjct  100   YDDISFNEENPRPGIIINSPHGEDVYEGVPKDYTGEDVTVDNFFAVILGNKTALSGGSGK  159

Query  1186  vvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACE  1007
             V+DS  +D IFIYY+DHGGPGVLGMP  P+LYAND IEVLKKKH++GTY  +V Y+EACE
Sbjct  160   VLDSGPNDHIFIYYSDHGGPGVLGMPTSPYLYANDLIEVLKKKHASGTYNSLVFYLEACE  219

Query  1006  SGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSE  827
             SGS FEG++PE LNIY TTA+NAEESSWGTYCPG +P+PPPEY TCLGDLYSVAWMEDS+
Sbjct  220   SGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGEDPSPPPEYETCLGDLYSVAWMEDSD  279

Query  826   SHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN--  653
              HNL  ET+ +QYE VK RT+N N    GSHVM+YG   + K E + LY G +PA  N  
Sbjct  280   VHNLRTETLRQQYELVKKRTANDNSVY-GSHVMQYGDLGLNK-EDLVLYMGTNPANDNYT  337

Query  652   -LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDAS  476
              +  N +R   P   VNQRDADL+  W++++   + +  KA+  K+  + M HR  +D +
Sbjct  338   FVDNNSLR--LPSKAVNQRDADLVHFWDKFRKAPEGSPRKAEAQKQFLEAMSHRTHIDHA  395

Query  475   IDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAF  296
             I  +G  LFG + GS +LK+VR  G  LVDDW CLK++VR FE HCGSL QYGMKHMR+ 
Sbjct  396   IKLVGRLLFGMKKGSEVLKTVRPAGQPLVDDWHCLKTLVRTFEAHCGSLSQYGMKHMRSI  455

Query  295   ANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             ANICN+ I +  M EA    C  +    ++   K +SA
Sbjct  456   ANICNAGIEKEQMAEASAQACVTIPPGPWSSLDKGFSA  493



>ref|NP_001236564.1| vacuolar processing enzyme 2 precursor [Glycine max]
 gb|AAL58570.1| vacuolar processing enzyme 2 [Glycine max]
Length=482

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/463 (59%), Positives = 335/463 (72%), Gaps = 15/463 (3%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
              +R P +  +D++     +GTRWAVL+AGSNGY NYRHQADVCHAYQIL++GGLK+ENI+
Sbjct  30    FLRLPSETDNDDN----FKGTRWAVLLAGSNGYWNYRHQADVCHAYQILRKGGLKEENII  85

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA N  NPR GVIIN P+G DVY GVPKDYTG+ VT  N +A LLG+K  + GG
Sbjct  86    VFMYDDIAFNGENPRPGVIINKPDGGDVYKGVPKDYTGEDVTVDNFFAALLGNKSALTGG  145

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVVDS  DD IF+YYTDHGGPGVLGMP  P+LYA+D IEVLKKKH++GTYK++V Y+E
Sbjct  146   SGKVVDSGPDDHIFVYYTDHGGPGVLGMPAGPYLYADDLIEVLKKKHASGTYKNLVFYLE  205

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++PED+NIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWME
Sbjct  206   ACESGSIFEGLLPEDINIYATTASNAEESSWGTYCPGEYPSPPPEYTTCLGDLYSVAWME  265

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYG----SRDIIKPEKVYLYQGFD  668
             DS+ HNL  ET+ +QY+ VK RT +  D   GSHVM+YG    SRD++     + Y G D
Sbjct  266   DSDRHNLRTETLHQQYKLVKERTIS-GDSYYGSHVMQYGDVGLSRDVL-----FHYLGTD  319

Query  667   PATINLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
             PA  N        L +P   VNQRDADL+  W++++   + ++ K    K++ + M HR 
Sbjct  320   PANDNFTFVDENSLWSPSKPVNQRDADLIHFWDKFRKAPEGSLRKNTAQKQVLEAMSHRM  379

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              +D S+  +G  LFG E G  +L +VR  G ALVDDW CLK+MVR FETHCGSL QYGMK
Sbjct  380   HVDNSVKLIGKLLFGIEKGPEVLNAVRPAGSALVDDWHCLKTMVRTFETHCGSLSQYGMK  439

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             HMR+FANICN  I    M EA    C  + +  ++   + +SA
Sbjct  440   HMRSFANICNVGIKNEQMAEASAQACVSIPSNPWSSLQRGFSA  482



>ref|XP_007222246.1| hypothetical protein PRUPE_ppa004713mg [Prunus persica]
 gb|EMJ23445.1| hypothetical protein PRUPE_ppa004713mg [Prunus persica]
Length=494

 Score =   531 bits (1369),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 271/455 (60%), Positives = 334/455 (73%), Gaps = 8/455 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             D   DE  +G T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  45    DDGPDEQDDG-TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  103

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR GVIIN P+G DVY GVPKDYTGD VT  N +A +LG+K  + GG+GKVVD
Sbjct  104   IAYNEENPRPGVIINSPHGDDVYKGVPKDYTGDDVTVNNFFAAILGNKTALTGGTGKVVD  163

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFIYY+DHGGPGVLGMP  P++YAND IEVLKKKH+AGTYK +V Y+EACESGS
Sbjct  164   SGPNDHIFIYYSDHGGPGVLGMPTSPYIYANDLIEVLKKKHAAGTYKSLVFYLEACESGS  223

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HN
Sbjct  224   IFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDIHN  283

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LP  647
             L  ET+ +QYE VK RT+N N    GSHVM+YG   + K E +++Y G +PA  N   L 
Sbjct  284   LRSETLHQQYELVKTRTANDNS-GFGSHVMQYGDVGLSK-ENLFVYMGTNPANDNYTFLG  341

Query  646   GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDN  467
              N +R  T    VNQRDADL+  W +Y+   + +  K +  K+  + M HR  +D ++  
Sbjct  342   ENSLRPSTK--AVNQRDADLVHFWHKYRKAPEGSPRKIQAQKDFVEAMSHRMHMDQTMKL  399

Query  466   LGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANI  287
             +G  LFG + G  +L +VR  G  LVDDW CLK+MVR FET+CGSL QYGMKHMR+ ANI
Sbjct  400   IGKLLFGIKKGPEVLNTVRPAGQPLVDDWDCLKTMVRSFETYCGSLSQYGMKHMRSLANI  459

Query  286   CNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             CN+ +++  M EA    C+ + + +++   + +SA
Sbjct  460   CNAGMTKEQMTEASAQACTSVPSSRWSSLHRGFSA  494



>ref|XP_002276759.2| PREDICTED: vacuolar-processing enzyme [Vitis vinifera]
Length=526

 Score =   532 bits (1371),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 270/458 (59%), Positives = 335/458 (73%), Gaps = 8/458 (2%)
 Frame = -3

Query  1546  QPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFM  1367
             +P    DD++   E+ GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENI+VFM
Sbjct  74    RPGGAADDDT-GAESAGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIIVFM  132

Query  1366  YDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgk  1187
             YDDI+ N  NPR G+IIN P+G DVY GVPKDYTG+ VT  N +AV+LG+K  + GGSGK
Sbjct  133   YDDISFNEENPRPGIIINSPHGEDVYEGVPKDYTGEDVTVDNFFAVILGNKTALSGGSGK  192

Query  1186  vvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACE  1007
             V+DS  +D IFIYY+DHGGPGVLGMP  P+LYAND IEVLKKKH++GTY  +V Y+EACE
Sbjct  193   VLDSGPNDHIFIYYSDHGGPGVLGMPTSPYLYANDLIEVLKKKHASGTYNSLVFYLEACE  252

Query  1006  SGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSE  827
             SGS FEG++PE LNIY TTA+NAEESSWGTYCPG +P+PPPEY TCLGDLYSVAWMEDS+
Sbjct  253   SGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGEDPSPPPEYETCLGDLYSVAWMEDSD  312

Query  826   SHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN--  653
              HNL  ET+ +QYE VK RT+N N    GSHVM+YG   + K E + LY G +PA  N  
Sbjct  313   VHNLRTETLRQQYELVKKRTANDNSVY-GSHVMQYGDLGLNK-EDLVLYMGTNPANDNYT  370

Query  652   -LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDAS  476
              +  N +R   P   VNQRDADL+  W++++   + +  KA+  K+  + M HR  +D +
Sbjct  371   FVDNNSLR--LPSKAVNQRDADLVHFWDKFRKAPEGSPRKAEAQKQFLEAMSHRTHIDHA  428

Query  475   IDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAF  296
             I  +G  LFG + GS +LK+VR  G  LVDDW CLK++VR FE HCGSL QYGMKHMR+ 
Sbjct  429   IKLVGRLLFGMKKGSEVLKTVRPAGQPLVDDWHCLKTLVRTFEAHCGSLSQYGMKHMRSI  488

Query  295   ANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             ANICN+ I +  M EA    C  +    ++   K +SA
Sbjct  489   ANICNAGIEKEQMAEASAQACVTIPPGPWSSLDKGFSA  526



>gb|ACF79136.1| unknown [Zea mays]
 gb|ACF85763.1| unknown [Zea mays]
 gb|ACF88139.1| unknown [Zea mays]
 tpg|DAA58991.1| TPA: legumain-like protease Precursor [Zea mays]
Length=481

 Score =   531 bits (1367),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 264/465 (57%), Positives = 342/465 (74%), Gaps = 10/465 (2%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             R +P IR P ++    +   +  GTRWAVL+AGSNGY NYRHQAD+CHAYQI+K+GGLKD
Sbjct  24    RLEPTIRLPSER----AAADDAVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKD  79

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIA++  NPR GVIINHP G DVYAGVPKDYTG +V   N +AVLLG+K  
Sbjct  80    ENIVVFMYDDIAHSPENPRPGVIINHPQGGDVYAGVPKDYTGREVNVDNFFAVLLGNKTA  139

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             ++GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AGTYK +V
Sbjct  140   LRGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKSLV  199

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
              Y+EACESGS FEG++P D+N+Y TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSV
Sbjct  200   FYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPEYDTCLGDLYSV  259

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDS+ HNL  E++++QY  VK RT+  + F  GSHVM+YGS + +  + ++ Y G +
Sbjct  260   AWMEDSDFHNLRTESLKQQYNLVKDRTAVQDTFSYGSHVMQYGSLE-LNVKHLFSYIGTN  318

Query  667   PATIN---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             PA  +   +  N +   +    VNQRDADL++ W++Y+   D++  K +  KE+ + M H
Sbjct  319   PANDDNTFIEDNSLPSFSK--AVNQRDADLVYFWQKYRKLADSSPEKNEARKELLEVMAH  376

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R  +D+S++ +G  LFG E+G  +LK+VR  G  LVDDW CLKS VR FE  CGSL QYG
Sbjct  377   RSHVDSSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSTVRTFEAQCGSLAQYG  436

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MKHMR+FANICN+ I   A+ +     C+ + +  ++   K +SA
Sbjct  437   MKHMRSFANICNAGILPEAVSKVAAQACTSIPSNPWSSIHKGFSA  481



>gb|AAF69014.1|AF260827_1 cysteine protease [Ipomoea batatas]
Length=492

 Score =   531 bits (1367),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 272/458 (59%), Positives = 334/458 (73%), Gaps = 5/458 (1%)
 Frame = -3

Query  1546  QPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFM  1367
             +P ++++ E+   ++ GTRWAVL+AGSNGY NYRHQAD+CHAYQILK GGLKDENIVVFM
Sbjct  37    RPAEEENREADGDDSVGTRWAVLIAGSNGYWNYRHQADICHAYQILKAGGLKDENIVVFM  96

Query  1366  YDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgk  1187
             YDDIA N  NPRKG+IIN P+G DVY GVPKDYTGD VTA NL AV+LGDK  VKGGSGK
Sbjct  97    YDDIAYNEENPRKGIIINSPHGEDVYHGVPKDYTGDDVTANNLLAVILGDKSAVKGGSGK  156

Query  1186  vvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACE  1007
             VVDS  +D IFIYY+DHGGPGVLGMP  P+LYA++    LKKKH+AG YK +V Y+EACE
Sbjct  157   VVDSGPNDHIFIYYSDHGGPGVLGMPTSPYLYADELNAALKKKHAAGAYKSLVFYLEACE  216

Query  1006  SGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSE  827
             SGS FEG++P+D+NIY TTASNA ESSWGTYCPG  P+PPPEY TCLGDLYS+AWMEDS+
Sbjct  217   SGSIFEGILPKDINIYATTASNAIESSWGTYCPGEYPSPPPEYETCLGDLYSIAWMEDSD  276

Query  826   SHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLP  647
              HNL  E++++QY  VK RT N N    GSHVM+YG  + +  + +++Y G +PA  N  
Sbjct  277   IHNLRTESLKQQYNLVKDRTLNGNT-AYGSHVMQYGDLE-LNADSLFMYMGTNPANENFT  334

Query  646   ---GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDAS  476
                   ++   P+  VNQRDADLL  W++++   + +  K++  K+ T+ + HR  LD S
Sbjct  335   FVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQKQFTEAITHRTHLDNS  394

Query  475   IDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAF  296
             I  +G  LFG E G  +L SVR  GL LVDDW CLKS VR FETHCGSL QYGMKHMR+ 
Sbjct  395   IALVGKLLFGMEKGPEVLSSVRATGLPLVDDWSCLKSYVRAFETHCGSLSQYGMKHMRSI  454

Query  295   ANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             ANICN+ ISE  M EA    C    +  ++     +SA
Sbjct  455   ANICNAGISEERMAEASAQACPTFPSYSWSSLRGGFSA  492



>ref|XP_009337146.1| PREDICTED: vacuolar-processing enzyme-like [Pyrus x bretschneideri]
Length=495

 Score =   531 bits (1367),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 273/454 (60%), Positives = 330/454 (73%), Gaps = 9/454 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             DQ+DD      T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  49    DQQDDG-----TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  103

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR+GVIIN P+G+DVY GVPKDYTG  VT  N +A +LGDK  + GGSGKVVD
Sbjct  104   IAYNEENPRQGVIINSPHGSDVYKGVPKDYTGQDVTVNNFFAAILGDKSALTGGSGKVVD  163

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNL-PHLYANDFIEVLKKKHSAGTYKDMVIYVEACESG  1001
             S  +D IFIYY+DHGGPGVLGMP + P++YAND IEVLKKKH+AGTYK MV Y+EACESG
Sbjct  164   SGPNDHIFIYYSDHGGPGVLGMPGISPYIYANDLIEVLKKKHAAGTYKSMVFYLEACESG  223

Query  1000  SFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESH  821
             S FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ H
Sbjct  224   SIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDIH  283

Query  820   NLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGN  641
             NL  ET+ +QYE VK RT+N N    GSHVM+YG   + K   +++Y G +PA  N    
Sbjct  284   NLKSETLRQQYELVKTRTANDNS-GLGSHVMQYGDVGLSK-NNLFVYMGTNPANENFTFL  341

Query  640   QIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNL  464
                 L P    VNQRDADL+  W +Y+   + +  K +  KE  + M HR  +D ++  +
Sbjct  342   GQNSLRPSSKAVNQRDADLVHFWHKYRKAPEGSPRKVQAQKEFVEAMSHRMHIDETMKLI  401

Query  463   GVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANIC  284
             G  LFG E G  +L +VR  G  LVDDW CLK+MVR FETHCGSL QYGMKHMR+ ANIC
Sbjct  402   GKLLFGIEKGPEVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANIC  461

Query  283   NSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             N+ +++  M EA    C  + + +++     +SA
Sbjct  462   NAGMTKEQMAEASAQACVSVPSGRWSSLHMGFSA  495



>gb|EYU29312.1| hypothetical protein MIMGU_mgv1a005315mg [Erythranthe guttata]
Length=489

 Score =   530 bits (1365),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 267/437 (61%), Positives = 326/437 (75%), Gaps = 4/437 (1%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             ++ +DE+ + ++ GTRWAVL+AGS+GY NYRHQADVCHAYQILKRGGL+DENIVVFMYDD
Sbjct  40    EEANDEAGD-DSVGTRWAVLLAGSSGYWNYRHQADVCHAYQILKRGGLRDENIVVFMYDD  98

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IANN  NPR GVIIN P+G DVY GVPKDY GD VT  N +AVLLG+K  VKGGSGKVVD
Sbjct  99    IANNEENPRPGVIINSPHGEDVYKGVPKDYVGDDVTVDNFFAVLLGNKTAVKGGSGKVVD  158

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IF+YY+DHGGPGVLGMP  P+LYAND I+VLK KH++GTYK +V Y+EACESGS
Sbjct  159   SGPNDHIFVYYSDHGGPGVLGMPTSPYLYANDLIDVLKTKHASGTYKSLVFYLEACESGS  218

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HN
Sbjct  219   IFEGLLPEGLNIYATTASNAEESSWGTYCPGDNPSPPPEYETCLGDLYSVAWMEDSDVHN  278

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  ET+ +QY+ VK RT+N N +  GSHVM++G    +  + +++Y G +PA  N     
Sbjct  279   LRTETLRQQYQLVKQRTANQNSYY-GSHVMQFGDLK-LSVDNLFMYMGTNPANDNFTYAV  336

Query  637   IRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLG  461
                L P    VNQRDADL+  W++++     +  K +  K++ + M HR  +D SI  +G
Sbjct  337   SNSLRPSSKTVNQRDADLIHFWDKFRKAPQGSTRKYEAQKDLAEAMAHRTHIDNSIKLIG  396

Query  460   VHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICN  281
               LFG + G  +LK+VR  G  LVDDW CLKS+VR FETHCGSL QYGMKHMR+ ANICN
Sbjct  397   KLLFGFQKGPQVLKTVRPAGKPLVDDWTCLKSLVRTFETHCGSLSQYGMKHMRSIANICN  456

Query  280   SNISEAAMEEACKNTCS  230
             + +S   M E     C+
Sbjct  457   AGVSIEQMAEVSAQACT  473



>ref|XP_011096125.1| PREDICTED: vacuolar-processing enzyme [Sesamum indicum]
Length=491

 Score =   530 bits (1365),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 268/442 (61%), Positives = 327/442 (74%), Gaps = 6/442 (1%)
 Frame = -3

Query  1498  GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVI  1319
             GTRWA+L+AGSNGY NYRHQADVCHAYQILKRGGLKDENIVVFMYDDIA N  NPR GVI
Sbjct  53    GTRWAILIAGSNGYWNYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAYNEENPRPGVI  112

Query  1318  INHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTD  1139
             IN+P+G DVY GVPKDY GD VT  N +AVLLG+K  V+GGSGKVVDS   D IFIYYTD
Sbjct  113   INNPHGEDVYKGVPKDYVGDDVTVNNFFAVLLGNKTAVRGGSGKVVDSGPSDHIFIYYTD  172

Query  1138  HGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIY  959
             HGGPGVLGMP  P++YA+D I VLKKKH++GTYK +V Y+EACESGS FEG++PE LNIY
Sbjct  173   HGGPGVLGMPTSPYIYADDLINVLKKKHASGTYKSLVFYLEACESGSIFEGLLPEGLNIY  232

Query  958   VTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENV  779
              TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  E++ +QY+ V
Sbjct  233   ATTASNAEESSWGTYCPGDYPSPPPEYETCLGDLYSVAWMEDSDIHNLRTESLRQQYQLV  292

Query  778   KLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLP---GNQIRRLTPKGVV  608
             K RT+N N +  GSHVM+YG    +  + ++ Y G +PA  N     GN + RL+    V
Sbjct  293   KTRTANENSYY-GSHVMQYGDLK-LSVDHLFSYMGTNPANDNFTFVDGNSL-RLSSSRAV  349

Query  607   NQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSN  428
             NQRDADL+  W++++   + +  K +  K++ + M HR  +D SI  +G  LFG E G  
Sbjct  350   NQRDADLVHFWDKFRKAPEGSARKVEAQKQLAEAMAHRSHIDNSIQLIGKLLFGIEKGPQ  409

Query  427   ILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEA  248
             +L +VR  G  LVDDW CLK +VR FETHCGSL QYGMKHMR+ ANICN+ +++  M E 
Sbjct  410   VLNTVRPAGEPLVDDWNCLKLLVRTFETHCGSLSQYGMKHMRSIANICNAGVNKEQMGEV  469

Query  247   CKNTCSEMKTMKYTHPSKVYSA  182
                 C+ + +  ++   + YSA
Sbjct  470   SAQACTNVPSNSWSSLHRGYSA  491



>gb|KHN37015.1| Vacuolar-processing enzyme [Glycine soja]
Length=474

 Score =   528 bits (1361),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 267/441 (61%), Positives = 325/441 (74%), Gaps = 3/441 (1%)
 Frame = -3

Query  1501  QGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGV  1322
             +GTRWAVL+AGSNGY NYRHQADVCHAYQIL++GGLK+ENI+VFMYDDIA N  NPR GV
Sbjct  36    KGTRWAVLLAGSNGYWNYRHQADVCHAYQILRKGGLKEENIIVFMYDDIAFNGENPRPGV  95

Query  1321  IINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYT  1142
             IIN P+G DVY GVPKDYTG+ VT  N +A LLG+K  + GGSGKVVDS  DD IF+YYT
Sbjct  96    IINKPDGGDVYEGVPKDYTGEDVTVGNFFAALLGNKSALTGGSGKVVDSGPDDHIFVYYT  155

Query  1141  DHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNI  962
             DHGGPGVLGMP  P+LYA+D IEVLKKKH++GTYK++V Y+EACESGS FEG++PED+NI
Sbjct  156   DHGGPGVLGMPAGPYLYADDLIEVLKKKHASGTYKNLVFYLEACESGSIFEGLLPEDINI  215

Query  961   YVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYEN  782
             Y TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  ET+ +QY+ 
Sbjct  216   YATTASNAEESSWGTYCPGEYPSPPPEYSTCLGDLYSVAWMEDSDRHNLRTETLHQQYKL  275

Query  781   VKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRL-TPKGVVN  605
             VK RT +  D   GSHVM+YG    +  + ++ Y G DPA  N        L +P   VN
Sbjct  276   VKERTIS-GDSYYGSHVMQYGDVG-LSSDVLFHYLGTDPANDNFTFVDENSLWSPSKPVN  333

Query  604   QRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNI  425
             QRDADL+  W++++   + ++ K    K++ + M HR  +D S+  +G  LFG E G  +
Sbjct  334   QRDADLIHFWDKFRKAPEGSLRKNAAQKQVLEAMSHRMHVDNSVKLIGKLLFGIEKGPEV  393

Query  424   LKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEAC  245
             L +VR  G ALVDDW CLK+MVR FETHCGSL QYGMKHMR+FANICN  I    M EA 
Sbjct  394   LNAVRPAGSALVDDWHCLKTMVRTFETHCGSLSQYGMKHMRSFANICNVGIKNEQMAEAS  453

Query  244   KNTCSEMKTMKYTHPSKVYSA  182
                C  + +  ++   + +SA
Sbjct  454   AQACVSIPSNPWSSLQRGFSA  474



>emb|CAC18100.1| putative legumain [Zea mays]
Length=485

 Score =   528 bits (1361),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 261/465 (56%), Positives = 341/465 (73%), Gaps = 6/465 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             R +P IR P ++   +  + +  GTRWAVL+AGSNGY NYRHQAD+CHAYQI+K+GGLKD
Sbjct  24    RLEPTIRLPSERAAADETDDDAVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKD  83

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIA++  NPR GVIINHP G DVYAGVPKDYTG +V   N +AVLLG+K  
Sbjct  84    ENIVVFMYDDIAHSPENPRPGVIINHPQGGDVYAGVPKDYTGREVNVDNFFAVLLGNKTA  143

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             ++GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AGTYK +V
Sbjct  144   LRGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKSLV  203

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
              Y+EACESGS FEG++P D+N+Y TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSV
Sbjct  204   FYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPEYDTCLGDLYSV  263

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDS+ HNL  E++++QY  VK RT+  + F  GSHVM+YGS + +  + ++ Y G +
Sbjct  264   AWMEDSDFHNLRTESLKQQYNLVKDRTAVQDTFSYGSHVMQYGSLE-LNVKHLFSYIGTN  322

Query  667   PA---TINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             PA     ++  N +   +    VNQRDADL++ W++Y+   D++  K +  +E+ + M H
Sbjct  323   PANDDNTSIEDNSLPSFSK--AVNQRDADLVYFWQKYRKLADSSHEKNEARRELLEVMAH  380

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R  +D+S++ +G  LFG E+G  +LK+VR  G  LVDDW CLKS VR FE  CGSL  YG
Sbjct  381   RSHVDSSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSTVRTFEAQCGSLAHYG  440

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MKHMR+F NICN+ I   A+ +     C+ + +  ++   K +SA
Sbjct  441   MKHMRSFPNICNAGILPEAVSKVAAQACTSIPSNPWSSIHKGFSA  485



>ref|XP_008377927.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
 ref|XP_008357361.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
Length=492

 Score =   528 bits (1361),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 269/447 (60%), Positives = 326/447 (73%), Gaps = 6/447 (1%)
 Frame = -3

Query  1531  KDDESPEGE--TQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             + D +P+ +  T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  43    RGDNAPDQDDGTVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  102

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR+GVIIN P+G+DVY GVPKDYTG  VT  N +A +LG+K  + GGSGKVVD
Sbjct  103   IAYNEENPRQGVIINSPHGSDVYKGVPKDYTGQDVTVNNFFAAILGNKSALTGGSGKVVD  162

Query  1177  sKADDRIFIYYTDHGGPGVLGMP-NLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESG  1001
             S  +D IFIYY+DHGGPGVLGMP   P++YAND IEVLKKKH+AGTYK MV Y+EACESG
Sbjct  163   SGPNDHIFIYYSDHGGPGVLGMPATSPYIYANDLIEVLKKKHAAGTYKSMVFYLEACESG  222

Query  1000  SFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESH  821
             S FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ H
Sbjct  223   SIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDIH  282

Query  820   NLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGN  641
             NL  ET+ +QYE VK RT+N N    GSHVM+YG   + K   +++Y G +PA  N    
Sbjct  283   NLKSETLHQQYELVKTRTANDNS-GFGSHVMQYGDVGLSK-NNLFVYMGTNPANENFTFL  340

Query  640   QIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNL  464
                 L P    VNQRDADL+  W +Y    + +  K +  KE  + M HR  +D ++  +
Sbjct  341   GQNSLRPSSKAVNQRDADLVHFWHKYSKAPEGSPRKVQAQKEFVEAMSHRMHIDETMKLI  400

Query  463   GVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANIC  284
             G  LFG E G  +L +VR  G  LVDDW CLK+MVR FETHCGSL QYGMKHMR+ ANIC
Sbjct  401   GKLLFGIEKGPXVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANIC  460

Query  283   NSNISEAAMEEACKNTCSEMKTMKYTH  203
             N+ +++  M EA    C    + +++H
Sbjct  461   NAGMTKEQMAEASAQACVSAPSXRWSH  487



>ref|XP_004291017.1| PREDICTED: vacuolar-processing enzyme-like [Fragaria vesca subsp. 
vesca]
Length=494

 Score =   528 bits (1361),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 270/461 (59%), Positives = 336/461 (73%), Gaps = 11/461 (2%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
               R   DQ+DD      T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIV
Sbjct  42    FFRAGDDQQDDG-----TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIV  96

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA N  NPR+GVIIN P+G DVY GVPKDYTG+ VT  N +A +LG+K  + GG
Sbjct  97    VFMYDDIAYNEENPRQGVIINSPHGDDVYKGVPKDYTGEDVTVGNFFAAILGNKTAISGG  156

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVVDS  +D IFIYY+DHGGPGVLGMP  P++YA+  IEVLKKKH+AGTY+ +V Y+E
Sbjct  157   SGKVVDSGPNDHIFIYYSDHGGPGVLGMPTSPYIYADRLIEVLKKKHAAGTYESLVFYLE  216

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++PE LNI+ TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWME
Sbjct  217   ACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWME  276

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATI  656
             DS+ HNL  ET+ +QYE VK RT++ N    GSHVM+YG   + K   +++Y G +PA  
Sbjct  277   DSDIHNLRSETLHQQYELVKSRTASDNS-PYGSHVMQYGDIPLSK-NNLFMYMGTNPAND  334

Query  655   N---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRL  485
             N   +P N +R  + K  VNQRDADL+  W +Y+   + +  KA+  KE  + M HR  +
Sbjct  335   NYTFMPQNFLRPSSSK-AVNQRDADLVHFWHKYRKAPEGSARKAQAQKEFLEAMSHRMHI  393

Query  484   DASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHM  305
             D S+  +G  LFG + G  +L +VR  G  LVDDW CLK+MVR FET+CGSL QYGMKHM
Sbjct  394   DESVKLIGKLLFGIKKGPEVLSAVRPAGQPLVDDWDCLKTMVRSFETYCGSLSQYGMKHM  453

Query  304   RAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             R+ ANICN+ +++  M EA    C  + + +++   + +SA
Sbjct  454   RSLANICNAGMTKEQMAEASAQACVNVPSGRWSSLHRGFSA  494



>ref|XP_009616670.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
 dbj|BAC54828.1| vacuolar processing enzyme-1b [Nicotiana tabacum]
Length=489

 Score =   528 bits (1360),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 268/452 (59%), Positives = 329/452 (73%), Gaps = 6/452 (1%)
 Frame = -3

Query  1525  DESPEGE----TQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             DES  G+    + GTRWA+L+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  40    DESNAGDHDDDSVGTRWAILLAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  99

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IANN  NPR+GVIIN P+G DVY GVPKDYTGD VT  N +AV+LG+K  + GGSGKVV+
Sbjct  100   IANNEENPRRGVIINSPHGEDVYKGVPKDYTGDDVTVDNFFAVILGNKTALSGGSGKVVN  159

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFI+Y+DHGGPGVLGMP  P+LYAND I+VLKKKH++GTYK +V Y+EACESGS
Sbjct  160   SGPNDHIFIFYSDHGGPGVLGMPTDPYLYANDLIDVLKKKHASGTYKSLVFYLEACESGS  219

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNIY TTASNAEESSWGTYCPG  P+PP EY+TCLGDLYS++WMEDSE HN
Sbjct  220   IFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPIEYMTCLGDLYSISWMEDSELHN  279

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  E++++QY  VK RT+  N    GSHVM+YG   + K + +YLY G +PA  N     
Sbjct  280   LRTESLKQQYHLVKERTATGNPVY-GSHVMQYGDLHLSK-DALYLYMGTNPANDNYTFMD  337

Query  637   IRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGV  458
                L     VNQRDADLL  W +++   + +V K +  K++ + + HR  LD S+  +G 
Sbjct  338   DNSLRVSKAVNQRDADLLHFWHKFRTAPEGSVRKIEAQKQLNEAISHRVHLDNSVALVGK  397

Query  457   HLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNS  278
              LFG E G  +L  VR  G  LVDDW CLKS VR FETHCGSL QYGMKHMR+ ANICN+
Sbjct  398   LLFGIEKGPEVLSGVRPAGQPLVDDWDCLKSFVRTFETHCGSLSQYGMKHMRSIANICNA  457

Query  277   NISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              I +  M EA    C  + +  ++   + +SA
Sbjct  458   GIKKEQMVEASAQACPSVPSNTWSSLHRGFSA  489



>ref|XP_002324151.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
 gb|EEF02716.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
Length=489

 Score =   528 bits (1360),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 263/440 (60%), Positives = 324/440 (74%), Gaps = 3/440 (1%)
 Frame = -3

Query  1498  GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVI  1319
             GTRWA+L+AGSNGY NYRHQADVCHAYQ+L++GGLK+ENI+VFMYDDIA N+ NPR+GVI
Sbjct  52    GTRWAILLAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIAYNSENPRRGVI  111

Query  1318  INHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTD  1139
             IN P G DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVVDS  +D IFIYYTD
Sbjct  112   INSPQGEDVYKGVPKDYTGEDVTVGNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTD  171

Query  1138  HGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIY  959
             HGGPGVLGMP  P+LYA+D I+VLKKKH++GTYK +V Y+EACESGS FEG++P+ LNIY
Sbjct  172   HGGPGVLGMPTNPYLYADDLIDVLKKKHASGTYKSLVFYLEACESGSIFEGLLPQGLNIY  231

Query  958   VTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENV  779
              TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  ET+ +QYE V
Sbjct  232   ATTASNAEESSWGTYCPGENPSPPPEYETCLGDLYSVAWMEDSDIHNLQTETLHQQYELV  291

Query  778   KLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKG-VVNQ  602
             K RTSN N    GSHVM+YG   + K + ++LY G +PA  N        L P+   VNQ
Sbjct  292   KRRTSNDNS-PYGSHVMQYGDVGLSK-DNIFLYMGTNPANDNFTFMDENLLRPRSKAVNQ  349

Query  601   RDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNIL  422
             RDADL+  W++Y+   + +  K +  K+  + M HR  +D SI  +G  LFG E  S +L
Sbjct  350   RDADLVHFWDKYRKAPEGSSRKVEAQKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASEVL  409

Query  421   KSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACK  242
              ++R  G  LVDDW CLK++VR FETHCGS+ QYGMKHMR+ AN+CN+ I +  M EA  
Sbjct  410   NAIRPAGQPLVDDWDCLKTLVRTFETHCGSVSQYGMKHMRSLANLCNAGIGKEQMAEASA  469

Query  241   NTCSEMKTMKYTHPSKVYSA  182
               C    +  ++   K +SA
Sbjct  470   QACVSFPSGPWSTLHKGFSA  489



>gb|AET08896.1| vacuolar processing enzyme 4 [Aegilops tauschii]
 emb|CCC14982.1| VPE4D protein [Aegilops tauschii]
Length=493

 Score =   528 bits (1359),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 266/470 (57%), Positives = 338/470 (72%), Gaps = 11/470 (2%)
 Frame = -3

Query  1576  QAARWDPLIRQP----VDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQIL  1409
             +  R +P IR P      Q+DD+S      GTRWAVL+AGSNGY NYRHQAD+CHAYQI+
Sbjct  30    RTPRLEPTIRLPSQRAAGQEDDDS-----VGTRWAVLIAGSNGYYNYRHQADICHAYQIM  84

Query  1408  KRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAV  1229
             K+GGLKDENI+VFMYDDIA+N  NPR GVIINHP G DVYAGVPKDYTG +V   N +AV
Sbjct  85    KKGGLKDENIIVFMYDDIAHNPENPRPGVIINHPQGGDVYAGVPKDYTGKEVNVKNFFAV  144

Query  1228  LLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSA  1049
             LLG+K  V GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+A
Sbjct  145   LLGNKTAVSGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAA  204

Query  1048  GTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITC  869
             GTYK +V Y+EACESGS FEG++P D+ +Y TTASNAEESSWGTYCPG  P+PPPEY TC
Sbjct  205   GTYKSLVFYLEACESGSIFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPPEYDTC  264

Query  868   LGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKV  689
             LGDLYS++WMEDS+ HNL  E++++QY  VK RT+  + +  GSHVM+YGS D +  E +
Sbjct  265   LGDLYSISWMEDSDVHNLRTESLKQQYNLVKKRTAAQDSYSYGSHVMQYGSLD-LNAEHL  323

Query  688   YLYQGFDPATINLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEIT  512
             + Y G +PA  N    +   L +    VNQRDADL++ W++Y+   +++  K    K++ 
Sbjct  324   FSYIGSNPANENTTFVEDNALPSFSRAVNQRDADLVYFWQKYRKLAESSPEKNDARKQLL  383

Query  511   DTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGS  332
             + M HR  +D S++ +G  LFG   G  +LK+VR  G  LVDDW CLKS VR FE+ CGS
Sbjct  384   EMMGHRSHIDNSVEPIGNLLFGSAGGPMVLKAVRPAGEPLVDDWSCLKSTVRTFESQCGS  443

Query  331   LGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             L QYGMKHMR+FANICN+ I   AM +      + + T  ++   K +SA
Sbjct  444   LAQYGMKHMRSFANICNAGIVPEAMAKVAAQARTSIPTNPWSATHKGFSA  493



>gb|AET08891.1| vacuolar processing enzyme 4 [Triticum monococcum]
 emb|CCC14976.1| VPE4A protein [Triticum urartu]
Length=493

 Score =   527 bits (1358),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 266/470 (57%), Positives = 339/470 (72%), Gaps = 11/470 (2%)
 Frame = -3

Query  1576  QAARWDPLIRQP----VDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQIL  1409
             ++ R +P IR P      Q+DD+S      GTRWAVL+AGSNGY NYRHQAD+CHAYQI+
Sbjct  30    RSPRLEPTIRLPSQRAAGQEDDDS-----VGTRWAVLIAGSNGYYNYRHQADICHAYQIM  84

Query  1408  KRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAV  1229
             K+GGLKDENI+VFMYDDIA+N  NP  GVIINHP G DVYAGVPKDYTG +V   NL+AV
Sbjct  85    KKGGLKDENIIVFMYDDIAHNLENPGPGVIINHPQGGDVYAGVPKDYTGKEVNVKNLFAV  144

Query  1228  LLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSA  1049
             LLG+K  V GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+A
Sbjct  145   LLGNKTAVSGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAA  204

Query  1048  GTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITC  869
             GTYK +V Y+EACESGS FEG++P D+ +Y TTASNAEESSWGTYCPG  P+PPPEY TC
Sbjct  205   GTYKSLVFYLEACESGSIFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPPEYDTC  264

Query  868   LGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKV  689
             LGDLYS++WMEDS+ HNL  E++++QY  VK RT+  + +  GSHVM+YGS D +  E +
Sbjct  265   LGDLYSISWMEDSDVHNLRTESLKQQYNLVKKRTAAQDSYSYGSHVMQYGSLD-LNAEHL  323

Query  688   YLYQGFDPATINLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEIT  512
             + Y G +PA  N    +   L +    VNQRDADL++ W++Y+   +++  K    K++ 
Sbjct  324   FSYIGSNPANENTTFVEDNALPSFSRAVNQRDADLVYFWQKYRKLAESSPEKNDARKQLL  383

Query  511   DTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGS  332
             + M HR  +D S++ +G  LFG   G  +LK+VR  G  LVDDW CLKS VR FE+ CGS
Sbjct  384   EMMGHRSHIDNSVELIGNLLFGSAGGPMVLKAVRPAGEPLVDDWSCLKSTVRTFESQCGS  443

Query  331   LGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             L QYGMKHMR+FANICN+ I   A  +     C+ + T  ++   K +SA
Sbjct  444   LAQYGMKHMRSFANICNAGIVPEATAKVAAQACTSIPTNPWSATHKGFSA  493



>gb|KHG13131.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=488

 Score =   527 bits (1358),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 269/448 (60%), Positives = 324/448 (72%), Gaps = 3/448 (1%)
 Frame = -3

Query  1522  ESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNA  1343
              S + E  GTRWAVL+AGSNGY NYRHQADVCHAYQ+L+ GGLK+ENI+VFMYDDIA N 
Sbjct  43    RSDDDEVGGTRWAVLIAGSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAFNE  102

Query  1342  FNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADD  1163
              NPR GVIIN+P+G DVY GVPKDYTG+ V   N +A LLG+K  + GGSGKVVDS  DD
Sbjct  103   ENPRPGVIINNPHGDDVYKGVPKDYTGEDVNVHNFFAALLGNKSAITGGSGKVVDSGPDD  162

Query  1162  RIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGM  983
              IFIYYTDHGGPGVLGMP  P+LYA+D IEVLKKKH++G YK MV Y+EACESGS FEG+
Sbjct  163   HIFIYYTDHGGPGVLGMPTFPYLYADDLIEVLKKKHASGNYKSMVFYLEACESGSIFEGL  222

Query  982   MPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEET  803
             +P+ LNIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  ET
Sbjct  223   LPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDMHNLRTET  282

Query  802   IERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPG-NQIRRL  626
             + +QYE VK RT N N    GSHVM+YG   + K + ++ Y G +PA  N    ++   +
Sbjct  283   LHQQYELVKKRTINGNS-AYGSHVMQYGDVGLSK-DSLFAYLGTNPANDNFTFVDENSLV  340

Query  625   TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFG  446
              P   VNQRDADL+  W +Y+   + +V K +  K+  + M  R  +D S+  +G  LFG
Sbjct  341   PPTKAVNQRDADLVHFWYKYRKAPEGSVRKTEAQKQFVEAMSLRMHIDHSVKLIGKLLFG  400

Query  445   PENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISE  266
              E GS +L +VR  G  LVDDW+CLK +VR FETHCGSL QYGMKHMR+ ANICN+ I  
Sbjct  401   IERGSEVLNTVRPAGQPLVDDWKCLKKVVRTFETHCGSLAQYGMKHMRSLANICNARIQT  460

Query  265   AAMEEACKNTCSEMKTMKYTHPSKVYSA  182
               M EA    C  + T +++   K +SA
Sbjct  461   EQMAEASAQACVSVPTGRWSSLQKGFSA  488



>gb|KDP34125.1| hypothetical protein JCGZ_07696 [Jatropha curcas]
Length=493

 Score =   527 bits (1357),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 267/447 (60%), Positives = 327/447 (73%), Gaps = 7/447 (2%)
 Frame = -3

Query  1513  EGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNP  1334
             E ++ GTRWA+L+AGSNGY NYRHQADVCHAYQ+LK+GGLKDENI+VFMYDDIA N  NP
Sbjct  51    EDDSTGTRWAILIAGSNGYWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIAFNKENP  110

Query  1333  RKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIF  1154
             R GVIIN+P G DVY GVPKDYTG+ V   N +A +LG+K  + GGSGKVVDS  +D IF
Sbjct  111   RPGVIINNPYGEDVYKGVPKDYTGEDVNVNNFFAAILGNKTAITGGSGKVVDSGPNDHIF  170

Query  1153  IYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPE  974
             IYYTDHGGPGVLGMP  P+LYAND I+VL KKH++GTYK +V Y+EACESGS FEG++PE
Sbjct  171   IYYTDHGGPGVLGMPTNPYLYANDLIDVLIKKHASGTYKSLVFYLEACESGSIFEGLLPE  230

Query  973   DLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIER  794
              LNIY TTA+NAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  ET+ +
Sbjct  231   GLNIYATTAANAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDVHNLQTETLRQ  290

Query  793   QYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLT  623
             QY+ VK RT+N N    GSHVM+YG   + K + ++LY G +PA  N   +  N +R   
Sbjct  291   QYQLVKRRTANGNS-AYGSHVMQYGDVGLSK-DNLFLYMGTNPANENYTFVDENSLR--P  346

Query  622   PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGP  443
             P   VNQRDADL+  W++Y+   D +  K +  K+  + M HR  LD S+  +G  LFG 
Sbjct  347   PSKAVNQRDADLVHFWDKYRKAPDGSTRKIQAQKQFVEAMSHRMHLDHSMKLIGKLLFGI  406

Query  442   ENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEA  263
               GS +L ++R  G  LVDDW CLK++VR FETHCGSL QYGMKHMR+ AN+CN+ I E 
Sbjct  407   GKGSEVLNAIRPAGQPLVDDWVCLKTLVRTFETHCGSLSQYGMKHMRSLANLCNAGIRED  466

Query  262   AMEEACKNTCSEMKTMKYTHPSKVYSA  182
              M EA    C  + +  ++   K +SA
Sbjct  467   QMAEASAQACVSIPSGPWSSLHKGFSA  493



>emb|CAB64545.1| legumain-like protease [Zea mays]
Length=481

 Score =   526 bits (1356),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 263/465 (57%), Positives = 339/465 (73%), Gaps = 10/465 (2%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             R +P IR P D+    +   +  GTRWAVL+AGSNGY NYRHQAD+CHAYQI+K+GGLKD
Sbjct  24    RLEPTIRLPSDR----AAADDAVGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGLKD  79

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIA++  NPR GVIINHP G DVYAGVPKDYTG  V   N +AVLLG+K  
Sbjct  80    ENIVVFMYDDIAHSPENPRPGVIINHPQGGDVYAGVPKDYTGRDVNVDNFFAVLLGNKTA  139

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             ++GGSGKVVDS  +D I ++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AGTYK +V
Sbjct  140   LRGGSGKVVDSGPNDHISVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKSLV  199

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
              Y+EACESGS FEG++P D+N+Y TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSV
Sbjct  200   FYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPEYDTCLGDLYSV  259

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDS+ HNL  E++++QY  VK RT+  + F  GSHVM+YGS   +  + ++ Y G +
Sbjct  260   AWMEDSDFHNLRTESLKQQYNLVKDRTAVQDTFSYGSHVMQYGSLG-LNVKHLFSYIGTN  318

Query  667   PATIN---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             PA  +   +  N +   +    VNQRDADL++ W++Y+   D++  K +  +E+ + M H
Sbjct  319   PANDDNTFIEDNSLPSFSK--AVNQRDADLVYFWQKYRKLADSSPEKNEARRELLEVMAH  376

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R  +D+S++ +G  LFG E+G  +LK+VR  G  LVDDW CLKS VR FE  CGSL QYG
Sbjct  377   RSHVDSSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSTVRTFEAQCGSLAQYG  436

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MKHMR+FANICN+ I   A+ +     C+ + +  ++   K +SA
Sbjct  437   MKHMRSFANICNAGILPEAVSKVAAQACTSIPSNPWSSIHKGFSA  481



>ref|XP_002960690.1| hypothetical protein SELMODRAFT_75074 [Selaginella moellendorffii]
 gb|EFJ38229.1| hypothetical protein SELMODRAFT_75074 [Selaginella moellendorffii]
Length=478

 Score =   526 bits (1354),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 265/432 (61%), Positives = 326/432 (75%), Gaps = 6/432 (1%)
 Frame = -3

Query  1525  DESPEGET-QGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAN  1349
             DE  E ++ +GTRWAVL+AGS GY NYRHQADVCHAYQ+L+RGG+++ENIVVFMYDDIAN
Sbjct  35    DEFLEDQSARGTRWAVLLAGSAGYWNYRHQADVCHAYQLLRRGGMREENIVVFMYDDIAN  94

Query  1348  NAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKA  1169
             N  NPR GV+INHPNG +VYAGVPKDYTGDQVT  N  AVL GDKE ++GGSGKVV+S  
Sbjct  95    NFANPRPGVMINHPNGDNVYAGVPKDYTGDQVTVNNFLAVLRGDKEALQGGSGKVVESGP  154

Query  1168  DDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFE  989
             +D IF++Y+DHGGPGVLGMP  P+LYA D +  L+  H    YK+MV+Y+EACESGS FE
Sbjct  155   NDHIFVFYSDHGGPGVLGMPVTPYLYAVDLVTTLQDMHDNNKYKEMVLYIEACESGSIFE  214

Query  988   GMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLME  809
             G++P++LNI+VTTASNA ESSWGTYCPG EP+PPPEY TC+GDLYSVAWMEDSE HNL  
Sbjct  215   GLLPKNLNIFVTTASNAVESSWGTYCPGMEPSPPPEYDTCIGDLYSVAWMEDSEVHNLDH  274

Query  808   ETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRR  629
             E ++ QY  VK RTS+ N ++ GSHVM+YG  ++ K E++ LY GFDPA  NL       
Sbjct  275   ERLKDQYNTVKARTSDANTYRMGSHVMKYGDTNMDK-ERLSLYLGFDPANANLTSYN---  330

Query  628   LTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLF  449
               P   + QRDADLL  W++YK   +N++ K+K L+E  D +  R ++D S++ +G  L 
Sbjct  331   -KPASSIGQRDADLLHFWQKYKNSKENSLEKSKALQEFLDVIGRRTQIDRSVELVGSVLL  389

Query  448   GPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNIS  269
             G E+ S IL SVR  G  LVD+W CLK MVRVFET CG LGQYGMKHMRAFAN+CN+ + 
Sbjct  390   GSESASQILNSVRPEGHPLVDNWDCLKEMVRVFETKCGPLGQYGMKHMRAFANLCNAGVD  449

Query  268   EAAMEEACKNTC  233
                M+ A   TC
Sbjct  450   PERMKSAAGATC  461



>ref|XP_006853917.1| hypothetical protein AMTR_s00036p00187360 [Amborella trichopoda]
 gb|ERN15384.1| hypothetical protein AMTR_s00036p00187360 [Amborella trichopoda]
Length=469

 Score =   525 bits (1353),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 269/454 (59%), Positives = 327/454 (72%), Gaps = 14/454 (3%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
             + W   +R P  Q +D      + GTRWAVLVAGS+GY NYRHQAD+CHAYQ + RGGLK
Sbjct  25    STWSDFLRMP--QTED------SVGTRWAVLVAGSSGYGNYRHQADICHAYQTMIRGGLK  76

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             ++NIVVFMYDDIA N  NPR GVIIN P+G DVYAGVPKDY GD V   NL+AV+LG+K 
Sbjct  77    EKNIVVFMYDDIAYNEENPRPGVIINRPHGEDVYAGVPKDYVGDDVNVDNLFAVILGNKS  136

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              + GGSGKVVDS  DD IFI+Y+DHGG GVLGMP  P+LYA+D + VLKKKH +GTYK +
Sbjct  137   ALTGGSGKVVDSGPDDHIFIFYSDHGGAGVLGMPTYPYLYADDLVNVLKKKHVSGTYKSL  196

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             V Y+EACESGS FEG++PE LNIY TTASNA ESSWGTYCP   P  P EY TCLGDLYS
Sbjct  197   VFYLEACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPDDSPDFPQEYDTCLGDLYS  256

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGF  671
             V+WMEDS+ HNL  ET+++QYE VK+RTSN+  +  GSHVM+YG   + K E++ LY G 
Sbjct  257   VSWMEDSDIHNLQFETLKQQYELVKMRTSNFETYMFGSHVMQYGDSGLGK-EQLVLYMGS  315

Query  670   DPATIN---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
             +PA  N   +  N++   +    VNQRDADL++ W +Y+     ++ K    KE+ D M 
Sbjct  316   NPANDNSTFISRNELPSFSK--AVNQRDADLVYFWNKYRKSPVGSIKKRNAQKELFDVMA  373

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR  LD SI+ +G  LFG E G  ILK+VR  GL LVDDW CLK+MVR FET CGS+ QY
Sbjct  374   HRLHLDNSIELIGKLLFGSEKGPEILKTVRTTGLPLVDDWDCLKAMVRTFETKCGSISQY  433

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTCSEMKT  218
             GMKHMR+ ANICN+ IS+  M EA    C+ + T
Sbjct  434   GMKHMRSMANICNAGISKEVMAEASAEACTRIPT  467



>ref|XP_006646004.1| PREDICTED: vacuolar-processing enzyme-like [Oryza brachyantha]
Length=516

 Score =   527 bits (1357),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 260/442 (59%), Positives = 329/442 (74%), Gaps = 6/442 (1%)
 Frame = -3

Query  1498  GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVI  1319
             GTRWAVL+AGSNGY NYRHQADVCHAYQI+K+GGLKDENI+VFMYDDIA+N+ NPR GVI
Sbjct  78    GTRWAVLIAGSNGYYNYRHQADVCHAYQIMKKGGLKDENIIVFMYDDIAHNSENPRPGVI  137

Query  1318  INHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTD  1139
             INHP G DVYAGVPKDYTG  V   NL+AVLLGDK  V GGSGKV+DS  +D IFI+Y+D
Sbjct  138   INHPQGGDVYAGVPKDYTGKDVNVKNLFAVLLGDKTAVSGGSGKVLDSGPNDHIFIFYSD  197

Query  1138  HGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIY  959
             HGGPGVLGMP  P+LY +D ++VLKKKH+AGTYK +V Y+EACESGS FEG++P+D+N+Y
Sbjct  198   HGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKSLVFYLEACESGSIFEGLLPDDINVY  257

Query  958   VTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENV  779
              TTASNA+ESSWGTYCPG  P+PPPEY TCLGDLYSVAWMED + HNL  E++ +QY  V
Sbjct  258   ATTASNADESSWGTYCPGEYPSPPPEYDTCLGDLYSVAWMEDCDVHNLRTESLRQQYNLV  317

Query  778   KLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPKGVV  608
             K RTS  + + +GSHVM+YGS + +    ++LY G +PA  N   +  N +   +    V
Sbjct  318   KERTSVQHTYDSGSHVMQYGSIE-LNAHHLFLYMGSNPANDNSTFVEDNSLPSFSR--AV  374

Query  607   NQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSN  428
             NQRDADL++ W++Y+   + +  K +  K++ + M HR  +D S++ +G  LFG E G  
Sbjct  375   NQRDADLVYFWQKYRKLAEGSPEKNEARKQLLEMMAHRSHVDNSVELIGNLLFGSEEGPR  434

Query  427   ILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEA  248
             +LK+VR  G  L+DDW CLKSMVR FE  CGSL QYGMKHMR+FANIC + IS   M + 
Sbjct  435   VLKAVRATGEPLIDDWSCLKSMVRAFEAQCGSLAQYGMKHMRSFANICIAGISAEEMAKV  494

Query  247   CKNTCSEMKTMKYTHPSKVYSA  182
                 C+ + +  ++   + +SA
Sbjct  495   AAQACTSIPSNPWSSTHRGFSA  516



>ref|XP_010049168.1| PREDICTED: vacuolar-processing enzyme-like [Eucalyptus grandis]
 gb|KCW81642.1| hypothetical protein EUGRSUZ_C03004 [Eucalyptus grandis]
Length=488

 Score =   526 bits (1354),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 263/442 (60%), Positives = 327/442 (74%), Gaps = 7/442 (2%)
 Frame = -3

Query  1498  GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVI  1319
             GTRWAVL+AGSNGY NYRHQADVCHAYQ+LK+GGLKDENI+VF+YDDIA+N  NPR G++
Sbjct  51    GTRWAVLIAGSNGYWNYRHQADVCHAYQLLKKGGLKDENIIVFIYDDIADNEENPRPGIV  110

Query  1318  INHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTD  1139
             IN P+G DVY GVPKDYTG+ V   N ++V+LG+K  + GGSGKV++S  DD IFIYYTD
Sbjct  111   INSPDGDDVYEGVPKDYTGEDVNVNNFFSVILGNKTALTGGSGKVLESGPDDTIFIYYTD  170

Query  1138  HGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIY  959
             HGGPGVLGMP  P LYA+D I+VLKKKH++GTYK +V Y+EACESGS FEG++PE LNIY
Sbjct  171   HGGPGVLGMPTSPFLYADDLIDVLKKKHASGTYKSLVFYLEACESGSIFEGLLPEGLNIY  230

Query  958   VTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENV  779
              TTASNAEESSWGTYCPG  P+PP EY TCLGDLYSVAWMEDSE HNL  ET+ +QY+ V
Sbjct  231   ATTASNAEESSWGTYCPGEYPSPPVEYETCLGDLYSVAWMEDSEVHNLRTETLHQQYQLV  290

Query  778   KLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPKGVV  608
             K RT+N N    GSHVM++G   + K E ++LY G +PA  N   +  N +R   P+  V
Sbjct  291   KKRTANDNT-AYGSHVMQFGDIGLSK-EDLFLYMGTNPANDNSSFVDDNSLR--PPQKAV  346

Query  607   NQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSN  428
             NQRDADLL  W +++   + +  K +  K+  + M HR  +D S+  +G  LFG + G  
Sbjct  347   NQRDADLLHFWHKFRKAPEGSSRKLEAQKQFFEAMSHRMHIDHSVKLIGKLLFGIKKGPE  406

Query  427   ILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEA  248
             +L +VR  G  LVDDW CL+S+VR FETHCGSL QYGMKHMR+FANICN+ I    M EA
Sbjct  407   VLNAVRPAGQPLVDDWACLRSLVRTFETHCGSLSQYGMKHMRSFANICNAGIRTEQMTEA  466

Query  247   CKNTCSEMKTMKYTHPSKVYSA  182
                 C+ + +  ++  S+ +SA
Sbjct  467   SGQACAHIPSGPWSSLSRGFSA  488



>emb|CBM41515.1| legumain/vacuolar processing enzyme [Papaver rhoeas]
Length=490

 Score =   526 bits (1354),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 276/481 (57%), Positives = 339/481 (70%), Gaps = 14/481 (3%)
 Frame = -3

Query  1603  AIACQLQNLQAARWDPLIRQPVDQKD----DESPEGETQGTRWAVLVAGSNGYANYRHQA  1436
             A+    +N++    D +IR P + KD        +    GTRWAVL+AGS+GY NYRHQA
Sbjct  17    AVGSSARNIEE---DGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLIAGSSGYWNYRHQA  73

Query  1435  DVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQ  1256
             DVCHAYQ+LKRGG+KDENIVVFMYDDIA N  NPR GVIINHP G DVYAGVPKDYTG  
Sbjct  74    DVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGEDVYAGVPKDYTGRD  133

Query  1255  VTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFI  1076
             VTA N Y+VLLG+K  VKGGSGKV+DS  +D IFIYY+DHGGPGVLGMP  P+LYA+D +
Sbjct  134   VTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLGMPTYPYLYADDLV  193

Query  1075  EVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEP  896
              VLK+KH+ G YK +V Y+EACESGS FEG++P+ LNIY TTASNAEESSWGTYCPG  P
Sbjct  194   NVLKQKHALGAYKSLVFYLEACESGSIFEGILPKGLNIYATTASNAEESSWGTYCPGEFP  253

Query  895   APPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGS  716
             +PP EY TCLGDLYSVAWMEDS+ HNL  ET+++QY  VK RT N N    GSHVM+YG 
Sbjct  254   SPPSEYETCLGDLYSVAWMEDSDVHNLRSETLKQQYHLVKERTQNANS-AYGSHVMQYGD  312

Query  715   RDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNA  545
              ++ K E ++LY G +PA  N   +  N +  L+  G VNQR+ADL+  W++Y+   + +
Sbjct  313   LEVSK-EDLFLYMGTNPANDNNKFIEQNSLPSLS--GSVNQREADLIHFWQKYRKAPEGS  369

Query  544   VSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKS  365
               KA   K+  + M HR  +D SI  +G  LFG E G  +L++VR  G  LVDDW CLK+
Sbjct  370   QRKADAQKQFVEVMAHRMHVDHSIKLIGKLLFGFEKGPQVLEAVRPAGQPLVDDWDCLKT  429

Query  364   MVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYS  185
             MVR FE  CGSL QYGMKHMR+ ANICN+ I +  M EA    C  +    ++   + +S
Sbjct  430   MVRTFEAQCGSLSQYGMKHMRSVANICNAGIKKEQMAEAASQACVTIPNGSWSSTHQGFS  489

Query  184   A  182
             A
Sbjct  490   A  490



>gb|KHG30636.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=488

 Score =   525 bits (1353),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 267/449 (59%), Positives = 326/449 (73%), Gaps = 5/449 (1%)
 Frame = -3

Query  1522  ESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNA  1343
              S + E  GTRWAVL+AGSNGY NYRHQADVCHAYQ+L+ GGLK+ENI+VFMYDDIA N 
Sbjct  43    RSDDDEVGGTRWAVLIAGSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAYNE  102

Query  1342  FNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADD  1163
              NPR G+IIN+P+G DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVV+S   D
Sbjct  103   ENPRPGIIINNPHGDDVYKGVPKDYTGENVTVNNFFAAILGNKSALTGGSGKVVNSGPSD  162

Query  1162  RIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGM  983
              IFIYY+DHGGPGVLGMP LP+LYA+D I+VLKKKH++GTYK +V Y+EACESGS FEG+
Sbjct  163   HIFIYYSDHGGPGVLGMPTLPYLYADDLIDVLKKKHASGTYKSLVFYLEACESGSIFEGL  222

Query  982   MPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEET  803
             +PE LNIY TTA+NA ESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL +ET
Sbjct  223   LPEGLNIYATTAANAVESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDIHNLRKET  282

Query  802   IERQYENVKLRTSNYNDFQAGSHVMEYGSRDI-IKPEKVYLYQGFDPATINLPG-NQIRR  629
             + +QYE VK RT N N    GSHVM++G  DI I  + ++ Y G +PA  N    ++   
Sbjct  283   LHQQYELVKRRTINGNS-AYGSHVMQFG--DIGISMDNLFTYLGTNPANDNFKSVDENSL  339

Query  628   LTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLF  449
             L P   VNQRDADL+  W++Y+   D +V K +  K++ + M HR  +D SI  +G  LF
Sbjct  340   LPPTKAVNQRDADLVHFWDKYRKAPDGSVRKVEAQKQVMEAMSHRMHVDNSIQLIGKLLF  399

Query  448   GPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNIS  269
             G E G  +L +VR  G  LVDDW+CLK MVR FETHCGSL QYGMKHMR+ ANICN+ I 
Sbjct  400   GVERGPEVLNTVRPTGQPLVDDWKCLKKMVRTFETHCGSLAQYGMKHMRSLANICNAGIE  459

Query  268   EAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
                M E     C  + +  +    K +SA
Sbjct  460   TEKMGEVSAQACVNIPSGHWGSVEKGFSA  488



>ref|XP_010432633.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Camelina 
sativa]
Length=492

 Score =   524 bits (1350),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 276/467 (59%), Positives = 334/467 (72%), Gaps = 12/467 (3%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGG  1397
             QA+R+     +P    DD+S      GTRWAVLVAGS+GY NYRHQADVCHAYQ+L++GG
Sbjct  36    QASRF----FRPAQDNDDDS----NAGTRWAVLVAGSSGYDNYRHQADVCHAYQLLRKGG  87

Query  1396  LKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgd  1217
             LKDENIVVFMYDDIA +  NPR G IIN P+G DVY GVPKDYTGD VT  NL+AV+LGD
Sbjct  88    LKDENIVVFMYDDIAYHHANPRPGTIINSPHGKDVYQGVPKDYTGDDVTVDNLFAVILGD  147

Query  1216  kegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYK  1037
             K  VKGGSGKVVDS  +D IFI+YTDHGGPG+LGMP  P++YAND  +VLKKKH+ GTYK
Sbjct  148   KTAVKGGSGKVVDSGPNDHIFIFYTDHGGPGILGMPTYPYIYANDLNDVLKKKHALGTYK  207

Query  1036  DMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDL  857
              +V Y+EACESGS FEG++PE LNIY TTASNAEESSWGTYCPG EP+PPPEY TCLGDL
Sbjct  208   SLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGDEPSPPPEYDTCLGDL  267

Query  856   YSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQ  677
             YSVAWMEDS  HNL  ET+++QYE VK RT+   ++  GSHVM+YG   + K + + LY 
Sbjct  268   YSVAWMEDSGVHNLQTETLQQQYELVKKRTAP-TEYSYGSHVMQYGDVGLSK-DLLDLYM  325

Query  676   GFDPATINLPGNQIRRLT--PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTM  503
             G +PA  N        L   P  V NQRDADL+  WE+Y+   + +  K +  K++ + M
Sbjct  326   GTNPANENFTFVDANSLKPPPSRVTNQRDADLVHFWEKYRKAPEGSARKTEAHKQLLEVM  385

Query  502   LHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQ  323
              HR  +D S+  +G  LFG  +G  +L  VR  G  LVDDW CLK+MVR FE HCGSL Q
Sbjct  386   SHRLHVDNSVMLVGKILFGISDGPIVLNKVRSAGQPLVDDWNCLKNMVRAFERHCGSLSQ  445

Query  322   YGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             YGMKHMR+FANICN+ I    MEEA    C+ +    ++   + +SA
Sbjct  446   YGMKHMRSFANICNAGIQMEQMEEAASQACTTIPPGPWSSLRRGFSA  492



>ref|XP_006296251.1| hypothetical protein CARUB_v10025418mg [Capsella rubella]
 gb|EOA29149.1| hypothetical protein CARUB_v10025418mg [Capsella rubella]
Length=481

 Score =   524 bits (1349),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 277/477 (58%), Positives = 334/477 (70%), Gaps = 8/477 (2%)
 Frame = -3

Query  1600  IACQLQNLQAARWDPLIRQPVDQKDDESPEGETQ-GTRWAVLVAGSNGYANYRHQADVCH  1424
             +     +L AA  D  IR P +      P  E    TRWAVLVAGS+GY NYRHQADVCH
Sbjct  9     VVVLFLSLVAAASDNFIRLPSEASKFFRPNNENDDSTRWAVLVAGSSGYWNYRHQADVCH  68

Query  1423  AYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAA  1244
             AYQ+LK+GG+K+ENIVVFMYDDIANN  NPR GVIIN PNG DVY GVPKDYTGD+V   
Sbjct  69    AYQLLKKGGVKEENIVVFMYDDIANNEENPRPGVIINSPNGEDVYNGVPKDYTGDEVNVN  128

Query  1243  NLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLK  1064
             N +AVLLG+K  +KGGSGKVV+S  +D IFIYY+DHGGPGVLGMP  P+LYA D  +VLK
Sbjct  129   NFFAVLLGNKTALKGGSGKVVNSGPNDHIFIYYSDHGGPGVLGMPTSPYLYAKDLNDVLK  188

Query  1063  KKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPP  884
             KKH++GTYK +V Y+EACESGS FEG++PE LNIY TTASNAEESSWGTYCPG +P+PP 
Sbjct  189   KKHASGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEDPSPPS  248

Query  883   EYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDII  704
             EY TCLGDLYSVAWMEDS+ HNL  E++ +QYE VK RT+       GSHV+E+G   + 
Sbjct  249   EYETCLGDLYSVAWMEDSDKHNLQTESLHQQYELVKKRTAGTGS-SYGSHVLEFGDIGLS  307

Query  703   KPEKVYLYQGFDPATINLP---GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKA  533
             K EK+ LY G +PA  N      N   RL P  V NQRDADL+  W++Y+   + +  K 
Sbjct  308   K-EKLVLYMGTNPANENFTFVDENSSLRL-PSRVTNQRDADLVHFWDKYRKAPEGSARKV  365

Query  532   KLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRV  353
             +  K++ + M HR  +D S+  +G  LFG E G  +L  VR  G  LVDDW CLKSMVR 
Sbjct  366   EAQKQVLEAMSHRLHVDNSVLLIGKLLFGLE-GPAVLNKVRPSGRPLVDDWDCLKSMVRA  424

Query  352   FETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             FE HCGSL QYG+KHMR+ ANICN+ I    MEEA K  C  +    ++   + +SA
Sbjct  425   FERHCGSLSQYGIKHMRSIANICNAGIQMGLMEEAAKQACPSIPAGPWSSLHRGFSA  481



>ref|XP_009407316.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=488

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 263/462 (57%), Positives = 332/462 (72%), Gaps = 7/462 (2%)
 Frame = -3

Query  1552  IRQPVDQKDDESPEGETQ--GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENI  1379
             IR P D+       G+    GTRWAVL+AGSNG+ NYRHQAD+CHAYQI+K GGLKDENI
Sbjct  29    IRLPSDRAAGLHIGGDDDAVGTRWAVLIAGSNGFFNYRHQADICHAYQIMKNGGLKDENI  88

Query  1378  VVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkg  1199
             +VFMYDDIA +  NPR G IINHP G DVYAGVPKDY GD V   N +AVLLG+K  + G
Sbjct  89    IVFMYDDIAYSEDNPRLGTIINHPEGGDVYAGVPKDYVGDDVNVNNFFAVLLGNKTALTG  148

Query  1198  gsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYV  1019
             GSGKVVDS  +D IFI+Y+DHGGPGVLGMP  P+LYA+D I VLKKKH++G+YK MV Y+
Sbjct  149   GSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTNPYLYADDLISVLKKKHASGSYKSMVFYL  208

Query  1018  EACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWM  839
             EACESGS FEG++PED+NIY TTASNA ESSWGTYCPG +P+PP EY TCLGDLYS+AWM
Sbjct  209   EACESGSIFEGLLPEDINIYATTASNAYESSWGTYCPGEDPSPPQEYYTCLGDLYSIAWM  268

Query  838   EDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPAT  659
             EDS+ HNL  ET+++QY  VK RT+    ++ GSHVM+YG  + +  + ++LY G +P  
Sbjct  269   EDSDIHNLRTETLKQQYHLVKTRTAVSETYRFGSHVMQYGDLE-LNMKDLFLYLGSNPLN  327

Query  658   IN---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
              N   +  N +   + K  VNQRDADL++ W +Y+   + +  K    K++ + M HR  
Sbjct  328   ENATFVDDNSLLSFS-KAAVNQRDADLVYFWHKYRRAPEGSSHKLNAQKDLLEVMSHRLH  386

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             +D SI+ +G  LFG    S +LKSVR  G  LVDDW CLKSMVR FE+HCGSL QYGMKH
Sbjct  387   IDNSIELIGKLLFGSGKASELLKSVRTAGQPLVDDWSCLKSMVRTFESHCGSLSQYGMKH  446

Query  307   MRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MR+ ANICN+ +S+  M E     C+ + + +++   + +SA
Sbjct  447   MRSLANICNAGVSKETMAEVAAQACTAVPSNRWSSLHRGFSA  488



>gb|AAK15049.1|AF238384_1 asparaginyl endopeptidase [Vigna radiata]
Length=483

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 264/459 (58%), Positives = 332/459 (72%), Gaps = 8/459 (2%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
              +R P D  +D++     +GTRWA+L AGSNGY NYRHQAD+CHAYQIL++GGLK+ENI+
Sbjct  32    FLRLPSDSGNDDN----VKGTRWAILFAGSNGYWNYRHQADICHAYQILRKGGLKEENII  87

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA N  NPR GVIIN P+G DVY GVPKDYTG+  TA N Y+ LLGDK  + GG
Sbjct  88    VFMYDDIAFNWDNPRPGVIINKPDGDDVYEGVPKDYTGEDATAHNFYSALLGDKSALTGG  147

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVV+S  DDRIFI+Y+DHGGPGVLG P  P++YA+D +EVLKKKH++GTYK++V Y+E
Sbjct  148   SGKVVNSGPDDRIFIFYSDHGGPGVLGTPAGPYIYASDLVEVLKKKHASGTYKNLVFYLE  207

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACE+GS FEG++PED+NIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWME
Sbjct  208   ACEAGSIFEGLLPEDINIYATTASNAEESSWGTYCPGEYPSPPPEYSTCLGDLYSVAWME  267

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATI  656
             DS+ HNL  E++ +QY+ VK RT +   +  GSHVM+YG  +  K + ++LY G DPA  
Sbjct  268   DSDRHNLRTESLHQQYKVVKDRTLSGGWY--GSHVMQYGDVEFSK-DTLFLYLGTDPAND  324

Query  655   NLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDA  479
             NL       L +    VNQRDADL+  W +++   + +  K +  K++ + M HR  +D 
Sbjct  325   NLTFVDENSLWSSSTAVNQRDADLVHFWHKFRKAPEGSPKKNEARKQVLEVMSHRMHIDD  384

Query  478   SIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRA  299
             S+  +G  LFG E    +L +VR  G ALVDDW CLK+MVR FETHCGSL QYGMKHMR+
Sbjct  385   SVKLVGKLLFGFEKAPEVLNAVRPAGSALVDDWACLKTMVRTFETHCGSLSQYGMKHMRS  444

Query  298   FANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             FANICN  I +  M EA    C  +    ++   + +SA
Sbjct  445   FANICNVGIKKEQMAEASAQACVTVPASSWSSLQRGFSA  483



>ref|XP_010447316.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme [Camelina 
sativa]
Length=491

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 275/466 (59%), Positives = 333/466 (71%), Gaps = 11/466 (2%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGG  1397
             QA+R+     +P    DD+S      GTRWAVLVAGS+GY NYRHQADVCHAYQ+L++GG
Sbjct  36    QASRF----FRPAQDNDDDS----NAGTRWAVLVAGSSGYDNYRHQADVCHAYQLLRKGG  87

Query  1396  LKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgd  1217
             LKDENIVVFMYDDIA +  NPR G +IN P+G DVY GVPKDYTGD V   NL+AV+LGD
Sbjct  88    LKDENIVVFMYDDIAYHHANPRPGTLINSPHGKDVYQGVPKDYTGDDVNVDNLFAVILGD  147

Query  1216  kegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYK  1037
             K  VKGGSGKVVDS  +D IFI+YTDHGGPG+LGMP  P+LYAND  +VLKKKH+ GTYK
Sbjct  148   KTAVKGGSGKVVDSGPNDHIFIFYTDHGGPGILGMPTYPYLYANDLNDVLKKKHALGTYK  207

Query  1036  DMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDL  857
              +V Y+EACESGS FEG++PE LNIY TTASNAEESSWGTYCPG EP+PPPEY TCLGDL
Sbjct  208   SLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGDEPSPPPEYDTCLGDL  267

Query  856   YSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQ  677
             YSVAWMEDS  HNL  ET+++QYE VK RT+   ++  GSHVM+YG   + K + + LY 
Sbjct  268   YSVAWMEDSGVHNLQTETLQQQYELVKRRTAP-TEYSYGSHVMQYGDVGLNK-DLLDLYM  325

Query  676   GFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
             G +PA  N        L P   V NQRDADL+  WE+Y+   + +  K +  K++ + M 
Sbjct  326   GTNPANENFTFVDTNSLKPPSRVTNQRDADLVHFWEKYRKAPEGSARKTEAQKQLLEVMS  385

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR  +D S+  +G  LFG  +G  +L  VR  G  LVDDW CLK+MVR FE HCGSL QY
Sbjct  386   HRLHVDNSVMLVGKILFGISDGPIVLNKVRSAGKPLVDDWSCLKNMVRAFERHCGSLSQY  445

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             GMKHMR+FANICN+ I    MEEA    C+ +    ++   + +SA
Sbjct  446   GMKHMRSFANICNAGIQMEQMEEAASQACTTIPPGPWSSLRRGFSA  491



>gb|ACQ91103.1| vacuolar processing enzyme a [Populus tomentosa]
Length=493

 Score =   523 bits (1348),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 265/442 (60%), Positives = 324/442 (73%), Gaps = 7/442 (2%)
 Frame = -3

Query  1498  GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVI  1319
             GTRWA+L+AGSNGY NYRHQADVCHAYQ+L++GGLK+ENI+VFMYDDIA+N  NPR GVI
Sbjct  56    GTRWAILLAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIADNPENPRPGVI  115

Query  1318  INHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTD  1139
             IN+P G DVY GVPKDYTG  VT  N +A +LG+K  + GGSGKVVDS  +D IFIYYTD
Sbjct  116   INNPQGEDVYEGVPKDYTGQDVTVGNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTD  175

Query  1138  HGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIY  959
             HGGPGVLGMP  P+LYA+D I+VLKKKH++GTYK +V Y+EACESGS FEG++P+ LNIY
Sbjct  176   HGGPGVLGMPTNPYLYADDLIDVLKKKHASGTYKSLVFYLEACESGSIFEGLLPQGLNIY  235

Query  958   VTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENV  779
              TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  ET+ +QYE V
Sbjct  236   ATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDIHNLRTETLHQQYELV  295

Query  778   KLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPKGVV  608
             K RTS+ N    GSHVM+YG   + K E ++ Y G +PA  N   L  N +R   P   V
Sbjct  296   KRRTSDENS-AYGSHVMQYGDVGLSK-EDLFQYMGTNPANDNFTFLEDNSLR--PPSKAV  351

Query  607   NQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSN  428
             NQRDADL+  W +Y+   + +  K +  K+  + M HR  +D SI  +G  LFG E  S 
Sbjct  352   NQRDADLVHFWAKYRKAPEGSSRKVEAQKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASE  411

Query  427   ILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEA  248
             +L +VR  G  LVDDW CLK++VR FETHCGS+ QYGMKHMR+ AN+CN+ I +  M EA
Sbjct  412   VLNNVRPAGQPLVDDWVCLKTLVRTFETHCGSISQYGMKHMRSLANLCNAGIVKEQMAEA  471

Query  247   CKNTCSEMKTMKYTHPSKVYSA  182
                 C  + +  ++   K +SA
Sbjct  472   SAQACVSIPSGSWSSLHKGFSA  493



>dbj|BAA76745.1| asparaginyl endopeptidase (VmPE-1A) [Vigna mungo]
Length=482

 Score =   523 bits (1346),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 269/470 (57%), Positives = 334/470 (71%), Gaps = 11/470 (2%)
 Frame = -3

Query  1579  LQAARWD---PLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQIL  1409
             L AAR D     +R P D  +D++     QGTRWA+L AGSNGY NYRHQAD+CHAYQIL
Sbjct  20    LVAARRDHVGDFLRLPSDSGNDDN----VQGTRWAILFAGSNGYWNYRHQADICHAYQIL  75

Query  1408  KRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAV  1229
             ++GGLK+ENI+VFMYDDIA N  NPR GVIIN P+G DVY GVPKDYTG+  TA N Y+ 
Sbjct  76    RKGGLKEENIIVFMYDDIAFNWDNPRPGVIINKPDGDDVYEGVPKDYTGEDATAHNFYSA  135

Query  1228  LLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSA  1049
             LLGDK  + GGSGKVV S  DDRIFI+Y+DHGGPGVLG P  P++YA+D +EVLKKKH++
Sbjct  136   LLGDKSALTGGSGKVVSSGPDDRIFIFYSDHGGPGVLGTPAGPYIYASDLVEVLKKKHAS  195

Query  1048  GTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITC  869
             GTYK++V Y+EACE+GS FEG++PED+NIY TTASNAEESSWGTYCPG  P+PPPEY TC
Sbjct  196   GTYKNLVFYLEACEAGSIFEGLLPEDINIYATTASNAEESSWGTYCPGEYPSPPPEYSTC  255

Query  868   LGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKV  689
             LGDLYSVAWMEDS+ HNL  E++ +QY+ VK RT +   +  GSHVM+YG  +  K + +
Sbjct  256   LGDLYSVAWMEDSDRHNLRTESLHQQYKVVKDRTLSGGWY--GSHVMQYGDVEFSK-DAL  312

Query  688   YLYQGFDPATINLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEIT  512
             +LY G DPA  NL       L +    VNQRDADL+  W +++   + +  K +  K++ 
Sbjct  313   FLYLGTDPANDNLTFVDENSLWSSSTAVNQRDADLVHFWHKFRKAPEGSPKKNEARKQVL  372

Query  511   DTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGS  332
             + M HR  +D S+  +G  LFG E    +L +VR  G ALVDDW CLK+MVR FETHCGS
Sbjct  373   EVMSHRMHIDDSVKLVGKLLFGFEKAPEVLNAVRPAGSALVDDWACLKTMVRTFETHCGS  432

Query  331   LGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             L QYGMKHM  FANICN  I +  M EA    C  +    ++   + +SA
Sbjct  433   LSQYGMKHMSPFANICNVGIKKEQMAEASAQACVTVPASSWSSLQRGFSA  482



>ref|XP_011019532.1| PREDICTED: vacuolar-processing enzyme isoform X1 [Populus euphratica]
Length=493

 Score =   522 bits (1345),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 263/440 (60%), Positives = 321/440 (73%), Gaps = 3/440 (1%)
 Frame = -3

Query  1498  GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVI  1319
             GTRWA+L+AGSNGY NYRHQADVCHAYQ+L++GGLK+ENI+VFMYDDIA+N  NPR GVI
Sbjct  56    GTRWAILLAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIADNPENPRPGVI  115

Query  1318  INHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTD  1139
             IN+P G DVY GVPKDYTG  VT  N +A +LG+K  + GGSGKVVDS  +D IFIYYTD
Sbjct  116   INNPQGEDVYKGVPKDYTGQDVTVGNFFAAILGNKTALTGGSGKVVDSGPNDHIFIYYTD  175

Query  1138  HGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIY  959
             HGGPGVLGMP  P+LYA+D I+VLKKKH++GTYK +V Y+EACESGS FEG++P+ LNIY
Sbjct  176   HGGPGVLGMPTNPYLYADDLIDVLKKKHASGTYKSLVFYLEACESGSIFEGLLPQGLNIY  235

Query  958   VTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENV  779
              TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  ET+ +QYE V
Sbjct  236   ATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDMHNLRTETLHQQYELV  295

Query  778   KLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKG-VVNQ  602
             K RTS  N    GSHVM+YG   + K + ++LY G +PA  N    +   L P    VNQ
Sbjct  296   KRRTSEDNS-PYGSHVMQYGDVGLSK-DDLFLYMGTNPANDNFTFVEDNSLRPHSKAVNQ  353

Query  601   RDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNIL  422
             RDADL+  W +Y+   + +  K +  K+  + M HR  +D SI  +G  LFG E  S +L
Sbjct  354   RDADLVHFWAKYRKAPEGSTRKIEAQKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASEVL  413

Query  421   KSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACK  242
              +VR  G  LVDDW CLK++VR FETHCGS+ QYGMKHMR+ AN+CN+ I +  M EA  
Sbjct  414   NTVRPAGQPLVDDWVCLKTLVRTFETHCGSISQYGMKHMRSLANLCNAGIVKEQMAEASA  473

Query  241   NTCSEMKTMKYTHPSKVYSA  182
               C    +  ++   K +SA
Sbjct  474   QACVSFPSGSWSSLHKGFSA  493



>ref|XP_009762556.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana sylvestris]
 dbj|BAC54827.1| vacuolar processing enzyme-1a [Nicotiana tabacum]
Length=490

 Score =   521 bits (1343),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 268/452 (59%), Positives = 323/452 (71%), Gaps = 7/452 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             D  DD+S      GTRWA+L+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  46    DDHDDDS-----VGTRWAILLAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  100

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IANN  NPR GVIIN P+G DVY GVPKDYTGD VT  N +A LLG+K  + GGSGKVV+
Sbjct  101   IANNEENPRPGVIINSPHGEDVYKGVPKDYTGDDVTVNNFFAALLGNKTALSGGSGKVVN  160

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D I I+Y+DHGGPGVLGMP  P+LYAND I+VLKKKH++GTYK +V Y+EACESGS
Sbjct  161   SGPNDHILIFYSDHGGPGVLGMPTDPYLYANDLIDVLKKKHASGTYKSLVFYLEACESGS  220

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++PE LNIY TTASNAEESSWGTYCPG  P+PP EY TCLGDLYS++WMEDSE HN
Sbjct  221   IFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPIEYETCLGDLYSISWMEDSELHN  280

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  E++++QY  V+ RT+  N    GSHVM+YG   + K + +YLY G +PA  N     
Sbjct  281   LRTESLKQQYHLVRERTATGNPVY-GSHVMQYGDLHLSK-DALYLYMGTNPANDNYTFMD  338

Query  637   IRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGV  458
                L     VNQRDADLL  W +++   + +V K +  K++ + + HR  LD SI  +G 
Sbjct  339   DNSLRVSKAVNQRDADLLHFWYKFRKAPEGSVRKIEAQKQLNEAISHRVHLDNSIALVGK  398

Query  457   HLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNS  278
              LFG + G  +L SVR  G  LVDDW CLKS VR FETHCGSL QYGMKHMR+ ANICN 
Sbjct  399   LLFGIKKGPEVLSSVRPAGQPLVDDWDCLKSFVRTFETHCGSLSQYGMKHMRSIANICNV  458

Query  277   NISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              I  A M EA    C    +  ++   + +SA
Sbjct  459   GIKMAQMVEASAQACPSFASNTWSSLQRGFSA  490



>ref|XP_010437829.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Camelina 
sativa]
Length=491

 Score =   521 bits (1342),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 271/456 (59%), Positives = 328/456 (72%), Gaps = 7/456 (2%)
 Frame = -3

Query  1546  QPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFM  1367
             +P    DD+S      GTRWAVLVAGS+GY NYRHQADVCHAYQ+L++GGLKDENIVVFM
Sbjct  42    RPAQDNDDDS----NAGTRWAVLVAGSSGYDNYRHQADVCHAYQLLRKGGLKDENIVVFM  97

Query  1366  YDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgk  1187
             YDDIA +  NPR G +IN P+G DVY GVPKDYTGD V   NL+AV+LGDK  VKGGSGK
Sbjct  98    YDDIAYHHANPRPGTLINSPHGKDVYQGVPKDYTGDDVNVDNLFAVILGDKTAVKGGSGK  157

Query  1186  vvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACE  1007
             VVDS  +D IFI+YTDHGGPG+LGMP  P+LYAND  +VL+KKH+ GTYK +V Y+EACE
Sbjct  158   VVDSGPNDHIFIFYTDHGGPGILGMPTSPYLYANDLNDVLRKKHALGTYKSLVFYLEACE  217

Query  1006  SGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSE  827
             SGS FEG++PE LNIY TTASNAEESSWGTYCPG EP+PPPEY TCLGDLYSVAWMEDS 
Sbjct  218   SGSIFEGVLPEGLNIYATTASNAEESSWGTYCPGDEPSPPPEYDTCLGDLYSVAWMEDSG  277

Query  826   SHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLP  647
              HNL  ET+++QYE VK RT+   ++  GSHVM+YG   + K + + LY G +PA  N  
Sbjct  278   VHNLQTETLQQQYELVKRRTAP-TEYSYGSHVMQYGDVGLSK-DLLDLYMGTNPANENFT  335

Query  646   GNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASID  470
                   L P   V NQRDADL+  WE+Y+   + +  K +  K++ + M HR  +D S+ 
Sbjct  336   FVDANSLKPPSRVTNQRDADLVHFWEKYRKAPEGSARKTEAHKQLLEVMSHRLHVDNSVM  395

Query  469   NLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFAN  290
              +G  LFG  +G  +L  VR  G  LVDDW CLK+MVR FE HCGSL QYGMKHMR+FAN
Sbjct  396   LVGKILFGISDGPIVLNKVRSAGKPLVDDWNCLKNMVRAFERHCGSLSQYGMKHMRSFAN  455

Query  289   ICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             ICN+ I    MEEA    C+ +    ++   + +SA
Sbjct  456   ICNAGIQMEQMEEAASQACTTIPPGPWSSLHRGFSA  491



>gb|ABK25457.1| unknown [Picea sitchensis]
Length=453

 Score =   519 bits (1337),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 273/422 (65%), Positives = 324/422 (77%), Gaps = 13/422 (3%)
 Frame = -3

Query  1549  RQPVDQKDDESPEGETQ--GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
             R   D K   S EGE +  GT+WAVL+AGS GY+NYRHQADVCHAYQILKRGGLKDENIV
Sbjct  27    RFHFDSKIRLSTEGEDENIGTQWAVLLAGSAGYSNYRHQADVCHAYQILKRGGLKDENIV  86

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIANN  NPR G+IINHP G+DVYAGVPKDYTG +VT  N +AV+LGDK+ VKGG
Sbjct  87    VFMYDDIANNPVNPRPGIIINHPEGSDVYAGVPKDYTGKEVTVDNFFAVILGDKDSVKGG  146

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVVDS  +D IFIYYTDHGGPGVLGMP+   LYA D ++VLKKKH+A TYK MVIYVE
Sbjct  147   SGKVVDSGPNDHIFIYYTDHGGPGVLGMPSGHMLYAKDLVDVLKKKHAADTYKQMVIYVE  206

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++PE +NIYVTTASNAEESSWGTYCPG +P+PP EY TCLGDLYSVAWME
Sbjct  207   ACESGSIFEGLLPEGMNIYVTTASNAEESSWGTYCPGMKPSPPLEYDTCLGDLYSVAWME  266

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDI-IKPEKVYLYQGFDPAT  659
             DSE HN M+ET+++QY+ VK RTSN+  +  GSHVM+YG  DI I  + + LY GFDPA 
Sbjct  267   DSEVHNTMKETLKQQYQVVKERTSNHQTYGMGSHVMQYG--DIPISEDPLSLYIGFDPAN  324

Query  658   IN------LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
              +      LP  Q  R      +NQRDADLL++W++YK    ++  K +  +E+ ++M H
Sbjct  325   ADAIFENRLP--QYLREKDAAAINQRDADLLYLWQKYKRSKPDSTEKLEAQQELIESMSH  382

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R  LD SI+ +G  LFG + G+ +L +VR  G  LVDDW CLK+MVR FE+HCGSL QYG
Sbjct  383   RLYLDKSINFIGKLLFGSDMGTAVLNAVRPSGQPLVDDWDCLKTMVRTFESHCGSLSQYG  442

Query  316   MK  311
             MK
Sbjct  443   MK  444



>dbj|BAA76744.1| asparaginyl endopeptidase (VmPE-1) [Vigna mungo]
Length=483

 Score =   520 bits (1338),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 267/477 (56%), Positives = 332/477 (70%), Gaps = 6/477 (1%)
 Frame = -3

Query  1600  IACQLQNLQAARWDPLIRQPVD-QKDDESPEGET--QGTRWAVLVAGSNGYANYRHQADV  1430
             +   L  L +   D ++R P +  +  ++P  +   +GTRWAVL+AGSNGY NYRHQ+DV
Sbjct  9     VVANLITLVSGGRDEILRMPSEASRFFQAPATDENDEGTRWAVLIAGSNGYWNYRHQSDV  68

Query  1429  CHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVT  1250
             CHAYQ+L +GGLK+ENIVVFMYDDIA N  NPR GVIIN P+G DVY GVPKDY G+ VT
Sbjct  69    CHAYQLLTKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVPKDYVGEDVT  128

Query  1249  AANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEV  1070
               N +A +LG+K  + GGSGKVV+S  +D IFIYY+DHGGPGVLGMP  P++YA+D IEV
Sbjct  129   VNNFFAAILGNKSALTGGSGKVVNSGPNDHIFIYYSDHGGPGVLGMPTSPYMYASDLIEV  188

Query  1069  LKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAP  890
             LKKKH++GTYK +  Y+E CESGS F G++PE LNIY TTA+NAEESSWGTYCPG  P+P
Sbjct  189   LKKKHASGTYKSLAFYLEGCESGSIFGGLLPEGLNIYATTAANAEESSWGTYCPGDNPSP  248

Query  889   PPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRD  710
             PPEY TCLGDLYSVAWMEDS+ HNL  ET+ +Q+E VK RT N N    GSHVM+YG   
Sbjct  249   PPEYETCLGDLYSVAWMEDSDIHNLRTETLHQQFELVKQRTMNGNS-AYGSHVMQYGDVG  307

Query  709   IIKPEKVYLYQGFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKA  533
             + K   V LY G +PA  N P  +   L P    VNQRDADL+  W+++      +  K+
Sbjct  308   LSK-NNVSLYLGTNPANDNFPFREKNSLVPPSKAVNQRDADLVHFWDKFPKAPLGSSRKS  366

Query  532   KLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRV  353
                K+I + M HR  +D S+  +G  LFG E G  +L SVR  G  LVDDW CLK++VR 
Sbjct  367   VAQKQILEAMSHRMHIDDSVTLIGKLLFGIEEGPELLSSVRPAGQPLVDDWDCLKTLVRT  426

Query  352   FETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             FETHCGSL QYGMKHMR+FAN+CN+ I +  M EA    C  +    ++  S  +SA
Sbjct  427   FETHCGSLSQYGMKHMRSFANLCNAGIRKEQMAEASAQACVSIPATPWSSLSSGFSA  483



>dbj|BAJ95226.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   520 bits (1339),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 260/462 (56%), Positives = 334/462 (72%), Gaps = 3/462 (1%)
 Frame = -3

Query  1561  DPLIRQPVDQKDDESPEGE-TQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDE  1385
             +P +R P  +      E + + GT+WAVLVAGSNGY NYRHQADVCHAYQI+K+GGLKDE
Sbjct  29    EPGLRLPSQRAAAGRQENDGSVGTKWAVLVAGSNGYQNYRHQADVCHAYQIIKKGGLKDE  88

Query  1384  NIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegv  1205
             NI+VFMYDDIA+N  NPR GVIINHP G DVYAGVPKDYTG +V A NL+AVLLG+K  V
Sbjct  89    NIIVFMYDDIAHNPENPRPGVIINHPQGGDVYAGVPKDYTGKEVNAKNLFAVLLGNKTAV  148

Query  1204  kggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
              GGSGKVVDS  +D IF++Y+DHGGPGV+GMP  P++Y +D ++VLKKKH+AGTYK +V 
Sbjct  149   SGGSGKVVDSGPNDHIFVFYSDHGGPGVIGMPTYPYIYGDDLVDVLKKKHAAGTYKSLVF  208

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             Y+EACE+GS FEG++P D+ +Y TTASNAEESSWG YCPG  P+PPPEY TCLGDLYS++
Sbjct  209   YLEACEAGSVFEGLLPNDIGVYATTASNAEESSWGAYCPGEYPSPPPEYDTCLGDLYSIS  268

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             WMEDS+ HNL  E+++ QY  VK RT+  + +  GSHVM+YGS D +  + ++LY G +P
Sbjct  269   WMEDSDVHNLRTESLKEQYNLVKKRTAAQDSYSYGSHVMQYGSLD-LNAQHLFLYIGSNP  327

Query  664   ATINLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
             A  N    +   L +    VNQRDADL++ W +Y+   +++  K    K++ + M HR  
Sbjct  328   ANDNATFVEENSLPSFSRAVNQRDADLVYFWHKYRKLAESSPEKNNARKQLLEMMGHRSH  387

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             +D S++ +G  LFG  +G  +LKSVR  G  LVDDW CLKS V  FE+ CGSL QYGMKH
Sbjct  388   VDNSVELIGNLLFGSADGPMVLKSVRPAGEPLVDDWNCLKSTVHTFESQCGSLAQYGMKH  447

Query  307   MRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MR+FANICN+ I    M +     C+ + T  ++   K +SA
Sbjct  448   MRSFANICNAGILPETMVKVAAQACTSIPTNPWSGTHKGFSA  489



>ref|XP_010526069.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Tarenaya 
hassleriana]
Length=498

 Score =   520 bits (1340),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 266/450 (59%), Positives = 330/450 (73%), Gaps = 7/450 (2%)
 Frame = -3

Query  1528  DDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAN  1349
             DD+S    T GTRWAVLVAGSNGY NYRHQADVCHAYQ+L++GGLK+ENIVVFMYDDIAN
Sbjct  55    DDDS----TVGTRWAVLVAGSNGYWNYRHQADVCHAYQLLRKGGLKEENIVVFMYDDIAN  110

Query  1348  NAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKA  1169
             N  NPR G+IIN P+G DVY GVPKDYTGD+V+  NL+AV+LG+K  +KGGSGKVVDS  
Sbjct  111   NEENPRPGIIINSPHGEDVYKGVPKDYTGDEVSVDNLFAVILGNKTALKGGSGKVVDSGP  170

Query  1168  DDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFE  989
             +D IFIYYTDHGGPGVLGMP  P+LY  D ++VLKKKH++GTYK +V Y+EACESGS FE
Sbjct  171   NDHIFIYYTDHGGPGVLGMPTSPYLYGKDLVDVLKKKHASGTYKSLVFYLEACESGSIFE  230

Query  988   GMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLME  809
             G++PE +NIY TTASNAEESSWGTYCPG +P+ P EY TCLGDLYSVAWMEDS+ HNL  
Sbjct  231   GLLPEGMNIYATTASNAEESSWGTYCPGEDPSTPAEYETCLGDLYSVAWMEDSDIHNLRT  290

Query  808   ETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRR  629
             E + +QYE VK RT+N  D   GSHVM+YG   + K ++++LY G +PA  N        
Sbjct  291   ENLHQQYELVKRRTANV-DSAYGSHVMQYGDIGLSK-DQLFLYMGTNPANDNFTFMDENS  348

Query  628   LT-PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHL  452
             LT P  V NQRDADL+  W++Y+   + +V K +  K++ + M HR  +D SI  +G  L
Sbjct  349   LTLPSRVTNQRDADLVHFWDKYRKAPEGSVRKVQSQKQVIEVMSHRMHVDNSIKLIGKLL  408

Query  451   FGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNI  272
             FG E G  +L  VR  G  +VDDW CLK+MVR +E HCGSL QYGMK MR+ ANICN+ +
Sbjct  409   FGIEKGPEVLDHVRPAGQPVVDDWSCLKAMVRAYEKHCGSLSQYGMKQMRSIANICNAGV  468

Query  271   SEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
                 M++A    C  + +  ++   + +SA
Sbjct  469   HVDQMDDAASQACPMVPSGPWSSLHRGFSA  498



>ref|XP_002983346.1| hypothetical protein SELMODRAFT_445464 [Selaginella moellendorffii]
 gb|EFJ15688.1| hypothetical protein SELMODRAFT_445464 [Selaginella moellendorffii]
Length=498

 Score =   520 bits (1339),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 265/445 (60%), Positives = 327/445 (73%), Gaps = 18/445 (4%)
 Frame = -3

Query  1528  DDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAN  1349
             +D+SP    +GTRWAVL+AGS GY NYRHQADVCHAYQ+L+RGG+++ENIVVFMYDDIAN
Sbjct  39    EDQSP----RGTRWAVLIAGSAGYWNYRHQADVCHAYQLLRRGGMREENIVVFMYDDIAN  94

Query  1348  NAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKA  1169
             N  NPR GV+INHPNG +VY GVP DYTGDQVT  N  AVL GDKE ++GGSGKVV+S  
Sbjct  95    NFANPRPGVMINHPNGDNVYEGVPNDYTGDQVTVNNFLAVLRGDKEALQGGSGKVVESGP  154

Query  1168  DDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFE  989
             +D IF++Y+DHGGPGVLGMP  P+LYA D +  LK  H    YK+MV+Y+EACESGS FE
Sbjct  155   NDHIFVFYSDHGGPGVLGMPVTPYLYAVDLVTTLKDMHDNNKYKEMVLYIEACESGSIFE  214

Query  988   GMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLME  809
             G++P++LNI+VTTASNA ESSWGTYCPG EP+PPPEY TC+GDLYSVAWMEDSE HNL  
Sbjct  215   GLLPKNLNIFVTTASNAVESSWGTYCPGMEPSPPPEYDTCIGDLYSVAWMEDSEVHNLDH  274

Query  808   ETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIR-  632
             E ++ QY  VK RTS+ N ++ GSHVM+YG  ++ K E++ LY GFDPA  NL     + 
Sbjct  275   ERLKDQYNTVKARTSDANTYRMGSHVMKYGDTNMDK-ERLSLYLGFDPANANLTSYSAKA  333

Query  631   -RLTPKGV-----------VNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
               L P G+           + QRDADLL  W++YK   +N++ K+K L+E  D +  R +
Sbjct  334   VELLPVGLKLFLQDKPASSIGQRDADLLHFWQKYKNSKENSLEKSKALQEFLDVIGRRTQ  393

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             +D S++ +G  L G E+ S IL SVR  G  LVD+W CLK MVRVFE  CG LGQYGMKH
Sbjct  394   IDRSVELVGSVLLGSESASQILNSVRPEGHPLVDNWDCLKEMVRVFEAKCGPLGQYGMKH  453

Query  307   MRAFANICNSNISEAAMEEACKNTC  233
             MRAFAN+CN+ +    M+ A   TC
Sbjct  454   MRAFANLCNAGVDPERMKSAAGATC  478



>emb|CDM87100.1| unnamed protein product [Triticum aestivum]
Length=478

 Score =   519 bits (1337),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 333/460 (72%), Gaps = 10/460 (2%)
 Frame = -3

Query  1558  PLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENI  1379
             P IR P D          + GTRWAVLVAGSNGY NYRHQAD+CHAYQILK+GGLKDENI
Sbjct  28    PTIRLPSDDG--------SVGTRWAVLVAGSNGYYNYRHQADICHAYQILKKGGLKDENI  79

Query  1378  VVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkg  1199
             +VFMYDDIA+N  NPR GVIINHP G DVYAGVPKDYTG +V   NL+AVLLG+K  V G
Sbjct  80    IVFMYDDIAHNLENPRPGVIINHPQGGDVYAGVPKDYTGKEVNVKNLFAVLLGNKTAVSG  139

Query  1198  gsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYV  1019
             GSGKVVDS  +D IF++Y+DHGGPGV+GMP  P++Y +D ++VLKKKH+AGTYK +V Y+
Sbjct  140   GSGKVVDSGPNDHIFVFYSDHGGPGVIGMPTYPYVYGDDLVDVLKKKHAAGTYKSLVFYL  199

Query  1018  EACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWM  839
             EACE+GS FEG++P D+ +Y TTASNAEESSWGTYCPG  P+PP EY TCLGDLYS++WM
Sbjct  200   EACEAGSVFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPSEYDTCLGDLYSISWM  259

Query  838   EDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPAT  659
             EDS+ HNL  E++++QY+ VK RT+  + +  GSHVM+YGS D +  + ++LY G +PA 
Sbjct  260   EDSDVHNLRTESLKQQYDLVKKRTAAQDSYSYGSHVMQYGSLD-LNDQHLFLYIGSNPAN  318

Query  658   INLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLD  482
              N    +   L +    VNQRDADL++ W +Y+   +++  K    K++ + M HR  +D
Sbjct  319   DNTTFVEDNSLPSFSRAVNQRDADLVYFWHKYQKLAESSPEKNDARKQLLEMMGHRSHID  378

Query  481   ASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMR  302
              S++ +G  LFG  +G  +LK++R  G  L DDW CLKS VR FE+ CGSL QYGMKHMR
Sbjct  379   NSVELIGNLLFGFADGPMVLKTIRPAGEPLADDWSCLKSTVRAFESQCGSLAQYGMKHMR  438

Query  301   AFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             +FANICN+ I   AM +     C+ + T  ++   + +SA
Sbjct  439   SFANICNAGILPEAMVKVAAQACTSIPTNPWSATHRGFSA  478



>ref|XP_004960991.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=473

 Score =   519 bits (1336),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 254/454 (56%), Positives = 322/454 (71%), Gaps = 11/454 (2%)
 Frame = -3

Query  1573  AARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGL  1394
              ARW   +R P +  D         GTRWAVL+AGSNGY NYRHQADVCHAYQI+K+GGL
Sbjct  28    GARWQDFLRLPSEGGD------AAAGTRWAVLIAGSNGYYNYRHQADVCHAYQIMKKGGL  81

Query  1393  KDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdk  1214
             KDENI+VFMYDDIA++  NPR GVIINHP+G DVYAGVPKDYTG+ VT  N  AVLLG++
Sbjct  82    KDENIIVFMYDDIASSPDNPRPGVIINHPSGGDVYAGVPKDYTGEDVTVNNFLAVLLGNR  141

Query  1213  egvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKD  1034
               V GGSGKVV S   D +F+YY+DHGGPGVLGMP+  +LYA D +  L++KH AG Y+ 
Sbjct  142   SAVSGGSGKVVASGPGDHVFVYYSDHGGPGVLGMPSGDYLYAKDLVGALERKHDAGGYRS  201

Query  1033  MVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLY  854
             +V Y+EACESGS FEG++PE +N+Y TTA+NAEESSWGTYCPG +  PPPE+ TCLGDLY
Sbjct  202   LVFYLEACESGSIFEGLLPEGINVYATTAANAEESSWGTYCPGDDQGPPPEFDTCLGDLY  261

Query  853   SVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQG  674
             SVAWMEDS+ HNL  E++++QYE VK RTS +  +  GSHVM+YG +  +  + +Y + G
Sbjct  262   SVAWMEDSDVHNLRTESLKQQYEVVKDRTSAHGTYSLGSHVMQYGDQS-LNGQSLYQFIG  320

Query  673   FDPATINLP---GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTM  503
              DPA  N      N +RR +  G VNQRDADL++ W++YK   +    KA+  K +   M
Sbjct  321   TDPANDNATFGRDNSLRRRS-SGTVNQRDADLVYFWQKYKKSAEGTPEKAEARKRLLQVM  379

Query  502   LHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQ  323
               R R+D+S++ +G  LFG + G  +L +VR  G  L DDW CLK+MV  +E  CG L Q
Sbjct  380   SRRSRVDSSMELIGSLLFGSDEGPKVLGAVRPAGQPLADDWDCLKAMVHAYEAQCGPLKQ  439

Query  322   YGMKHMRAFANICNSNISEAAMEEACKNTCSEMK  221
             YGMKHMR+FANICN+ + E AM +     C+  +
Sbjct  440   YGMKHMRSFANICNAGVGEDAMAKVASQACAAAR  473



>ref|XP_002308580.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
 gb|EEE92103.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
Length=493

 Score =   519 bits (1337),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 262/440 (60%), Positives = 322/440 (73%), Gaps = 3/440 (1%)
 Frame = -3

Query  1498  GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVI  1319
             GTRWA+L+AGSNGY NYRHQADVCHAYQ+L++GGLK+ENI+VFMYDDIA+N  NPR GVI
Sbjct  56    GTRWAILLAGSNGYWNYRHQADVCHAYQLLRQGGLKEENIIVFMYDDIADNPENPRPGVI  115

Query  1318  INHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTD  1139
             IN+P G DVY GVPKDYTG  VT  N +A +LG+K  + GGSGKV+DS  +D IFIYYTD
Sbjct  116   INNPQGEDVYKGVPKDYTGPDVTVGNFFAAILGNKTALTGGSGKVIDSGPNDHIFIYYTD  175

Query  1138  HGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIY  959
             HGGPGVLGMP  P+LYA+D I+VLKKKH++GTYK +V Y+EACESGS FEG++P+ LNIY
Sbjct  176   HGGPGVLGMPTNPYLYADDLIDVLKKKHASGTYKSLVFYLEACESGSIFEGLLPQGLNIY  235

Query  958   VTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENV  779
              TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  ET+ +QYE V
Sbjct  236   ATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDIHNLRTETLHQQYELV  295

Query  778   KLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKG-VVNQ  602
             K RTS Y++   GSHVM+YG   + K + ++ Y G +PA  N    +   L P   VVNQ
Sbjct  296   KRRTS-YDNSPYGSHVMQYGDVGLSK-DDLFQYMGTNPANDNYTFVEENSLRPHSKVVNQ  353

Query  601   RDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNIL  422
             RDADL+  W +Y+   + +  K +  K+  + M HR  +D SI  +G  LFG E  S  L
Sbjct  354   RDADLVHFWTKYRKAPEGSSRKVEAQKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASEAL  413

Query  421   KSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACK  242
              +VR  G  LVDDW CLK++VR FETHCGS+ QYGMKHMR+ AN+CN+ I +  M EA  
Sbjct  414   NTVRPAGQPLVDDWVCLKTLVRTFETHCGSISQYGMKHMRSLANLCNAGIVKEQMAEASA  473

Query  241   NTCSEMKTMKYTHPSKVYSA  182
               C    +  ++   K +SA
Sbjct  474   QACVSFPSGSWSSLHKGFSA  493



>ref|XP_010244352.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=485

 Score =   518 bits (1335),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 271/478 (57%), Positives = 340/478 (71%), Gaps = 12/478 (3%)
 Frame = -3

Query  1603  AIACQLQNLQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCH  1424
             AI  + +NL       ++R P +       E ++ GTRWAVL+AGSNGY NYRHQAD+CH
Sbjct  16    AIVAESRNLDG----DVLRLPSEFLRGGDNEDDSAGTRWAVLIAGSNGYWNYRHQADICH  71

Query  1423  AYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAA  1244
             AYQ+L+ GGLKDENI+VFMYDDIA N  NPR G+IINHP+G DVY GVPKDYTG+ V   
Sbjct  72    AYQLLRNGGLKDENIIVFMYDDIAFNEENPRPGIIINHPHGDDVYEGVPKDYTGEDVNVG  131

Query  1243  NLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLK  1064
             N +AVLLG++  + GGSGKVVDS  +D IFIYY+DHGGPGVLGMP  P+LYA+D I+VLK
Sbjct  132   NFFAVLLGNRTALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTSPYLYADDLIDVLK  191

Query  1063  KKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPG--SEPAP  890
             KK+++GTY+ +V Y+EACESGS FEG++PE LNIY TTASNA+ESSWGTYCPG  ++P P
Sbjct  192   KKYASGTYRSLVFYLEACESGSIFEGLLPEGLNIYATTASNADESSWGTYCPGEFTDP-P  250

Query  889   PPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRD  710
             PPEY TCLGDLYSVAWMEDSE HNL  E++ +QY+ VK RTS+ N    GSHVM+YG   
Sbjct  251   PPEYETCLGDLYSVAWMEDSEVHNLRTESLRQQYQLVKRRTSSGNS-AFGSHVMQYGDLR  309

Query  709   IIKPEKVYLYQGFDPATINLPGNQIRRLTPKGV--VNQRDADLLFMWERYKMKGDNAVSK  536
             +   E ++LY G +PA  N       +L P  +  VNQRDADLL  W +++   + +  K
Sbjct  310   LSSAE-LFLYMGTNPANDNYTFIDENKL-PSSIQTVNQRDADLLHFWHKFRKAPEGSPKK  367

Query  535   AKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVR  356
              K  K+  D M HR  +D S+  +G  LFG E G  +LK+VR  G  LVDDW CLK+MVR
Sbjct  368   FKAQKQFLDMMSHRMHIDHSMMLIGKLLFGYEKGPEVLKTVRPAGQPLVDDWDCLKTMVR  427

Query  355   VFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              FETHCGSL QYGMKHMR+ ANICN+ +++  M  A    C+ +    ++  SK +SA
Sbjct  428   AFETHCGSLSQYGMKHMRSLANICNAGVTKEMMAGASSQACTSIPINSWSSLSKGFSA  485



>ref|XP_003525979.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
 gb|KHN32223.1| Vacuolar-processing enzyme [Glycine soja]
Length=484

 Score =   518 bits (1335),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 271/478 (57%), Positives = 333/478 (70%), Gaps = 8/478 (2%)
 Frame = -3

Query  1600  IACQLQNLQAARWDPLIRQPVDQ----KDDESPEGETQGTRWAVLVAGSNGYANYRHQAD  1433
             +A  +     AR D ++R P +     K   + +   +GTRWAVLVAGSNGY NYRHQ+D
Sbjct  10    VATLITLASGARHD-ILRLPSEASRFFKAPANADQNDEGTRWAVLVAGSNGYWNYRHQSD  68

Query  1432  VCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQV  1253
             VCHAYQ+L++GG+K+ENIVVFMYDDIA N  NPR GVIIN P+G DVY GVPKDY G+ V
Sbjct  69    VCHAYQLLRKGGVKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVPKDYVGEDV  128

Query  1252  TAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIE  1073
             T  N +A +LG+K  + GGSGKVVDS  +D IFIYY+DHGGPGVLGMP  P++YA+D IE
Sbjct  129   TVDNFFAAILGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTNPYMYASDLIE  188

Query  1072  VLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPA  893
             VLKKKH++GTYK +V Y+EACESGS FEG++PE LNIY TTASNAEESSWGTYCPG  P+
Sbjct  189   VLKKKHASGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPS  248

Query  892   PPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSR  713
             PPPEY TCLGDLYSVAWMEDS+ HNL  ET+ +QY+ VK RT N N    GSHVM+YG  
Sbjct  249   PPPEYETCLGDLYSVAWMEDSDIHNLRTETLHQQYDLVKERTMNGNSIY-GSHVMQYGDI  307

Query  712   DIIKPEKVYLYQGFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSK  536
              + K   + LY G +PA  N        L P    VNQRDADL+  W++++     +  K
Sbjct  308   GLSK-NNLVLYLGTNPANDNFTFVHKNSLVPPSKAVNQRDADLIHFWDKFRKAPVGSSRK  366

Query  535   AKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVR  356
             A   KEI + M HR  +D ++  +G  LFG E G  +L SVR  G  LVDDW CLK++VR
Sbjct  367   AAAEKEILEAMSHRMHIDDNMKLIGKLLFGIEKGPELLSSVRPAGQPLVDDWDCLKTLVR  426

Query  355   VFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              FETHCGSL QYGMKHMR+FAN CN+ I +  M EA    C  +    ++   + +SA
Sbjct  427   TFETHCGSLSQYGMKHMRSFANFCNAGIRKEQMAEASAQACVSIPASSWSSLHRGFSA  484



>gb|KHN29737.1| Vacuolar-processing enzyme [Glycine soja]
Length=483

 Score =   518 bits (1334),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 272/478 (57%), Positives = 335/478 (70%), Gaps = 9/478 (2%)
 Frame = -3

Query  1600  IACQLQNLQAARWDPLIRQPVDQKDD-ESPEGET--QGTRWAVLVAGSNGYANYRHQADV  1430
             +A  +     AR D ++R P +     ++P G+   +GTRWAVL+AGSNGY NYRHQ+DV
Sbjct  10    LATLITLASGARHD-ILRLPSEASTFFKAPGGDQNDEGTRWAVLIAGSNGYWNYRHQSDV  68

Query  1429  CHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVT  1250
             CHAYQ+L++GGLK+ENIVVFMYDDIA N  NPR GVIIN P+G DVY GVPKDY G+ VT
Sbjct  69    CHAYQLLRKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVPKDYIGEDVT  128

Query  1249  AANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEV  1070
               N +A +LG+K  + GGSGKVVDS  +D IFIYY+DHGGPGVLGMP  P++YA+D IEV
Sbjct  129   VGNFFAAILGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTNPYMYASDLIEV  188

Query  1069  LKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAP  890
             LKKKH++G+YK +V Y+EACESGS FEG++PE LNIY TTASNAEESSWGTYCPG  P+P
Sbjct  189   LKKKHASGSYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSP  248

Query  889   PPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRD  710
             P EY TCLGDLYSVAWMEDS+ HNL  ET+ +QYE VK RT N N    GSHVM+YG  D
Sbjct  249   PSEYETCLGDLYSVAWMEDSDIHNLQTETLHQQYELVKQRTMNGNSIY-GSHVMQYG--D  305

Query  709   I-IKPEKVYLYQGFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSK  536
             I +    + LY G +PA  N        L P    VNQRDADL+  W++++     +  K
Sbjct  306   IGLSENNLVLYLGTNPANDNFTFVHKNSLVPPSKAVNQRDADLIHFWDKFRKAPVGSSRK  365

Query  535   AKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVR  356
             A   K+I + M HR  +D S+  +G  LFG E G  +L SVR  G  LVDDW CLK++VR
Sbjct  366   AAAEKQILEAMSHRMHIDDSMKRIGKLLFGIEKGPELLSSVRPAGQPLVDDWDCLKTLVR  425

Query  355   VFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              FETHCGSL QYGMKHMR+FAN CN+ I +  M EA    C  +    ++   + +SA
Sbjct  426   TFETHCGSLSQYGMKHMRSFANFCNAGIRKEQMAEASAQACVNIPASSWSSMHRGFSA  483



>gb|EPS65165.1| vacuolar processing enzyme-1b, partial [Genlisea aurea]
Length=478

 Score =   518 bits (1333),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 264/435 (61%), Positives = 327/435 (75%), Gaps = 6/435 (1%)
 Frame = -3

Query  1513  EGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNP  1334
             E ++ GTRWAVLVAGS+GY NYRHQADVCHAYQILKRGGLKDENI+VFMYDDIA N  NP
Sbjct  34    EDDSVGTRWAVLVAGSSGYWNYRHQADVCHAYQILKRGGLKDENIIVFMYDDIAQNLENP  93

Query  1333  RKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIF  1154
             R G++IN+P+G DVY GVPKDY G QVTA N Y+VLLGDK G+ GGSGKV++S  +D IF
Sbjct  94    RPGIVINNPHGEDVYHGVPKDYVGRQVTAHNFYSVLLGDKAGLTGGSGKVIESGPNDHIF  153

Query  1153  IYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPE  974
             IYYTDHGGPGVLGMP+ P++YA+D  +VLKKKH++GTYK +V Y+EACESGS FEG++P+
Sbjct  154   IYYTDHGGPGVLGMPSGPYIYADDLNDVLKKKHASGTYKSLVFYLEACESGSIFEGILPD  213

Query  973   DLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIER  794
             +LNIY TTASNAEESSWGTYCPG   APP EY TCLGDLYS+AWMEDS+ HNL  E++E+
Sbjct  214   NLNIYATTASNAEESSWGTYCPGDIIAPPLEYDTCLGDLYSIAWMEDSDIHNLRTESLEQ  273

Query  793   QYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLT  623
             QY+ VK RT+N  D   GSHVM+YG    +  E ++LY G DPA  N   + GN +   +
Sbjct  274   QYQVVKKRTAN-GDSYYGSHVMQYGELK-LDLENLFLYLGTDPANDNYTFVEGNSL-STS  330

Query  622   PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGP  443
             P G VNQRDADLL  W ++    + +  K +  + + + + HR  +D SI+ +G  LFG 
Sbjct  331   PSGRVNQRDADLLHFWHKFWKAPERSSEKDEAQRRLAEVVSHRSHIDDSIELIGDLLFGS  390

Query  442   ENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEA  263
               G+ +LK VR  G  +VDDW CL+S+VR FET+CGSL QYGMKHMR+FANICNS +   
Sbjct  391   TEGTRVLKHVRPSGRPVVDDWDCLRSLVRTFETYCGSLSQYGMKHMRSFANICNSGVKAE  450

Query  262   AMEEACKNTCSEMKT  218
              M EA +  C+   +
Sbjct  451   KMGEATQQVCTAFPS  465



>ref|XP_006412409.1| hypothetical protein EUTSA_v10025034mg [Eutrema salsugineum]
 gb|ESQ53862.1| hypothetical protein EUTSA_v10025034mg [Eutrema salsugineum]
Length=488

 Score =   517 bits (1332),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 265/459 (58%), Positives = 328/459 (71%), Gaps = 8/459 (2%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
             +  +P D  +D S      GTRWAVLVAGSNGY NYRHQAD+CHAYQ+L++GG+K++NIV
Sbjct  37    MFFRPADDDNDSS-----AGTRWAVLVAGSNGYWNYRHQADICHAYQLLRKGGVKEDNIV  91

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIANN  NPR+G+IIN P+G DVY GVPKDYTGD VT  NL+AV+LG+K   KGG
Sbjct  92    VFMYDDIANNEENPRRGIIINSPHGKDVYQGVPKDYTGDDVTVDNLFAVILGNKTATKGG  151

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVVDS  +D IFI+Y+DHGGPGVLGMP  P+LYAND  +VLKKKH++GTYK +V Y+E
Sbjct  152   SGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHASGTYKSLVFYLE  211

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++ E LNIY TTASNA ESSWGTYCPG +P+ PPEY TCLGDLYSV+WME
Sbjct  212   ACESGSIFEGLLEEGLNIYATTASNAVESSWGTYCPGEDPSLPPEYETCLGDLYSVSWME  271

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATI  656
             DS  HNL  ET+ +QYE VK RT+       GSHVM+YG   + K +K+ LY G +PA  
Sbjct  272   DSGMHNLQTETLRQQYELVKRRTAGVGS-AYGSHVMQYGDVGLSK-DKLDLYMGTNPAND  329

Query  655   NLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDA  479
             N        LTP   V NQRDADL+  W++Y+   + +  K +  K++ + M HR  +D 
Sbjct  330   NFTFVDENSLTPPSRVTNQRDADLVHFWDKYRKAPEGSTRKTEAQKQVLEAMSHRLHVDN  389

Query  478   SIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRA  299
             S+  +G  LFG   G  +L  VR  G  LVDDW CLK++VR FE HCGSL QYG+KHMR+
Sbjct  390   SVKLVGKLLFGISEGPEVLNKVRSAGQPLVDDWNCLKNLVRAFERHCGSLSQYGIKHMRS  449

Query  298   FANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             FANICN+ I    MEEA    C+ +    ++   + +SA
Sbjct  450   FANICNAGIQMEQMEEASSQACTTIPPGPWSSLHRGFSA  488



>ref|XP_006578073.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
Length=483

 Score =   516 bits (1330),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 271/478 (57%), Positives = 334/478 (70%), Gaps = 9/478 (2%)
 Frame = -3

Query  1600  IACQLQNLQAARWDPLIRQPVDQKDD-ESPEGET--QGTRWAVLVAGSNGYANYRHQADV  1430
             +A  +     AR D ++R P +     ++P G+   +GTRWAVL+AGSNGY NYRHQ+DV
Sbjct  10    LATLITLASGARHD-ILRLPSEASTFFKAPGGDQNDEGTRWAVLIAGSNGYWNYRHQSDV  68

Query  1429  CHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVT  1250
             CHAYQ+L++GGLK+ENIVVFMYDDIA N  NPR GVIIN P+G DVY GVPKDY G+ VT
Sbjct  69    CHAYQLLRKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVPKDYIGEDVT  128

Query  1249  AANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEV  1070
               N +A +LG+K  + GGSGKVVDS  +D IFIYY+DHGGPGVLGMP  P++YA+D IEV
Sbjct  129   VGNFFAAILGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTNPYMYASDLIEV  188

Query  1069  LKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAP  890
             LKKKH++G+YK +V Y+EACESGS FEG++PE LNIY TTASNAEESSWGTYCPG  P+P
Sbjct  189   LKKKHASGSYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSP  248

Query  889   PPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRD  710
             P EY TCLGDLYSVAWMEDS+ HNL  ET+ +QYE VK RT N N    GSHVM+YG  D
Sbjct  249   PSEYETCLGDLYSVAWMEDSDIHNLQTETLHQQYELVKQRTMNGNSIY-GSHVMQYG--D  305

Query  709   I-IKPEKVYLYQGFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSK  536
             I +    + LY G +PA  N        L P    VNQRDADL+  W++++     +  K
Sbjct  306   IGLSENNLVLYLGTNPANDNFTFVLKNSLVPPSKAVNQRDADLIHFWDKFRKAPVGSSRK  365

Query  535   AKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVR  356
             A   K+I + M HR  +D S+  +G   FG E G  +L SVR  G  LVDDW CLK++VR
Sbjct  366   AAAEKQILEAMSHRMHIDDSMKRIGKLFFGIEKGPELLSSVRPAGQPLVDDWDCLKTLVR  425

Query  355   VFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              FETHCGSL QYGMKHMR+FAN CN+ I +  M EA    C  +    ++   + +SA
Sbjct  426   TFETHCGSLSQYGMKHMRSFANFCNAGIRKEQMAEASAQACVNIPASSWSSMHRGFSA  483



>dbj|BAC86022.1| unnamed protein product [Homo sapiens]
Length=483

 Score =   516 bits (1329),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 271/478 (57%), Positives = 334/478 (70%), Gaps = 9/478 (2%)
 Frame = -3

Query  1600  IACQLQNLQAARWDPLIRQPVDQKDD-ESPEGET--QGTRWAVLVAGSNGYANYRHQADV  1430
             +A  +     AR D ++R P +     ++P G+   +GTRWAVL+AGSNGY NYRHQ+DV
Sbjct  10    LATLITLASGARHD-ILRLPSEASTFFKAPGGDQNDEGTRWAVLIAGSNGYWNYRHQSDV  68

Query  1429  CHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVT  1250
             CHAYQ+L++GGLK+ENIVVFMYDDIA N  NPR GVIIN P+G DVY GVPKDY G+ VT
Sbjct  69    CHAYQLLRKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVPKDYIGEDVT  128

Query  1249  AANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEV  1070
               N +A +LG+K  + GGSGKVVDS  +D IFIYY+DHGGPGVLGMP  P++YA+D IEV
Sbjct  129   VGNFFAAILGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTNPYVYASDLIEV  188

Query  1069  LKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAP  890
             LKKKH++G+YK +V Y+EACESGS FEG++PE LNIY TTASNAEESSWGTYCPG  P+P
Sbjct  189   LKKKHASGSYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSP  248

Query  889   PPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRD  710
             P EY TCLGDLYSVAWMEDS+ HNL  ET+ +QYE VK RT N N    GSHVM+YG  D
Sbjct  249   PSEYETCLGDLYSVAWMEDSDIHNLQTETLHQQYELVKQRTMNGNSIY-GSHVMQYG--D  305

Query  709   I-IKPEKVYLYQGFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSK  536
             I +    + LY G +PA  N        L P    VNQRDADL+  W++++     +  K
Sbjct  306   IGLSENNLVLYLGTNPANDNFTFVLKNSLVPPSKAVNQRDADLIHFWDKFRKAPVGSSRK  365

Query  535   AKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVR  356
             A   K+I + M HR  +D S+  +G   FG E G  +L SVR  G  LVDDW CLK++VR
Sbjct  366   AAAEKQILEAMSHRMHIDDSMKRIGKLFFGIEKGPELLSSVRPAGQPLVDDWDCLKTLVR  425

Query  355   VFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              FETHCGSL QYGMKHMR+FAN CN+ I +  M EA    C  +    ++   + +SA
Sbjct  426   TFETHCGSLSQYGMKHMRSFANFCNAGIRKEQMAEASAQACVNIPASSWSSMHRGFSA  483



>ref|XP_007160985.1| hypothetical protein PHAVU_001G033500g [Phaseolus vulgaris]
 gb|ESW32979.1| hypothetical protein PHAVU_001G033500g [Phaseolus vulgaris]
Length=484

 Score =   516 bits (1329),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 332/459 (72%), Gaps = 7/459 (2%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
              +R P D  + ++      GTRWA+L AGS+GY NYRHQAD+CHAYQ+L++GGLKDENI+
Sbjct  32    FLRLPSDSGNGDN----VHGTRWAILFAGSSGYWNYRHQADICHAYQLLRKGGLKDENII  87

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA N+ NPR+GVIIN PNG DVY GVPKDYTG+ VTA N YA LLGDK  + GG
Sbjct  88    VFMYDDIAFNSENPRRGVIINSPNGDDVYKGVPKDYTGEDVTAHNFYAALLGDKSKLTGG  147

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVV+S  +D IFI+Y+DHGGPGVLG P  P++YA+D  EVLKKKH++GTYK++V Y+E
Sbjct  148   SGKVVNSGPNDHIFIFYSDHGGPGVLGSPAGPYIYASDLNEVLKKKHASGTYKNLVFYLE  207

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++PED+N+Y TTASNA+ESSWGTYCPG +P+PPPEY TCLGDLYSVAWME
Sbjct  208   ACESGSIFEGLLPEDINVYATTASNADESSWGTYCPGEDPSPPPEYSTCLGDLYSVAWME  267

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATI  656
             DS+ HNL  ET+ +QY+ VK RT +      GSHVM+YG   + K + ++ Y G DPA  
Sbjct  268   DSDRHNLRTETLHQQYKLVKERTIS-GGLYYGSHVMQYGDVGLSK-DILFHYLGTDPANE  325

Query  655   NLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDA  479
             NL       L +    VNQRDADL+  W++++   + +  K +  K++ + M HR  +D 
Sbjct  326   NLTFVDENSLWSSSKAVNQRDADLVHFWDKFRKAPEGSPKKNEARKQVLEVMSHRMHIDD  385

Query  478   SIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRA  299
             S++ +G  LFG E    +L +VR  G ALVDDW CLK+MVR FETHCGSL QYGMKHMR+
Sbjct  386   SVELVGKLLFGIEKAPELLNAVRPAGSALVDDWDCLKTMVRTFETHCGSLSQYGMKHMRS  445

Query  298   FANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             FAN+CN  I +  M EA    C  +    ++   + +SA
Sbjct  446   FANMCNVGIKKEQMREASAQACVTIPANPWSSLQRGFSA  484



>dbj|BAJ33795.1| unnamed protein product [Thellungiella halophila]
Length=478

 Score =   515 bits (1327),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 263/445 (59%), Positives = 322/445 (72%), Gaps = 8/445 (2%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
             +  +P D  +D S      GTRWAVLVAGSNGY NYRHQAD+CHAYQ+L++GG+K++NIV
Sbjct  37    MFFRPADDDNDSS-----AGTRWAVLVAGSNGYWNYRHQADICHAYQLLRKGGVKEDNIV  91

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIANN  NPR+G+IIN P+G DVY GVPKDYTGD VT  NL+AV+LG+K   KGG
Sbjct  92    VFMYDDIANNEENPRRGIIINSPHGKDVYQGVPKDYTGDDVTVDNLFAVILGNKTATKGG  151

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVVDS  +D IFI+Y+DHGGPGVLGMP  P+LYAND  +VLKKKH++GTYK +V Y+E
Sbjct  152   SGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHASGTYKSLVFYLE  211

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++ E LNIY TTASNA ESSWGTYCPG +P+ PPEY TCLGDLYSV+WME
Sbjct  212   ACESGSIFEGLLEEGLNIYATTASNAVESSWGTYCPGEDPSLPPEYETCLGDLYSVSWME  271

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATI  656
             DS  HNL  ET+ +QYE VK RT+       GSHVM+YG   + K +K+ LY G +PA  
Sbjct  272   DSGMHNLQTETLRQQYELVKRRTAGVGS-AYGSHVMQYGDVGLSK-DKLDLYMGTNPAND  329

Query  655   NLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDA  479
             N        LTP   V NQRDADL+  W++Y+   + +  K +  K++ + M HR  +D 
Sbjct  330   NFTFVDENSLTPPSRVTNQRDADLVHFWDKYRKAPEGSTRKTEAQKQVLEAMSHRLHVDN  389

Query  478   SIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRA  299
             S+  +G  LFG   G  +L  VR  G  LVDDW CLK++VR FE HCGSL QYG+KHMR+
Sbjct  390   SVKLVGKLLFGISEGPEVLNKVRSAGQPLVDDWNCLKNLVRAFERHCGSLSQYGIKHMRS  449

Query  298   FANICNSNISEAAMEEACKNTCSEM  224
             FANICN+ I    MEEA    C+ +
Sbjct  450   FANICNAGIQMEQMEEASSQACTTI  474



>ref|XP_004501477.1| PREDICTED: vacuolar-processing enzyme-like [Cicer arietinum]
Length=488

 Score =   515 bits (1327),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 262/442 (59%), Positives = 319/442 (72%), Gaps = 5/442 (1%)
 Frame = -3

Query  1501  QGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGV  1322
             +GTRWA+L+AGSNGY NYRHQ+DVCHAYQ+L++GGLK+ENIVVFMYDDIA N  NPR GV
Sbjct  50    EGTRWAILIAGSNGYWNYRHQSDVCHAYQVLRKGGLKEENIVVFMYDDIAFNEENPRPGV  109

Query  1321  IINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYT  1142
             IIN P+G DVY GVPKDYTG+ V   N +A LLG+K  + GGSGKVVDS  +D IFIYY+
Sbjct  110   IINSPHGDDVYKGVPKDYTGEDVNVDNFFAALLGNKSALTGGSGKVVDSGPNDHIFIYYS  169

Query  1141  DHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNI  962
             DHGGPGVLGMP  P++YA+D IEVLKKKH++GTYK +V Y+EACESGS FEG++PE LNI
Sbjct  170   DHGGPGVLGMPTSPYMYASDLIEVLKKKHASGTYKSLVFYLEACESGSIFEGLLPEGLNI  229

Query  961   YVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYEN  782
             Y TTA+NA+ESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL  ET+ +QYE 
Sbjct  230   YATTAANADESSWGTYCPGEFPSPPPEYETCLGDLYSVAWMEDSDMHNLQSETLHQQYEL  289

Query  781   VKLRTSNYNDFQAGSHVMEYGSRDI-IKPEKVYLYQGFDPATINLPGNQIRRLTPKG-VV  608
             VK RT N N    GSHVM+YG  DI +    ++LY G +PA  N        L P    V
Sbjct  290   VKERTKNGNTLY-GSHVMQYG--DIGLSENSLFLYLGTNPANENFTFVGRNSLVPPSKAV  346

Query  607   NQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSN  428
             NQRDADL+  W++++     +  KA   K++ + M HR  +D SI  +G  LFG E G  
Sbjct  347   NQRDADLVHFWDKFRKAPQGSPRKAAAEKQVLEAMSHRMHIDDSIKLVGKLLFGMEKGPE  406

Query  427   ILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEA  248
             +L SVR  G  L DDW CLK++VR FET+CGSL QYGMKHMR+FAN CN+ I +  M EA
Sbjct  407   VLTSVRPAGQPLADDWNCLKTLVRTFETYCGSLSQYGMKHMRSFANFCNAGIHKEQMAEA  466

Query  247   CKNTCSEMKTMKYTHPSKVYSA  182
                 C  +    ++     +SA
Sbjct  467   SAQACVNVPANPWSSLRSGFSA  488



>gb|EYU20379.1| hypothetical protein MIMGU_mgv1a005412mg [Erythranthe guttata]
Length=484

 Score =   515 bits (1326),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 330/459 (72%), Gaps = 5/459 (1%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
              I+ P D       + ++ GTRWAVL+AGS+GY NYRHQAD+CHAYQIL++GGLKDENI+
Sbjct  30    FIKLPSDGT--AGADDDSVGTRWAVLLAGSSGYWNYRHQADICHAYQILRKGGLKDENII  87

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA N  NPR GV+IN P+G DVY GVPKDY G+ VT  N YA LLG+K  + GG
Sbjct  88    VFMYDDIAYNIENPRPGVLINSPHGEDVYKGVPKDYIGNDVTPNNFYAALLGNKTALTGG  147

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVVDS  +D IF++Y+DHGGPGVLGMP   ++YAND IEVL KKH++GTYK +V Y+E
Sbjct  148   SGKVVDSGPNDHIFVFYSDHGGPGVLGMPTSHYIYANDLIEVLIKKHASGTYKKLVFYLE  207

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACE+GS FEG++P+ LNIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYS+AWME
Sbjct  208   ACEAGSIFEGLLPKGLNIYATTASNAEESSWGTYCPGDYPSPPPEYETCLGDLYSIAWME  267

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATI  656
             DS+ HNL  ET+ +QYE VK RT+N N +  GSHVM+YG    +  E ++ Y G DPA  
Sbjct  268   DSDIHNLRTETLSQQYELVKKRTANENSYY-GSHVMQYGDVK-LNAESLFTYLGTDPAND  325

Query  655   NLPG-NQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDA  479
             NL   ++   L     VNQRDADLL  W +++   + +  K    K++++ M HR  +D+
Sbjct  326   NLTFVDENSPLPSSKPVNQRDADLLHFWHKFRRAPEGSDRKFAAQKQLSEAMAHRTHVDS  385

Query  478   SIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRA  299
             SI  +G  LFG + G  +LK++R  G  LVDDW CLKS+VR FETHCGSL QYGMKHMR+
Sbjct  386   SIKLIGKLLFGIDKGPQMLKAMRPSGQPLVDDWDCLKSLVRTFETHCGSLSQYGMKHMRS  445

Query  298   FANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              ANICN+ ++   M EA    C+   +  ++   + +SA
Sbjct  446   IANICNAGVTREQMAEASGQACTSFPSNSWSSLHRGFSA  484



>ref|XP_007136809.1| hypothetical protein PHAVU_009G076100g [Phaseolus vulgaris]
 gb|ESW08803.1| hypothetical protein PHAVU_009G076100g [Phaseolus vulgaris]
Length=483

 Score =   515 bits (1326),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 265/477 (56%), Positives = 334/477 (70%), Gaps = 6/477 (1%)
 Frame = -3

Query  1600  IACQLQNLQAARWDPLIRQPVD-QKDDESPEGET--QGTRWAVLVAGSNGYANYRHQADV  1430
             +   L  L +   D ++R P +  +  ++P  +   +GTRWA+L+AGSNGY NYRHQ+DV
Sbjct  9     LLATLITLVSGGRDEILRLPSEASRFFQAPAADQNQEGTRWALLIAGSNGYWNYRHQSDV  68

Query  1429  CHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVT  1250
             CHAYQ+L++GGLK+ENIVVFMYDDIA N  NPR GVIIN P+G DVY GVPKDY G+ VT
Sbjct  69    CHAYQLLRKGGLKEENIVVFMYDDIAFNEENPRPGVIINSPHGNDVYKGVPKDYVGEDVT  128

Query  1249  AANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEV  1070
               N +A +LG+K  + GGSGKV+DS  +D IFIYY+DHGGPGVLGMP  P++YA+D IEV
Sbjct  129   VNNFFAAILGNKSALTGGSGKVIDSGPNDHIFIYYSDHGGPGVLGMPTSPYMYASDLIEV  188

Query  1069  LKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAP  890
             LKKKH++ TYK +V Y+EACESGS FEG++PE +NIY TTA+NAEESSWGTYCPG  P+P
Sbjct  189   LKKKHASETYKSLVFYLEACESGSIFEGLLPEGMNIYATTAANAEESSWGTYCPGEYPSP  248

Query  889   PPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRD  710
             PPEY TCLGDLYSVAWMEDS+ HNL  ET+ +Q+E VK RT N N    GSHVM+YG   
Sbjct  249   PPEYETCLGDLYSVAWMEDSDIHNLQTETLHQQFELVKQRTINGNS-AYGSHVMQYGDIG  307

Query  709   IIKPEKVYLYQGFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKA  533
             + K   + LY G +PA  N    +   L P    VNQRDADL+ +W++Y+     +  K+
Sbjct  308   LSK-NNLSLYLGTNPANDNFAFREKNSLVPPSKAVNQRDADLVHLWDKYRKAPVGSSRKS  366

Query  532   KLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRV  353
                K+I + M HR  +D S+  +G  LFG E G  +L SVR  G  LVDDW CLK++VR 
Sbjct  367   VAQKQILEAMSHRMHIDDSMKLIGKLLFGIEEGPKLLNSVRPAGQPLVDDWDCLKTLVRT  426

Query  352   FETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             FETHCGSL QYGMKHMR+FAN CN+ I +  M EA    C  +    ++     +SA
Sbjct  427   FETHCGSLSQYGMKHMRSFANFCNAGIGKEQMAEASAQACVSIPATPWSSLRSGFSA  483



>ref|XP_003603121.1| Vacuolar processing enzyme [Medicago truncatula]
 gb|AES73372.1| vacuolar processing enzyme [Medicago truncatula]
Length=484

 Score =   515 bits (1326),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 264/453 (58%), Positives = 321/453 (71%), Gaps = 12/453 (3%)
 Frame = -3

Query  1573  AARWDPLIRQPVD-----QKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQIL  1409
             A   D  +R P       Q DD++ EG    T+WA+L+AGSNGY NYRHQ+DVCHAYQ+L
Sbjct  21    ATAGDDFLRLPSQASRFFQSDDDNNEG----TKWAILIAGSNGYWNYRHQSDVCHAYQVL  76

Query  1408  KRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAV  1229
             ++GGLK+ENI+VFMYDDIA+N  NPR GVIIN P+G DVY GVPKDYTGD V   N +A 
Sbjct  77    RKGGLKEENIIVFMYDDIADNQENPRPGVIINSPHGDDVYKGVPKDYTGDDVNVNNFFAA  136

Query  1228  LLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSA  1049
             LLG+K  + GGSGKVVDS  +D IFIYY+DHGGPGVLGMP  P +YA D IEVLKKKH++
Sbjct  137   LLGNKSALTGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTGPFMYATDLIEVLKKKHAS  196

Query  1048  GTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITC  869
              TYK +V Y+EACESGS FEG++PE LNIY TTA+NAEESSWGTYCPG  P+PPPEY TC
Sbjct  197   ETYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGENPSPPPEYETC  256

Query  868   LGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKV  689
             LGDLYSVAWMEDS+ HNL  ET+ +QYE VK RTSN N    GSHVM++G   + + + +
Sbjct  257   LGDLYSVAWMEDSDIHNLQTETLHQQYELVKERTSNGNSIY-GSHVMQFGDIGLSR-DSL  314

Query  688   YLYQGFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEIT  512
             +LY G +PA  N        L P    VNQRDADL+  W++++     +  K    K++ 
Sbjct  315   FLYLGSNPANENFTFMGRNSLVPPSKTVNQRDADLIHFWDKFRKAPQGSPRKVAAQKQVL  374

Query  511   DTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGS  332
             + M HR  +D SI  +G  LFG + G  +L SVR  G  +VDDW CLKS+VR FET+CGS
Sbjct  375   EAMSHRMHIDESIKLVGKLLFGMKKGPEVLASVRPAGQPVVDDWDCLKSLVRTFETYCGS  434

Query  331   LGQYGMKHMRAFANICNSNISEAAMEEACKNTC  233
             L QYGMKHMR+FAN CN+ I    M EA    C
Sbjct  435   LSQYGMKHMRSFANFCNAGIHSEQMAEASAQAC  467



>ref|XP_006355320.1| PREDICTED: vacuolar-processing enzyme [Solanum tuberosum]
Length=482

 Score =   514 bits (1325),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 262/447 (59%), Positives = 323/447 (72%), Gaps = 2/447 (0%)
 Frame = -3

Query  1522  ESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNA  1343
             ++ E ++ GTRWA+L+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDDIANN 
Sbjct  38    DADENDSVGTRWAILLAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIANNE  97

Query  1342  FNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADD  1163
              NPR+GVIIN P+G DVY GVPKDYTGD VT  N  A LLG+K  + GGSGKVVDS  +D
Sbjct  98    ENPRQGVIINSPHGEDVYKGVPKDYTGDDVTVNNFLAALLGNKTAITGGSGKVVDSGPND  157

Query  1162  RIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGM  983
              IFI+Y+DHGG GV+GMP  P+LYAND I+ LKKKH++GTYK +V Y+EACESGS FEG+
Sbjct  158   HIFIFYSDHGGAGVIGMPTDPYLYANDLIDALKKKHASGTYKSLVFYLEACESGSMFEGL  217

Query  982   MPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEET  803
             +PE LNIY TTASNA+ESSWGTYCPG  P+PP EY TCLGDLYS++WMEDSE HNL  ET
Sbjct  218   LPEGLNIYATTASNADESSWGTYCPGEFPSPPIEYGTCLGDLYSISWMEDSERHNLRTET  277

Query  802   IERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLT  623
             +++QY  VK RT++ N    GSHVM+YG   + K + ++LY G DPA  N        + 
Sbjct  278   LKQQYHLVKERTASGNP-AYGSHVMQYGDVHLSK-DVLFLYMGTDPANDNSTFMDDNSMR  335

Query  622   PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGP  443
                 VNQRDADL+  W ++    + +V K +  K++ + + HR  LD SI  +G  LFG 
Sbjct  336   VSKAVNQRDADLVHFWYKFHKAPEGSVRKTEAQKQLNEAISHRMHLDNSIALVGKLLFGI  395

Query  442   ENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEA  263
             + G  +L SVR  G  LVDDW CLKS VR FETHCGSL QYGMKHMR+ ANICN+ I   
Sbjct  396   KKGPEVLTSVRPAGQPLVDDWDCLKSYVRTFETHCGSLSQYGMKHMRSVANICNAGIKME  455

Query  262   AMEEACKNTCSEMKTMKYTHPSKVYSA  182
              M EA    C  + +  ++   + +SA
Sbjct  456   QMVEASAQACPSVPSNTWSSLQRGFSA  482



>sp|O24325.1|VPE1_PHAVU RecName: Full=Vacuolar-processing enzyme; Short=VPE; AltName: 
Full=Legumain-like proteinase; Short=LLP; Flags: Precursor 
[Phaseolus vulgaris]
 emb|CAB17078.1| asparagine-specific endopeptidase precursor [Phaseolus vulgaris]
Length=484

 Score =   514 bits (1324),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 260/459 (57%), Positives = 332/459 (72%), Gaps = 7/459 (2%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
              +R P D  + ++      GTRWA+L AGS+GY NYRHQAD+CHAYQ+L++GGLKDENI+
Sbjct  32    FLRLPSDSGNGDN----VHGTRWAILFAGSSGYWNYRHQADICHAYQLLRKGGLKDENII  87

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA N+ NPR+GVIIN PNG +VY GVPKDYTG+ VTA N YA LLGDK  + GG
Sbjct  88    VFMYDDIAFNSENPRRGVIINSPNGDEVYKGVPKDYTGEDVTAHNFYAALLGDKSKLTGG  147

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVV+S  +D IFI+Y+DHGGPGVLG P  P++YA+D  EVLKKKH++GTYK++V Y+E
Sbjct  148   SGKVVNSGPNDHIFIFYSDHGGPGVLGSPAGPYIYASDLNEVLKKKHASGTYKNLVFYLE  207

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++PED+N+Y TTASNA+ESSWGTYCPG +P+PPPEY TCLGDLYSVAWME
Sbjct  208   ACESGSIFEGLLPEDINVYATTASNADESSWGTYCPGEDPSPPPEYSTCLGDLYSVAWME  267

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATI  656
             DS+ HNL  ET+ +QY+ VK RT +      GSHVM+YG   + K + ++ Y G DPA  
Sbjct  268   DSDRHNLRTETLHQQYKLVKERTIS-GGLYYGSHVMQYGDVGLSK-DILFHYLGTDPANE  325

Query  655   NLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDA  479
             NL       L +    VNQRDADL+  W++++   + +  K +  K++ + M HR  +D 
Sbjct  326   NLTFVDENSLWSSSKAVNQRDADLVHFWDKFRKAPEGSPKKNEARKQVLEVMSHRMHIDD  385

Query  478   SIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRA  299
             S++ +G  LFG E    +L +VR  G ALVDDW CLK+MVR FETHCGSL QYGMKHMR+
Sbjct  386   SVELVGKLLFGIEKAPELLNAVRPAGSALVDDWDCLKTMVRTFETHCGSLSQYGMKHMRS  445

Query  298   FANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             FAN+CN  I +  M EA    C  +    ++   + +SA
Sbjct  446   FANMCNVGIKKEQMREASAQACVTIPANPWSSLQRGFSA  484



>gb|EMT00724.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=477

 Score =   514 bits (1323),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 264/442 (60%), Positives = 326/442 (74%), Gaps = 27/442 (6%)
 Frame = -3

Query  1438  ADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGD  1259
             ADVCHAYQIL++GGLK+ENIVVFMYDDIA N  NPR GVIINHP G DVYAGVPKDYTG 
Sbjct  40    ADVCHAYQILRKGGLKEENIVVFMYDDIAKNDLNPRPGVIINHPKGEDVYAGVPKDYTGK  99

Query  1258  QVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVL-------GMPNLP  1100
             QVTA N +AVLLG+K  V GGSGKV++SK  D IFIYY DHGGPGVL       GMPN P
Sbjct  100   QVTAKNFFAVLLGNKTAVTGGSGKVINSKPKDHIFIYYADHGGPGVLANRSKFIGMPNRP  159

Query  1099  HLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWG  920
             ++YA DFI+VL++KH++ +Y  M+IYVEACESGS FEG++PEDLNIYVTTASNA E+SWG
Sbjct  160   YIYAGDFIKVLREKHASKSYSKMIIYVEACESGSIFEGLLPEDLNIYVTTASNAVENSWG  219

Query  919   TYCPGSEPAPPPEYITCLGDLYSVAWMED--------------SESHNLMEETIERQYEN  782
              YCPG + +PP EY TCLGD+YSV+WMED              SE+HNL +ET+++QYE 
Sbjct  220   AYCPGMKSSPPAEYDTCLGDIYSVSWMEDRICQKVLNRSILLCSETHNLKKETLKQQYEV  279

Query  781   VKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTP--KGVV  608
             VK RTS   +F  GSHVMEYG +   K EK++LYQGF PA  N+     R L P  +G +
Sbjct  280   VKTRTSKSKEFDKGSHVMEYGDK-TFKDEKLFLYQGFGPANSNVAN---RLLLPELEGAI  335

Query  607   NQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSN  428
             NQRDAD+LFMW+RY+     +  K ++L+EI +T++HR+ LD+SID +G  +FG ENG +
Sbjct  336   NQRDADILFMWKRYEKLNGGSEEKQRVLREIKETVVHRKHLDSSIDFIGKLVFGFENGPS  395

Query  427   ILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEA  248
             ++++ R  G  LVDDW CLK  VRVFE+ CGSL QYGMKHMRAFANICN+ IS A M EA
Sbjct  396   MIEAARSSGQPLVDDWDCLKRTVRVFESQCGSLTQYGMKHMRAFANICNNGISGAEMREA  455

Query  247   CKNTCSEMKTMKYTHPSKVYSA  182
               + C    + K++  +  +SA
Sbjct  456   SISACGGYDSAKWSPLAVGHSA  477



>ref|XP_006408834.1| hypothetical protein EUTSA_v10001970mg [Eutrema salsugineum]
 gb|ESQ50287.1| hypothetical protein EUTSA_v10001970mg [Eutrema salsugineum]
Length=490

 Score =   513 bits (1322),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 261/444 (59%), Positives = 321/444 (72%), Gaps = 7/444 (2%)
 Frame = -3

Query  1504  TQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKG  1325
             + GT+WAVLVAGS+GY NYRHQADVCHAYQ+L++GGLK+ENI+VFMYDDIA N  NPR G
Sbjct  51    SAGTKWAVLVAGSSGYWNYRHQADVCHAYQLLRKGGLKEENIIVFMYDDIAKNKENPRPG  110

Query  1324  VIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYY  1145
             +IIN PNG DVY GVPKDYTGD V   NL+AV+L +K  +KGGSGKVVDS  DD IFIYY
Sbjct  111   IIINSPNGNDVYNGVPKDYTGDDVNVDNLFAVILANKTALKGGSGKVVDSGPDDHIFIYY  170

Query  1144  TDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLN  965
             +DHGGPGVLGMP  PHLYAND I++LKKKH++GTYK +V Y+EACESGS FEG++PE LN
Sbjct  171   SDHGGPGVLGMPTSPHLYANDLIDILKKKHASGTYKSLVFYLEACESGSIFEGLLPEGLN  230

Query  964   IYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYE  785
             IY TTASNAEESSWGTYCPG + +PP EY TCLGDLYSV+WMEDS+ HNL  E++ +QYE
Sbjct  231   IYATTASNAEESSWGTYCPGDDSSPPKEYETCLGDLYSVSWMEDSDQHNLQTESLHQQYE  290

Query  784   NVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPKG  614
              VK RT+  N    GSHVME+G   + K E + LY G +P   N   +  N +R   P  
Sbjct  291   LVKKRTAGSNT-SYGSHVMEFGDIGLSK-EMLVLYMGTNPDNENYTFVDKNSLR--PPSR  346

Query  613   VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENG  434
             V NQRDADL+  W++Y+   + +  KA+  K++ + M HR  +D S   +G  LFG   G
Sbjct  347   VTNQRDADLVHFWDKYQKAPEGSARKAEAQKQVLEAMSHRLHIDNSFLMIGKLLFGISEG  406

Query  433   SNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAME  254
               +L  VR  G  LVDDW CLK++VR +E HCGSL QYG+KHMR+ ANICN+ I    ME
Sbjct  407   PLVLNKVRPSGKPLVDDWDCLKTLVRAYERHCGSLSQYGIKHMRSIANICNAGIQVEQME  466

Query  253   EACKNTCSEMKTMKYTHPSKVYSA  182
             EA    C  +    ++   + +SA
Sbjct  467   EAAMQACPTIPAGPWSSLHRGFSA  490



>ref|XP_004245113.1| PREDICTED: vacuolar-processing enzyme-like [Solanum lycopersicum]
Length=482

 Score =   513 bits (1321),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 263/447 (59%), Positives = 322/447 (72%), Gaps = 2/447 (0%)
 Frame = -3

Query  1522  ESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNA  1343
             ++ E ++ GTRWA+L+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDDIANN 
Sbjct  38    DADEIDSVGTRWAILLAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIANNE  97

Query  1342  FNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADD  1163
              NPR+GVIIN P+G DVY GVPKDYTGD VT  N  A LLG+K  + GGSGKVVDS  +D
Sbjct  98    ENPRQGVIINSPHGEDVYNGVPKDYTGDDVTVDNFLAALLGNKTALTGGSGKVVDSGPND  157

Query  1162  RIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGM  983
              IFI+Y+DHGG GVLGMP  P+LYAND I+ LK KH++GTYK +V Y+EACESGS FEG+
Sbjct  158   HIFIFYSDHGGAGVLGMPTNPYLYANDLIDALKMKHASGTYKSLVFYLEACESGSMFEGL  217

Query  982   MPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEET  803
             +PE LNIY TTASNA+ESSWGTYCPG  P+PP EY TCLGDLYS++WMEDSE HNL  E+
Sbjct  218   LPEGLNIYATTASNADESSWGTYCPGEYPSPPIEYDTCLGDLYSISWMEDSERHNLRTES  277

Query  802   IERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLT  623
             +++QY  VK RT++ N    GSHVM+YG   + K + V+LY G DPA  N        L 
Sbjct  278   LKQQYHLVKERTASGNP-AYGSHVMQYGDVHLSK-DAVFLYMGTDPANDNSTFMDDNSLR  335

Query  622   PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGP  443
                 VNQRDADL+  W ++    + +VSK +  K + + + HR  LD SI  +G  LFG 
Sbjct  336   VSKAVNQRDADLVHFWYKFHKAPEGSVSKTEAQKRLNEAISHRMHLDNSIALVGKLLFGI  395

Query  442   ENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEA  263
             + G  +L SVR  G  LVD+W CLKS VR FETHCGSL QYGMKHMR+ ANICN+ I   
Sbjct  396   KKGPEVLTSVRPAGQPLVDNWDCLKSYVRTFETHCGSLSQYGMKHMRSVANICNAGIKME  455

Query  262   AMEEACKNTCSEMKTMKYTHPSKVYSA  182
              M EA    C  + +  ++   + +SA
Sbjct  456   QMVEASAQACPSVPSYTWSSLHRGFSA  482



>gb|AEO79971.1| vacuolar processing enzyme [Arachis diogoi]
Length=487

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 259/460 (56%), Positives = 330/460 (72%), Gaps = 7/460 (2%)
 Frame = -3

Query  1552  IRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVV  1373
             +R P +       E E +GT+WAVL+AGSNGY NYRHQAD+CHAYQ+L+ GG+K+ENI+V
Sbjct  32    LRLPSEAISRFFHEPENEGTKWAVLLAGSNGYWNYRHQADICHAYQLLRSGGVKEENIIV  91

Query  1372  FMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggs  1193
             FM+DDIA +  NPR GVIIN P+G DVY GVPKDYTG  V   N +A LLG+K  + GGS
Sbjct  92    FMFDDIAYSEENPRPGVIINKPDGGDVYKGVPKDYTGKDVNVNNFFAALLGNKSALTGGS  151

Query  1192  gkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEA  1013
             GKVVDS  +D IF++Y+DHGGPG+LGMP  P+LYAND  EVLKKKH++G YK +V Y+EA
Sbjct  152   GKVVDSGPNDHIFVFYSDHGGPGILGMPVGPYLYANDLNEVLKKKHASGGYKSLVFYLEA  211

Query  1012  CESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMED  833
             CESGS FEG++PED+NIY TTASNA ESSWGTYCPG +P+PPPEY TCLGDLYS++WMED
Sbjct  212   CESGSIFEGLLPEDINIYATTASNAVESSWGTYCPGEDPSPPPEYSTCLGDLYSISWMED  271

Query  832   SESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN  653
             S++HNL  ET+ +QY+ VK RT N N +  GSH M+YG   I +   ++ Y G +PA  N
Sbjct  272   SDTHNLRTETLHQQYKLVKDRTLNGNAYY-GSHAMQYGDVGISE-NLLFQYLGTNPANDN  329

Query  652   ---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLD  482
                +  N +R  TP   VNQRDADL+  WE+++   + + SK    K++ + M HR  +D
Sbjct  330   YTFVDENSLR--TPSKAVNQRDADLIHFWEKFRKAPEGSSSKITAQKQVVEVMSHRMHID  387

Query  481   ASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMR  302
              S+  +G  LFG E G  +L +VR  G  LVDDW CLK+MVR FETHCGSL QYGMKHMR
Sbjct  388   NSVKLIGNLLFGTEKGPELLSAVRPAGKPLVDDWDCLKNMVRTFETHCGSLSQYGMKHMR  447

Query  301   AFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              FANICN+ I +  M+EA    C  + +  ++   + +SA
Sbjct  448   TFANICNAGIHKDQMDEATAQACVSIPSNPWSSLERGFSA  487



>emb|CDY11506.1| BnaA09g40720D [Brassica napus]
Length=489

 Score =   513 bits (1320),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 262/452 (58%), Positives = 326/452 (72%), Gaps = 5/452 (1%)
 Frame = -3

Query  1528  DDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAN  1349
             +D+  +  + GT+WAVLVAGS GY NYRHQADVCHAYQ+L++GG+K+ENIVVFMYDDIA 
Sbjct  40    EDDVGDDSSAGTKWAVLVAGSRGYWNYRHQADVCHAYQLLRKGGVKEENIVVFMYDDIAK  99

Query  1348  NAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKA  1169
             N  NPR G+IIN PNG DVY G+PKDYTGD V   NL+AV+LG+K  +KGGSGKVVDS  
Sbjct  100   NKENPRPGIIINSPNGNDVYNGIPKDYTGDDVNVDNLFAVILGNKTALKGGSGKVVDSGP  159

Query  1168  DDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFE  989
             DD IFIYY+DHGGPGVLGMP  P LYAND  +VLKKKH++GTYK +V Y+EACESGS FE
Sbjct  160   DDHIFIYYSDHGGPGVLGMPTSPALYANDLNDVLKKKHASGTYKSLVFYLEACESGSIFE  219

Query  988   GMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLME  809
             G++PE LNIY TTA+NAEESSWGTYCPG + + P E+ TCLGDLYSVAW+EDS+ HNL  
Sbjct  220   GLLPEGLNIYATTAANAEESSWGTYCPGEDTSVPSEFETCLGDLYSVAWLEDSDKHNLQT  279

Query  808   ETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLP---GNQ  638
             E++ +QYE VK RT+       GSHVME+G   ++  EK+ LY G +P   N      N 
Sbjct  280   ESLHQQYELVKKRTAATGS-TYGSHVMEFGDIGLLGKEKLVLYLGTNPDNENATFADENS  338

Query  637   IRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGV  458
             +R L+  GV NQRDADL+  WE+YK   + +  KA+  K++ + M HR  +D S+  +G 
Sbjct  339   LRPLS-GGVTNQRDADLVHFWEKYKKAPEGSSRKAEAQKQVLEAMSHRLHVDNSVLLIGK  397

Query  457   HLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNS  278
              LFG   G  +L  VR  G  LVDDW+CLK++VR FE HCGSL QYG+KHMR+ ANICN+
Sbjct  398   LLFGISEGPAVLNKVRPGGKPLVDDWECLKTLVRAFEKHCGSLSQYGLKHMRSIANICNA  457

Query  277   NISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              I    MEEA    C  + T  ++   + +SA
Sbjct  458   GIQMEQMEEAAIQACPTIPTGPWSSLHQGFSA  489



>ref|XP_002880728.1| alpha-vacuolar processing enzyme [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56987.1| alpha-vacuolar processing enzyme [Arabidopsis lyrata subsp. lyrata]
Length=479

 Score =   512 bits (1318),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 274/468 (59%), Positives = 331/468 (71%), Gaps = 5/468 (1%)
 Frame = -3

Query  1579  LQAARWDPLIRQPVDQKDDESP-EGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKR  1403
             L AA    +I+ P        P E +   TRWAVLVAGS+GY NYRHQADVCHAYQ+LK+
Sbjct  15    LVAAVSGDVIKLPSQASKFFHPTENDDDSTRWAVLVAGSSGYWNYRHQADVCHAYQLLKK  74

Query  1402  GGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLL  1223
             GG+K+ENIVVFMYDDIA N  NPR GVIIN PNG DVY GVPKDYTGD V   NL AV+L
Sbjct  75    GGVKEENIVVFMYDDIAKNEENPRPGVIINSPNGEDVYNGVPKDYTGDDVNVDNLLAVIL  134

Query  1222  gdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGT  1043
             G+K  VKGGSGKVVDS  +D IFIYY+DHGGPGVLGMP  P+LYAND  +VLKKKH++GT
Sbjct  135   GNKTAVKGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHASGT  194

Query  1042  YKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLG  863
             YK +V Y+EACESGS FEG++PE LNIY TTASNA ESSWGTYCPG +P+PP EY TCLG
Sbjct  195   YKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGEDPSPPSEYETCLG  254

Query  862   DLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYL  683
             DLYSVAWMEDS+ HNL  ET+ +QYE VK RT+       GSHVME+G   + K EK+ L
Sbjct  255   DLYSVAWMEDSDIHNLQTETLHQQYELVKKRTAGSGK-SFGSHVMEFGDIGLSK-EKLVL  312

Query  682   YQGFDPATINLPG-NQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDT  506
             Y G +PA  N    N+     P  V NQRDADL+  W++Y+   + +  K +  K++ + 
Sbjct  313   YMGTNPANENFTFVNENSLRPPSRVTNQRDADLVHFWDKYRKAPEGSARKVEAQKQVLEA  372

Query  505   MLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLG  326
             M HR  +D SI  +G  LFG ++ + +L +VR  G  LVDDW CLKS+VRVFE HCGSL 
Sbjct  373   MSHRLHVDNSILLIGKLLFGLDSPA-VLNNVRPSGTPLVDDWDCLKSLVRVFEMHCGSLS  431

Query  325   QYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             QYG+KHMR+ ANICN+ I    MEEA    C  +    ++   + +SA
Sbjct  432   QYGIKHMRSIANICNAGIQMGQMEEAAMQACPTIPASPWSSLERGFSA  479



>gb|ACC68680.1| vacoular processing enzyme 1 [Solanum tuberosum]
Length=482

 Score =   511 bits (1317),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 261/447 (58%), Positives = 322/447 (72%), Gaps = 2/447 (0%)
 Frame = -3

Query  1522  ESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNA  1343
             ++ E ++ GTRWA+L+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDDIANN 
Sbjct  38    DADENDSVGTRWAILLAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIANNE  97

Query  1342  FNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADD  1163
              NPR+GVIIN P+G DVY GVPKDYTGD VT  N  A LLG+K  + GGSGKVVDS  +D
Sbjct  98    ENPRQGVIINSPHGEDVYKGVPKDYTGDDVTVNNFLAALLGNKTAITGGSGKVVDSGPND  157

Query  1162  RIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGM  983
              IFI+Y+DHGG GV+GMP  P+LYAND I+ LKKKH++GTYK +V Y+EACESGS FEG+
Sbjct  158   HIFIFYSDHGGAGVIGMPTDPYLYANDLIDALKKKHASGTYKSLVFYLEACESGSMFEGL  217

Query  982   MPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEET  803
             +PE LNIY TTASNA+ESSWGTYCPG  P+PP EY TCLGDLYS++WMEDS  HNL  ET
Sbjct  218   LPEGLNIYATTASNADESSWGTYCPGEFPSPPIEYGTCLGDLYSISWMEDSGRHNLRTET  277

Query  802   IERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLT  623
             +++QY  VK RT++ N    GSHVM+YG   + K + ++LY G DPA  N        + 
Sbjct  278   LKQQYHLVKERTASGNP-AYGSHVMQYGDVHLSK-DVLFLYMGTDPANDNSTFMDDNSMR  335

Query  622   PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGP  443
                 VNQRDADL+  W ++    + +V K +  K++ + + HR  LD SI  +G  LFG 
Sbjct  336   VSKAVNQRDADLVHFWYKFHKAPEGSVRKTEAQKQLNEAISHRMHLDNSIALVGKLLFGI  395

Query  442   ENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEA  263
             + G  +L SVR  G  LVDDW CLKS VR FETHCGSL QYGMKHMR+ ANICN+ I   
Sbjct  396   KKGPEVLTSVRPAGQPLVDDWDCLKSYVRTFETHCGSLSQYGMKHMRSVANICNAGIKME  455

Query  262   AMEEACKNTCSEMKTMKYTHPSKVYSA  182
              M EA    C  + +  ++   + +SA
Sbjct  456   QMVEASAQACPSVPSNTWSSLQRGFSA  482



>emb|CDP09909.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   512 bits (1318),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 265/431 (61%), Positives = 320/431 (74%), Gaps = 7/431 (2%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             + +G  WAVLVAGSN + NYRHQADVCHAYQILK+GGLKDE+IV FMYDDIANN  NP+ 
Sbjct  51    KCRGKTWAVLVAGSNEWYNYRHQADVCHAYQILKKGGLKDEHIVAFMYDDIANNQENPKP  110

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIIN P+G DVY GV KDYTG      N YAVLLG+K  + GGSGKVV+S  +DRIFI+
Sbjct  111   GVIINRPHGDDVYKGVLKDYTGKHANTQNFYAVLLGNKMALTGGSGKVVNSTNEDRIFIF  170

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGG GVLGMP+   LYANDF EVLKKKH++GTYK+MVIYVEACESGS FEG++P++L
Sbjct  171   YSDHGGAGVLGMPSGDPLYANDFNEVLKKKHASGTYKEMVIYVEACESGSIFEGLLPQNL  230

Query  967   NIYVTTASNAEESSWGTYCPGSEPAP-PPEYITCLGDLYSVAWMEDS-----ESHNLMEE  806
             +IY TTA+NA E S+ TYC   + A   PE   CLGDLYSV+WMEDS     ESHNL +E
Sbjct  231   SIYATTAANAREDSYATYCSFPDTATGEPEVFPCLGDLYSVSWMEDSQFICSESHNLKKE  290

Query  805   TIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRL  626
             TI++Q++ VK RTSN + +  GSHV EYG+  +   EK+YLY GF+PAT + P N     
Sbjct  291   TIKQQFKKVKERTSNNHTYIDGSHVTEYGNTRM-HAEKLYLYHGFNPATESFPPNDRDSP  349

Query  625   TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFG  446
                 VV QR ADL F+  RYK   D +  K KLL++IT+   +R+ LD S+D +G  LFG
Sbjct  350   VHMAVVEQRSADLFFLRNRYKRMKDGSAEKVKLLEQITNMENYRKLLDGSVDIIGASLFG  409

Query  445   PENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISE  266
              E   ++L  VR PGL +VDDW+CLKSMVRVFETHCG L QYGMKHMRAFAN+CN  I+ 
Sbjct  410   QERSPSVLTHVRAPGLPVVDDWECLKSMVRVFETHCGPLTQYGMKHMRAFANLCNDRITP  469

Query  265   AAMEEACKNTC  233
             +AME ACK+ C
Sbjct  470   SAMEAACKSAC  480



>gb|EPS59704.1| hypothetical protein M569_15100, partial [Genlisea aurea]
Length=431

 Score =   509 bits (1311),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 254/431 (59%), Positives = 321/431 (74%), Gaps = 14/431 (3%)
 Frame = -3

Query  1498  GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVI  1319
             GTRWAVLVAGSNGY NYRHQADVCHAYQ LK+GGLKDENI+VFMYDDIA N  NPR GVI
Sbjct  6     GTRWAVLVAGSNGYWNYRHQADVCHAYQTLKKGGLKDENIIVFMYDDIAYNDENPRPGVI  65

Query  1318  INHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTD  1139
             INHP+G +VY GVPKDY GD VT  N +AVLLG+K  + GGSGKVVDS  +D IF+YY+D
Sbjct  66    INHPHGENVYDGVPKDYVGDDVTVDNFFAVLLGNKTALSGGSGKVVDSGPNDHIFVYYSD  125

Query  1138  HGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIY  959
             HGGPGVLGMP  P+LYAND I+VLK+KH++GTYK +V YVEACESGS FEG++PE LNI+
Sbjct  126   HGGPGVLGMPTDPYLYANDLIDVLKRKHASGTYKSLVFYVEACESGSIFEGLLPEGLNIF  185

Query  958   VTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENV  779
              TTASNAEE+SWGTYCPG +  PPPEY TCLGD+YSV+WMEDS+ HNL  ET+ +QY  V
Sbjct  186   ATTASNAEENSWGTYCPGDDIGPPPEYETCLGDMYSVSWMEDSDQHNLRTETLRQQYHVV  245

Query  778   KLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPA--------TINLPGNQIRRLT  623
             + RT+  N  + GSHVM+YG    +  +K++LY G +P+        +++L GN      
Sbjct  246   RERTARDNSHRYGSHVMQYGDLK-LSVDKLFLYMGSNPSNDNSTFGGSVHLSGNS--SWP  302

Query  622   PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGP  443
                 V+QRDAD+L  W++++   + +  KA+  K++ + M+ R R+D S+ ++G  LFG 
Sbjct  303   SSMAVSQRDADVLHFWDKFRKAPEGSSRKAEAQKQLAEVMVRRSRVDISVVSIGKLLFG-  361

Query  442   ENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEA  263
                S I+ ++R  G +LVDDW CLKS+VR+FET+C SL  YGMKHMR+ AN+CN+ +SE 
Sbjct  362   --SSEIMNAIRPSGKSLVDDWDCLKSLVRIFETYCSSLSGYGMKHMRSIANMCNAGVSEE  419

Query  262   AMEEACKNTCS  230
              M EA    CS
Sbjct  420   QMSEASSQVCS  430



>ref|XP_010429610.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like isoform 
X1 [Camelina sativa]
Length=484

 Score =   511 bits (1316),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 272/472 (58%), Positives = 332/472 (70%), Gaps = 10/472 (2%)
 Frame = -3

Query  1579  LQAARWDPLIRQPVDQKDDESP---EGETQGTRWAVLVAGSNGYANYRHQADVCHAYQIL  1409
             + AA  D +IR P        P   E +   TRWAVLVAGS+GY NYRHQADVCHAYQ+L
Sbjct  17    VAAAASDNIIRLPSQASKFFRPPTQENDDGSTRWAVLVAGSSGYWNYRHQADVCHAYQLL  76

Query  1408  KRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAV  1229
             K+GG+K+ENIVVFMYDDIA +  NPR GVIIN PNG DVY GVPKDYTGD+V   NL+AV
Sbjct  77    KKGGVKEENIVVFMYDDIAKHEENPRPGVIINSPNGEDVYNGVPKDYTGDEVNVDNLFAV  136

Query  1228  LLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSA  1049
             +LG+K+ +KGGSGKVV+S  +D IFIYY+DHGGPGVLGMP  P+LYA D  +VLKKKH++
Sbjct  137   ILGNKKALKGGSGKVVNSGPNDHIFIYYSDHGGPGVLGMPTSPYLYAKDLNDVLKKKHAS  196

Query  1048  GTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITC  869
             GTYK +V Y+EACESGS FEG++PE LNIY TTASNA ESSWGTYCPG +P+PP EY TC
Sbjct  197   GTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGEDPSPPSEYETC  256

Query  868   LGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKV  689
             LGDLYSVAWMEDS+ HNL  E++ +QYE VK RT+       GSHV+E+G   + K EK+
Sbjct  257   LGDLYSVAWMEDSDKHNLQTESLHQQYELVKKRTAGTGS-SYGSHVLEFGDIGLSK-EKL  314

Query  688   YLYQGFDPATINLP---GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKE  518
              LY G +PA  N      N + R  P  V NQRDADL+  W++Y+   + +  K +  K+
Sbjct  315   VLYMGTNPANENFTFVDENLLLR-PPSRVTNQRDADLVHFWDKYRKAPEGSARKVEAQKQ  373

Query  517   ITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHC  338
             + + M HR  +D S+  +G  LFG E G  IL  VR  G  LVDDW CLKSMVR FE HC
Sbjct  374   VIEAMSHRLHVDNSVLLIGKLLFGLE-GPEILNKVRTYGKPLVDDWDCLKSMVRAFERHC  432

Query  337   GSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             GSL QYG+KHMR+ ANICN+ I    MEEA    C  +    ++   + +SA
Sbjct  433   GSLSQYGIKHMRSIANICNAGIQMVQMEEAAMQACPSIPAGPWSSLHRGFSA  484



>ref|XP_009117035.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme [Brassica 
rapa]
Length=489

 Score =   511 bits (1316),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 261/451 (58%), Positives = 321/451 (71%), Gaps = 3/451 (1%)
 Frame = -3

Query  1528  DDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAN  1349
             +D+  +  + GT+WAVLVAGS GY NYRHQADVCHAYQ+L++GG+K+ENIVVFMYDDIA 
Sbjct  40    EDDVGDDSSAGTKWAVLVAGSRGYWNYRHQADVCHAYQLLRKGGVKEENIVVFMYDDIAK  99

Query  1348  NAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKA  1169
             N  NPR G+IIN PNG DVY G+PKDYTGD V   NL+AV+LG+K  +KGGSGKVVDS  
Sbjct  100   NKENPRPGIIINSPNGNDVYNGIPKDYTGDDVNVDNLFAVILGNKTALKGGSGKVVDSGP  159

Query  1168  DDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFE  989
             DD IFIYY+DHGGPGVLGMP  P LYAND  +VLKKKH++GTYK +V Y+EACESGS FE
Sbjct  160   DDHIFIYYSDHGGPGVLGMPTSPALYANDLNDVLKKKHASGTYKSLVFYLEACESGSIFE  219

Query  988   GMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLME  809
             G++PE LNIY TTA+NAEESSWGTYCPG + + P E+ TCLGDLYSVAW+EDS+ HNL  
Sbjct  220   GLLPEGLNIYATTAANAEESSWGTYCPGEDTSVPSEFETCLGDLYSVAWLEDSDKHNLQT  279

Query  808   ETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRR  629
             E++ +QYE VK RT+       GSHVME+G   ++  EK+ LY G  P   N        
Sbjct  280   ESLHQQYELVKKRTAATGS-TYGSHVMEFGDIGLLGKEKLVLYLGTIPDNENATFADEIS  338

Query  628   LTP--KGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVH  455
             L P   GV NQRDADL+  WE+YK   + +  KA+  K++ + M HR  +D S+  +G  
Sbjct  339   LRPLSGGVTNQRDADLVHFWEKYKKAPEGSARKAEAQKQVLEAMSHRLHVDNSVLLIGKL  398

Query  454   LFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSN  275
             LFG   G  +L  VR  G  LVDDW CLK++VR FE HCGSL QYG+KHMR+ ANICN+ 
Sbjct  399   LFGISEGPAVLNKVRSSGKPLVDDWDCLKTLVRAFEKHCGSLSQYGLKHMRSIANICNAG  458

Query  274   ISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             I    MEEA    C  + T  ++   + +SA
Sbjct  459   IQMEQMEEAAIQACPTIPTGPWSSLHQGFSA  489



>ref|XP_010417372.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme [Camelina 
sativa]
Length=484

 Score =   511 bits (1315),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 267/460 (58%), Positives = 324/460 (70%), Gaps = 12/460 (3%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
               R P  + DD S       TRWAVLVAGS+GY NYRHQADVCHAYQ+LK+GG+K+ENIV
Sbjct  35    FFRPPTQENDDGS-------TRWAVLVAGSSGYWNYRHQADVCHAYQLLKKGGVKEENIV  87

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA +  NPR GVIIN PNG DVY GVPKDYTGD+V   NL+AV+LG+K+ +KGG
Sbjct  88    VFMYDDIAEHEENPRPGVIINSPNGEDVYNGVPKDYTGDEVNVDNLFAVILGNKKALKGG  147

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVV+S  +D IFIYY+DHGGPGVLGMP  P+LYA D  +VLKKKH++GTYK +V Y+E
Sbjct  148   SGKVVNSGPNDHIFIYYSDHGGPGVLGMPTSPYLYAKDLNDVLKKKHASGTYKSLVFYLE  207

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++PE LNIY TTASNA ESSWGTYCPG +P+PP EY TCLGDLYSVAWME
Sbjct  208   ACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGEDPSPPSEYETCLGDLYSVAWME  267

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATI  656
             DS+ HNL  E++ +QYE VK RT+       GSHV+E+G   + K EK+ LY G +PA  
Sbjct  268   DSDKHNLQTESLHQQYELVKKRTAGTGS-SYGSHVLEFGDIGLSK-EKLVLYMGTNPANE  325

Query  655   NLP--GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLD  482
             N            P  V NQRDADL+  W++Y+   + +  K +  K++ + M HR  +D
Sbjct  326   NFTFVDENASLRPPSRVTNQRDADLVHFWDKYRKAPEGSARKVEAQKQVIEAMSHRLHVD  385

Query  481   ASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMR  302
              S+  +G  LFG E G  IL  VR  G  LVDDW CLKSMVR FE HCGSL QYG+KHMR
Sbjct  386   NSVLLIGKLLFGLE-GPEILNKVRPSGKPLVDDWDCLKSMVRAFERHCGSLSQYGIKHMR  444

Query  301   AFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             + ANICN+ I    MEEA    C  +    ++   + +SA
Sbjct  445   SIANICNAGIQMTQMEEAAMQACPSIPAGPWSSLHRGFSA  484



>ref|XP_004253098.1| PREDICTED: vacuolar-processing enzyme [Solanum lycopersicum]
Length=480

 Score =   510 bits (1314),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 260/445 (58%), Positives = 319/445 (72%), Gaps = 7/445 (2%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GTRWAVL+AGSNGY NYRHQADVCHAYQ+L++GGLKDENI+VFMYDDIA++  NPR 
Sbjct  40    DSVGTRWAVLLAGSNGYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDDIAHHEENPRP  99

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIIN P G DVY GVPKDYTGD V   N  AVLLG+K  + GGSGKVV+S  +D IFI+
Sbjct  100   GVIINSPAGEDVYEGVPKDYTGDDVNVHNFLAVLLGNKTALTGGSGKVVNSGPNDHIFIF  159

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP  P+LYA+D I VLKKKH+AGTYK +V+Y+EACESGS FEG++P  L
Sbjct  160   YSDHGGPGVLGMPTNPYLYADDLIAVLKKKHAAGTYKSLVLYIEACESGSIFEGLLPNGL  219

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLY+V+WMEDSE HNL  E + +QY
Sbjct  220   NIYATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYAVSWMEDSEMHNLRTENLRQQY  279

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPK  617
               VK RT+N N    GSHVM++G    +  E ++ + G +PA  N   +  N +  L   
Sbjct  280   HLVKKRTANGNT-AYGSHVMQFGDLQ-LSMESLFRFMGTNPANDNYTYVDDNSL--LASS  335

Query  616   GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPEN  437
               VNQRDADLL  W++++   + +  K +  K+ T+ M HR  LD  I  +G  LFG + 
Sbjct  336   KAVNQRDADLLHFWDKFRKAPEGSARKVEAQKQFTEAMSHRMHLDERIALVGKLLFGIQK  395

Query  436   GSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAM  257
             G  +LK VR  G  LVDDW CLKS VR FE+HCGSL QYGMKHMR+ ANICN+ I    M
Sbjct  396   GPEVLKHVRSAGQPLVDDWACLKSFVRTFESHCGSLSQYGMKHMRSIANICNAGIQMEQM  455

Query  256   EEACKNTCSEMKTMKYTHPSKVYSA  182
              EA    C  + +  ++   + +SA
Sbjct  456   VEASAQACPSIPSNIWSSLHRGFSA  480



>dbj|BAC54829.1| vacuolar processing enzyme-2 [Nicotiana tabacum]
Length=484

 Score =   509 bits (1312),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 262/443 (59%), Positives = 322/443 (73%), Gaps = 3/443 (1%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GT+WAVLVAGS GY NYRHQADVCHAYQ+LK+GGLKDENI+VFMYDDIA+N  NPR 
Sbjct  44    DSIGTKWAVLVAGSRGYWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIAHNFENPRP  103

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIIN PNG DVY GVPKDYTG  VTA N  AV+LG+K  + GGSGKVV+S  +D IFI+
Sbjct  104   GVIINSPNGDDVYKGVPKDYTGHHVTANNFLAVILGNKAALSGGSGKVVESGPNDHIFIF  163

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP+ P+LYA+D I+VLK+KH++GTYK +V Y+EACESGS FEG++PE L
Sbjct  164   YSDHGGPGVLGMPSGPYLYADDLIDVLKRKHASGTYKSLVFYIEACESGSIFEGLLPEGL  223

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNAEE SWGTYCPG  P PPPEY TCLGDLY+V+WMEDSE HNL  ET+  QY
Sbjct  224   NIYATTASNAEEDSWGTYCPGDYPGPPPEYQTCLGDLYAVSWMEDSEKHNLRRETLGMQY  283

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPG-NQIRRLTPKGV  611
             E VK RT+N   + A SHVM+YG   ++  + + LY G +PA  N    ++   L     
Sbjct  284   ELVKRRTANSFPY-ASSHVMQYGDLKLMD-DPLSLYMGTNPANDNYTFLDENSSLLSAKP  341

Query  610   VNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGS  431
             VNQRDADLL  W+++      +V K +  K++++ M HR  +D SI  +G  LFG E G 
Sbjct  342   VNQRDADLLHFWDKFLKAPQGSVRKVEAQKQLSEAMSHRMHIDDSIALVGRLLFGIEKGP  401

Query  430   NILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEE  251
             ++L  VR  G  LVDDW CLKS VR FET CGSL QYGMKHMRA ANICNS I+   + +
Sbjct  402   DVLIRVRPTGEPLVDDWNCLKSFVRTFETRCGSLSQYGMKHMRAVANICNSCITMEQIAK  461

Query  250   ACKNTCSEMKTMKYTHPSKVYSA  182
             A    C  + +  ++   + +SA
Sbjct  462   ASAQACVSIPSNSWSSLDEGFSA  484



>ref|XP_004968980.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=487

 Score =   509 bits (1312),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 268/465 (58%), Positives = 340/465 (73%), Gaps = 9/465 (2%)
 Frame = -3

Query  1561  DPLIRQPVDQKDDESPEG--ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
             +P IR P  ++   + EG  +  GTRWAVL+AGSNGY NYRHQAD+CHAYQILK+GGLKD
Sbjct  27    EPAIRLP-SERAAAAGEGTDDAVGTRWAVLIAGSNGYYNYRHQADICHAYQILKKGGLKD  85

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENI+VFMYDDIA++  NPR GVIINHP G DVYAGVPKDYTG +V   N +AVLLG+K  
Sbjct  86    ENIIVFMYDDIAHSPENPRPGVIINHPQGGDVYAGVPKDYTGREVNVNNFFAVLLGNKTA  145

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             V GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D + VLKKKH+AGTYK +V
Sbjct  146   VSGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVNVLKKKHAAGTYKSLV  205

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
              Y+EACESGS FEG++P D+N+Y TTASNA+ESSWGTYCPG  P+PPPEY TCLGDLYSV
Sbjct  206   FYLEACESGSIFEGLLPNDINVYATTASNADESSWGTYCPGESPSPPPEYDTCLGDLYSV  265

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDS+ HNL  E++++QY  VK RTS +N F  GSHVM+YGS + +  + ++ Y G +
Sbjct  266   AWMEDSDFHNLRTESLKQQYNLVKDRTSVHNTFTYGSHVMQYGSLN-LNVQHLFSYIGTN  324

Query  667   PATIN---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             PA  +   + GN +   T    VNQRDADL++ W++Y+   + +  K    KE+ + M H
Sbjct  325   PANDDNKFVEGNSLPSFTR--AVNQRDADLVYFWQKYRKVAEGSPGKNDARKELLEVMAH  382

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R  +D S++ +G  LFG E+G  +LK+VR  G  LVDDW CLKSMVR FE  CGSL QYG
Sbjct  383   RSHVDNSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSMVRAFEAQCGSLSQYG  442

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MKHMR+FANICN+ I   A+ +     C+ + +  ++     +SA
Sbjct  443   MKHMRSFANICNAGILPDAVSKVAAQACTSIPSNPWSSIHMGFSA  487



>ref|XP_001759301.1| predicted protein [Physcomitrella patens]
 gb|EDQ75985.1| predicted protein [Physcomitrella patens]
Length=496

 Score =   509 bits (1312),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 267/469 (57%), Positives = 329/469 (70%), Gaps = 14/469 (3%)
 Frame = -3

Query  1600  IACQLQNLQAA--RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVC  1427
             + C L  +  A   WD  I  P ++   + P+    G RWAVLVAGS+GY NYRHQADVC
Sbjct  12    LLCSLGAMAVAAREWDGKIVMPTEEGSKD-PQPTEDGQRWAVLVAGSSGYGNYRHQADVC  70

Query  1426  HAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTA  1247
             HAYQILK+GG+KDENIVVFM+DDIA+N  NPR GVI+NHPNG DVY GVPKDYTG  VT 
Sbjct  71    HAYQILKKGGMKDENIVVFMFDDIAHNRHNPRPGVILNHPNGEDVYHGVPKDYTGKNVTV  130

Query  1246  ANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVL  1067
              NL AVLLGDK+ +KGGSGKVV+S  +D IFIYY+DHGGPGVLGMP  P+LYA+D ++  
Sbjct  131   NNLLAVLLGDKKTLKGGSGKVVNSGPNDHIFIYYSDHGGPGVLGMPTNPNLYADDLLKTF  190

Query  1066  KKKHSAGTYKDM--VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPA  893
             KK H A TYK+M  V+Y+EACESGS F+G++P+DLNIY TTA+NAEESSWGTYCPG  PA
Sbjct  191   KKMHEAKTYKEMVFVVYIEACESGSIFQGLLPKDLNIYATTAANAEESSWGTYCPGMFPA  250

Query  892   PPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSR  713
             P  E+ TCLGDLYSVAWMED+E  NL +ET+  QY  VK RTSN+N +++GSHV+E+G  
Sbjct  251   PLEEFDTCLGDLYSVAWMEDTEVENLKKETLRDQYMIVKSRTSNHNTYKSGSHVLEFGDL  310

Query  712   DIIKPEKVYLYQGFDPATINLPGNQIRR----LTPKGV----VNQRDADLLFMWERYKMK  557
               +KPE++  Y G+DPA  N+ G    R    +   GV    +NQRDADL+  W RY   
Sbjct  311   K-MKPEELDQYLGYDPANENVTGPIFLREYLAIRLGGVEERHINQRDADLVHYWHRYHKS  369

Query  556   GDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQ  377
                + +KA+   ++   + HR  +D S+D +G  LFG E G   L +VR  GL L DDW 
Sbjct  370   KVGSTAKAEAELDLMRILSHRMYIDKSVDLVGRLLFGVEAGPTTLSAVRPDGLPLTDDWA  429

Query  376   CLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCS  230
             CLKSMV  FE  CG L +YGMKHMRAFANICN+ +  + M       C+
Sbjct  430   CLKSMVSAFELSCGELSEYGMKHMRAFANICNAGVEPSKMSGVAAEACA  478



>ref|XP_006342509.1| PREDICTED: vacuolar-processing enzyme-like [Solanum tuberosum]
Length=480

 Score =   509 bits (1310),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 258/443 (58%), Positives = 316/443 (71%), Gaps = 3/443 (1%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GTRWAVL+AGSNGY NYRHQADVCHAYQ+L++GGLKDENI+VFMYDDIA++  NPR 
Sbjct  40    DSVGTRWAVLLAGSNGYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDDIAHHEENPRP  99

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIIN P G DVY GVPKDYTGD V   N   VLLG+K  + GGSGKVV+S  +D IFI+
Sbjct  100   GVIINSPAGEDVYEGVPKDYTGDDVNVHNFLTVLLGNKTALTGGSGKVVNSGPNDHIFIF  159

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP  P+LYAND I VLKKKH+AGTYK +V+Y+EACESGS FEG++P+ L
Sbjct  160   YSDHGGPGVLGMPTNPYLYANDLIAVLKKKHAAGTYKSLVLYIEACESGSIFEGLLPKGL  219

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLY+V+WMEDSE HNL  E + +QY
Sbjct  220   NIYATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYAVSWMEDSEMHNLRTENLRQQY  279

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRL-TPKGV  611
               VK RT+N N    GSHVM++G    +  E ++ + G +PA  N        L      
Sbjct  280   HLVKKRTANGNT-AYGSHVMQFGDLQ-LSMESLFRFMGTNPANDNYTYVDDNSLWASSKA  337

Query  610   VNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGS  431
             VNQRDADLL  W++++   + +  K +  K+ T+ M HR  LD  I  +G  LFG + G 
Sbjct  338   VNQRDADLLHFWDKFRKAPEGSARKVEAQKQFTEAMSHRMHLDERIALVGKLLFGIQKGP  397

Query  430   NILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEE  251
              +LK VR  G  LVDDW CLKS VR FE+HCGSL QYGMKHMR+ ANICN+ +    M E
Sbjct  398   EVLKHVRSAGQPLVDDWACLKSFVRTFESHCGSLSQYGMKHMRSIANICNAGVQMEQMVE  457

Query  250   ACKNTCSEMKTMKYTHPSKVYSA  182
             A    C  + +  ++   + +SA
Sbjct  458   ASVQACPSIPSNTWSSLHRGFSA  480



>ref|XP_009410798.1| PREDICTED: vacuolar-processing enzyme [Musa acuminata subsp. 
malaccensis]
Length=488

 Score =   509 bits (1310),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 261/465 (56%), Positives = 326/465 (70%), Gaps = 4/465 (1%)
 Frame = -3

Query  1570  ARWDPLIRQPVDQKDDES-PEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGL  1394
             +R DP IR P D+       EG+  GTRWAVL+AGSNGY NYRHQADVCHAYQ+LK+GGL
Sbjct  26    SRLDP-IRLPSDRVAKPIIGEGDPLGTRWAVLIAGSNGYYNYRHQADVCHAYQVLKKGGL  84

Query  1393  KDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdk  1214
             +DENI+VFMYDDIANN  NPR GVIIN P G DVYAGVPKDY GD V   N +AVLLG+K
Sbjct  85    QDENIIVFMYDDIANNEDNPRPGVIINDPWGEDVYAGVPKDYVGDDVNVNNFFAVLLGNK  144

Query  1213  egvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKD  1034
               + GGSGKVV+S  +D IF++Y+DHGGPGVLGMP  P+LYA+D I VLKKKH++G++K 
Sbjct  145   TALSGGSGKVVNSAPNDHIFVFYSDHGGPGVLGMPTYPYLYADDLIAVLKKKHASGSFKS  204

Query  1033  MVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLY  854
             MV Y+EACESGS FEG++P+++ +Y TTA+N  ESS+GTYCPG  P+PPPEY TCLGDLY
Sbjct  205   MVFYLEACESGSIFEGLLPDNIKVYATTAANTTESSYGTYCPGMFPSPPPEYSTCLGDLY  264

Query  853   SVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQG  674
             SV+WMEDS  HN   ET+++QY+ VK RT+ +  +  GSHVM+YG  D +  +K+  Y G
Sbjct  265   SVSWMEDSYMHNWQIETLKQQYQLVKTRTAVHRTYLFGSHVMQYGDLD-LNAKKLVSYVG  323

Query  673   FDPATINLPGNQIRRLTP-KGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
              +PA  N        L P    VNQRDADL+  W ++    + +  K    K + + M H
Sbjct  324   SNPANDNPTYVDYNSLPPLPEAVNQRDADLIHFWHKFHRAPEGSHQKLNAQKHLLEVMEH  383

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R  +D SI  +G  LFG E G  +L+SVR  G  LVDDW CLKSMVR FET+CGSL QYG
Sbjct  384   RLHIDTSIQLIGKLLFGSEQGPEVLESVRPAGQPLVDDWSCLKSMVRAFETYCGSLSQYG  443

Query  316   MKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MKHMR+ ANICN+ I E  M E     C    +  ++   + +S+
Sbjct  444   MKHMRSLANICNAGIREETMAEVSAQACLRFPSNSWSSLHRGFSS  488



>ref|XP_009607675.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
Length=484

 Score =   508 bits (1309),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 261/443 (59%), Positives = 321/443 (72%), Gaps = 3/443 (1%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GT+WAVLVAGS GY NYRHQADVCHAYQ+LK+GGLKDENI+VFMYDDIA+N  NPR 
Sbjct  44    DSIGTKWAVLVAGSRGYWNYRHQADVCHAYQLLKKGGLKDENIIVFMYDDIAHNFENPRP  103

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIIN PNG DVY GVPKDYTG  VTA N  AV+LG+K  + GGSGKVV+S  +D IFI+
Sbjct  104   GVIINSPNGDDVYKGVPKDYTGHHVTANNFLAVILGNKAALSGGSGKVVESGPNDHIFIF  163

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP+ P+LYA+D I+VLK+KH++GTYK +V Y+EACESGS FEG++PE L
Sbjct  164   YSDHGGPGVLGMPSGPYLYADDLIDVLKRKHASGTYKSLVFYIEACESGSIFEGLLPEGL  223

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNAEE SWGTYCPG  P PPPEY TCLGDLY+V+WMEDSE HNL  ET+  QY
Sbjct  224   NIYATTASNAEEDSWGTYCPGDYPGPPPEYQTCLGDLYAVSWMEDSEKHNLRRETLGMQY  283

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPG-NQIRRLTPKGV  611
             E VK RT+N   + A SHVM+YG   ++  + + LY G +PA  N    ++   L     
Sbjct  284   ELVKRRTANSFPY-ASSHVMQYGDLKLMD-DPLSLYMGTNPANDNYTFLDENSSLLSAKP  341

Query  610   VNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGS  431
             VNQRDADLL  W+++      +V K +  K++++ M HR  +D SI  +G  LFG E G 
Sbjct  342   VNQRDADLLHFWDKFLKAPQGSVRKVEAQKQLSEAMSHRMHIDDSIVLVGRLLFGIEKGP  401

Query  430   NILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEE  251
             ++L  VR  G  LVDDW CLKS VR FET CGSL QYGMKHMRA ANICNS I+   + +
Sbjct  402   DVLIRVRPTGEPLVDDWNCLKSFVRTFETRCGSLSQYGMKHMRAVANICNSGITMEQIAK  461

Query  250   ACKNTCSEMKTMKYTHPSKVYSA  182
                  C  + +  ++   + +SA
Sbjct  462   VSAQACVSIPSNSWSSLDEGFSA  484



>emb|CAH56498.1| cysteine protease [Solanum lycopersicum]
Length=480

 Score =   508 bits (1308),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 259/445 (58%), Positives = 318/445 (71%), Gaps = 7/445 (2%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GTRWAVL+AGSNGY NYRHQADVCHAYQ+L++GGLKDENI+VFMYDDIA++  NPR 
Sbjct  40    DSVGTRWAVLLAGSNGYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDDIAHHEENPRP  99

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIIN P G DVY GVPKDYTGD V   N  AVLLG+K  + GGSGKVV+S  +D IFI+
Sbjct  100   GVIINSPAGEDVYEGVPKDYTGDDVNVHNFLAVLLGNKTALTGGSGKVVNSGPNDHIFIF  159

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP  P+LYA+D I VLKKKH+ GTYK +V+Y+EACESGS FEG++P  L
Sbjct  160   YSDHGGPGVLGMPTNPYLYADDLIAVLKKKHAPGTYKSLVLYIEACESGSIFEGLLPNGL  219

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLY+V+WMEDSE HNL  E + +QY
Sbjct  220   NIYATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYAVSWMEDSEMHNLRTENLRQQY  279

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPK  617
               VK RT+N N    GSHVM++G    +  E ++ + G +PA  N   +  N +  L   
Sbjct  280   HLVKKRTANGNT-AYGSHVMQFGDLQ-LSMESLFRFMGTNPANDNYTYVDDNSL--LASS  335

Query  616   GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPEN  437
               VNQRDADLL  W++++   + +  K +  K+ T+ M HR  LD  I  +G  LFG + 
Sbjct  336   KAVNQRDADLLHFWDKFRKAPEGSARKVEAQKQFTEAMSHRMHLDERIALVGKLLFGIQK  395

Query  436   GSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAM  257
             G  +LK VR  G  LVDDW CLKS VR FE+HCGSL QYGMKHMR+ ANICN+ I    M
Sbjct  396   GPEVLKHVRSAGQPLVDDWACLKSFVRTFESHCGSLSQYGMKHMRSIANICNAGIQMEQM  455

Query  256   EEACKNTCSEMKTMKYTHPSKVYSA  182
              EA    C  + +  ++   + +SA
Sbjct  456   VEASAQACPSIPSNIWSSLHRGFSA  480



>ref|XP_010669169.1| PREDICTED: vacuolar-processing enzyme-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   508 bits (1309),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 264/448 (59%), Positives = 319/448 (71%), Gaps = 6/448 (1%)
 Frame = -3

Query  1564  WDPLIRQPVDQKDDESPEGETQ--GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLK  1391
             +D  +R P D     S + +    GTRWAVL+AGSNGY NYRHQADVCHAYQ+LK+GGLK
Sbjct  26    FDDFLRLPSDHDFPRSNDVDDDQIGTRWAVLIAGSNGYWNYRHQADVCHAYQVLKKGGLK  85

Query  1390  DENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdke  1211
             DENI+VFMYDDIA +  NPR GVIIN P G DVYAGVPKDYTG+ VT  N +A LLGD+E
Sbjct  86    DENIIVFMYDDIAYHEENPRPGVIINSPYGGDVYAGVPKDYTGNNVTVHNFFAALLGDRE  145

Query  1210  gvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDM  1031
              + GGSGKVVDS  +D IFIYY+DHGG GVLGMP +P LYA+  +  LK+KH++ TYK +
Sbjct  146   AITGGSGKVVDSGPNDHIFIYYSDHGGAGVLGMPTVPFLYADTLMNTLKRKHASRTYKSL  205

Query  1030  VIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYS  851
             V YVEACESGS FEG++PE LNIY TTASNA ESSWGTYCPG  P PPPEY TCLGDLYS
Sbjct  206   VFYVEACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGDYPGPPPEYETCLGDLYS  265

Query  850   VAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGF  671
              AWMEDSE HNL  ET++ QYE VK+RTSN    + GSHV+++G +D+ K +K+Y+Y G 
Sbjct  266   AAWMEDSEIHNLRTETLKHQYELVKMRTSN-GGSRYGSHVLQFGDKDLSK-DKLYMYMGS  323

Query  670   DPATINLPGNQIRRLTPKG--VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLH  497
             +PA  N        L P     VNQRDADL+  WE+++   + +  K +  K   + M H
Sbjct  324   NPANENFTYVDNNSLHPPSSKAVNQRDADLVHFWEKFRKAPEGSQRKMEAQKLFMEAMSH  383

Query  496   RQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYG  317
             R  LD SI  +G  LFG E G  IL++VR  G  LVDDW CL+++VR FE HCGSL QYG
Sbjct  384   RIHLDHSIKLVGKLLFGIEKGPEILETVRPAGQPLVDDWTCLRTLVRTFEMHCGSLSQYG  443

Query  316   MKHMRAFANICNSNISEAAMEEACKNTC  233
             MKHMR+ AN+CN+  +   M EA    C
Sbjct  444   MKHMRSIANLCNAGTTADQMSEASAQAC  471



>ref|XP_010669172.1| PREDICTED: vacuolar-processing enzyme-like [Beta vulgaris subsp. 
vulgaris]
 emb|CAC43295.1| putative vacuolar processing enzyme [Beta vulgaris]
Length=486

 Score =   508 bits (1307),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 257/462 (56%), Positives = 328/462 (71%), Gaps = 5/462 (1%)
 Frame = -3

Query  1561  DPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDEN  1382
             D LIR P D       + ++ GTRWAVL+AGS+GY NYRHQADVCHAYQ+LK+GGLKDEN
Sbjct  28    DNLIRWPSDHPSIFESDDDSVGTRWAVLIAGSSGYWNYRHQADVCHAYQVLKKGGLKDEN  87

Query  1381  IVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvk  1202
             I+VFMYDDIA +  NPR GV+IN P G DVYAGVPKDYTG+ VT  N +A +LG+K+ + 
Sbjct  88    IIVFMYDDIAYDEENPRPGVLINSPYGHDVYAGVPKDYTGEDVTVNNFFAAILGNKDAIT  147

Query  1201  ggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIY  1022
             GGSGKVV+S  +D IFI+Y+DHGG GVLGMP  P+LYA++ IE LK+KH++GTYK +V+Y
Sbjct  148   GGSGKVVNSGPNDHIFIFYSDHGGAGVLGMPTYPYLYADELIETLKEKHASGTYKSLVVY  207

Query  1021  VEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAW  842
             +EACESGS FEG++PE LNIY TTASNA ESSWGTYCPG +P  PPEY TCLGDLYSV+W
Sbjct  208   IEACESGSIFEGILPEGLNIYATTASNAVESSWGTYCPGQDPNVPPEYDTCLGDLYSVSW  267

Query  841   MEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPA  662
             +EDSE HNL  E++++QYE VK +T+    +  GSHVM+YG +++ + + +YLY G +P 
Sbjct  268   IEDSERHNLHTESLKQQYEVVKTKTAEKPFY--GSHVMQYGDKELTQ-DMLYLYMGTNPN  324

Query  661   TINLPGNQIRRLTP--KGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
               N        L P     VNQRDADL+  W +++   + +  K    K+  + M HR  
Sbjct  325   NENYTYVDDNSLHPTSSNAVNQRDADLIHFWNKFRKASEGSQRKINAQKQFMEVMSHRVH  384

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             LD SI  +G  LFG E G  +L++VR  G  LVDDW CLK++VR FE HCGSL QYGMKH
Sbjct  385   LDDSIKLIGKLLFGIEKGLGVLQTVRPTGQPLVDDWNCLKTLVRTFEKHCGSLSQYGMKH  444

Query  307   MRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             MR+ ANICN+ I+   M EA    C    +  ++   + +SA
Sbjct  445   MRSIANICNAGITTNQMAEASAQACPSFPSGPWSSLHRGFSA  486



>ref|XP_010097094.1| Vacuolar-processing enzyme [Morus notabilis]
 gb|EXB66895.1| Vacuolar-processing enzyme [Morus notabilis]
Length=484

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 261/447 (58%), Positives = 321/447 (72%), Gaps = 10/447 (2%)
 Frame = -3

Query  1519  SPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAF  1340
             S + +  GTRWAVL+AGSNGY NYRHQADVCHAYQ+L++GGLKDENI+VFMYDD+A +  
Sbjct  47    SEDNDAVGTRWAVLIAGSNGYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDDVAYDEE  106

Query  1339  NPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDR  1160
             NPR G+IIN P+G DVY GVPKDYTGD VT  N +AV+LG+K  VKGGSGKVVDS  +D 
Sbjct  107   NPRPGIIINSPHGEDVYNGVPKDYTGDDVTVDNFFAVVLGNKTAVKGGSGKVVDSGPNDH  166

Query  1159  IFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMM  980
             IFI+Y+DHGGPGVLG+       A+D +EVLKKKH+AGTYK +V Y+EACESGS FEG++
Sbjct  167   IFIFYSDHGGPGVLGI-------ADDLLEVLKKKHAAGTYKSLVFYLEACESGSIFEGLL  219

Query  979   PEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETI  800
             PE LNIY TTASNAEESSWGTYCPG  P+PPPEY TCLGDLYSV+WMEDS+ HNL  E++
Sbjct  220   PEGLNIYATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYSVSWMEDSDVHNLRTESL  279

Query  799   ERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTP  620
              +QY+ VK RT+N N    GSHVM+YG   + K   ++LY G +PA  N        L P
Sbjct  280   HQQYQLVKTRTANENSIY-GSHVMQYGDVQLSK-NNLFLYLGTNPANDNFTFVDENSLRP  337

Query  619   K-GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGP  443
             +   VNQRDADL+  W +++   + +  K K  KE  + M HR  +D S+  +G  L G 
Sbjct  338   RTKAVNQRDADLVHFWVKFRKAPEGSPRKIKAQKEFVEAMSHRMHIDDSVKLIGKLLVGI  397

Query  442   ENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEA  263
             E    +L +VR  GL LVDDW CLK++VR FETHCGSL QYGMKHMR+FANICN+ I   
Sbjct  398   EKAPELLNAVRPAGLPLVDDWDCLKTLVRTFETHCGSLSQYGMKHMRSFANICNAGIRNE  457

Query  262   AMEEACKNTCSEMKTMKYTHPSKVYSA  182
              M EA    C  +   +++   K +SA
Sbjct  458   KMAEASAQACVNVPRSRWSSLQKGFSA  484



>ref|XP_010472621.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like [Camelina 
sativa]
Length=485

 Score =   507 bits (1305),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 270/470 (57%), Positives = 329/470 (70%), Gaps = 10/470 (2%)
 Frame = -3

Query  1573  AARWDPLIRQPVDQKDDESP---EGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKR  1403
             AA  D +IR P        P   E +   TRWAVLVAGS+GY NYRHQADVCHAYQ+LK+
Sbjct  20    AASSDNIIRLPSQASKFFGPPTQENDDGSTRWAVLVAGSSGYWNYRHQADVCHAYQLLKK  79

Query  1402  GGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLL  1223
             GG+K+ENIVVFMYDDIA +  NPR GVIIN PNG DVY GVPKDYTGD+V   NL+AV+L
Sbjct  80    GGVKEENIVVFMYDDIAKHEENPRPGVIINSPNGEDVYNGVPKDYTGDEVNVDNLFAVIL  139

Query  1222  gdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGT  1043
             G+K+ +KGGSGKVV+S  +D IFIYY+DHGGPGVLGMP  P+LYA D  +VLKKKH++GT
Sbjct  140   GNKKALKGGSGKVVNSGPNDHIFIYYSDHGGPGVLGMPTSPYLYAKDLNDVLKKKHASGT  199

Query  1042  YKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLG  863
             YK +  Y+EACESGS FEG++PE LNIY TTASNA ESSWGTYCPG +P+PP EY TCLG
Sbjct  200   YKSLAFYLEACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGEDPSPPSEYETCLG  259

Query  862   DLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYL  683
             DLYSVAWMEDS+ HNL  E++ +QYE VK RT+       GSHV+E+G   + K EK+ L
Sbjct  260   DLYSVAWMEDSDKHNLQTESLHQQYELVKKRTAGTGS-SYGSHVLEFGDIGLSK-EKLVL  317

Query  682   YQGFDPATINLP---GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEIT  512
             Y G +PA  N      N + R  P  V NQRDADL+  W++Y+   + +  K +  K++ 
Sbjct  318   YMGTNPANENFTFVDENLLLR-PPSRVTNQRDADLVHFWDKYRKAPEGSARKVEAQKQVI  376

Query  511   DTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGS  332
             + M HR  +D S+  +G  LFG E G  IL  VR  G  LVDDW  LKSMVR FE HCGS
Sbjct  377   EAMSHRLHVDNSVLLIGKLLFGLE-GPAILNKVRPSGKPLVDDWDLLKSMVRAFERHCGS  435

Query  331   LGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             L QYG+KHMR+ ANICN+ I    MEEA    C  +    ++   + +SA
Sbjct  436   LSQYGIKHMRSIANICNAGIQMTQMEEAAMQACPSIPAGPWSSLHRGFSA  485



>emb|CDX76736.1| BnaC08g33220D [Brassica napus]
Length=486

 Score =   506 bits (1304),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 262/450 (58%), Positives = 322/450 (72%), Gaps = 3/450 (1%)
 Frame = -3

Query  1528  DDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIAN  1349
             +D+  +  + GT+WAVLVAGS GY NYRHQADVCHAYQ+L++GG+K+ENIVVFMYDDIA 
Sbjct  39    EDDVCDDSSAGTKWAVLVAGSRGYWNYRHQADVCHAYQLLRKGGVKEENIVVFMYDDIAK  98

Query  1348  NAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKA  1169
             N  NPR G+IIN PNG DVY GVPKDYTGD V   NL+AV+LG+K  +KGGSGKVVDS  
Sbjct  99    NKENPRPGIIINSPNGDDVYNGVPKDYTGDDVNVDNLFAVILGNKTALKGGSGKVVDSGP  158

Query  1168  DDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFE  989
             +D IFIYY+DHGGPGVLGMP  P LYAND  +VLKKKH++GTYK +V Y+EACESGS FE
Sbjct  159   NDHIFIYYSDHGGPGVLGMPTSPALYANDLNDVLKKKHASGTYKSLVFYLEACESGSIFE  218

Query  988   GMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLME  809
             G++PE LNIY TTA+NAEESSWGTYCPG + + P E+ TCLGDLYSVAW+EDS+ HNL  
Sbjct  219   GLLPEGLNIYATTAANAEESSWGTYCPGEDTSVPSEFETCLGDLYSVAWLEDSDKHNLQT  278

Query  808   ETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRR  629
             E++ +QYE VK RT+       GSHVME+G   + K EK+ LY G +P   N        
Sbjct  279   ESLHQQYELVKKRTAATGS-SYGSHVMEFGDIGLSK-EKLVLYLGTNPDNENATFADENS  336

Query  628   LTP-KGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHL  452
             L P  GV NQRDADL+  WE+YK   + +  KA+  K++ + M HR  +D S+  +G  L
Sbjct  337   LRPFSGVTNQRDADLVHFWEKYKKAPEGSARKAEAQKQVLEAMSHRLHVDNSLLLIGKLL  396

Query  451   FGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNI  272
             FG   G  +L  VR  G  LVDDW CLK++VR FE HCGSL QYG+KHMR+ ANICN+ I
Sbjct  397   FGISEGPAVLNKVRPCGKPLVDDWDCLKTLVRAFEKHCGSLSQYGLKHMRSIANICNAGI  456

Query  271   SEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
                 MEEA    C  + T  ++   + +SA
Sbjct  457   RMEQMEEAAIQACPTIPTGPWSSLHQGFSA  486



>ref|XP_004159537.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
Length=493

 Score =   506 bits (1303),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 253/445 (57%), Positives = 325/445 (73%), Gaps = 7/445 (2%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GTRWAVL+AGSNGY NYRHQAD+CHAYQ+L++ GLKDENI+VFMYDDIA N  NPR 
Sbjct  53    DSVGTRWAVLIAGSNGYWNYRHQADICHAYQLLRKNGLKDENIIVFMYDDIAFNPENPRP  112

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIINHP G+DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVVDS  +D IFIY
Sbjct  113   GVIINHPKGSDVYHGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIY  172

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP  P++YA+D  +VLKKKH+AG+YK +V Y+EACESGS FEG++PE L
Sbjct  173   YSDHGGPGVLGMPTYPYMYADDLNKVLKKKHAAGSYKSLVFYLEACESGSIFEGLLPEGL  232

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNA ESSWGTYCPG  P+PPPEY TCLGDLYSVAW+EDS++HNL  E++ +QY
Sbjct  233   NIYTTTASNAYESSWGTYCPGDYPSPPPEYDTCLGDLYSVAWLEDSDNHNLKTESLRQQY  292

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPK  617
             E VK RT +   +  GSHVM+YG   ++    ++ Y G DPA  N   +  N +R  T  
Sbjct  293   ELVKKRTIS-GQYAYGSHVMQYGDL-MLNKNALFSYLGTDPANENNTFVEENSLRPATK-  349

Query  616   GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPEN  437
                NQRDADL+  WE+++   + +++K +  K+  + M HR  +D S+  +G  LFG + 
Sbjct  350   -FTNQRDADLVHFWEKFRKAPEGSLTKVEAQKKFVEAMSHRAHIDNSVKLVGKLLFGIKE  408

Query  436   GSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAM  257
             G  +L+++R  G  LVDDW CL++MVR FE  CGSL QYGMKHMR+FAN+CN+ IS+  M
Sbjct  409   GPEVLEAIRPAGRPLVDDWNCLRNMVRSFEARCGSLSQYGMKHMRSFANLCNAGISKEQM  468

Query  256   EEACKNTCSEMKTMKYTHPSKVYSA  182
              EA    C  +    ++   K ++A
Sbjct  469   AEASAQACMSVPPGPWSSLLKGFTA  493



>gb|KFK32531.1| hypothetical protein AALP_AA6G255400 [Arabis alpina]
Length=484

 Score =   506 bits (1302),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 260/443 (59%), Positives = 316/443 (71%), Gaps = 9/443 (2%)
 Frame = -3

Query  1498  GTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVI  1319
             G RWAVLVAGS GY NYRHQADVCHAYQ+L++GGLK+ENIVVFMYDDIA N  NPR GVI
Sbjct  47    GVRWAVLVAGSKGYWNYRHQADVCHAYQLLRKGGLKEENIVVFMYDDIAKNKENPRPGVI  106

Query  1318  INHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTD  1139
             IN P G DVY+GVPKDYTGD V   NL AV+L ++  +KGGSGKV+DS  +D IFIYY+D
Sbjct  107   INSPYGEDVYSGVPKDYTGDDVNVNNLSAVILRNRTALKGGSGKVLDSGPNDHIFIYYSD  166

Query  1138  HGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIY  959
             HGGPGVLGMP  PHLYAND  +VLKKKH++GTYK MV Y+EACESGS F+G++P+ LNIY
Sbjct  167   HGGPGVLGMPTSPHLYANDLNDVLKKKHASGTYKSMVFYLEACESGSIFDGLLPKGLNIY  226

Query  958   VTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENV  779
              TTASN EESSWGTYCPG +P+PP EY TCLGDLYSVAWMEDS+ HNL  E++ +QYE V
Sbjct  227   ATTASNPEESSWGTYCPGEDPSPPSEYETCLGDLYSVAWMEDSDKHNLQTESLHQQYEVV  286

Query  778   KLRTSNYNDFQAGSHVMEYGSRDI-IKPEKVYLYQGFDPATINLP---GNQIRRLTPKGV  611
             K RT+  +    GSHVMEYG  D+ +  +K+ LY G +P   N      N +R   P  V
Sbjct  287   KKRTAGSSS-SYGSHVMEYG--DVGLSIDKLVLYMGTNPDNENFTFVDENLLR--PPSRV  341

Query  610   VNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGS  431
              NQRDADL+  W++Y+   + +  K +  K++ + M HR  +D SI  +G  LFG   G 
Sbjct  342   TNQRDADLVHFWDKYRKAPEGSARKVEAQKQVLEVMSHRLHVDNSIQLIGKLLFGISEGP  401

Query  430   NILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEE  251
              +L  VR  G  LVDDW CLK++VR FE HCGSL QYG+KHMR+ ANICN  I    MEE
Sbjct  402   EVLNKVRPSGKPLVDDWDCLKTLVRAFERHCGSLSQYGIKHMRSIANICNVGIQMEEMEE  461

Query  250   ACKNTCSEMKTMKYTHPSKVYSA  182
             A    C  +    ++   + +SA
Sbjct  462   AAMQACPTIPAGPWSSLHRGFSA  484



>gb|EMT10444.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=532

 Score =   507 bits (1306),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 265/504 (53%), Positives = 336/504 (67%), Gaps = 50/504 (10%)
 Frame = -3

Query  1561  DPLIRQP----VDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGL  1394
             DP IR P      Q+DD+S      GTRWAVL+AGSNGY NYRHQAD+CHAYQI+K+GGL
Sbjct  35    DPTIRLPSQRAAGQEDDDS-----VGTRWAVLIAGSNGYYNYRHQADICHAYQIMKKGGL  89

Query  1393  KDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdk  1214
             KDENI+VFMY+DIA+N  NPR GVIINHP G DVYAGVPKDYTG +V   N +AVLLG+K
Sbjct  90    KDENIIVFMYNDIAHNPENPRPGVIINHPQGGDVYAGVPKDYTGKEVNVKNFFAVLLGNK  149

Query  1213  egvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKD  1034
               V GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LY +D ++VLKKKH+AGTYK 
Sbjct  150   TAVSGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTYPYLYGDDLVDVLKKKHAAGTYKS  209

Query  1033  MVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLY  854
             +V Y+EACESGS FEG++P D+ +Y TTASNAEESSWGTYCPG  P+PPPEY TCLGDLY
Sbjct  210   LVFYLEACESGSIFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPPEYDTCLGDLY  269

Query  853   SVAWMEDS---------------------------------------ESHNLMEETIERQ  791
             S++WMED                                        + HNL  E++++Q
Sbjct  270   SISWMEDRANLMAMELGASFAVNAPCRNSCSCCTQPYSYEIATEHHLDVHNLRTESLKQQ  329

Query  790   YENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRL-TPKG  614
             Y  VK RT+  + +  GSHVM+YGS D +  E ++ Y G +PA  N    +   L +   
Sbjct  330   YNLVKKRTAAQDSYSYGSHVMQYGSLD-LNAEHLFSYIGSNPANENTTFVEDNALPSFSR  388

Query  613   VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENG  434
              VNQRDADL++ W++Y+   +++  K    K++ + M HR  +D S++ +G  LFG   G
Sbjct  389   AVNQRDADLVYFWQKYRKLAESSPEKNDARKQLLEMMGHRSHIDNSVELIGNLLFGSAGG  448

Query  433   SNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAME  254
               +LK+VR  G  LVDDW CLKS VR FE+ CGSL QYGMKHMR+FANICN+ I   AM 
Sbjct  449   PMVLKAVRPAGEPLVDDWSCLKSTVRTFESQCGSLAQYGMKHMRSFANICNAGIVPEAMA  508

Query  253   EACKNTCSEMKTMKYTHPSKVYSA  182
             +     C+ + T  ++   K +SA
Sbjct  509   KVAAQACTSIPTNPWSATHKGFSA  532



>ref|XP_004142919.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
 gb|KGN62401.1| Vacuolar processing enzyme [Cucumis sativus]
Length=493

 Score =   506 bits (1302),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 253/445 (57%), Positives = 325/445 (73%), Gaps = 7/445 (2%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GTRWAVL+AGSNGY NYRHQAD+CHAYQ+L++ GLKDENI+VFMYDDIA N  NPR 
Sbjct  53    DSVGTRWAVLIAGSNGYWNYRHQADICHAYQLLRKNGLKDENIIVFMYDDIAFNPENPRP  112

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIINHP G+DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVVDS  +D IFIY
Sbjct  113   GVIINHPKGSDVYHGVPKDYTGEDVTVNNFFAAILGNKTALTGGSGKVVDSGPNDHIFIY  172

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP  P++YA+D  +VLKKKH+AG+YK +V Y+EACESGS FEG++PE L
Sbjct  173   YSDHGGPGVLGMPTYPYMYADDLNKVLKKKHAAGSYKSLVFYLEACESGSIFEGLLPEGL  232

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNA ESSWGTYCPG  P+PPPEY TCLGDLYSVAW+EDS++HNL  E++ +QY
Sbjct  233   NIYTTTASNAYESSWGTYCPGDYPSPPPEYDTCLGDLYSVAWLEDSDNHNLKTESLRQQY  292

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPK  617
             E VK RT +   +  GSHVM+YG   ++    ++ Y G DPA  N   +  N +R  T  
Sbjct  293   ELVKKRTLS-GQYAYGSHVMQYGDL-MLNKNALFSYLGTDPANENNTFVEENSLRPATK-  349

Query  616   GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPEN  437
                NQRDADL+  WE+++   + +++K +  K+  + M HR  +D S+  +G  LFG + 
Sbjct  350   -FTNQRDADLVHFWEKFRKAPEGSLTKVEAQKKFVEAMSHRAHIDNSVKLVGKLLFGIKE  408

Query  436   GSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAM  257
             G  +L+++R  G  LVDDW CL++MVR FE  CGSL QYGMKHMR+FAN+CN+ IS+  M
Sbjct  409   GPEVLEAIRPAGRPLVDDWNCLRNMVRSFEARCGSLSQYGMKHMRSFANLCNAGISKEQM  468

Query  256   EEACKNTCSEMKTMKYTHPSKVYSA  182
              EA    C  +    ++   K ++A
Sbjct  469   AEASAQACMSVPPGPWSSLLKGFTA  493



>ref|XP_006285517.1| hypothetical protein CARUB_v10006959mg [Capsella rubella]
 gb|EOA18415.1| hypothetical protein CARUB_v10006959mg [Capsella rubella]
Length=482

 Score =   504 bits (1299),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 277/474 (58%), Positives = 338/474 (71%), Gaps = 9/474 (2%)
 Frame = -3

Query  1588  LQNLQAARWDP--LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQ  1415
             L  L AAR  P  +I+ P        P     GTRWAVLVAGS+GY NYRHQAD+CHAYQ
Sbjct  13    LIALSAARNGPDDVIKLPSQASRFFRPPENDAGTRWAVLVAGSSGYGNYRHQADICHAYQ  72

Query  1414  ILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLY  1235
             +L++GGLK+ENIVVFMYDDIANN  NPR G IIN P+G DVY GVPKDYTGD VT  NL+
Sbjct  73    LLRKGGLKEENIVVFMYDDIANNYENPRPGTIINSPHGKDVYQGVPKDYTGDDVTVDNLF  132

Query  1234  AVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKH  1055
             AV+LGDK  +KGGSGKVVDS  +D IFI+Y+DHGGPGVLGMP  P++YAND  +VLKKKH
Sbjct  133   AVILGDKTAIKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTFPYIYANDLNDVLKKKH  192

Query  1054  SAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYI  875
             + GTYK +V Y+EACESGS FEG++PE LNIY TTASNAEESSWGTYCPG EP+PPPEY 
Sbjct  193   ALGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEEPSPPPEYD  252

Query  874   TCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPE  695
             TCLGDLYSVAWMEDS  HNL  ET+++QYE VK RT+  + +  GSHVM+YG   + K +
Sbjct  253   TCLGDLYSVAWMEDSGIHNLQTETLQQQYELVKKRTA-LDGYYYGSHVMQYGDVGLSK-D  310

Query  694   KVYLYQGFDPATIN---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLL  524
             K+ +Y G +PA  N   +  N ++   P  V NQRDADL+  WE+Y+   + +  KA+  
Sbjct  311   KLEIYMGTNPANENSTFVDSNSLK--LPSRVTNQRDADLVHFWEKYRKAPEGSSRKAEAQ  368

Query  523   KEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFET  344
             K++ + M HR  +D S+  +G  LFG   G  +L  VR  G  LVDDW CLK+MVR FE 
Sbjct  369   KQVLEVMSHRLHVDNSVILVGKILFGISKGPQVLNEVRSAGQPLVDDWNCLKNMVRAFER  428

Query  343   HCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             HCGSL QYG+KHMR+FAN CNS I    MEEA    C+ +    ++   + +SA
Sbjct  429   HCGSLSQYGIKHMRSFANFCNSGIQMEQMEEAASQACTTIPPGPWSSLHRGFSA  482



>ref|XP_008444493.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis melo]
Length=493

 Score =   505 bits (1300),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 254/445 (57%), Positives = 324/445 (73%), Gaps = 7/445 (2%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GTRWAVL+AGSNGY NYRHQAD+CHAYQ+L++ GLKDENI+VFMYDDIA N  NPR 
Sbjct  53    DSVGTRWAVLIAGSNGYWNYRHQADICHAYQLLRKNGLKDENIIVFMYDDIAFNPENPRP  112

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIINHP G+DVY GVPKDYTG+ V   N +A +LG++  + GGSGKVVDS  +D IFIY
Sbjct  113   GVIINHPKGSDVYHGVPKDYTGEDVNVNNFFAAILGNRTALTGGSGKVVDSGPNDHIFIY  172

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP  P++YA+D  EVLKKKH+AG+YK +V Y+EACESGS FEG++PE L
Sbjct  173   YSDHGGPGVLGMPTYPYIYADDLNEVLKKKHAAGSYKSLVFYLEACESGSIFEGLLPEGL  232

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNA ESSWGTYCPG  P PPPEY TCLGDLYSVAW+EDS++HNL  E++ +QY
Sbjct  233   NIYTTTASNAYESSWGTYCPGDYPGPPPEYDTCLGDLYSVAWLEDSDNHNLKTESLRQQY  292

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPK  617
             E VK RT + + +  GSHVM+YG   + K   ++ Y G DPA  N   +  N +R  T  
Sbjct  293   ELVKKRTLS-DQYAYGSHVMQYGDLKLNK-NALFSYLGTDPANENNTFVEENSLRPATK-  349

Query  616   GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPEN  437
                NQRDADL+  WE+++   + +++K +  K+  + M HR  +D S+  +G  LFG + 
Sbjct  350   -FTNQRDADLVHFWEKFRKAPEGSLTKVEAQKKFVEAMSHRAHIDNSVMLVGKLLFGIKE  408

Query  436   GSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAM  257
             G  +L++VR  G  +VDDW CL++MVR FE  CGSL QYGMKHMR+FANICN+ IS+  M
Sbjct  409   GPEVLEAVRPTGRPVVDDWDCLRNMVRSFEARCGSLSQYGMKHMRSFANICNAGISKEQM  468

Query  256   EEACKNTCSEMKTMKYTHPSKVYSA  182
              EA    C  +    ++   K ++A
Sbjct  469   AEASAQACVSVPPGPWSSLHKGFTA  493



>gb|ACB30368.1| vascular processing enzyme-3 [Capsicum annuum]
Length=484

 Score =   504 bits (1299),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 261/453 (58%), Positives = 315/453 (70%), Gaps = 9/453 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             D  DD+S      GTRWAVL+AGSNGY NYRHQADVCHAYQ+L++GGLKDENI+VFMYDD
Sbjct  40    DHADDDS-----VGTRWAVLLAGSNGYWNYRHQADVCHAYQLLRKGGLKDENIIVFMYDD  94

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR GVIIN+P   DVY GVPKDYT D+V   N  AVLLG+K  + GGSGKVV+
Sbjct  95    IAYNEENPRPGVIINNPAAEDVYEGVPKDYTRDEVNVHNFLAVLLGNKTALTGGSGKVVN  154

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFI+Y+DHGGPGVLGMP  P+LYA+D I  LKKKH+AG YK +V+Y+EACESGS
Sbjct  155   SGPNDHIFIFYSDHGGPGVLGMPTNPYLYASDLINALKKKHAAGAYKSLVLYIEACESGS  214

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++P  LNIY TTASNA ESSWGTYCPG  P+PPPEY TCLGDLY+V+WMEDSE HN
Sbjct  215   IFEGLLPTGLNIYATTASNAVESSWGTYCPGEYPSPPPEYETCLGDLYAVSWMEDSEMHN  274

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  E + +QY  VK RT+N N    GSHVM++G    +  E ++ + G +PA  N     
Sbjct  275   LRTENLRQQYHLVKRRTANGN--TCGSHVMQFGDLQ-LSMESLFSFMGTNPANDNYTYVD  331

Query  637   IRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLG  461
                L      VNQRDADLL  W++++   + +  K +  K+ T+ M HR  LD SI  +G
Sbjct  332   DNSLWASSRAVNQRDADLLHFWDKFRKAPEGSARKVEAQKQFTEAMSHRMHLDNSIALVG  391

Query  460   VHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICN  281
               LFG + G  +LK VR  G  LVDDW CLKS VR FETHCGSL QYGMKHMR+ ANICN
Sbjct  392   KLLFGIQKGPEVLKRVRSAGQPLVDDWACLKSFVRTFETHCGSLSQYGMKHMRSIANICN  451

Query  280   SNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             + I    M EA    C  +    ++   + +SA
Sbjct  452   AGIHTEQMVEASAQACPSIPANTWSSLHRGFSA  484



>ref|XP_002993765.1| hypothetical protein SELMODRAFT_137569 [Selaginella moellendorffii]
 gb|EFJ05184.1| hypothetical protein SELMODRAFT_137569 [Selaginella moellendorffii]
Length=438

 Score =   502 bits (1293),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 253/419 (60%), Positives = 316/419 (75%), Gaps = 6/419 (1%)
 Frame = -3

Query  1519  SPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAF  1340
             S E    GTRWA+LVAGS+G+ NYRHQADVCHAYQ+L+  GLK+ENIVV M+DDIANN  
Sbjct  3     SSEDVASGTRWALLVAGSSGFGNYRHQADVCHAYQLLRSNGLKEENIVVMMFDDIANNTD  62

Query  1339  NPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDR  1160
             NPR G IINHP G+DVYAGVPKDYTG  VTA N  AVLLGDK    GG+GKVV S  +D 
Sbjct  63    NPRPGTIINHPQGSDVYAGVPKDYTGAAVTAENFLAVLLGDKNSTSGGTGKVVSSGPEDH  122

Query  1159  IFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMM  980
             +F++Y+DHGGPGVLGMP   +LYAND I+V+KKKH++G Y++MVIY+EACESGS  EG++
Sbjct  123   VFLFYSDHGGPGVLGMPGESNLYANDLIDVIKKKHASGGYREMVIYIEACESGSMVEGLL  182

Query  979   PEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETI  800
             P  L++YVTTASNA ESSWGTYCPG  P+ PPEY TCLGDLYSVAWMEDSE HNL  ET+
Sbjct  183   PLGLDLYVTTASNAIESSWGTYCPGMLPSAPPEYDTCLGDLYSVAWMEDSEVHNLKRETL  242

Query  799   ERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTP  620
              +QY +VK RTSN+N ++AGSHVM+YG  + +    + ++ GFDPA  +  G+ I   + 
Sbjct  243   LQQYLDVKDRTSNHNTYEAGSHVMQYGDVE-LNSNPLSMFLGFDPAIADGNGDLIIPSSA  301

Query  619   KGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPE  440
              G V+QRDADLL +W +Y+   D + +K +  + + + + HRQ +D S+D +G  LFG +
Sbjct  302   NG-VSQRDADLLHLWSKYRRAKDGS-AKREARERMMNALAHRQHVDESVDQVGERLFGSK  359

Query  439   -NGSNILKSVRKPGLALVDDWQCLKSM--VRVFETHCGSLGQYGMKHMRAFANICNSNI  272
                S +L +VR  GLALVDDW CLKS+  V+ FET CG LGQYGMKHMRAFAN+CN  +
Sbjct  360   AAASKVLSTVRGSGLALVDDWTCLKSLASVQAFETSCGLLGQYGMKHMRAFANLCNEGV  418



>sp|P49044.1|VPE_VICSA RecName: Full=Vacuolar-processing enzyme; Short=VPE; AltName: 
Full=Proteinase B; Flags: Precursor [Vicia sativa]
 emb|CAA84383.1| cysteine proteinase [Vicia sativa]
Length=493

 Score =   504 bits (1298),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 264/463 (57%), Positives = 332/463 (72%), Gaps = 16/463 (3%)
 Frame = -3

Query  1555  LIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIV  1376
               R+P +  D E       GTRWA+L+AGSNGY NYRHQ+DVCHAYQ+L++GG K+ENI+
Sbjct  42    FFREPKNDDDFE-------GTRWAILLAGSNGYWNYRHQSDVCHAYQLLRKGGSKEENII  94

Query  1375  VFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkgg  1196
             VFMYDDIA+N  NPR GVIIN P+G DVYAGVPKDYTG +V A N YA LLG+K  + GG
Sbjct  95    VFMYDDIASNEENPRPGVIINKPDGDDVYAGVPKDYTGAEVHADNFYAALLGNKSALTGG  154

Query  1195  sgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVE  1016
             SGKVVDS  +D IF+YYTDHGGPGVLGMP  P+LYA+D  EVLKKKH++GTYK +V Y+E
Sbjct  155   SGKVVDSGPNDHIFVYYTDHGGPGVLGMPVGPYLYASDLNEVLKKKHASGTYKSLVFYLE  214

Query  1015  ACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWME  836
             ACESGS FEG++P+DLNIY TTASNAEESSWG YCPG +P PPPEY TCLGDLYS+AWME
Sbjct  215   ACESGSIFEGLLPDDLNIYATTASNAEESSWGYYCPGDKPPPPPEYSTCLGDLYSIAWME  274

Query  835   DSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPAT-  659
             DSE HNL  E++++QY+ VK RT +      GSHVMEYG   + K + +Y Y G +PA  
Sbjct  275   DSEVHNLQTESLQQQYKLVKNRTISE---PYGSHVMEYGDIGLSKND-LYQYLGTNPAND  330

Query  658   ----INLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
                 ++   N ++  TP   VNQRDADL+  WE+++   + +  K +  K++ + M HR+
Sbjct  331   NNSFVDETENSLKLRTPSAAVNQRDADLIHFWEKFRKAPEGSSQKNEAEKQVLEAMSHRK  390

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              +D S+  +G  LFG E G+ +L  VR  G  LVD+W CLK+MV+ FETHCGSL QYGMK
Sbjct  391   HIDNSVKLIGQLLFGIEKGTELLDVVRPAGSPLVDNWDCLKTMVKTFETHCGSLSQYGMK  450

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             HMR+FANICN+ I    M EA    C+ +    ++     +SA
Sbjct  451   HMRSFANICNAGIPNEPMAEASAQACASIPANPWSSLQGGFSA  493



>emb|CDX75302.1| BnaA01g04000D [Brassica napus]
Length=487

 Score =   504 bits (1297),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 281/480 (59%), Positives = 343/480 (71%), Gaps = 16/480 (3%)
 Frame = -3

Query  1588  LQNLQAARWDP---LIRQP-------VDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQ  1439
             L  L AAR +P   +I+ P       +   DD+S    + GTRWAVLVAGS+GY NYRHQ
Sbjct  13    LIALSAARQNPDDDVIKLPSQASRFFLPNNDDDS---SSSGTRWAVLVAGSSGYWNYRHQ  69

Query  1438  ADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGD  1259
             ADVCHAYQ+L++GGLK+ENIVVFMYDDIA+N  NPRKG+IIN P+G+DVY GVPKDYTGD
Sbjct  70    ADVCHAYQLLRKGGLKEENIVVFMYDDIADNEENPRKGIIINSPHGSDVYEGVPKDYTGD  129

Query  1258  QVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDF  1079
              VT  NL+AV+LGDK  VKGGSGKVVDS  +D IFI+Y+DHGGPGVLGMP  P+LYA+D 
Sbjct  130   DVTVENLFAVILGDKGAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYADDL  189

Query  1078  IEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSE  899
              +VLKKKH++GTYK MV Y+EACESGS FEG++ E LNIY TTASNA ESSWGTYCPG E
Sbjct  190   NDVLKKKHASGTYKSMVFYLEACESGSIFEGLLEEGLNIYATTASNAVESSWGTYCPGEE  249

Query  898   PAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYG  719
             P+PPPEY TCLGDLYSVAWMEDS  HNL  ET+ +QYE VK RT+       GSHVM+YG
Sbjct  250   PSPPPEYETCLGDLYSVAWMEDSGMHNLQTETLRQQYELVKRRTAG-GASAYGSHVMQYG  308

Query  718   SRDIIKPEKVYLYQGFDPATINLPGNQIRRLT-PKGVVNQRDADLLFMWERYKMKGDNAV  542
                + K +K+ LY G +PA  N        LT P GV NQRDADL+  W++Y+   + + 
Sbjct  309   DVGLNK-DKLDLYMGTNPANDNFTFVDANSLTPPSGVTNQRDADLVHFWDKYRKAPEGST  367

Query  541   SKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSM  362
              K +  K++ + M HR  +D S+  +G  LFG   GS +L  VR  G  L DDW CLK+M
Sbjct  368   RKTEAQKQVLEAMSHRLHVDNSVKLIGKLLFGISEGSEVLNKVRPAGQPLADDWTCLKNM  427

Query  361   VRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             VR FE HCGSL QYG+KHMR+FANICN+ I    MEEA    C+ + +  ++   + +SA
Sbjct  428   VRAFERHCGSLSQYGIKHMRSFANICNAGIQMRQMEEAASQACTSIPSGPWSSLHRGFSA  487



>ref|XP_009125229.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme [Brassica 
rapa]
Length=487

 Score =   503 bits (1296),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 282/484 (58%), Positives = 343/484 (71%), Gaps = 16/484 (3%)
 Frame = -3

Query  1600  IACQLQNLQAARWDP---LIRQPVD-------QKDDESPEGETQGTRWAVLVAGSNGYAN  1451
             I   L  L AAR +P   +I+ P           DD+S    + GTRWAVLVAGS+GY N
Sbjct  9     IFLSLIALSAARQNPDDDVIKLPSQASRFFRPNNDDDS---SSSGTRWAVLVAGSSGYWN  65

Query  1450  YRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKD  1271
             YRHQADVCHAYQ+L++GGLK+ENIVVFMYDDIA+N  NPRKG+IIN P+G+DVY GVPKD
Sbjct  66    YRHQADVCHAYQLLRKGGLKEENIVVFMYDDIADNEENPRKGIIINSPHGSDVYEGVPKD  125

Query  1270  YTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLY  1091
             YTGD VT  NL+AV+LGDK  VKGGSGKVVDS  +D IFI+Y+DHGGPGVLGMP  P+LY
Sbjct  126   YTGDDVTVENLFAVILGDKGAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLY  185

Query  1090  ANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYC  911
             A+D  +VLKKKH++GTYK MV Y+EACESGS FEG++ E LNIY TTASNA ESSWGTYC
Sbjct  186   ADDLNDVLKKKHASGTYKSMVFYLEACESGSIFEGLLEEGLNIYATTASNAVESSWGTYC  245

Query  910   PGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHV  731
             PG EP+PPPEY TCLGDLYSVAWMEDS  HNL  ET+ +QYE VK RT+       GSHV
Sbjct  246   PGEEPSPPPEYETCLGDLYSVAWMEDSGVHNLQTETLRQQYELVKKRTAG-GASAYGSHV  304

Query  730   MEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLT-PKGVVNQRDADLLFMWERYKMKG  554
             M+YG   + K +K+ LY G +PA  N        LT P GV NQRDADL+  W++Y+   
Sbjct  305   MQYGDVGLNK-DKLDLYMGTNPANDNFTFVDANSLTPPSGVTNQRDADLVHFWDKYRKAP  363

Query  553   DNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQC  374
             + +  K +  K++ + M HR  +D S+  +G  LFG   GS +L  VR  G  L DDW C
Sbjct  364   EGSTRKTEAQKQVLEAMSHRLHVDNSVKLVGKLLFGISEGSEVLNKVRPAGQPLADDWTC  423

Query  373   LKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSK  194
             LK+MVR FE HCGSL QYG+KHMR+FANICN+ I    MEEA    C+ + +  ++   +
Sbjct  424   LKNMVRAFERHCGSLSQYGIKHMRSFANICNAGIQMRQMEEAASQACTSIPSGPWSSLHR  483

Query  193   VYSA  182
              +SA
Sbjct  484   GFSA  487



>ref|XP_001769381.1| predicted protein [Physcomitrella patens]
 gb|EDQ65750.1| predicted protein [Physcomitrella patens]
Length=457

 Score =   501 bits (1290),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 260/435 (60%), Positives = 321/435 (74%), Gaps = 7/435 (2%)
 Frame = -3

Query  1522  ESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNA  1343
             E  +GE +GTRWA+L+AGS GY NYRHQADVCHAYQILKRGGLKDENI+VFM+DDIA + 
Sbjct  5     EGHKGE-EGTRWAILIAGSAGYWNYRHQADVCHAYQILKRGGLKDENIIVFMHDDIAYHP  63

Query  1342  FNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADD  1163
              NP  G IIN P+G DVY GVPKDYTG  VT +NLYA +LGDK  ++GG+GKVVDS  +D
Sbjct  64    ENPYPGTIINKPDGPDVYQGVPKDYTGSDVTVSNLYAAILGDKSAIEGGTGKVVDSGPND  123

Query  1162  RIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGM  983
              IFIYY+DHGGPGVLGMPN P+LYA+DF+ +LKKK +AGT+K++VIY+EACESGS FEG+
Sbjct  124   HIFIYYSDHGGPGVLGMPNPPNLYADDFVGILKKKAAAGTFKELVIYLEACESGSIFEGL  183

Query  982   MPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEET  803
             +PE LNIYVTTASNA ESSWGTYCPG  P+PP EY TCLGDLYSVAWMED+E  NL +ET
Sbjct  184   LPEGLNIYVTTASNAVESSWGTYCPGMYPSPPSEYGTCLGDLYSVAWMEDTEKENLKKET  243

Query  802   IERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLT  623
             +E QY  VK RTSN+N +++GSHVM+YG    I  E++  Y GFDPA  N+    +  L+
Sbjct  244   LEDQYLIVKSRTSNHNTYRSGSHVMQYGDLK-IDVEELERYLGFDPANENVTKPGLSELS  302

Query  622   PKGV-----VNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGV  458
             P        V QR+ADL+ +  ++      ++ +A    E+  T+LHR+ LD S+  +G 
Sbjct  303   PVNSDIVTHVPQREADLVHLKHKFYNAKKGSLREANAASELAKTILHRRHLDDSVRLIGE  362

Query  457   HLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNS  278
              LF  E+    L +VR  G  +VDDW CLK+MVR+FE  CG L QYGMKHMRAFANICN+
Sbjct  363   LLFAGEDALQKLGAVRPAGSVVVDDWACLKNMVRIFEASCGPLTQYGMKHMRAFANICNA  422

Query  277   NISEAAMEEACKNTC  233
              I+ + M  A    C
Sbjct  423   GINSSRMSLASLEVC  437



>ref|XP_008220440.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-processing enzyme-like 
[Prunus mume]
Length=520

 Score =   503 bits (1296),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 265/464 (57%), Positives = 322/464 (69%), Gaps = 34/464 (7%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             D   DE  +G T GTRWAVL+AGSNGY NYRHQAD+CHAYQ+LK+GGLKDENIVVFMYDD
Sbjct  45    DDGPDEQDDG-TVGTRWAVLIAGSNGYWNYRHQADICHAYQLLKKGGLKDENIVVFMYDD  103

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA N  NPR GVIIN P+G DVY GVPKDYTGD VT  N +A +LG+K  + GG+GKVVD
Sbjct  104   IAYNEENPRPGVIINSPHGDDVYKGVPKDYTGDDVTVNNFFAAILGNKTALTGGTGKVVD  163

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNL--------------------------PHLYANDFI  1076
             S  +D IFIYY+DHGGPGVLG                              P++YAND I
Sbjct  164   SGPNDHIFIYYSDHGGPGVLGXYQFCTXQYXYYFAHIPISYLLXXXXXXXXPYIYANDLI  223

Query  1075  EVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEP  896
             EVLKKKH+AGTYK +V Y+EACESGS FEG++P+ LNI+ TTASNAEESSWGTYCPG  P
Sbjct  224   EVLKKKHAAGTYKSLVFYLEACESGSIFEGLLPKGLNIFATTASNAEESSWGTYCPGEYP  283

Query  895   APPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGS  716
             +PPPEY TCLGDLYSVAWMEDS+ HNL  ET+ +QYE VK RT+N N    GSHVM+YG 
Sbjct  284   SPPPEYETCLGDLYSVAWMEDSDVHNLRSETLHQQYELVKTRTANDNS-GFGSHVMQYGD  342

Query  715   RDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNA  545
               + K E +++Y G +PA  N   L  N +R  T    VNQRDADL+  W +Y+   + +
Sbjct  343   VGLSK-ENLFVYMGTNPANDNYTFLGENSLRPSTK--AVNQRDADLVHFWHKYRKAPEGS  399

Query  544   VSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKS  365
               K +  K+  + M HR  +D ++  +G  LFG + G  +L +VR  G  LVDDW CLK+
Sbjct  400   PRKIQAQKDFVEAMSHRMHMDQTMKLIGKLLFGIKKGPEVLNTVRPAGQPLVDDWDCLKT  459

Query  364   MVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTC  233
             MVR FET+CGSL QYGMKHMR+ ANICN+ +++  M +A    C
Sbjct  460   MVRSFETYCGSLSQYGMKHMRSLANICNAGMTKEQMADASAQAC  503



>ref|XP_009780274.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana sylvestris]
Length=481

 Score =   502 bits (1292),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 260/470 (55%), Positives = 325/470 (69%), Gaps = 3/470 (1%)
 Frame = -3

Query  1588  LQNLQAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQIL  1409
             L  + AA    +++ P +         ++ GTRWAVL+AGSNGY NYRHQADVCHAYQ+L
Sbjct  14    LSVIAAAAGRNVLKLPSEASRFFDEADDSVGTRWAVLLAGSNGYWNYRHQADVCHAYQLL  73

Query  1408  KRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAV  1229
             ++GGLKDENI+VFMYDDIA N  NPR+GVIIN P G DVY GVPKDYTGD V   N  AV
Sbjct  74    RKGGLKDENIIVFMYDDIAYNEENPRQGVIINSPAGEDVYKGVPKDYTGDDVNVDNFLAV  133

Query  1228  LLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSA  1049
             LLG+K  + GGSGKVVDS  +D IF++Y+DHGGPGVLGMP  P+LYA+D I+VLKKKH++
Sbjct  134   LLGNKTALTGGSGKVVDSGPNDHIFVFYSDHGGPGVLGMPTNPYLYASDLIDVLKKKHAS  193

Query  1048  GTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITC  869
             GTYK +V+Y+EACESGS FEG++P+ LNIY TTASNA ESSWGTYCPG  P+ PP Y TC
Sbjct  194   GTYKSLVLYIEACESGSIFEGLLPKGLNIYATTASNAVESSWGTYCPGDYPSLPPGYETC  253

Query  868   LGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKV  689
             LGDLY+V+WMEDSE HNL  E + +QY  VK RT+N N    GSHV+++G    +  + +
Sbjct  254   LGDLYAVSWMEDSEMHNLRTENLRQQYHLVKQRTANGNS-AYGSHVLQFGDLQ-LSMDSL  311

Query  688   YLYQGFDPATINLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEIT  512
             ++Y G +PA  N        L      VNQRDADLL  W++++   + +  K +  K+ T
Sbjct  312   FIYMGTNPANDNYTYVDDNSLWASSKAVNQRDADLLHFWDKFRKAPEGSARKVEAQKQFT  371

Query  511   DTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGS  332
             + M HR  LD S+  +G  LFG + G  +LK VR  G  LVDDW CLKS VR FETHCGS
Sbjct  372   EAMSHRMHLDNSMALVGKLLFGIQKGPEVLKRVRPVGQPLVDDWTCLKSFVRTFETHCGS  431

Query  331   LGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             L QYGMKHMR+ ANICN  I    M EA    C  + +  ++   + +SA
Sbjct  432   LSQYGMKHMRSIANICNDGIKMEQMVEASAQACPSVPSNTWSSLHRGFSA  481



>emb|CDX68923.1| BnaC01g05300D [Brassica napus]
Length=487

 Score =   501 bits (1291),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 280/484 (58%), Positives = 342/484 (71%), Gaps = 16/484 (3%)
 Frame = -3

Query  1600  IACQLQNLQAARWDP---LIRQPVD-------QKDDESPEGETQGTRWAVLVAGSNGYAN  1451
             +   L  + AAR +P   +I+ P           DDES    + GTRWAVLVAGS+GY N
Sbjct  9     LVLSLIAVSAARQNPDDDVIKLPSQASRFFRPNNDDES---SSSGTRWAVLVAGSSGYWN  65

Query  1450  YRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKD  1271
             YRHQADVCHAYQ+L++GGLK+ENIVVFMYDDIA+N  NPRKG+IIN P+G+DVY GVPKD
Sbjct  66    YRHQADVCHAYQLLRKGGLKEENIVVFMYDDIADNEENPRKGIIINSPHGSDVYEGVPKD  125

Query  1270  YTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLY  1091
             YTGD VT  NL+AV+LGDK  VKGGSGKVVDS  +D IFI+Y+DHGGPGVLGMP  P+LY
Sbjct  126   YTGDDVTVDNLFAVILGDKTAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLY  185

Query  1090  ANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYC  911
             A+D  +VLKKKH++GTYK MV Y+EACESGS FEG++ E LNIY TTASNA ESSWGTYC
Sbjct  186   ADDLNDVLKKKHASGTYKSMVFYLEACESGSIFEGLLEEGLNIYATTASNAVESSWGTYC  245

Query  910   PGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHV  731
             PG EP+PPPEY TCLGDLYSVAWMEDS  HNL  ET+ +QYE VK RT+       GSHV
Sbjct  246   PGEEPSPPPEYETCLGDLYSVAWMEDSGVHNLQTETLRQQYELVKRRTAG-GASAYGSHV  304

Query  730   MEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLT-PKGVVNQRDADLLFMWERYKMKG  554
             M+YG   + K +K+ LY G +PA  N        LT P GV NQRDADL+  W++Y+   
Sbjct  305   MQYGDVGLNK-DKLDLYMGTNPANDNFTFVDANSLTPPSGVTNQRDADLVHFWDKYRKAP  363

Query  553   DNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQC  374
             + +  K +  K++ + M HR  +D S+  +G  LFG   GS +L  VR  G  L DDW C
Sbjct  364   EGSTRKTEAQKQVLEAMSHRLHVDNSVKLVGKLLFGISEGSEVLNKVRPAGQPLADDWTC  423

Query  373   LKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSK  194
             LK+ VR FE HCGSL QYG+KHMR+FANICN+ I    MEEA    C+ + +  ++   +
Sbjct  424   LKNTVRAFERHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQACTSIPSGPWSSLHR  483

Query  193   VYSA  182
              +SA
Sbjct  484   GFSA  487



>ref|XP_009616632.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
 dbj|BAC54830.1| vacuolar processing enzyme-3 [Nicotiana tabacum]
Length=481

 Score =   501 bits (1290),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 257/445 (58%), Positives = 319/445 (72%), Gaps = 7/445 (2%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GTRWAVL+AGSNGY NYRHQADVCHAYQ+L++GGLKDENI++FMYDDIA N  NPR+
Sbjct  41    DSVGTRWAVLLAGSNGYWNYRHQADVCHAYQLLRKGGLKDENIIMFMYDDIAYNEENPRQ  100

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIIN P G DVY GVPKDYTGD V   N  AVLLG+K  + GGSGKVVDS  +D IFI+
Sbjct  101   GVIINSPAGEDVYKGVPKDYTGDDVNVDNFLAVLLGNKTALTGGSGKVVDSGPNDHIFIF  160

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP  P+LYA+D I+VLKKKH++GTYK +V+Y+EACESGS FEG++P+ L
Sbjct  161   YSDHGGPGVLGMPTNPYLYASDLIDVLKKKHASGTYKSLVLYIEACESGSIFEGLLPKGL  220

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNA ESSWGTYCPG  P+ PP Y TCLGDLY+V+WMEDSE HNL  E + +QY
Sbjct  221   NIYATTASNAVESSWGTYCPGDYPSLPPGYETCLGDLYAVSWMEDSEMHNLRTENLRQQY  280

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQIRRLTPK  617
               VK RT+N N    GSHV+++G    +  + +++Y G +PA  N   +  N +R     
Sbjct  281   HLVKERTANGNS-AYGSHVLQFGDLQ-LGMDSLFMYMGTNPANDNYTYVDDNSLR--ASS  336

Query  616   GVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPEN  437
               VNQRDADLL  W++++   + +  K +  K+ T+ M HR  LD S+  +G  LFG + 
Sbjct  337   KAVNQRDADLLHFWDKFRKAPEGSARKVEAQKQFTEAMSHRMHLDNSMALVGKLLFGIQK  396

Query  436   GSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAM  257
             G  +LK VR  G  LVDDW CLK  VR FETHCGSL QYGMKHMR+ ANICN+ I    M
Sbjct  397   GPEVLKRVRPVGQPLVDDWTCLKYFVRTFETHCGSLSQYGMKHMRSIANICNAGIKMEQM  456

Query  256   EEACKNTCSEMKTMKYTHPSKVYSA  182
              EA    C  + T  ++   + +SA
Sbjct  457   VEASTQACPSVPTNIWSSLHRGFSA  481



>ref|XP_006450795.1| hypothetical protein CICLE_v10008097mg [Citrus clementina]
 gb|ESR64035.1| hypothetical protein CICLE_v10008097mg [Citrus clementina]
 gb|KDO80005.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=494

 Score =   500 bits (1287),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 262/443 (59%), Positives = 324/443 (73%), Gaps = 4/443 (1%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GTRWAVL+AGSNG+ NYRHQAD+CHAYQ+L++GGLKDENI+VFMYDDIA N  NPR 
Sbjct  55    DSVGTRWAVLLAGSNGFWNYRHQADICHAYQLLRKGGLKDENIIVFMYDDIAFNEENPRP  114

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIINHP+G DVY GVPKDYTG+ VT  N +AV+LG+K  + GGSGKVVDS  +D IFI+
Sbjct  115   GVIINHPHGDDVYKGVPKDYTGEDVTVENFFAVILGNKTALTGGSGKVVDSGPNDHIFIF  174

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP   ++YA++ I+VLKKKH++G YK +V Y+EACESGS FEG++PE L
Sbjct  175   YSDHGGPGVLGMPTSRYIYADELIDVLKKKHASGNYKSLVFYLEACESGSIFEGLLPEGL  234

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNAEESSWGTYCPG  P PPPEY TCLGDLYS+AWMEDS+ HNL  ET+ +QY
Sbjct  235   NIYATTASNAEESSWGTYCPGEIPGPPPEYSTCLGDLYSIAWMEDSDIHNLRTETLHQQY  294

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKG-V  611
             E VK RT++YN +  GSHVM+YG   + K   ++ Y G +PA  N        L P    
Sbjct  295   ELVKTRTASYNSY--GSHVMQYGDIGLSK-NNLFTYLGTNPANDNYTFVDENSLRPASKA  351

Query  610   VNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGS  431
             VNQRDADLL  W++Y+   +    KA+  K+  + M HR  +D SI  +G  LFG E G 
Sbjct  352   VNQRDADLLHFWDKYRKAPEGTPRKAEAQKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGP  411

Query  430   NILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEE  251
              IL +VR  G  LVDDW CLKS+VR FE+HCG+L QYGMKHMR+ ANICN+ I +  M E
Sbjct  412   EILNTVRPAGQPLVDDWGCLKSLVRTFESHCGALSQYGMKHMRSLANICNTGIGKEKMAE  471

Query  250   ACKNTCSEMKTMKYTHPSKVYSA  182
             A    C  + +  ++   K +SA
Sbjct  472   ASAQACENIPSGPWSSLDKGFSA  494



>gb|KFK29905.1| hypothetical protein AALP_AA7G193600 [Arabis alpina]
Length=488

 Score =   500 bits (1287),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 272/453 (60%), Positives = 329/453 (73%), Gaps = 7/453 (2%)
 Frame = -3

Query  1537  DQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDD  1358
             D  DD+S      GTRWAVLVAGS+GY NYRHQAD+CHAYQ+L++GGLK+ENIVVFMYDD
Sbjct  42    DVNDDDS----NSGTRWAVLVAGSSGYWNYRHQADICHAYQLLRKGGLKEENIVVFMYDD  97

Query  1357  IANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvd  1178
             IA+N  NPRKG+IIN P+G DVY GVPKDYTGD V+  NL+AVLLGDK  VKGGSGKVVD
Sbjct  98    IADNEENPRKGIIINSPHGKDVYQGVPKDYTGDDVSVENLFAVLLGDKTAVKGGSGKVVD  157

Query  1177  sKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGS  998
             S  +D IFI+Y+DHGGPGVLGMP  P+LYAND  +VLKKKH++GTYK +V Y+EACESGS
Sbjct  158   SGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHASGTYKSLVFYLEACESGS  217

Query  997   FFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHN  818
              FEG++ E LNIY TTASNAEESSWGTYCPG EP+PPPEY TCLGDLYSVAWMEDS  HN
Sbjct  218   IFEGLLEEGLNIYATTASNAEESSWGTYCPGEEPSPPPEYETCLGDLYSVAWMEDSGIHN  277

Query  817   LMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQ  638
             L  ET+ +QYE VK RTS       GSHVM+YG   + K   + +Y G +PA  N     
Sbjct  278   LQTETLHQQYELVKRRTSGVGSVY-GSHVMQYGDAGLGK-NNLDIYMGTNPANDNFTFVD  335

Query  637   IRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLG  461
                L P   V NQRDADL+  W++Y+   + +  K +  K++ + M HR  +D S+  +G
Sbjct  336   ANSLMPPSRVTNQRDADLVHFWDKYRKAPEGSTRKTEAQKQVLEAMSHRLHVDNSVKLVG  395

Query  460   VHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICN  281
               LFG   GS +L  VR  G  LVDDW+CLK+MVR FE HCGSL QYG+KHMR+FANICN
Sbjct  396   KLLFGISEGSEVLNKVRSAGQPLVDDWKCLKNMVRAFERHCGSLSQYGIKHMRSFANICN  455

Query  280   SNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             + I    MEEA    C+ + +  ++   + +SA
Sbjct  456   AGIQMEQMEEAASQACTTIPSGHWSSLHRGFSA  488



>ref|NP_180165.1| alpha-vacuolar processing enzyme [Arabidopsis thaliana]
 sp|P49047.2|VPEA_ARATH RecName: Full=Vacuolar-processing enzyme alpha-isozyme; AltName: 
Full=Alpha-VPE; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC31241.1| putative vacuolar processing enzyme [Arabidopsis thaliana]
 dbj|BAA09614.2| alpha-VPE [Arabidopsis thaliana]
 gb|AAL24163.1| At2g25940/F17H15.3 [Arabidopsis thaliana]
 gb|AAL90957.1| At2g25940/F17H15.3 [Arabidopsis thaliana]
 gb|AAM15043.1| putative vacuolar processing enzyme [Arabidopsis thaliana]
 gb|AEC07775.1| alpha-vacuolar processing enzyme [Arabidopsis thaliana]
Length=478

 Score =   498 bits (1283),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 268/447 (60%), Positives = 323/447 (72%), Gaps = 8/447 (2%)
 Frame = -3

Query  1513  EGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNP  1334
             E +   T+WAVLVAGS+GY NYRHQADVCHAYQ+LK+GG+K+ENIVVFMYDDIA N  NP
Sbjct  37    ENDDDSTKWAVLVAGSSGYWNYRHQADVCHAYQLLKKGGVKEENIVVFMYDDIAKNEENP  96

Query  1333  RKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIF  1154
             R GVIIN PNG DVY GVPKDYTGD+V   NL AV+LG+K  +KGGSGKVVDS  +D IF
Sbjct  97    RPGVIINSPNGEDVYNGVPKDYTGDEVNVDNLLAVILGNKTALKGGSGKVVDSGPNDHIF  156

Query  1153  IYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPE  974
             IYY+DHGGPGVLGMP  P+LYAND  +VLKKK+++GTYK +V Y+EACESGS FEG++PE
Sbjct  157   IYYSDHGGPGVLGMPTSPNLYANDLNDVLKKKYASGTYKSLVFYLEACESGSIFEGLLPE  216

Query  973   DLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIER  794
              LNIY TTASNAEESSWGTYCPG +P+PP EY TCLGDLYSVAW+EDSE HNL  ET+  
Sbjct  217   GLNIYATTASNAEESSWGTYCPGEDPSPPSEYETCLGDLYSVAWIEDSEKHNLQTETLHE  276

Query  793   QYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLP---GNQIRRLT  623
             QYE VK RT+       GSHVME+G   + K EK+ L+ G +PA  N      N IR   
Sbjct  277   QYELVKKRTAGSGK-SYGSHVMEFGDIGLSK-EKLVLFMGTNPADENFTFVNENSIR--P  332

Query  622   PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGP  443
             P  V NQRDADL+  W +Y+   + +  K +  K++ + M HR  +D SI  +G+ LFG 
Sbjct  333   PSRVTNQRDADLVHFWHKYQKAPEGSARKVEAQKQVLEAMSHRLHVDNSILLIGILLFGL  392

Query  442   ENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEA  263
             E G  +L  VR  G  LVDDW CLKS+VR FE HCGSL QYG+KHMR+ AN+CN+ I   
Sbjct  393   E-GHAVLNKVRPSGEPLVDDWDCLKSLVRAFERHCGSLSQYGIKHMRSIANMCNAGIQMR  451

Query  262   AMEEACKNTCSEMKTMKYTHPSKVYSA  182
              MEEA    C  + T  ++   + +SA
Sbjct  452   QMEEAAMQACPTIPTSPWSSLDRGFSA  478



>ref|XP_010429611.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like isoform 
X2 [Camelina sativa]
Length=479

 Score =   498 bits (1282),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 269/472 (57%), Positives = 328/472 (69%), Gaps = 15/472 (3%)
 Frame = -3

Query  1579  LQAARWDPLIRQPVDQKDDESP---EGETQGTRWAVLVAGSNGYANYRHQADVCHAYQIL  1409
             + AA  D +IR P        P   E +   TRWAVLVAGS+GY NYRHQADVCHAYQ+L
Sbjct  17    VAAAASDNIIRLPSQASKFFRPPTQENDDGSTRWAVLVAGSSGYWNYRHQADVCHAYQLL  76

Query  1408  KRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAV  1229
             K+GG+K+ENIVVFMYDDIA +  NPR GVIIN PNG DVY GVPKDYTGD+V   NL+AV
Sbjct  77    KKGGVKEENIVVFMYDDIAKHEENPRPGVIINSPNGEDVYNGVPKDYTGDEVNVDNLFAV  136

Query  1228  LLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSA  1049
             +LG+K+ +KGGSGKVV+S  +D IFIYY+DHGGPGVLGMP  P+LYA D  +VLKKKH++
Sbjct  137   ILGNKKALKGGSGKVVNSGPNDHIFIYYSDHGGPGVLGMPTSPYLYAKDLNDVLKKKHAS  196

Query  1048  GTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITC  869
             GTYK +     ACESGS FEG++PE LNIY TTASNA ESSWGTYCPG +P+PP EY TC
Sbjct  197   GTYKSL-----ACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGEDPSPPSEYETC  251

Query  868   LGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKV  689
             LGDLYSVAWMEDS+ HNL  E++ +QYE VK RT+       GSHV+E+G   + K EK+
Sbjct  252   LGDLYSVAWMEDSDKHNLQTESLHQQYELVKKRTAGTGS-SYGSHVLEFGDIGLSK-EKL  309

Query  688   YLYQGFDPATINLP---GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKE  518
              LY G +PA  N      N + R  P  V NQRDADL+  W++Y+   + +  K +  K+
Sbjct  310   VLYMGTNPANENFTFVDENLLLR-PPSRVTNQRDADLVHFWDKYRKAPEGSARKVEAQKQ  368

Query  517   ITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHC  338
             + + M HR  +D S+  +G  LFG E G  IL  VR  G  LVDDW CLKSMVR FE HC
Sbjct  369   VIEAMSHRLHVDNSVLLIGKLLFGLE-GPEILNKVRTYGKPLVDDWDCLKSMVRAFERHC  427

Query  337   GSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             GSL QYG+KHMR+ ANICN+ I    MEEA    C  +    ++   + +SA
Sbjct  428   GSLSQYGIKHMRSIANICNAGIQMVQMEEAAMQACPSIPAGPWSSLHRGFSA  479



>ref|NP_195020.1| vacuolar-processing enzyme gamma [Arabidopsis thaliana]
 sp|Q39119.2|VPEG_ARATH RecName: Full=Vacuolar-processing enzyme gamma-isozyme; AltName: 
Full=Gamma-VPE; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK43975.1|AF370160_1 putative vacuolar processing enzyme gamma-VPE [Arabidopsis thaliana]
 gb|AAL11612.1|AF424619_1 AT4g32940/F26P21_60 [Arabidopsis thaliana]
 emb|CAA21203.1| gamma-VPE (vacuolar processing enzyme) [Arabidopsis thaliana]
 emb|CAB80011.1| gamma-VPE (vacuolar processing enzyme) [Arabidopsis thaliana]
 gb|AAL15210.1| putative vacuolar processing enzyme gamma-VPE [Arabidopsis thaliana]
 gb|AAM91361.1| At4g32940/F26P21_60 [Arabidopsis thaliana]
 gb|AEE86150.1| vacuolar-processing enzyme gamma [Arabidopsis thaliana]
Length=494

 Score =   498 bits (1281),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 275/466 (59%), Positives = 332/466 (71%), Gaps = 12/466 (3%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGG  1397
             QA+R+     +P +  DD +      GTRWAVLVAGS+GY NYRHQAD+CHAYQ+L++GG
Sbjct  40    QASRF----FRPAENDDDSN-----SGTRWAVLVAGSSGYWNYRHQADICHAYQLLRKGG  90

Query  1396  LKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgd  1217
             LK+ENIVVFMYDDIANN  NPR G IIN P+G DVY GVPKDYTGD V   NL+AV+LGD
Sbjct  91    LKEENIVVFMYDDIANNYENPRPGTIINSPHGKDVYQGVPKDYTGDDVNVDNLFAVILGD  150

Query  1216  kegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYK  1037
             K  VKGGSGKVVDS  +D IFI+Y+DHGGPGVLGMP  P+LYAND  +VLKKKH+ GTYK
Sbjct  151   KTAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHALGTYK  210

Query  1036  DMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDL  857
              +V Y+EACESGS FEG++PE LNIY TTASNAEESSWGTYCPG EP+PPPEY TCLGDL
Sbjct  211   SLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEEPSPPPEYETCLGDL  270

Query  856   YSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQ  677
             YSVAWMEDS  HNL  ET+ +QYE VK RT+    +  GSHVM+YG   I K + + LY 
Sbjct  271   YSVAWMEDSGMHNLQTETLHQQYELVKRRTAPVG-YSYGSHVMQYGDVGISK-DNLDLYM  328

Query  676   GFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
             G +PA  N        L P   V NQRDADL+  WE+Y+   + +  K +  K++ + M 
Sbjct  329   GTNPANDNFTFADANSLKPPSRVTNQRDADLVHFWEKYRKAPEGSARKTEAQKQVLEAMS  388

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR  +D S+  +G  LFG   G  +L  VR  G  LVDDW CLK+ VR FE HCGSL QY
Sbjct  389   HRLHIDNSVILVGKILFGISRGPEVLNKVRSAGQPLVDDWNCLKNQVRAFERHCGSLSQY  448

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             G+KHMR+FANICN+ I    MEEA    C+ + T  ++  ++ +SA
Sbjct  449   GIKHMRSFANICNAGIQMEQMEEAASQACTTLPTGPWSSLNRGFSA  494



>dbj|BAA18924.1| gamma-VPE [Arabidopsis thaliana]
Length=490

 Score =   497 bits (1280),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 275/466 (59%), Positives = 332/466 (71%), Gaps = 12/466 (3%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGG  1397
             QA+R+     +P +  DD +      GTRWAVLVAGS+GY NYRHQAD+CHAYQ+L++GG
Sbjct  36    QASRF----FRPAENDDDSN-----SGTRWAVLVAGSSGYWNYRHQADICHAYQLLRKGG  86

Query  1396  LKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgd  1217
             LK+ENIVVFMYDDIANN  NPR G IIN P+G DVY GVPKDYTGD V   NL+AV+LGD
Sbjct  87    LKEENIVVFMYDDIANNYENPRPGTIINSPHGKDVYQGVPKDYTGDDVNVDNLFAVILGD  146

Query  1216  kegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYK  1037
             K  VKGGSGKVVDS  +D IFI+Y+DHGGPGVLGMP  P+LYAND  +VLKKKH+ GTYK
Sbjct  147   KTAVKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHALGTYK  206

Query  1036  DMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDL  857
              +V Y+EACESGS FEG++PE LNIY TTASNAEESSWGTYCPG EP+PPPEY TCLGDL
Sbjct  207   SLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEEPSPPPEYETCLGDL  266

Query  856   YSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQ  677
             YSVAWMEDS  HNL  ET+ +QYE VK RT+    +  GSHVM+YG   I K + + LY 
Sbjct  267   YSVAWMEDSGMHNLQTETLHQQYELVKRRTAPVG-YSYGSHVMQYGDVGISK-DNLDLYM  324

Query  676   GFDPATINLPGNQIRRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTML  500
             G +PA  N        L P   V NQRDADL+  WE+Y+   + +  K +  K++ + M 
Sbjct  325   GTNPANDNFTFADANSLKPPSRVTNQRDADLVHFWEKYRKAPEGSARKTEAQKQVLEAMS  384

Query  499   HRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQY  320
             HR  +D S+  +G  LFG   G  +L  VR  G  LVDDW CLK+ VR FE HCGSL QY
Sbjct  385   HRLHIDNSVILVGKILFGISRGPEVLNKVRSAGQPLVDDWNCLKNQVRAFERHCGSLSQY  444

Query  319   GMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             G+KHMR+FANICN+ I    MEEA    C+ + T  ++  ++ +SA
Sbjct  445   GIKHMRSFANICNAGIQMEQMEEAASQACTTLPTGPWSSLNRGFSA  490



>ref|XP_011081710.1| PREDICTED: vacuolar-processing enzyme [Sesamum indicum]
Length=485

 Score =   497 bits (1280),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 258/441 (59%), Positives = 314/441 (71%), Gaps = 13/441 (3%)
 Frame = -3

Query  1543  PVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMY  1364
             PV   DD +      GT+WAVLVAGSNGY NYRHQADVCHAYQILKRGGLKDENI+VFMY
Sbjct  41    PVGAYDDSA------GTKWAVLVAGSNGYENYRHQADVCHAYQILKRGGLKDENIIVFMY  94

Query  1363  DDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkv  1184
             DDIANN  NPR GVIIN P+G DVY GVPKDY G+ VTA N +AVLLG+K  +KGGSGKV
Sbjct  95    DDIANNVENPRPGVIINSPHGEDVYKGVPKDYVGEDVTAHNFFAVLLGNKTALKGGSGKV  154

Query  1183  vdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACES  1004
             VDS  +D IFIYY DHG  G+LGMP    +YA++ I VLKKKH++GTYK +V YVEACES
Sbjct  155   VDSGPNDHIFIYYADHGAAGLLGMPTSREIYADELINVLKKKHASGTYKSLVFYVEACES  214

Query  1003  GSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSES  824
             GS FEG++PE LNIY TTASN+EESS+  YCPG +P+PPP Y TCLGD YSV+WMEDS+S
Sbjct  215   GSMFEGLLPEGLNIYATTASNSEESSYAIYCPGYDPSPPPAYDTCLGDTYSVSWMEDSDS  274

Query  823   HNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---  653
             HNL  ET+++QY+ VK RT++  D    SHVM+YG    +  E + +Y G  P   N   
Sbjct  275   HNLQTETLKQQYQLVKNRTAS-QDPDLSSHVMQYGDLK-LSAETLSVYMGTHPNKDNHTI  332

Query  652   LPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASI  473
             +  N  R     GV+NQRDAD+L  W +++     +  K +  K++   M  R  +D+SI
Sbjct  333   VYDNSPR--PSSGVINQRDADVLHFWHKFRGAPQGSAKKFEAQKQLAVAMAQRTHVDSSI  390

Query  472   DNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFA  293
               +G  +FG + G  +L SVR  G ALVDDW CLKSMVR FETHCGSL QYGM+HMR+ A
Sbjct  391   QLIGKLIFGTDKGPQVLNSVRPAGQALVDDWDCLKSMVRTFETHCGSLSQYGMRHMRSIA  450

Query  292   NICNSNISEAAMEEACKNTCS  230
             NICN+ + +  M EA    C+
Sbjct  451   NICNAGVKKEQMGEASAQACA  471



>ref|XP_002987841.1| hypothetical protein SELMODRAFT_126781 [Selaginella moellendorffii]
 gb|EFJ11144.1| hypothetical protein SELMODRAFT_126781 [Selaginella moellendorffii]
Length=439

 Score =   495 bits (1274),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 254/419 (61%), Positives = 315/419 (75%), Gaps = 5/419 (1%)
 Frame = -3

Query  1519  SPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAF  1340
             S E    GTRWA+LVAGS+G+ NYRHQADVCHAYQ+L+  GLK+ENIVV M+DDIANN  
Sbjct  3     SSEEVASGTRWALLVAGSSGFGNYRHQADVCHAYQLLRSNGLKEENIVVMMFDDIANNTD  62

Query  1339  NPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDR  1160
             NPR G IINHP G+DVYAGVPKDYTG  VTA N  AVLLGDK    GG+GKVV S  +D 
Sbjct  63    NPRPGTIINHPQGSDVYAGVPKDYTGAAVTAENFLAVLLGDKNSTSGGTGKVVSSGPEDH  122

Query  1159  IFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMM  980
             +F++Y+DHGGPGVLGMP   +LYAND I+V+KKKH++G Y++MVIY+EACESGS  EG++
Sbjct  123   VFLFYSDHGGPGVLGMPGESNLYANDLIDVIKKKHASGGYREMVIYIEACESGSMVEGLL  182

Query  979   PEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETI  800
             P  L +YVTTASNA ESSWGTYCPG  P+ PPEY TCLGDLYSVAWMEDSE HNL  ET+
Sbjct  183   PLGLGLYVTTASNAIESSWGTYCPGMVPSAPPEYDTCLGDLYSVAWMEDSEVHNLKRETL  242

Query  799   ERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTP  620
              +QY +VK RTSN+N ++AGSHVM+YG  + +    + ++ GFDPA  +  G+ I   + 
Sbjct  243   LQQYLDVKDRTSNHNTYEAGSHVMQYGDVE-LNSNPLSMFLGFDPAIADGNGDLIIPSSA  301

Query  619   KGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPE  440
              G V+QRDADLL +W +Y+   D + SK +  + + + + HRQ +D S+D +G  LFG +
Sbjct  302   NG-VSQRDADLLHLWSKYRRAKDGSDSKREARERMMNALAHRQHVDESVDRVGERLFGSK  360

Query  439   -NGSNILKSVRKPGLALVDDWQCLKSM--VRVFETHCGSLGQYGMKHMRAFANICNSNI  272
                S +L +VR  GLALVDDW CLKS+  V+ FET CG LGQYGMKHMRAFAN+CN  +
Sbjct  361   AAASKVLSTVRGSGLALVDDWTCLKSLASVQAFETSCGLLGQYGMKHMRAFANLCNEGV  419



>ref|XP_004498922.1| PREDICTED: vacuolar-processing enzyme-like [Cicer arietinum]
Length=492

 Score =   497 bits (1279),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 267/463 (58%), Positives = 332/463 (72%), Gaps = 9/463 (2%)
 Frame = -3

Query  1552  IRQPVD-QKDDESPEGE--TQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDEN  1382
             +R P D  +    PE +   QGTRWA+L+AGSNGY NYRHQADVCHAYQIL++GGLK+EN
Sbjct  33    LRLPSDASRFFHEPENDDNVQGTRWAILLAGSNGYWNYRHQADVCHAYQILRKGGLKEEN  92

Query  1381  IVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvk  1202
             I+VFMYDDIA +  NPR GVIIN P+G DVYAGVPKDYTGD V   N YA LLG+K  + 
Sbjct  93    IIVFMYDDIAFDIENPRPGVIINKPDGGDVYAGVPKDYTGDDVNVDNFYAALLGNKSALT  152

Query  1201  ggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIY  1022
             GGSGKVVDS  +D IF+YYTDHGGPGVLGMP  P+LYA+D  EVLKKKH++G+YK +V Y
Sbjct  153   GGSGKVVDSGPNDHIFVYYTDHGGPGVLGMPVGPYLYASDLNEVLKKKHASGSYKSLVFY  212

Query  1021  VEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAW  842
             +EACESGS FEG++PE++NIY TTASNA+ESSWGTYCPG  P PPPEY TCLGDLYSVAW
Sbjct  213   LEACESGSIFEGLLPENINIYATTASNADESSWGTYCPGEYPPPPPEYSTCLGDLYSVAW  272

Query  841   MEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPA  662
             MEDS+ HNL  E++ +QY+ VK RT   N    GSHVMEYG    +    +++Y G +PA
Sbjct  273   MEDSDIHNLRTESLHQQYKVVKDRT--INGVYYGSHVMEYGDVG-LSNNHLFIYLGTNPA  329

Query  661   TINLPGNQIRRLT---PKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQ  491
               N+       LT   P   VNQRDADL+  W++++   + +  K +  K++ + M HR+
Sbjct  330   NDNISFVDESSLTLRSPSAAVNQRDADLIHFWDKFRKAPEGSARKNEAEKQVLEAMSHRK  389

Query  490   RLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMK  311
              +D S++ +G  LFG E G  +  +VR  GL LVD+W CLK+MVR FETHCGSL QYGMK
Sbjct  390   HVDNSVELIGKLLFGIEKGPELFNTVRPAGLPLVDNWDCLKTMVRTFETHCGSLSQYGMK  449

Query  310   HMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
             HMR+FANICN+ I    M EA    CS +    ++   + +SA
Sbjct  450   HMRSFANICNAGIQNEQMAEASAQACSNIPANPWSSLHRGFSA  492



>emb|CBX26637.1| vacuolar processing enzyme 2a [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   493 bits (1269),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 244/401 (61%), Positives = 309/401 (77%), Gaps = 7/401 (2%)
 Frame = -3

Query  1435  DVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQ  1256
             DVCHAYQILK+GGLKDENIVVFMYDDIAN+  NPR G++INHP G DVY GVPKDYTGDQ
Sbjct  1     DVCHAYQILKKGGLKDENIVVFMYDDIANSPDNPRPGIVINHPKGKDVYHGVPKDYTGDQ  60

Query  1255  VTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFI  1076
             VTA N YAVLLG+K  V GGS KVV+SK +D IFIYYTDHG  G+L MPN P +YA+DFI
Sbjct  61    VTAKNFYAVLLGNKTAVTGGSRKVVNSKPNDHIFIYYTDHGAAGLLCMPNPPDVYADDFI  120

Query  1075  EVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEP  896
             +VL++KH++ +Y  M+IYVEACESGS FEG+MP+D NIYVTTA+NA+E+SW  YCP  E 
Sbjct  121   KVLRQKHASKSYSKMIIYVEACESGSIFEGLMPQDHNIYVTTAANAQENSWAAYCPTMEI  180

Query  895   APPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGS  716
              PPPEY TCLGD YSV+WMEDSE+ +L +E+I++QYE VK RT+        SHVMEYG 
Sbjct  181   PPPPEYDTCLGDAYSVSWMEDSETQDLKKESIKQQYEVVKERTAPL------SHVMEYGD  234

Query  715   RDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSK  536
             +   K + ++L+QGFDPA  ++    +   + KG +NQRDAD+LFMW +Y+     +  K
Sbjct  235   K-TFKEDMLFLFQGFDPAKSSIRNRPLPMPSLKGAINQRDADILFMWRKYEKLNAGSEEK  293

Query  535   AKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVR  356
              + L+E+ +T+LHR+ LD+SID +G  +FG + G ++L++ R  G  LVDDW CL++MVR
Sbjct  294   QRALREVKETVLHRKHLDSSIDFIGKLVFGFDKGPSMLQAARGSGQPLVDDWDCLRTMVR  353

Query  355   VFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTC  233
             VFE+ CGSL QYGMKHMRAFANICN+ +SEA M+EA  + C
Sbjct  354   VFESQCGSLTQYGMKHMRAFANICNNGVSEAEMKEASISAC  394



>emb|CAQ00100.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26642.1| vacuolar processing enzyme 4 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99424.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   495 bits (1275),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 245/435 (56%), Positives = 308/435 (71%), Gaps = 8/435 (2%)
 Frame = -3

Query  1513  EGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNP  1334
             E +  GTRWAVL+AGSNGY NYRHQADVCHAYQI+K+GGLKDENI+VFMYDDIANN  NP
Sbjct  33    EKDVVGTRWAVLIAGSNGYYNYRHQADVCHAYQIMKKGGLKDENIIVFMYDDIANNRDNP  92

Query  1333  RKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKA-DDRI  1157
             R GVIINHP G DVYAGVPKDYTG  V   N  A LLGDK  + G     V S   DD I
Sbjct  93    RPGVIINHPKGGDVYAGVPKDYTGADVNTNNFLAALLGDKSKLTGSGSGKVVSSGPDDHI  152

Query  1156  FIYYTDHGGPGVLGMP-NLPHLYANDFIEVLKKKHSAGT-YKDMVIYVEACESGSFFEGM  983
             F+YY DHGGPG+LGMP +  +LYAND +  L+KKH+ G  YK +V Y+EACESGS FEG+
Sbjct  153   FVYYADHGGPGILGMPEDEEYLYANDLVRTLEKKHAGGAGYKSLVFYLEACESGSIFEGL  212

Query  982   MPEDLNIYVTTASNAEESSWGTYCPG-SEPAPPPEYITCLGDLYSVAWMEDSESHNLMEE  806
             +P ++++Y TTA+NAEESSWGTYCPG  E APPPEY TCLGDLYSVAWMEDS++HNL  E
Sbjct  213   LPGNISVYATTAANAEESSWGTYCPGDDEGAPPPEYDTCLGDLYSVAWMEDSDAHNLNAE  272

Query  805   TIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATIN---LPGNQI  635
             ++++QYE V+ RTS    +  GSHVM+YG    +  + ++ Y G +PA  N   +  +  
Sbjct  273   SLKQQYERVRNRTSADGTYSLGSHVMQYGDLG-LNDQSLFQYIGTNPANDNATFVQSSSS  331

Query  634   RRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVH  455
              R  P   VNQRDADL+  W +Y+   + +  K +  + + +TM  R R+D+S++ +G  
Sbjct  332   SRQLPGARVNQRDADLVHFWHKYRRSAEGSAEKVEARRRLVETMARRSRVDSSVELIGGL  391

Query  454   LFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSN  275
             LFG E G+ +L +VR  G  +VDDW CLKS+VR FE  CG L QYGMKHMR+ ANICN+ 
Sbjct  392   LFGSEEGAKVLGTVRPAGQPVVDDWGCLKSVVRRFEERCGPLTQYGMKHMRSLANICNAG  451

Query  274   ISEAAMEEACKNTCS  230
             + E  M++A    C+
Sbjct  452   VREEVMDKAASQACA  466



>gb|AAD04882.1| C13 endopeptidase NP1 precursor [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   492 bits (1267),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 244/401 (61%), Positives = 308/401 (77%), Gaps = 7/401 (2%)
 Frame = -3

Query  1435  DVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQ  1256
             DVCHAYQILK+GGLKDENIVVFMYDDIAN+  NPR G++INHP G DVY GVPKDYTGDQ
Sbjct  1     DVCHAYQILKKGGLKDENIVVFMYDDIANSPDNPRPGIVINHPKGKDVYHGVPKDYTGDQ  60

Query  1255  VTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFI  1076
             VTA N YAVLLG+K  V GGS KVV+SK +D IFIYYTDHG  G+L MPN P +YA+DFI
Sbjct  61    VTAKNFYAVLLGNKTAVTGGSRKVVNSKPNDHIFIYYTDHGAAGLLCMPNPPDVYADDFI  120

Query  1075  EVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEP  896
             +VL++KH++ +Y  M+IYVEACESGS FEG+MP+D NIYVTTA+NA+E+SW  YCP  E 
Sbjct  121   KVLRQKHASKSYSKMIIYVEACESGSIFEGLMPQDHNIYVTTAANAQENSWAAYCPTMEI  180

Query  895   APPPEYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGS  716
              PPPEY TCLGD YSV+WMEDSE+ +L  E+I++QYE VK RT+        SHVMEYG 
Sbjct  181   PPPPEYDTCLGDAYSVSWMEDSETQDLKNESIKQQYEVVKERTAPL------SHVMEYGD  234

Query  715   RDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSK  536
             +   K + ++L+QGFDPA  ++    +   + KG +NQRDAD+LFMW +Y+     +  K
Sbjct  235   K-TFKEDMLFLFQGFDPAKSSIRNRPLPMPSLKGAINQRDADILFMWRKYEKLNAGSEEK  293

Query  535   AKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVR  356
              + L+E+ +T+LHR+ LD+SID +G  +FG + G ++L++ R  G  LVDDW CL++MVR
Sbjct  294   QRALREVKETVLHRKHLDSSIDFIGKLVFGFDKGPSMLQAARGSGQPLVDDWDCLRTMVR  353

Query  355   VFETHCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTC  233
             VFE+ CGSL QYGMKHMRAFANICN+ +SEA M+EA  + C
Sbjct  354   VFESQCGSLTQYGMKHMRAFANICNNGVSEAEMKEASISAC  394



>ref|XP_002867219.1| GAMMA-VPE [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43478.1| GAMMA-VPE [Arabidopsis lyrata subsp. lyrata]
Length=494

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 270/452 (60%), Positives = 326/452 (72%), Gaps = 7/452 (2%)
 Frame = -3

Query  1534  QKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDI  1355
             Q DD+S      GTRWAVLVAGS+GY NYRHQAD+CHAYQ+L++GGLK+ENIVVFMYDDI
Sbjct  49    QDDDDS----NAGTRWAVLVAGSSGYWNYRHQADICHAYQLLRKGGLKEENIVVFMYDDI  104

Query  1354  ANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvds  1175
             ANN  NPR G +IN P+G DVY GVPKDYTGD V   NL+AV+LGDK  VKGGSGKVVDS
Sbjct  105   ANNYENPRPGTLINSPHGKDVYQGVPKDYTGDDVNVDNLFAVILGDKTAVKGGSGKVVDS  164

Query  1174  KADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSF  995
               +D IFI+Y+DHGGPGVLGMP  P+LYAND  +VLKKKH++GTYK +V Y+EACESGS 
Sbjct  165   GPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKKHASGTYKSLVFYLEACESGSI  224

Query  994   FEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNL  815
             FEG++PE LNIY TTASNAEESSWGTYCPG EP+PPPEY TCLGDLYSVAWMEDS  HNL
Sbjct  225   FEGLLPEGLNIYATTASNAEESSWGTYCPGEEPSPPPEYETCLGDLYSVAWMEDSGMHNL  284

Query  814   MEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQI  635
               ET+ +QYE VK RT+    +  GSHVM+YG   + K + + LY G +PA  N      
Sbjct  285   QTETLHQQYELVKRRTAPVG-YSYGSHVMQYGDVGLSK-DNLDLYMGTNPANDNFTFADA  342

Query  634   RRLTPKG-VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGV  458
               L P   V NQRDADL+  WE+Y+   + +  K +  K++ + M HR  +D S+  +G 
Sbjct  343   NSLKPPSRVTNQRDADLVHFWEKYRKAPEGSARKTEAQKQVLEAMSHRLHVDNSVILVGK  402

Query  457   HLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNS  278
              LFG   G  +L  VR  G  LVDDW CLK++VR FE HCGSL QYG+KHMR+FANICN+
Sbjct  403   ILFGISEGPEVLNKVRSAGQPLVDDWNCLKNLVRAFERHCGSLSQYGIKHMRSFANICNA  462

Query  277   NISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              I    MEEA    C+ +    ++   + +SA
Sbjct  463   GIRTEQMEEAASQACTSIPPGPWSSLHRGFSA  494



>gb|AES90965.2| vacuolar processing enzyme [Medicago truncatula]
Length=373

 Score =   489 bits (1260),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 243/332 (73%), Positives = 286/332 (86%), Gaps = 3/332 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
              WDP+IR P +  DD   E +  GTRWAVLVAGS+GY NYRHQADVCHAYQ+L +GG+K+
Sbjct  36    EWDPVIRLPGEVVDDA--EVDEVGTRWAVLVAGSSGYGNYRHQADVCHAYQLLIKGGVKE  93

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIANN  NPR GVIINHP G +VY GVPKDYTGD VTA NLYAV+LGDK  
Sbjct  94    ENIVVFMYDDIANNELNPRPGVIINHPQGPNVYVGVPKDYTGDNVTAENLYAVILGDKSK  153

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             VKGGSGKV++SK++DRIFIYY+DHGGPGVLGMPN+P++YA DFI+VLKKKH++G YK MV
Sbjct  154   VKGGSGKVINSKSEDRIFIYYSDHGGPGVLGMPNMPYVYAMDFIDVLKKKHASGGYKKMV  213

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
             +Y+EACESGS FEG+MP+DLN+YVTTASNA+ESSWGTYCPG EPAPPPEYITCLGDLYSV
Sbjct  214   VYIEACESGSMFEGVMPKDLNVYVTTASNAQESSWGTYCPGVEPAPPPEYITCLGDLYSV  273

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDSESHNL  ET+++QY++VK RTSNYN++  GSHVM+YG  +I   EK+YLYQGFD
Sbjct  274   AWMEDSESHNLKRETVKQQYKSVKERTSNYNNYALGSHVMQYGDTNITD-EKLYLYQGFD  332

Query  667   PATINLPGNQIRRLTPKGVVNQRDADLLFMWE  572
             PAT+NLP +  +  +   VVNQRDA++LFMWE
Sbjct  333   PATVNLPPHNDKLESKMEVVNQRDAEILFMWE  364



>gb|EMT14075.1| Vacuolar-processing enzyme beta-isozyme [Aegilops tauschii]
Length=415

 Score =   491 bits (1264),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 244/414 (59%), Positives = 310/414 (75%), Gaps = 1/414 (0%)
 Frame = -3

Query  1423  AYQILKRGGLKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAA  1244
             A+ ILK+GGLKDENIVVFMYDDIAN+  NPR+G +INHP G DVY GVPKDYTGDQVTA 
Sbjct  3     AWWILKKGGLKDENIVVFMYDDIANSPDNPRRGTVINHPKGKDVYHGVPKDYTGDQVTAK  62

Query  1243  NLYAVLLgdkegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLK  1064
             N YAVLLG+K  V GGS KV++SK +D IFI+Y+DHG PG LGMPN P +YA+DFI+VL+
Sbjct  63    NFYAVLLGNKTAVTGGSRKVINSKPEDHIFIFYSDHGSPGSLGMPNGPDVYADDFIKVLR  122

Query  1063  KKHSAGTYKDMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPP  884
             +KH++ +Y  MVIYVEACESGS FEG+MP+D NIYVT ASNA ESSW  YCP     PPP
Sbjct  123   QKHASKSYSKMVIYVEACESGSIFEGLMPQDQNIYVTAASNAVESSWAAYCPDDGTPPPP  182

Query  883   EYITCLGDLYSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDII  704
             EY TCLGDLYSV+WMEDSE+ NL  ETI++QYE VK RT+  N+   GSHVMEYG +   
Sbjct  183   EYFTCLGDLYSVSWMEDSETQNLKNETIKQQYEVVKARTAPRNESIRGSHVMEYGDK-TF  241

Query  703   KPEKVYLYQGFDPATINLPGNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLL  524
             K + ++LYQGFDPA  ++    +   + KG + QRDAD+LFMW++Y+     +  K + L
Sbjct  242   KEDMLFLYQGFDPAKSSIRNRPLPMPSLKGAIKQRDADILFMWKKYEKLNGGSEEKQRAL  301

Query  523   KEITDTMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFET  344
             +E+ +T+LHR+ LD+SID +G  +FG + G  +L++ R  G  LVDDW CLK+MV+VFE+
Sbjct  302   REVKETVLHRKHLDSSIDFIGKLVFGFDKGPLVLEAARGSGQPLVDDWDCLKTMVQVFES  361

Query  343   HCGSLGQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              CGSL QYGMKH RAFAN+CN+ +SEA M+EA  + C      +++   + YSA
Sbjct  362   QCGSLTQYGMKHTRAFANMCNNGVSEAEMKEASISACDGYDMGRWSPLVRGYSA  415



>ref|XP_003608768.1| Vacuolar-processing enzyme [Medicago truncatula]
Length=366

 Score =   489 bits (1259),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 243/332 (73%), Positives = 286/332 (86%), Gaps = 3/332 (1%)
 Frame = -3

Query  1567  RWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKD  1388
              WDP+IR P +  DD   E +  GTRWAVLVAGS+GY NYRHQADVCHAYQ+L +GG+K+
Sbjct  29    EWDPVIRLPGEVVDDA--EVDEVGTRWAVLVAGSSGYGNYRHQADVCHAYQLLIKGGVKE  86

Query  1387  ENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkeg  1208
             ENIVVFMYDDIANN  NPR GVIINHP G +VY GVPKDYTGD VTA NLYAV+LGDK  
Sbjct  87    ENIVVFMYDDIANNELNPRPGVIINHPQGPNVYVGVPKDYTGDNVTAENLYAVILGDKSK  146

Query  1207  vkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMV  1028
             VKGGSGKV++SK++DRIFIYY+DHGGPGVLGMPN+P++YA DFI+VLKKKH++G YK MV
Sbjct  147   VKGGSGKVINSKSEDRIFIYYSDHGGPGVLGMPNMPYVYAMDFIDVLKKKHASGGYKKMV  206

Query  1027  IYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSV  848
             +Y+EACESGS FEG+MP+DLN+YVTTASNA+ESSWGTYCPG EPAPPPEYITCLGDLYSV
Sbjct  207   VYIEACESGSMFEGVMPKDLNVYVTTASNAQESSWGTYCPGVEPAPPPEYITCLGDLYSV  266

Query  847   AWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFD  668
             AWMEDSESHNL  ET+++QY++VK RTSNYN++  GSHVM+YG  +I   EK+YLYQGFD
Sbjct  267   AWMEDSESHNLKRETVKQQYKSVKERTSNYNNYALGSHVMQYGDTNITD-EKLYLYQGFD  325

Query  667   PATINLPGNQIRRLTPKGVVNQRDADLLFMWE  572
             PAT+NLP +  +  +   VVNQRDA++LFMWE
Sbjct  326   PATVNLPPHNDKLESKMEVVNQRDAEILFMWE  357



>ref|NP_001275777.1| vacuolar-processing enzyme precursor [Citrus sinensis]
 sp|P49043.1|VPE_CITSI RecName: Full=Vacuolar-processing enzyme; Short=VPE; Flags: Precursor 
[Citrus sinensis]
 emb|CAA87720.1| cystein proteinase (by similarity) [Citrus sinensis]
 prf||2208463A vascular processing protease
Length=494

 Score =   494 bits (1271),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 260/443 (59%), Positives = 322/443 (73%), Gaps = 4/443 (1%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             ++ GTRWAVL+AGSNG+ NYRHQAD+CHAYQ+L++GGLKDENI+VFMYDDIA N  NPR 
Sbjct  55    DSVGTRWAVLLAGSNGFWNYRHQADICHAYQLLRKGGLKDENIIVFMYDDIAFNEENPRP  114

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             GVIINHP+G DVY GVPKDYTG+ VT    +AV+LG+K  + GGSGKVVDS  +D IFI+
Sbjct  115   GVIINHPHGDDVYKGVPKDYTGEDVTVEKFFAVVLGNKTALTGGSGKVVDSGPNDHIFIF  174

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP   ++YA++ I+VLKKKH++G YK +V Y+EACESGS FEG++ E L
Sbjct  175   YSDHGGPGVLGMPTSRYIYADELIDVLKKKHASGNYKSLVFYLEACESGSIFEGLLLEGL  234

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTASNAEESSWGTYCPG  P PPPEY TCLGDLYS+AWMEDS+ HNL  ET+ +QY
Sbjct  235   NIYATTASNAEESSWGTYCPGEIPGPPPEYSTCLGDLYSIAWMEDSDIHNLRTETLHQQY  294

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTPKG-V  611
             E VK RT++YN +  GSHVM+YG   + K   ++ Y G +PA  N        L P    
Sbjct  295   ELVKTRTASYNSY--GSHVMQYGDIGLSK-NNLFTYLGTNPANDNYTFVDENSLRPASKA  351

Query  610   VNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENGS  431
             VNQRDADLL  W++Y+   +    KA+  K+  + M HR  +D SI  +G  LFG E G 
Sbjct  352   VNQRDADLLHFWDKYRKAPEGTPRKAEAQKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGP  411

Query  430   NILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAMEE  251
              IL +VR  G  LVDDW CLKS+VR FE+HCG+L QYGMKHMR+ ANICN+ I +  M E
Sbjct  412   EILNTVRPAGQPLVDDWGCLKSLVRTFESHCGALSQYGMKHMRSLANICNTGIGKEKMAE  471

Query  250   ACKNTCSEMKTMKYTHPSKVYSA  182
             A    C  + +  ++   K +SA
Sbjct  472   ASAQACENIPSGPWSSLDKGFSA  494



>gb|KEH39941.1| vacuolar processing enzyme [Medicago truncatula]
Length=493

 Score =   493 bits (1268),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 265/469 (57%), Positives = 338/469 (72%), Gaps = 19/469 (4%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGG  1397
             QA+R+     +P +  +D       QGTRWA+L+AGSNGY NYRHQADVCHAYQ+L++GG
Sbjct  40    QASRF---FHEPENDDND-------QGTRWAILLAGSNGYWNYRHQADVCHAYQLLRKGG  89

Query  1396  LKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgd  1217
             LK+ENI+VFMYDDIA+N  NPR GVIIN P+G DVY GVPKDYTG +V A N YA LLG+
Sbjct  90    LKEENIIVFMYDDIASNVENPRPGVIINKPDGGDVYEGVPKDYTGAEVHADNFYAALLGN  149

Query  1216  kegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYK  1037
             K  + GGSGKVVDS  +D IF+YYTDHGGPGVLGMP  P+LYA+D  EVLKKKH++G+YK
Sbjct  150   KSALTGGSGKVVDSGPNDHIFVYYTDHGGPGVLGMPVGPYLYASDLNEVLKKKHASGSYK  209

Query  1036  DMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDL  857
              +V Y+EACESGS FEG++PED+NIY TTASNA ESSWGTYCPG  P PPPEY TCLGDL
Sbjct  210   SLVFYLEACESGSIFEGLLPEDINIYATTASNAVESSWGTYCPGEYPPPPPEYSTCLGDL  269

Query  856   YSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDI-IKPEKVYLY  680
             YS+AWMEDS+ HNL  E++ +QY+ VK RT N      GSHVMEYG  D+ +    ++LY
Sbjct  270   YSIAWMEDSDIHNLRTESLHQQYKLVKDRTIN---GYYGSHVMEYG--DVGLSNNHLFLY  324

Query  679   QGFDPATINLP---GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITD  509
              G +PA  N+     + ++  +P   VNQRDADL+  W++++   + ++ K +  KE+ +
Sbjct  325   LGTNPANDNISFVDESSLKLRSPSTAVNQRDADLIHFWDKFRKAPEGSLRKNEAQKEVLE  384

Query  508   TMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSL  329
              M HR  +D S+  +G  LFG E G+ +L +VR  G  LVD+W CLK+MV+ FETHCGSL
Sbjct  385   AMSHRMHVDNSVKLIGKLLFGIEKGTELLDNVRPAGSPLVDNWDCLKTMVKTFETHCGSL  444

Query  328   GQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              QYGMKHMR+FANICN+ I    M EA    C+ +    ++   + +SA
Sbjct  445   SQYGMKHMRSFANICNAGIQTEQMAEASAQACASIPANPWSSLQRGFSA  493



>gb|KHG17266.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=463

 Score =   491 bits (1265),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 254/444 (57%), Positives = 312/444 (70%), Gaps = 29/444 (7%)
 Frame = -3

Query  1507  ETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAFNPRK  1328
             + +GTRWAVL+A SNGY NYRHQADVCHAYQ+L+ GGLK+ENI+VFMYDDIA N  NPR 
Sbjct  47    KVEGTRWAVLIARSNGYWNYRHQADVCHAYQLLRNGGLKEENIIVFMYDDIAYNEENPRP  106

Query  1327  GVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDRIFIY  1148
             G+IIN+P+G DVY GVPKDYTG+ VT  N +A +LG+K  + GGSGKVV+S   D IFIY
Sbjct  107   GIIINNPHGDDVYKGVPKDYTGENVTVNNFFAAILGNKSALTGGSGKVVNSGPSDHIFIY  166

Query  1147  YTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMMPEDL  968
             Y+DHGGPGVLGMP LP+LYA+D I+VLKKKH++GTYK +V Y+EACESGS FEG++PE L
Sbjct  167   YSDHGGPGVLGMPTLPYLYADDLIDVLKKKHASGTYKSLVFYLEACESGSIFEGLLPEGL  226

Query  967   NIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETIERQY  788
             NIY TTA+NA ESSWGTYCPG  P+PPPEY TCLGDLYSVAWMEDS+ HNL +ET+ +QY
Sbjct  227   NIYATTAANAVESSWGTYCPGEYPSPPPEYETCLGDLYSVAWMEDSDIHNLRKETLHQQY  286

Query  787   ENVKLRTSNYNDFQAGSHVMEYGSRDI-IKPEKVYLYQGFDPATINLPG-NQIRRLTPKG  614
             E VK RT N N    GSHVM++G  DI I  + ++ Y G +PA  N    ++   L P  
Sbjct  287   ELVKRRTINGNS-AYGSHVMQFG--DIGISMDNLFTYLGTNPANDNFKSVDENSLLPPTK  343

Query  613   VVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVHLFGPENG  434
              VNQRDADL+  W++Y+   D +V K +  K++ + M HR  +D +              
Sbjct  344   AVNQRDADLVHFWDKYRKAPDGSVRKVEAQKQVMEAMSHRMHVDNT--------------  389

Query  433   SNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSNISEAAME  254
                       G  LVDDW+CLK MVR FETHCGSL QYGMKHMR+ ANICN+ I    M 
Sbjct  390   ----------GQPLVDDWKCLKEMVRTFETHCGSLAQYGMKHMRSLANICNAGIETEKMG  439

Query  253   EACKNTCSEMKTMKYTHPSKVYSA  182
             EA    C  + +  +    K +SA
Sbjct  440   EASAQACFNIPSGHWGSLGKGFSA  463



>gb|ACJ84443.1| unknown [Medicago truncatula]
Length=493

 Score =   491 bits (1263),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 265/469 (57%), Positives = 337/469 (72%), Gaps = 19/469 (4%)
 Frame = -3

Query  1576  QAARWDPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGG  1397
             QA+R+     +P +  +D       QGTRWA+L+AGSNGY NYRHQADVCHAYQ+L++GG
Sbjct  40    QASRF---FHEPENDDND-------QGTRWAILLAGSNGYWNYRHQADVCHAYQLLRKGG  89

Query  1396  LKDENIVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgd  1217
             LK+ENI+VFMYDDIA+N  NPR GVIIN P+G DVY GVPKDYTG +V A N YA LLG+
Sbjct  90    LKEENIIVFMYDDIASNVENPRPGVIINKPDGGDVYEGVPKDYTGAEVHADNFYAALLGN  149

Query  1216  kegvkggsgkvvdsKADDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYK  1037
             K  + GGSGKVVDS  +D IF+YYTDHGGPGVLGMP  P+LYA+D  EVLKKKH++G+YK
Sbjct  150   KSALTGGSGKVVDSGPNDHIFVYYTDHGGPGVLGMPVGPYLYASDLNEVLKKKHASGSYK  209

Query  1036  DMVIYVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDL  857
              +V Y+EACESGS FEG++PED+NIY TTASNA ESSWGTYCPG  P PPPEY TCLGDL
Sbjct  210   SLVFYLEACESGSIFEGLLPEDINIYATTASNAVESSWGTYCPGEYPPPPPEYSTCLGDL  269

Query  856   YSVAWMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDI-IKPEKVYLY  680
             YS+AWMEDS+ HNL  E++ +QY+ VK RT N      GSHVMEYG  D+ +    ++LY
Sbjct  270   YSIAWMEDSDIHNLRTESLHQQYKLVKDRTIN---GYYGSHVMEYG--DVGLSNNHLFLY  324

Query  679   QGFDPATINLP---GNQIRRLTPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITD  509
              G +PA  N+     + ++  +P   VNQRDADL+  W++++   + ++ K +  KE+ +
Sbjct  325   LGTNPANDNISFVDESSLKLRSPSTAVNQRDADLIHFWDKFRKAPEGSLRKNEAQKEVLE  384

Query  508   TMLHRQRLDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSL  329
              M HR  +D S   +G  LFG E G+ +L +VR  G  LVD+W CLK+MV+ FETHCGSL
Sbjct  385   AMSHRMHVDNSAKLIGKLLFGIEKGTELLGNVRPAGSPLVDNWDCLKTMVKTFETHCGSL  444

Query  328   GQYGMKHMRAFANICNSNISEAAMEEACKNTCSEMKTMKYTHPSKVYSA  182
              QYGMKHMR+FANICN+ I    M EA    C+ +    ++   + +SA
Sbjct  445   SQYGMKHMRSFANICNAGIQTEQMAEASAQACASIPANPWSSLQRGFSA  493



>ref|XP_001755207.1| predicted protein [Physcomitrella patens]
 gb|EDQ80151.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   488 bits (1256),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 261/439 (59%), Positives = 320/439 (73%), Gaps = 10/439 (2%)
 Frame = -3

Query  1519  SPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDENIVVFMYDDIANNAF  1340
             + E   +GTRWA+L+AGS+GY NYRHQADVCHAYQILKRGGLK+ENIVVFMYDDIA +  
Sbjct  3     TEEDAEKGTRWAILIAGSSGYWNYRHQADVCHAYQILKRGGLKEENIVVFMYDDIAYSTE  62

Query  1339  NPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvkggsgkvvdsKADDR  1160
             NP  G IIN P+G DVY GVPKDYTG  VT +N YA LLGDK+ +KGGSGKVV+S  +D 
Sbjct  63    NPHPGKIINKPDGPDVYQGVPKDYTGADVTVSNFYAALLGDKDAIKGGSGKVVNSGPNDH  122

Query  1159  IFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVIYVEACESGSFFEGMM  980
             IFIYYTDHGG GVLGMP  P+LYA+DF++ LKKK +AGT+K++VIY+EACESGS FEG++
Sbjct  123   IFIYYTDHGGAGVLGMPTSPNLYADDFVDTLKKKAAAGTFKELVIYLEACESGSIFEGLL  182

Query  979   PEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVAWMEDSESHNLMEETI  800
             PE LNIYVTTASNAEESSWGTYCPG  P PPPEY TCLGDLYSVAWMED+E  NL +ET+
Sbjct  183   PEGLNIYVTTASNAEESSWGTYCPGMYPPPPPEYDTCLGDLYSVAWMEDTEIENLKKETL  242

Query  799   ERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDPATINLPGNQIRRLTP  620
             E QY  VK RTSN+N ++ GSHVM+YG    +  E++  Y G+DPA  N+   ++     
Sbjct  243   EDQYVIVKSRTSNHNTYRTGSHVMQYGDVK-LDVEELARYLGYDPANENVTKPELPEFLS  301

Query  619   KGV-----VNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQRLDASIDNLGVH  455
                     V+QR+ADL+ +  +++     ++ +A    E+  T++HR+ LD S+  +G  
Sbjct  302   AHTEILTHVDQREADLIHLRYKFRNAVKGSLREANAATELAKTIVHRKHLDDSVQLIGEI  361

Query  454   LFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKHMRAFANICNSN  275
             LF  EN    L +VR  G  +VDDW CLK+MVR FE  CG L QYGMKHMRAFANICN+ 
Sbjct  362   LFAGENALEKLTAVRPAGSVVVDDWACLKTMVRTFEASCGPLTQYGMKHMRAFANICNAR  421

Query  274   ISEAAM----EEACKNTCS  230
             I  A M     EACK + S
Sbjct  422   IDPAKMAVASSEACKLSTS  440



>gb|AIB06797.1| cte peptide ligase [Clitoria ternatea]
Length=482

 Score =   487 bits (1253),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 238/445 (53%), Positives = 306/445 (69%), Gaps = 4/445 (1%)
 Frame = -3

Query  1561  DPLIRQPVDQKDDESPEGETQGTRWAVLVAGSNGYANYRHQADVCHAYQILKRGGLKDEN  1382
             D  +R P         +   +GTRWAVLVAGS GY NYRHQADVCHAYQILK+GGLKDEN
Sbjct  23    DDFLRLPSQASKFFQADDNVEGTRWAVLVAGSKGYVNYRHQADVCHAYQILKKGGLKDEN  82

Query  1381  IVVFMYDDIANNAFNPRKGVIINHPNGTDVYAGVPKDYTGDQVTAANLYAVLLgdkegvk  1202
             I+VFMYDDIA N  NP  GVIINHP G+DVY GVPKDY G+ +   N YAVLL +K  + 
Sbjct  83    IIVFMYDDIAYNESNPHPGVIINHPYGSDVYKGVPKDYVGEDINPPNFYAVLLANKSALT  142

Query  1201  ggsgkvvdsKA-DDRIFIYYTDHGGPGVLGMPNLPHLYANDFIEVLKKKHSAGTYKDMVI  1025
             G     V     +D +FIYYTDHGG GVLGMP+ P++ A+D  +VLKKKH++GTYK +V 
Sbjct  143   GTGSGKVLDSGPNDHVFIYYTDHGGAGVLGMPSKPYIAASDLNDVLKKKHASGTYKSIVF  202

Query  1024  YVEACESGSFFEGMMPEDLNIYVTTASNAEESSWGTYCPGSEPAPPPEYITCLGDLYSVA  845
             YVE+CESGS F+G++PED NIYV  AS+  ESSW TYCP   P+PPPEY  C+GDL+SVA
Sbjct  203   YVESCESGSMFDGLLPEDHNIYVMGASDTGESSWVTYCPLQHPSPPPEYDVCVGDLFSVA  262

Query  844   WMEDSESHNLMEETIERQYENVKLRTSNYNDFQAGSHVMEYGSRDIIKPEKVYLYQGFDP  665
             W+ED + HNL  ET ++QYE VK +T      + G+HV++YG   + K + +++Y G DP
Sbjct  263   WLEDCDVHNLQTETFQQQYEVVKNKTI-VALIEDGTHVVQYGDVGLSK-QTLFVYMGTDP  320

Query  664   ATINLPGNQIRRL-TPKGVVNQRDADLLFMWERYKMKGDNAVSKAKLLKEITDTMLHRQR  488
             A  N        L TP+  V+QRDADL+  WE+Y+   + +  KA+  K++ + M HR  
Sbjct  321   ANDNNTFTDKNSLGTPRKAVSQRDADLIHYWEKYRRAPEGSSRKAEAKKQLREVMAHRMH  380

Query  487   LDASIDNLGVHLFGPENGSNILKSVRKPGLALVDDWQCLKSMVRVFETHCGSLGQYGMKH  308
             +D S+ ++G  LFG E G  +L +VR  GL +VDDW C K+++R FETHCGSL +YGMKH
Sbjct  381   IDNSVKHIGKLLFGIEKGHKMLNNVRPAGLPVVDDWDCFKTLIRTFETHCGSLSEYGMKH  440

Query  307   MRAFANICNSNISEAAMEEACKNTC  233
             MR+FAN+CN+ I +  M EA    C
Sbjct  441   MRSFANLCNAGIRKEQMAEASAQAC  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5038884546152