BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25129_g1_i1 len=2138 path=[1326:0-946 2273:947-1009 2336:1010-1222
4554:1223-2137]

Length=2138
                                                                      Score     E

ref|XP_004252014.1|  PREDICTED: electron transfer flavoprotein-ub...    558   0.0      
ref|XP_006355764.1|  PREDICTED: electron transfer flavoprotein-ub...    552   0.0      
ref|XP_009604479.1|  PREDICTED: electron transfer flavoprotein-ub...    556   0.0      
ref|XP_009775903.1|  PREDICTED: electron transfer flavoprotein-ub...    554   0.0      
ref|XP_007226965.1|  hypothetical protein PRUPE_ppa002564mg             559   0.0      
ref|XP_011091641.1|  PREDICTED: electron transfer flavoprotein-ub...    549   0.0      
ref|XP_002270682.1|  PREDICTED: electron transfer flavoprotein-ub...    549   0.0      Vitis vinifera
ref|XP_011037121.1|  PREDICTED: electron transfer flavoprotein-ub...    549   0.0      
ref|XP_010672246.1|  PREDICTED: electron transfer flavoprotein-ub...    543   0.0      
ref|XP_010258523.1|  PREDICTED: electron transfer flavoprotein-ub...    551   0.0      
ref|XP_007033905.1|  Electron-transfer flavoprotein:ubiquinone ox...    546   0.0      
ref|XP_009142929.1|  PREDICTED: electron transfer flavoprotein-ub...    543   0.0      
ref|XP_006478732.1|  PREDICTED: electron transfer flavoprotein-ub...    554   0.0      
ref|XP_004309803.1|  PREDICTED: electron transfer flavoprotein-ub...    540   0.0      
ref|XP_006478731.1|  PREDICTED: electron transfer flavoprotein-ub...    553   0.0      
gb|EYU41104.1|  hypothetical protein MIMGU_mgv1a004148mg                536   0.0      
ref|XP_006397507.1|  hypothetical protein EUTSA_v10001353mg             541   0.0      
emb|CDX79827.1|  BnaA05g03290D                                          540   0.0      
emb|CBI36719.3|  unnamed protein product                                532   0.0      
ref|XP_010506212.1|  PREDICTED: electron transfer flavoprotein-ub...    537   0.0      
emb|CDY17928.1|  BnaC04g02910D                                          535   0.0      
ref|XP_006442991.1|  hypothetical protein CICLE_v10019615mg             543   0.0      
ref|XP_006295895.1|  hypothetical protein CARUB_v10025025mg             540   0.0      
ref|XP_008222598.1|  PREDICTED: electron transfer flavoprotein-ub...    531   0.0      
ref|XP_003546985.2|  PREDICTED: electron transfer flavoprotein-ub...    540   0.0      
ref|NP_181868.1|  electron-transfer flavoprotein--ubiquinone oxid...    536   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508435.1|  PREDICTED: electron transfer flavoprotein-ub...    531   0.0      
gb|KHG21413.1|  Electron transfer flavoprotein-ubiquinone oxidore...    523   0.0      
ref|XP_006397506.1|  hypothetical protein EUTSA_v10001353mg             541   0.0      
ref|XP_003597528.1|  Electron transfer flavoprotein-ubiquinone ox...    538   0.0      
ref|XP_010517901.1|  PREDICTED: electron transfer flavoprotein-ub...    530   0.0      
ref|XP_004147657.1|  PREDICTED: electron transfer flavoprotein-ub...    535   0.0      
ref|XP_008439064.1|  PREDICTED: electron transfer flavoprotein-ub...    538   0.0      
ref|XP_009389187.1|  PREDICTED: electron transfer flavoprotein-ub...    536   0.0      
ref|XP_002880044.1|  electron-transfer flavoprotein:ubiquinone ox...    531   0.0      
ref|XP_004486907.1|  PREDICTED: electron transfer flavoprotein-ub...    534   0.0      
ref|XP_002529480.1|  electron transfer flavoprotein-ubiquinone ox...    529   0.0      Ricinus communis
ref|XP_006858861.1|  hypothetical protein AMTR_s00066p00191280          527   0.0      
ref|XP_010069282.1|  PREDICTED: electron transfer flavoprotein-ub...    532   0.0      
ref|XP_007150442.1|  hypothetical protein PHAVU_005G153800g             539   0.0      
ref|XP_010527997.1|  PREDICTED: electron transfer flavoprotein-ub...    543   0.0      
gb|KDP43883.1|  hypothetical protein JCGZ_20893                         534   0.0      
ref|XP_010527913.1|  PREDICTED: electron transfer flavoprotein-ub...    542   0.0      
ref|XP_010933769.1|  PREDICTED: electron transfer flavoprotein-ub...    527   0.0      
ref|XP_004160647.1|  PREDICTED: electron transfer flavoprotein-ub...    525   0.0      
ref|XP_004486906.1|  PREDICTED: electron transfer flavoprotein-ub...    525   0.0      
ref|XP_010933768.1|  PREDICTED: electron transfer flavoprotein-ub...    526   0.0      
ref|XP_004486905.1|  PREDICTED: electron transfer flavoprotein-ub...    520   0.0      
gb|KCW57577.1|  hypothetical protein EUGRSUZ_H00345                     517   0.0      
ref|XP_004486902.1|  PREDICTED: electron transfer flavoprotein-ub...    521   0.0      
ref|XP_004309804.1|  PREDICTED: electron transfer flavoprotein-ub...    541   0.0      
ref|XP_004982609.1|  PREDICTED: electron transfer flavoprotein-ub...    495   0.0      
sp|Q337B8.1|ETFQO_ORYSJ  RecName: Full=Electron transfer flavopro...    494   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAK39567.1|AC025296_2  putative electron transfer oxidoreductase     489   0.0      Oryza sativa [red rice]
ref|XP_008673346.1|  PREDICTED: uncharacterized protein LOC100280...    493   0.0      
ref|XP_006661958.1|  PREDICTED: electron transfer flavoprotein-ub...    484   0.0      
gb|EEE51267.1|  hypothetical protein OsJ_32159                          487   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466941.1|  hypothetical protein SORBIDRAFT_01g017140          494   0.0      Sorghum bicolor [broomcorn]
gb|EEC67310.1|  hypothetical protein OsI_34318                          480   0.0      Oryza sativa Indica Group [Indian rice]
tpg|DAA49304.1|  TPA: hypothetical protein ZEAMMB73_777537              486   0.0      
ref|XP_003571956.1|  PREDICTED: electron transfer flavoprotein-ub...    491   0.0      
ref|XP_010933770.1|  PREDICTED: electron transfer flavoprotein-ub...    476   0.0      
ref|XP_010672247.1|  PREDICTED: electron transfer flavoprotein-ub...    455   0.0      
gb|ABB47885.1|  Electron transfer flavoprotein-ubiquinone oxidore...    468   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004486904.1|  PREDICTED: electron transfer flavoprotein-ub...    520   0.0      
ref|XP_004486903.1|  PREDICTED: electron transfer flavoprotein-ub...    535   0.0      
gb|AES67779.2|  electron transfer flavoprotein ubiquinone oxidore...    548   0.0      
ref|XP_006442990.1|  hypothetical protein CICLE_v10019615mg             545   0.0      
ref|XP_004486901.1|  PREDICTED: electron transfer flavoprotein-ub...    520   0.0      
ref|XP_001752925.1|  predicted protein                                  459   0.0      
ref|XP_002977361.1|  hypothetical protein SELMODRAFT_151870             454   0.0      
ref|XP_002974941.1|  hypothetical protein SELMODRAFT_150233             452   0.0      
ref|XP_009604480.1|  PREDICTED: electron transfer flavoprotein-ub...    400   0.0      
gb|KEH39482.1|  electron transfer flavoprotein ubiquinone oxidore...    548   0.0      
ref|XP_009775905.1|  PREDICTED: electron transfer flavoprotein-ub...    400   0.0      
gb|KEH39481.1|  electron transfer flavoprotein ubiquinone oxidore...    548   0.0      
ref|XP_006372846.1|  electron transfer flavoprotein-ubiquinone ox...    395   0.0      
ref|XP_005715486.1|  electron transfer flavoprotein-ubiquinone ox...    429   0.0      
ref|XP_005646544.1|  hypothetical protein COCSUDRAFT_37226              416   0.0      
ref|XP_010258524.1|  PREDICTED: electron transfer flavoprotein-ub...    389   0.0      
ref|XP_005702759.1|  electron-transferring-flavoprotein dehydroge...    404   0.0      
gb|KEH39483.1|  electron transfer flavoprotein ubiquinone oxidore...    550   0.0      
ref|WP_007677348.1|  electron transfer flavoprotein                     398   0.0      
ref|NP_001146788.1|  uncharacterized protein LOC100280392               380   0.0      Zea mays [maize]
ref|WP_018719670.1|  electron transfer flavoprotein                     380   0.0      
dbj|BAJ34227.1|  unnamed protein product                                542   0.0      
ref|WP_018719334.1|  electron transfer flavoprotein                     380   0.0      
gb|AAM53303.1|  biotin synthase Bio B                                   540   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010234895.1|  PREDICTED: electron transfer flavoprotein-ub...    492   0.0      
ref|WP_008943254.1|  electron transfer flavoprotein                     401   0.0      
ref|XP_004352386.1|  electron transfer flavoprotein-ubiquinone ox...    388   0.0      
ref|WP_027300957.1|  electron transfer flavoprotein-ubiquinone ox...    400   0.0      
ref|WP_029133943.1|  electron transfer flavoprotein-ubiquinone ox...    386   0.0      
ref|WP_019644428.1|  electron transfer flavoprotein                     388   4e-180   
gb|EIE75850.1|  hypothetical protein RO3G_00554                         363   1e-179   
ref|WP_037461408.1|  electron transfer flavoprotein-ubiquinone ox...    374   2e-179   
ref|WP_009539099.1|  Electron transfer flavoprotein-ubiquinone ox...    378   4e-179   
dbj|GAM20797.1|  hypothetical protein SAMD00019534_039720               386   2e-178   
gb|KEH39484.1|  electron transfer flavoprotein ubiquinone oxidore...    380   2e-178   
emb|CEI86823.1|  Putative Electron transfer flavoprotein ubiquino...    361   3e-178   
gb|EWY36007.1|  electron transfer flavoprotein                          370   3e-178   
ref|WP_028220220.1|  electron transfer flavoprotein-ubiquinone ox...    384   4e-178   
ref|WP_019255388.1|  dehydrogenase                                      382   4e-178   
ref|WP_029009999.1|  electron transfer flavoprotein-ubiquinone ox...    372   7e-178   
emb|CDS06384.1|  hypothetical protein LRAMOSA08912                      379   1e-177   
gb|KFI08173.1|  electron transfer flavoprotein-ubiquinone oxidore...    376   1e-177   
gb|EIF64680.1|  electron transfer flavoprotein-ubiquinone oxidore...    383   1e-177   
emb|CEG65208.1|  Putative Electron transfer flavoprotein ubiquino...    358   2e-177   
gb|EDU07603.1|  electron transfer flavoprotein-ubiquinone oxidore...    383   2e-177   Burkholderia pseudomallei 1655
ref|WP_025405091.1|  electron transfer flavoprotein-ubiquinone ox...    382   2e-177   
ref|WP_004526827.1|  dehydrogenase                                      383   2e-177   
ref|WP_038756861.1|  electron transfer flavoprotein-ubiquinone ox...    382   2e-177   
ref|WP_019957592.1|  electron transfer flavoprotein                     370   2e-177   
dbj|BAK03836.1|  predicted protein                                      504   2e-177   
ref|WP_038714431.1|  electron transfer flavoprotein-ubiquinone ox...    383   2e-177   
emb|CCA16231.1|  electrontransferringflavoprotein dehydrogenase puta    402   3e-177   
ref|WP_009966388.1|  dehydrogenase                                      382   3e-177   
ref|XP_001701999.1|  electron transfer flavoprotein-ubiquinone ox...    372   3e-177   Chlamydomonas reinhardtii
ref|WP_025986024.1|  electron transfer flavoprotein-ubiquinone ox...    382   3e-177   
ref|WP_004556915.1|  electron transfer flavoprotein-ubiquinone ox...    382   3e-177   
ref|WP_004193882.1|  MULTISPECIES: dehydrogenase                        382   4e-177   
ref|WP_038728634.1|  electron transfer flavoprotein-ubiquinone ox...    382   4e-177   
ref|WP_013046532.1|  electron transfer flavoprotein                     382   4e-177   
ref|WP_015601903.1|  FAD binding domain protein                         381   5e-177   
ref|WP_038771746.1|  electron transfer flavoprotein-ubiquinone ox...    382   5e-177   
ref|WP_019015990.1|  hypothetical protein                               367   6e-177   
ref|WP_035532860.1|  electron transfer flavoprotein-ubiquinone ox...    380   6e-177   
ref|WP_028466187.1|  electron transfer flavoprotein-ubiquinone ox...    381   6e-177   
ref|WP_027194283.1|  electron transfer flavoprotein-ubiquinone ox...    378   6e-177   
ref|WP_006026499.1|  dehydrogenase                                      380   7e-177   
ref|WP_035990382.1|  electron transfer flavoprotein-ubiquinone ox...    378   7e-177   
ref|WP_020054063.1|  hypothetical protein                               388   1e-176   
ref|WP_038743975.1|  electron transfer flavoprotein-ubiquinone ox...    380   1e-176   
gb|AHI78741.1|  FAD binding domain protein                              380   1e-176   
ref|WP_038780633.1|  electron transfer flavoprotein-ubiquinone ox...    380   1e-176   
ref|WP_027793424.1|  electron transfer flavoprotein-ubiquinone ox...    380   1e-176   
gb|KGS24093.1|  pyridine nucleotide-disulfide oxidoreductase fami...    382   1e-176   
ref|WP_003772075.1|  electron transfer flavoprotein                     391   2e-176   
ref|WP_012730109.1|  dehydrogenase                                      380   2e-176   
gb|EMC84765.1|  Electron transfer flavoprotein-ubiquinone oxidore...    373   2e-176   
ref|WP_021251410.1|  dehydrogenase                                      380   2e-176   
ref|XP_006682380.1|  hypothetical protein BATDEDRAFT_27979              379   3e-176   
ref|WP_009891608.1|  dehydrogenase                                      379   3e-176   
emb|CCI45444.1|  unnamed protein product                                402   3e-176   
ref|XP_005507908.1|  PREDICTED: electron transfer flavoprotein-ub...    373   3e-176   
ref|WP_038738208.1|  electron transfer flavoprotein-ubiquinone ox...    379   4e-176   
ref|WP_028217507.1|  electron transfer flavoprotein-ubiquinone ox...    377   4e-176   
ref|WP_021132414.1|  dehydrogenase                                      372   5e-176   
ref|WP_025989846.1|  electron transfer flavoprotein-ubiquinone ox...    376   6e-176   
ref|WP_017450682.1|  MULTISPECIES: dehydrogenase                        375   6e-176   
ref|WP_038751255.1|  electron transfer flavoprotein-ubiquinone ox...    375   6e-176   
gb|KFC75758.1|  Electron transfer flavoprotein-ubiquinone oxidore...    376   6e-176   
ref|WP_020850794.1|  FAD binding domain protein                         378   8e-176   
ref|NP_001087869.1|  electron-transferring-flavoprotein dehydroge...    374   9e-176   Xenopus laevis [clawed frog]
ref|WP_011881872.1|  dehydrogenase                                      382   1e-175   
ref|WP_036245898.1|  electron transfer flavoprotein-ubiquinone ox...    370   1e-175   
gb|KFH65101.1|  electron-transferring-flavoprotein dehydrogenase        367   1e-175   
ref|WP_028232653.1|  electron transfer flavoprotein-ubiquinone ox...    380   1e-175   
ref|WP_011285997.1|  electron transfer flavoprotein                     384   1e-175   
ref|WP_012400959.1|  dehydrogenase                                      374   1e-175   
ref|XP_009099437.1|  PREDICTED: electron transfer flavoprotein-ub...    370   1e-175   
ref|WP_014725166.1|  dehydrogenase                                      381   2e-175   
gb|KFZ53447.1|  hypothetical protein N338_10557                         371   2e-175   
ref|WP_027797970.1|  electron transfer flavoprotein-ubiquinone ox...    380   2e-175   
gb|KFU96891.1|  hypothetical protein N339_09144                         372   2e-175   
ref|WP_039754279.1|  electron transfer flavoprotein-ubiquinone ox...    372   2e-175   
ref|XP_005299361.1|  PREDICTED: electron transfer flavoprotein-ub...    369   2e-175   
ref|XP_006629536.1|  PREDICTED: electron transfer flavoprotein-ub...    370   2e-175   
gb|EPB88427.1|  electron-transferring-flavoprotein dehydrogenase        357   2e-175   
ref|WP_038712693.1|  electron transfer flavoprotein-ubiquinone ox...    370   2e-175   
ref|WP_008449442.1|  electron transfer flavoprotein-ubiquinone ox...    374   2e-175   
ref|WP_002691375.1|  electron transfer flavoprotein                     369   3e-175   
ref|XP_010074203.1|  PREDICTED: electron transfer flavoprotein-ub...    371   3e-175   
ref|WP_039370819.1|  electron transfer flavoprotein-ubiquinone ox...    374   3e-175   
ref|WP_036496110.1|  electron transfer flavoprotein-ubiquinone ox...    378   4e-175   
ref|WP_011660670.1|  dehydrogenase                                      374   4e-175   
emb|CCA85261.1|  ELECTRON TRANSFER FLAVOPROTEIN-UBIQUINONE OXIDOR...    373   4e-175   
ref|WP_015468218.1|  Electron transfer flavoprotein-ubiquinone ox...    393   4e-175   
ref|WP_014087161.1|  electron transfer flavoprotein                     369   4e-175   
gb|KDR21248.1|  Electron transfer flavoprotein-ubiquinone oxidore...    373   4e-175   
ref|WP_014897245.1|  dehydrogenase                                      373   4e-175   
gb|KDO29821.1|  hypothetical protein SPRG_04927                         412   5e-175   
ref|WP_034350157.1|  electron transfer flavoprotein-ubiquinone ox...    372   6e-175   
ref|NP_001005631.1|  electron transfer flavoprotein-ubiquinone ox...    372   6e-175   Xenopus tropicalis [western clawed frog]
ref|WP_027792375.1|  electron transfer flavoprotein-ubiquinone ox...    373   6e-175   
ref|WP_039335584.1|  electron transfer flavoprotein-ubiquinone ox...    371   7e-175   
ref|XP_009994219.1|  PREDICTED: electron transfer flavoprotein-ub...    370   7e-175   
gb|KFU88339.1|  hypothetical protein M959_02820                         370   7e-175   
ref|WP_028445286.1|  electron transfer flavoprotein-ubiquinone ox...    367   8e-175   
ref|WP_038709235.1|  electron transfer flavoprotein-ubiquinone ox...    368   8e-175   
ref|WP_027816459.1|  electron transfer flavoprotein-ubiquinone ox...    376   8e-175   
ref|WP_012213489.1|  dehydrogenase                                      371   8e-175   
ref|WP_014746187.1|  electron transfer flavoprotein                     380   8e-175   
ref|WP_007585449.1|  MULTISPECIES: dehydrogenase                        370   9e-175   
ref|WP_026687107.1|  electron transfer flavoprotein-ubiquinone ox...    361   9e-175   
ref|WP_038455600.1|  electron transfer flavoprotein-ubiquinone ox...    374   9e-175   
ref|WP_014087257.1|  electron transfer flavoprotein                     367   9e-175   
gb|EAY62113.1|  Dehydrogenase                                           372   1e-174   Burkholderia cenocepacia PC184
ref|XP_007436536.1|  PREDICTED: electron transfer flavoprotein-ub...    373   1e-174   
ref|WP_035546943.1|  electron transfer flavoprotein-ubiquinone ox...    380   1e-174   
ref|WP_006498524.1|  dehydrogenase                                      374   1e-174   
ref|WP_006413264.1|  dehydrogenase                                      370   1e-174   
ref|XP_005517648.1|  PREDICTED: electron transfer flavoprotein-ub...    370   1e-174   
ref|XP_007071342.1|  PREDICTED: electron transfer flavoprotein-ub...    367   1e-174   
ref|WP_014103512.1|  electron transfer flavoprotein                     387   1e-174   
ref|WP_006488512.1|  MULTISPECIES: dehydrogenase                        374   1e-174   
ref|XP_005232538.1|  PREDICTED: electron transfer flavoprotein-ub...    369   1e-174   
ref|WP_006402093.1|  dehydrogenase                                      370   1e-174   
gb|KFQ46672.1|  hypothetical protein N333_03372                         369   1e-174   
gb|AIO31185.1|  FAD binding domain protein                              374   1e-174   
gb|KDV26560.1|  electron transfer flavoprotein-ubiquinone oxidore...    372   1e-174   
ref|WP_012371926.1|  dehydrogenase                                      371   2e-174   
ref|XP_010009141.1|  PREDICTED: electron transfer flavoprotein-ub...    368   2e-174   
ref|WP_034203734.1|  electron transfer flavoprotein-ubiquinone ox...    374   2e-174   
ref|WP_034174160.1|  electron transfer flavoprotein-ubiquinone ox...    372   2e-174   
ref|WP_035950271.1|  electron transfer flavoprotein-ubiquinone ox...    370   2e-174   
ref|WP_034175548.1|  electron transfer flavoprotein-ubiquinone ox...    372   2e-174   
ref|WP_006489716.1|  dehydrogenase                                      374   2e-174   
ref|WP_012384737.1|  electron transfer flavoprotein                     381   2e-174   
gb|KER71661.1|  electron transfer flavoprotein-ubiquinone oxidore...    371   2e-174   
ref|WP_034199546.1|  electron transfer flavoprotein-ubiquinone ox...    374   2e-174   
emb|CDI00877.1|  Electron transfer flavoprotein-ubiquinone oxidor...    384   2e-174   
gb|KFQ73185.1|  hypothetical protein N337_04341                         369   2e-174   
gb|KFW96184.1|  hypothetical protein N336_10049                         369   2e-174   
ref|XP_002198937.2|  PREDICTED: electron transfer flavoprotein-ub...    371   2e-174   Taeniopygia guttata
ref|XP_009499703.1|  PREDICTED: electron transfer flavoprotein-ub...    369   2e-174   
gb|EIE80316.1|  hypothetical protein RO3G_05021                         350   2e-174   
ref|WP_008952700.1|  electron transfer flavoprotein                     367   2e-174   
emb|CCI45445.1|  unnamed protein product                                396   2e-174   
gb|KFR08684.1|  hypothetical protein Y956_01058                         368   2e-174   
ref|WP_008955617.1|  electron transfer flavoprotein                     363   2e-174   
ref|WP_026122040.1|  electron transfer flavoprotein-ubiquinone ox...    372   2e-174   
ref|WP_014085823.1|  electron transfer flavoprotein                     365   2e-174   
ref|XP_009473036.1|  PREDICTED: electron transfer flavoprotein-ub...    368   3e-174   
gb|KFO74349.1|  hypothetical protein N303_14232                         369   3e-174   
gb|KER69162.1|  electron transfer flavoprotein-ubiquinone oxidore...    370   3e-174   
ref|WP_029770445.1|  electron transfer flavoprotein-ubiquinone ox...    365   3e-174   
gb|KFV95243.1|  hypothetical protein N326_11102                         369   3e-174   
ref|XP_009556752.1|  PREDICTED: electron transfer flavoprotein-ub...    369   3e-174   
gb|KFP45177.1|  hypothetical protein N324_10181                         367   3e-174   
gb|EMP24943.1|  Electron transfer flavoprotein-ubiquinone oxidore...    365   3e-174   
ref|WP_011351769.1|  dehydrogenase                                      371   3e-174   
ref|WP_036168071.1|  electron transfer flavoprotein-ubiquinone ox...    374   3e-174   
emb|CCQ75325.1|  electron transfer flavoprotein-ubiquinone oxidor...    365   3e-174   
ref|WP_012363721.1|  dehydrogenase                                      370   4e-174   
ref|XP_009981915.1|  PREDICTED: electron transfer flavoprotein-ub...    367   4e-174   
ref|XP_005045087.1|  PREDICTED: electron transfer flavoprotein-ub...    368   4e-174   
ref|WP_020702680.1|  dehydrogenase                                      371   4e-174   
ref|WP_011349563.1|  dehydrogenase                                      370   4e-174   
ref|WP_036206833.1|  electron transfer flavoprotein-ubiquinone ox...    370   4e-174   
ref|WP_035926783.1|  electron transfer flavoprotein-ubiquinone ox...    374   4e-174   
ref|XP_010125411.1|  PREDICTED: electron transfer flavoprotein-ub...    367   4e-174   
gb|KFV01256.1|  hypothetical protein N340_11931                         367   4e-174   
ref|XP_010154741.1|  PREDICTED: electron transfer flavoprotein-ub...    368   5e-174   
ref|XP_009892019.1|  PREDICTED: electron transfer flavoprotein-ub...    368   5e-174   
ref|WP_006402897.1|  dehydrogenase                                      371   5e-174   
ref|WP_009605650.1|  electron transfer flavoprotein                     367   6e-174   
ref|XP_008909782.1|  hypothetical protein PPTG_14608                    403   6e-174   
ref|XP_009921881.1|  PREDICTED: electron transfer flavoprotein-ub...    367   6e-174   
ref|WP_027787713.1|  electron transfer flavoprotein-ubiquinone ox...    373   6e-174   
ref|XP_010202534.1|  PREDICTED: electron transfer flavoprotein-ub...    367   6e-174   
gb|KGM00205.1|  hypothetical protein N301_13207                         368   7e-174   
ref|WP_006411225.1|  dehydrogenase                                      370   7e-174   
ref|XP_010154742.1|  PREDICTED: electron transfer flavoprotein-ub...    368   7e-174   
ref|WP_027456757.1|  electron transfer flavoprotein-ubiquinone ox...    375   7e-174   
gb|KFP32656.1|  hypothetical protein N325_07535                         367   8e-174   
ref|WP_006407327.1|  dehydrogenase                                      369   8e-174   
ref|WP_006409262.1|  dehydrogenase                                      370   8e-174   
ref|WP_012337244.1|  dehydrogenase                                      371   8e-174   
gb|KFV40441.1|  hypothetical protein N328_11146                         367   9e-174   
ref|XP_009281609.1|  PREDICTED: electron transfer flavoprotein-ub...    368   9e-174   
emb|CDH44455.1|  Electron transfer flavoprotein-ubiquinone oxidor...    392   9e-174   
ref|WP_011879791.1|  dehydrogenase                                      367   9e-174   
ref|XP_009819725.1|  PREDICTED: electron transfer flavoprotein-ub...    367   9e-174   
gb|EXX79057.1|  Cir2p                                                   377   9e-174   
gb|KFO07740.1|  hypothetical protein N312_07702                         367   9e-174   
gb|KFQ07803.1|  hypothetical protein N329_07046                         366   1e-173   
ref|XP_009868933.1|  PREDICTED: electron transfer flavoprotein-ub...    362   1e-173   
gb|KFP89548.1|  hypothetical protein N311_08639                         362   1e-173   
ref|WP_012217813.1|  dehydrogenase                                      370   1e-173   
ref|WP_012337384.1|  dehydrogenase                                      371   1e-173   
ref|XP_010310552.1|  PREDICTED: electron transfer flavoprotein-ub...    367   1e-173   
ref|WP_006410643.1|  electron-transferring-flavoprotein dehydroge...    370   1e-173   
gb|KFM10270.1|  hypothetical protein AS27_12858                         368   1e-173   
gb|KFO65362.1|  hypothetical protein N302_06598                         366   1e-173   
ref|WP_020021779.1|  hypothetical protein                               377   1e-173   
ref|WP_017942690.1|  MULTISPECIES: hypothetical protein                 380   1e-173   
ref|WP_011884531.1|  dehydrogenase                                      367   1e-173   
gb|AIO41583.1|  FAD binding domain protein                              369   1e-173   
gb|KFP47374.1|  hypothetical protein N323_10926                         367   1e-173   
ref|WP_014722897.1|  dehydrogenase                                      367   1e-173   
ref|WP_017335522.1|  dehydrogenase                                      369   1e-173   
gb|KFW61327.1|  hypothetical protein AS28_03647                         370   1e-173   
ref|WP_034207096.1|  electron transfer flavoprotein-ubiquinone ox...    369   1e-173   
ref|WP_035573370.1|  electron transfer flavoprotein-ubiquinone ox...    394   2e-173   
ref|WP_034209389.1|  electron transfer flavoprotein-ubiquinone ox...    369   2e-173   
ref|WP_017332559.1|  dehydrogenase                                      369   2e-173   
ref|XP_008640139.1|  PREDICTED: electron transfer flavoprotein-ub...    365   2e-173   
gb|KFZ48922.1|  hypothetical protein N321_02503                         367   2e-173   
ref|WP_014725605.1|  dehydrogenase                                      369   2e-173   
ref|XP_009323480.1|  PREDICTED: electron transfer flavoprotein-ub...    369   2e-173   
gb|ETO69084.1|  hypothetical protein F444_14232                         403   2e-173   
gb|KGY59557.1|  electron transfer flavoprotein-ubiquinone oxidore...    370   2e-173   
ref|XP_009935227.1|  PREDICTED: electron transfer flavoprotein-ub...    366   2e-173   
gb|EIJ46980.1|  electron transfer flavoprotein-ubiquinone oxidore...    367   2e-173   
ref|XP_010173974.1|  PREDICTED: electron transfer flavoprotein-ub...    366   3e-173   
gb|KFR12602.1|  hypothetical protein N306_02775                         366   3e-173   
ref|WP_031359015.1|  electron transfer flavoprotein-ubiquinone ox...    378   3e-173   
ref|XP_005016639.1|  PREDICTED: electron transfer flavoprotein-ub...    363   3e-173   
ref|WP_027811264.1|  electron transfer flavoprotein-ubiquinone ox...    370   3e-173   
ref|WP_011545747.1|  dehydrogenase                                      370   3e-173   
emb|CDN65331.1|  Electron transfer flavoprotein-ubiquinone oxidor...    369   3e-173   
ref|WP_038570733.1|  electron transfer flavoprotein-ubiquinone ox...    369   3e-173   
ref|WP_015876148.1|  dehydrogenase                                      371   4e-173   
ref|WP_027818682.1|  electron transfer flavoprotein-ubiquinone ox...    371   4e-173   
gb|KFQ13014.1|  hypothetical protein N330_09593                         366   4e-173   
ref|WP_027786162.1|  electron transfer flavoprotein-ubiquinone ox...    369   4e-173   
ref|XP_009951741.1|  PREDICTED: electron transfer flavoprotein-ub...    366   4e-173   
ref|XP_642004.1|  electron transfer flavoprotein-ubiquinone oxido...    379   4e-173   
gb|KFO88270.1|  hypothetical protein N320_01173                         366   4e-173   
ref|WP_027810268.1|  electron transfer flavoprotein-ubiquinone ox...    369   4e-173   
ref|XP_008603788.1|  electron-transferring-flavoprotein dehydroge...    410   4e-173   
ref|XP_004656022.1|  PREDICTED: electron transfer flavoprotein-ub...    365   4e-173   
ref|WP_011545235.1|  dehydrogenase                                      369   4e-173   
gb|EOB03483.1|  Electron transfer flavoprotein-ubiquinone oxidore...    362   5e-173   
ref|XP_010132030.1|  PREDICTED: electron transfer flavoprotein-ub...    366   5e-173   
ref|XP_009698127.1|  PREDICTED: electron transfer flavoprotein-ub...    365   5e-173   
ref|XP_009049261.1|  hypothetical protein LOTGIDRAFT_230999             365   5e-173   
gb|EAY67266.1|  Dehydrogenase                                           367   5e-173   
ref|WP_027784247.1|  electron transfer flavoprotein-ubiquinone ox...    369   5e-173   
ref|WP_029770611.1|  electron transfer flavoprotein-ubiquinone ox...    357   6e-173   
ref|WP_011656662.1|  dehydrogenase                                      368   6e-173   
ref|WP_014414666.1|  electron transfer flavoprotein                     355   6e-173   
ref|XP_008324859.1|  PREDICTED: electron transfer flavoprotein-ub...    365   6e-173   
ref|WP_012404102.1|  dehydrogenase                                      368   7e-173   
ref|WP_036386181.1|  electron transfer flavoprotein-ubiquinone ox...    365   7e-173   
ref|WP_025898196.1|  electron transfer flavoprotein-ubiquinone ox...    369   7e-173   
gb|KFQ59650.1|  hypothetical protein N334_08785                         364   7e-173   
ref|WP_018425444.1|  dehydrogenase                                      382   8e-173   
ref|WP_027799847.1|  electron transfer flavoprotein-ubiquinone ox...    365   8e-173   
ref|WP_038491218.1|  electron transfer flavoprotein-ubiquinone ox...    369   8e-173   
ref|XP_009477806.1|  PREDICTED: electron transfer flavoprotein-ub...    364   8e-173   
ref|WP_029770647.1|  electron transfer flavoprotein-ubiquinone ox...    360   8e-173   
gb|KFP64834.1|  hypothetical protein N322_12557                         364   9e-173   
gb|AEE61469.1|  unknown                                                 366   9e-173   
ref|WP_028821241.1|  electron transfer flavoprotein-ubiquinone ox...    374   1e-172   
ref|XP_007229921.1|  PREDICTED: electron transfer flavoprotein-ub...    359   1e-172   
ref|XP_004343976.1|  electron transfer flavoproteinubiquinone oxi...    362   1e-172   
ref|XP_002907062.1|  electron transfer flavoprotein-ubiquinone ox...    403   1e-172   
ref|XP_005486379.1|  PREDICTED: electron transfer flavoprotein-ub...    368   1e-172   
ref|XP_010898270.1|  PREDICTED: electron transfer flavoprotein-ub...    363   1e-172   
gb|KER69068.1|  electron transfer flavoprotein-ubiquinone oxidore...    370   1e-172   
ref|XP_008286042.1|  PREDICTED: electron transfer flavoprotein-ub...    363   1e-172   
emb|CDY74218.1|  Electron transfer flavoprotein-ubiquinone oxidor...    369   1e-172   
ref|WP_006764518.1|  dehydrogenase                                      366   1e-172   
ref|WP_009522446.1|  dehydrogenase                                      372   1e-172   
ref|XP_005486378.1|  PREDICTED: electron transfer flavoprotein-ub...    367   1e-172   
ref|XP_005415631.1|  PREDICTED: electron transfer flavoprotein-ub...    366   1e-172   
ref|XP_009845263.1|  hypothetical protein H257_17980                    407   1e-172   
ref|XP_010746148.1|  PREDICTED: electron transfer flavoprotein-ub...    363   1e-172   
ref|XP_009845273.1|  hypothetical protein H257_17984                    408   2e-172   
gb|ERZ96880.1|  hypothetical protein GLOINDRAFT_39568                   373   2e-172   
gb|EPZ35727.1|  Electron transfer flavoprotein-ubiquinone oxidore...    355   2e-172   
ref|WP_035503415.1|  electron transfer flavoprotein-ubiquinone ox...    382   2e-172   
ref|WP_039786685.1|  electron transfer flavoprotein-ubiquinone ox...    372   2e-172   
ref|XP_010707744.1|  PREDICTED: electron transfer flavoprotein-ub...    365   2e-172   
ref|WP_003822875.1|  electron transfer flavoprotein                     392   2e-172   
emb|CDQ63778.1|  unnamed protein product                                364   2e-172   
ref|WP_009118666.1|  electron transfer flavoprotein                     376   2e-172   
gb|KFV70434.1|  hypothetical protein N307_12427                         360   2e-172   
ref|WP_034431638.1|  electron transfer flavoprotein-ubiquinone ox...    388   2e-172   
ref|XP_008931383.1|  PREDICTED: electron transfer flavoprotein-ub...    364   2e-172   
gb|KFW75628.1|  hypothetical protein N305_00468                         364   2e-172   
ref|WP_017423171.1|  dehydrogenase                                      369   2e-172   
ref|XP_009902875.1|  PREDICTED: electron transfer flavoprotein-ub...    359   3e-172   
ref|WP_014241697.1|  electron transfer flavoprotein                     379   3e-172   
ref|WP_007881971.1|  dehydrogenase                                      359   3e-172   
ref|WP_036214089.1|  electron transfer flavoprotein-ubiquinone ox...    365   3e-172   
ref|WP_005881508.1|  dehydrogenase                                      370   3e-172   
gb|KFP14007.1|  hypothetical protein Z169_00940                         365   4e-172   
ref|XP_004645516.1|  PREDICTED: electron transfer flavoprotein-ub...    362   4e-172   
ref|XP_009634763.1|  PREDICTED: electron transfer flavoprotein-ub...    364   4e-172   
ref|XP_001960840.1|  GF13564                                            358   4e-172   
ref|WP_026121186.1|  electron transfer flavoprotein-ubiquinone ox...    357   4e-172   
ref|XP_006081912.1|  PREDICTED: electron transfer flavoprotein-ub...    360   5e-172   
gb|KFV82475.1|  hypothetical protein N308_08162                         361   5e-172   
ref|XP_006081913.1|  PREDICTED: electron transfer flavoprotein-ub...    360   5e-172   
gb|ELK38664.1|  Electron transfer flavoprotein-ubiquinone oxidore...    362   6e-172   
ref|WP_013233788.1|  dehydrogenase                                      362   6e-172   
ref|XP_009675444.1|  PREDICTED: electron transfer flavoprotein-ub...    360   6e-172   
ref|XP_010834383.1|  PREDICTED: electron transfer flavoprotein-ub...    360   6e-172   
ref|XP_005860593.1|  PREDICTED: electron transfer flavoprotein-ub...    361   6e-172   
gb|ACI34143.1|  Electron transfer flavoprotein-ubiquinone oxidore...    361   6e-172   
ref|WP_039051630.1|  electron transfer flavoprotein-ubiquinone ox...    368   6e-172   
ref|XP_010834384.1|  PREDICTED: electron transfer flavoprotein-ub...    360   6e-172   
emb|CDQ62286.1|  unnamed protein product                                361   7e-172   
ref|XP_006752725.1|  PREDICTED: electron transfer flavoprotein-ub...    361   7e-172   
ref|NP_001070598.1|  electron transfer flavoprotein-ubiquinone ox...    360   7e-172   
ref|XP_010812107.1|  PREDICTED: electron transfer flavoprotein-ub...    360   7e-172   
ref|NP_001277165.1|  electron-transferring-flavoprotein dehydroge...    360   8e-172   
ref|XP_010410152.1|  PREDICTED: LOW QUALITY PROTEIN: electron tra...    363   8e-172   
gb|EYE98250.1|  electron transfer flavo protein-ubiquinone oxidor...    369   8e-172   
gb|ELR46334.1|  Electron transfer flavoprotein-ubiquinone oxidore...    360   8e-172   
ref|WP_002729595.1|  electron transfer flavoprotein                     369   8e-172   
ref|WP_022727647.1|  electron transfer flavoprotein                     381   8e-172   
ref|XP_009071349.1|  PREDICTED: electron transfer flavoprotein-ub...    362   9e-172   
ref|WP_027136124.1|  electron transfer flavoprotein-ubiquinone ox...    363   1e-171   
ref|XP_009071350.1|  PREDICTED: electron transfer flavoprotein-ub...    362   1e-171   
ref|XP_008142695.1|  PREDICTED: electron transfer flavoprotein-ub...    359   1e-171   
ref|XP_006121930.1|  PREDICTED: electron transfer flavoprotein-ub...    363   1e-171   
ref|XP_008142703.1|  PREDICTED: electron transfer flavoprotein-ub...    359   1e-171   
ref|WP_025282913.1|  electron transfer flavoprotein-ubiquinone ox...    364   1e-171   
ref|WP_006767519.1|  dehydrogenase                                      362   1e-171   
ref|WP_011515934.1|  dehydrogenase                                      373   1e-171   
ref|WP_008650519.1|  electron transfer flavoprotein-ubiquinone ox...    373   1e-171   
gb|EZQ04551.1|  electron transfer flavoprotein-ubiquinone oxidore...    381   1e-171   
ref|XP_008492032.1|  PREDICTED: electron transfer flavoprotein-ub...    365   1e-171   
ref|XP_003129051.1|  PREDICTED: electron transfer flavoprotein-ub...    359   1e-171   
ref|XP_004526004.1|  PREDICTED: electron transfer flavoprotein-ub...    359   1e-171   
ref|WP_026229668.1|  electron transfer flavoprotein-ubiquinone ox...    365   1e-171   
ref|WP_012433749.1|  dehydrogenase                                      364   1e-171   
gb|KFP00866.1|  hypothetical protein N300_14988                         365   2e-171   
ref|WP_038779429.1|  electron transfer flavoprotein-ubiquinone ox...    382   2e-171   
ref|XP_008419301.1|  PREDICTED: electron transfer flavoprotein-ub...    363   2e-171   
gb|ETA84218.1|  hypothetical protein HMPREF1177_00515                   387   2e-171   
ref|NP_942037.2|  electron transfer flavoprotein-ubiquinone oxido...    361   2e-171   
ref|XP_002736184.1|  PREDICTED: electron transfer flavoprotein-ub...    363   2e-171   
ref|XP_009497002.1|  electron-transferring-flavoprotein dehydroge...    374   2e-171   
ref|XP_001639093.1|  predicted protein                                  359   2e-171   
ref|XP_008759306.1|  PREDICTED: electron transfer flavoprotein-ub...    360   2e-171   
ref|XP_004591468.1|  PREDICTED: electron transfer flavoprotein-ub...    358   3e-171   
ref|WP_034337693.1|  electron transfer flavoprotein-ubiquinone ox...    370   3e-171   
ref|WP_021133486.1|  electron-transferring-flavoprotein dehydroge...    375   3e-171   
ref|XP_006213655.1|  PREDICTED: electron transfer flavoprotein-ub...    362   3e-171   
ref|WP_037490512.1|  electron transfer flavoprotein-ubiquinone ox...    374   3e-171   
ref|WP_018421160.1|  dehydrogenase                                      362   3e-171   
ref|XP_005330997.1|  PREDICTED: electron transfer flavoprotein-ub...    357   3e-171   
ref|WP_037488378.1|  electron transfer flavoprotein-ubiquinone ox...    383   3e-171   
sp|Q6UPE1.1|ETFD_RAT  RecName: Full=Electron transfer flavoprotei...    360   3e-171   
ref|WP_004284992.1|  electron transfer flavoprotein                     372   3e-171   
ref|WP_035881869.1|  electron transfer flavoprotein-ubiquinone ox...    372   3e-171   
ref|WP_024569195.1|  MULTISPECIES: electron transfer flavoprotein...    373   4e-171   
ref|WP_004286298.1|  electron transfer flavoprotein                     372   4e-171   
ref|WP_027776592.1|  electron transfer flavoprotein-ubiquinone ox...    362   4e-171   
ref|XP_004788929.1|  PREDICTED: electron transfer flavoprotein-ub...    359   4e-171   
ref|WP_039373561.1|  electron transfer flavoprotein-ubiquinone ox...    376   4e-171   
ref|WP_027288445.1|  electron transfer flavoprotein-ubiquinone ox...    380   4e-171   
sp|P55931.2|ETFD_PIG  RecName: Full=Electron transfer flavoprotei...    358   4e-171   
gb|EHH26275.1|  hypothetical protein EGK_16196                          356   4e-171   
gb|KGF83074.1|  electron transfer flavoprotein-ubiquinone oxidore...    379   4e-171   
ref|XP_008419302.1|  PREDICTED: electron transfer flavoprotein-ub...    362   5e-171   
ref|XP_007117528.1|  PREDICTED: electron transfer flavoprotein-ub...    357   5e-171   
ref|WP_028216684.1|  electron transfer flavoprotein-ubiquinone ox...    358   5e-171   
gb|AAB30031.1|  electron transfer flavoprotein-ubiquinone oxidore...    358   5e-171   
gb|EZQ05407.1|  electron transfer flavoprotein-ubiquinone oxidore...    380   5e-171   
pdb|2GMH|A  Chain A, Structure Of Porcine Electron Transfer Flavo...    358   5e-171   
ref|XP_007084277.1|  PREDICTED: electron transfer flavoprotein-ub...    359   5e-171   
ref|XP_005330998.1|  PREDICTED: electron transfer flavoprotein-ub...    356   5e-171   
ref|XP_007551093.1|  PREDICTED: electron transfer flavoprotein-ub...    363   5e-171   
ref|XP_005401021.1|  PREDICTED: electron transfer flavoprotein-ub...    355   6e-171   
ref|XP_002921708.1|  PREDICTED: electron transfer flavoprotein-ub...    359   6e-171   
ref|XP_004017330.1|  PREDICTED: electron transfer flavoprotein-ub...    357   6e-171   
ref|XP_008683776.1|  PREDICTED: electron transfer flavoprotein-ub...    359   6e-171   
ref|XP_008683777.1|  PREDICTED: electron transfer flavoprotein-ub...    359   6e-171   
gb|EFB29937.1|  hypothetical protein PANDA_010617                       359   6e-171   
ref|XP_005691358.1|  PREDICTED: electron transfer flavoprotein-ub...    357   7e-171   
ref|XP_007117525.1|  PREDICTED: electron transfer flavoprotein-ub...    357   7e-171   
ref|XP_008863422.1|  hypothetical protein H310_01869                    405   7e-171   
ref|XP_009519962.1|  hypothetical protein PHYSODRAFT_344769             396   7e-171   
ref|XP_005977494.1|  PREDICTED: electron transfer flavoprotein-ub...    357   7e-171   
ref|XP_007998312.1|  PREDICTED: electron transfer flavoprotein-ub...    355   8e-171   
ref|XP_003970635.1|  PREDICTED: electron transfer flavoprotein-ub...    357   8e-171   
ref|XP_002089866.1|  GE19317                                            357   8e-171   
ref|WP_005000177.1|  electron transfer flavoprotein                     361   9e-171   
ref|XP_004394282.1|  PREDICTED: electron transfer flavoprotein-ub...    360   9e-171   
ref|XP_004394283.1|  PREDICTED: electron transfer flavoprotein-ub...    359   9e-171   
ref|XP_003822584.1|  PREDICTED: electron transfer flavoprotein-ub...    354   9e-171   
ref|XP_001361234.1|  GA11432                                            356   9e-171   
ref|XP_006023223.1|  PREDICTED: electron transfer flavoprotein-ub...    361   1e-170   
ref|WP_029757288.1|  electron transfer flavoprotein-ubiquinone ox...    379   1e-170   
ref|WP_028226384.1|  electron transfer flavoprotein-ubiquinone ox...    366   1e-170   
ref|XP_002745327.1|  PREDICTED: electron transfer flavoprotein-ub...    358   1e-170   
ref|NP_001277019.1|  electron transfer flavoprotein-ubiquinone ox...    360   1e-170   
ref|XP_003899365.1|  PREDICTED: electron transfer flavoprotein-ub...    355   1e-170   
ref|XP_004266205.1|  PREDICTED: electron transfer flavoprotein-ub...    357   1e-170   
ref|XP_002112822.1|  hypothetical protein TRIADDRAFT_56357              370   1e-170   
ref|XP_005148982.1|  PREDICTED: electron transfer flavoprotein-ub...    357   1e-170   
ref|XP_003927982.1|  PREDICTED: electron transfer flavoprotein-ub...    357   1e-170   
ref|XP_004040617.1|  PREDICTED: electron transfer flavoprotein-ub...    355   1e-170   
ref|WP_016345021.1|  electron-transferring-flavoprotein dehydroge...    366   1e-170   
ref|XP_005182208.1|  PREDICTED: electron transfer flavoprotein-ub...    363   1e-170   
ref|XP_969902.1|  PREDICTED: electron transfer flavoprotein-ubiqu...    367   1e-170   
ref|WP_037406610.1|  electron transfer flavoprotein-ubiquinone ox...    371   1e-170   
ref|XP_003500255.1|  PREDICTED: electron transfer flavoprotein-ub...    358   1e-170   
ref|XP_008974386.1|  PREDICTED: electron transfer flavoprotein-ub...    354   1e-170   
ref|NP_080070.2|  electron transfer flavoprotein-ubiquinone oxido...    358   1e-170   
ref|XP_007551092.1|  PREDICTED: electron transfer flavoprotein-ub...    362   2e-170   
ref|NP_001004598.1|  electron transfer flavoprotein-ubiquinone ox...    358   2e-170   
ref|XP_010381495.1|  PREDICTED: electron transfer flavoprotein-ub...    355   2e-170   
ref|XP_517508.2|  PREDICTED: electron transfer flavoprotein-ubiqu...    354   2e-170   



>ref|XP_004252014.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Solanum lycopersicum]
Length=608

 Score =   558 bits (1437),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 277/374 (74%), Positives = 313/374 (84%), Gaps = 16/374 (4%)
 Frame = +3

Query  153   MLKFILSSAKSKL-----------STTPINRFSSFPNPCGKA-----SRFGAESGYSLNG  284
             M KFI SS+KSKL           S    N  S+  N   K      +  G    +  +G
Sbjct  1     MYKFINSSSKSKLIPLLSNSILYKSACSSNLVSNSRNEISKKIHKPKNGNGNRVLWGRSG  60

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
              R +SSES RE + YDVVIVGAGPAGLSAAI+LKQLC++K+ DLSVCVVEKGAEVGAHIL
Sbjct  61    FRSYSSESDRETMNYDVVIVGAGPAGLSAAIKLKQLCQQKDVDLSVCVVEKGAEVGAHIL  120

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRALDEL+P W++E+ PIDVPV+SD F LL++NRAFSLPSPF+NKGNYVISL Q
Sbjct  121   SGNVFEPRALDELVPHWKEEEAPIDVPVTSDNFWLLTENRAFSLPSPFDNKGNYVISLGQ  180

Query  645   LVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK  824
             LVRWLGQKAE+LGVE+YPGFAASEIL NE +EV GIATNDMGVAKDGSRKEN+QHGV LK
Sbjct  181   LVRWLGQKAEQLGVEIYPGFAASEILCNEHNEVTGIATNDMGVAKDGSRKENYQHGVALK  240

Query  825   GRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIG  1004
             GRVTLLAEGCRGSL+E++I KY LREKG GQHQTYALGIKEVWEIDA+KH+PG VLHT+G
Sbjct  241   GRVTLLAEGCRGSLSEKLIKKYNLREKGQGQHQTYALGIKEVWEIDADKHQPGYVLHTLG  300

Query  1005  WPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTV  1184
             WPLD KTYGGSFLYHMK+RQVA+GLVVAL+Y NPFLNPYEE+Q+FK HPAIRPLLEGG V
Sbjct  301   WPLDQKTYGGSFLYHMKDRQVAVGLVVALDYQNPFLNPYEEYQRFKRHPAIRPLLEGGNV  360

Query  1185  LQYGARTLNEGGYQ  1226
             LQYGAR+LNEGG+Q
Sbjct  361   LQYGARSLNEGGFQ  374


 Score =   403 bits (1036),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCSAGFLNVPKIKGTHTAMKSGMLAAESAF MLQ G  ME +WDNLRSSWIW
Sbjct  380   VFPGGAIMGCSAGFLNVPKIKGTHTAMKSGMLAAESAFSMLQEGLKMENYWDNLRSSWIW  439

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE GL+PGLALSA+E YILKGRSP+T  HGKPDHEA  EA+   PIEY
Sbjct  440   EELYTARNYRPAFEYGLYPGLALSAVEHYILKGRSPVTLNHGKPDHEATREAQLFSPIEY  499

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HL LKDP  PE VNLPKYAGPE+RYCPARVYE
Sbjct  500   PKPDGVVSFDVPTSLYRSNTNHDHDQPSHLHLKDPTVPENVNLPKYAGPEARYCPARVYE  559

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+ G++KL INAQNCLHCKAC IKDP QN +WTVPEGGGGPGYT+M
Sbjct  560   YIPDETGDLKLQINAQNCLHCKACSIKDPKQNFEWTVPEGGGGPGYTIM  608



>ref|XP_006355764.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like [Solanum tuberosum]
Length=608

 Score =   552 bits (1423),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/316 (83%), Positives = 292/316 (92%), Gaps = 0/316 (0%)
 Frame = +3

Query  279   NGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAH  458
             +G R +SSES RE + YDVVIVGAGPAGLSAAI+LKQLC++K  DLSVCVVEKGAEVGAH
Sbjct  59    SGFRSYSSESDRETMNYDVVIVGAGPAGLSAAIKLKQLCQQKEVDLSVCVVEKGAEVGAH  118

Query  459   ILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISL  638
             ILSGNVFEPRALDEL+P W++E+ PIDVPV+SD F LL++NRAFSLPSPF+NKGNYV+SL
Sbjct  119   ILSGNVFEPRALDELVPHWKEEEAPIDVPVTSDNFWLLTENRAFSLPSPFDNKGNYVLSL  178

Query  639   SQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVE  818
             SQLVRWLGQKAEELGVE+YPGFAASEIL NE +EV GIATNDMGVAKDGSRKEN+Q GV 
Sbjct  179   SQLVRWLGQKAEELGVEIYPGFAASEILCNEHNEVTGIATNDMGVAKDGSRKENYQRGVA  238

Query  819   LKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHT  998
             LKGRVTLLAEGCRGSL+E++I KY LREKG GQHQTYALGIKEVWEID +KH+PG VLHT
Sbjct  239   LKGRVTLLAEGCRGSLSEKLIKKYNLREKGQGQHQTYALGIKEVWEIDGDKHQPGYVLHT  298

Query  999   IGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGG  1178
             +GWPLD KTYGGSFLYHMK+RQVA+GLVVAL+Y NPFLNPYEE+Q+FK HPAIRPLLEGG
Sbjct  299   LGWPLDQKTYGGSFLYHMKDRQVAVGLVVALDYQNPFLNPYEEYQRFKRHPAIRPLLEGG  358

Query  1179  TVLQYGARTLNEGGYQ  1226
             TVLQYGAR+LNEGG+Q
Sbjct  359   TVLQYGARSLNEGGFQ  374


 Score =   405 bits (1042),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 186/229 (81%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAESAF MLQ G  ME +WDNLRSSWIW
Sbjct  380   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFSMLQEGLKMENYWDNLRSSWIW  439

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE GL+PGLALSA+E YILKGRSP+T  HGKPDHEA  EA+   PIEY
Sbjct  440   EELYTARNYRPAFEYGLYPGLALSAVEHYILKGRSPVTLNHGKPDHEATREAQLFSPIEY  499

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HL LKDP  PE VNLPKYAGPE+RYCPARVYE
Sbjct  500   PKPDGVVSFDVPTSLYRSNTNHDHDQPSHLHLKDPTVPENVNLPKYAGPEARYCPARVYE  559

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+ G++KL INAQNCLHCKAC IKDP QNI+WTVPEGGGGPGYT+M
Sbjct  560   YIPDETGDLKLQINAQNCLHCKACSIKDPKQNIEWTVPEGGGGPGYTIM  608



>ref|XP_009604479.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Nicotiana tomentosiformis]
Length=609

 Score =   556 bits (1432),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 282/375 (75%), Positives = 311/375 (83%), Gaps = 17/375 (5%)
 Frame = +3

Query  153   MLKFILSSAKSKL----------STTPINRFSSFPNPCGKASRFGAESGY-SLN------  281
             M + I SS+K KL          +  P +  S  PN  GK S F  +S   S N      
Sbjct  1     MYRLINSSSKFKLLCRSKSLYRSAQPPYSPNSILPNLLGKDSSFIHKSKLESWNQRSVRS  60

Query  282   GARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHI  461
              +   S    REAI+YDVVIVG GPAGLSAAIRLKQLC++K+ADLSVCVVEKGAE+GAHI
Sbjct  61    YSSSSSESDSREAIKYDVVIVGGGPAGLSAAIRLKQLCQQKDADLSVCVVEKGAELGAHI  120

Query  462   LSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLS  641
             LSGNVFEPRALDEL P+W+QE+ PIDVPV+SD F LLSKNRAFSLPSPF NKGNYVISLS
Sbjct  121   LSGNVFEPRALDELFPRWKQEEAPIDVPVTSDDFWLLSKNRAFSLPSPFHNKGNYVISLS  180

Query  642   QLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVEL  821
             QLVRWLGQKAEELGVE+YPGFAASEIL+NE +EV GIATNDMGVAKDGSRKEN+Q GV L
Sbjct  181   QLVRWLGQKAEELGVEIYPGFAASEILFNEHNEVTGIATNDMGVAKDGSRKENYQRGVAL  240

Query  822   KGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTI  1001
             KGRVTLLAEGCRGSL+++VI KY LREKG GQHQTYALGIKEVWEID +KH+PG VLHT+
Sbjct  241   KGRVTLLAEGCRGSLSDKVIKKYNLREKGQGQHQTYALGIKEVWEIDVDKHQPGSVLHTL  300

Query  1002  GWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGT  1181
             GWPLD KTYGGSFLYHMK+RQVA+G VVALNYHNPFLNPYEE+Q+FK HPAIRPLLEGGT
Sbjct  301   GWPLDQKTYGGSFLYHMKDRQVAVGFVVALNYHNPFLNPYEEYQRFKCHPAIRPLLEGGT  360

Query  1182  VLQYGARTLNEGGYQ  1226
             VLQYGAR LNEGGYQ
Sbjct  361   VLQYGARCLNEGGYQ  375


 Score =   401 bits (1030),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAES F  LQ G  M+ FWDNLRSSWIW
Sbjct  381   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAESVFSTLQEGLKMDYFWDNLRSSWIW  440

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE GL+PGLA+SAIE YILKGRSP+T KHGKPD+EA +EA+   PIEY
Sbjct  441   EELYTARNYRPAFEYGLYPGLAISAIEHYILKGRSPVTLKHGKPDYEATSEAQLFSPIEY  500

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDGA+SFD+ TS+YRSNTNHDHDQP+HL LKDP  PE VNLPKYAGPE+RYCPARVYE
Sbjct  501   PKPDGAVSFDVPTSLYRSNTNHDHDQPSHLLLKDPTVPENVNLPKYAGPEARYCPARVYE  560

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+ G++KL INAQNCLHCKAC IKDP QNI+WTVPEGGGGPGYT+M
Sbjct  561   YIPDETGDLKLQINAQNCLHCKACSIKDPRQNIEWTVPEGGGGPGYTIM  609



>ref|XP_009775903.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Nicotiana sylvestris]
Length=607

 Score =   554 bits (1428),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 276/373 (74%), Positives = 303/373 (81%), Gaps = 15/373 (4%)
 Frame = +3

Query  153   MLKFILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGARGFS-----------  299
             M +FI SS K KL       + S  +P    S  G E    ++ ++  S           
Sbjct  1     MYRFIKSSTKFKLLCRSKTLYRSAQSPYSPNSILGKEDSSFIHKSKLESWNQSSVRSYSR  60

Query  300   ----SESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILS  467
                     REAI YDVVIVG GPAGLSAAI+LKQLC++K+ADLSVCVVEKGAE+GAHILS
Sbjct  61    SSSSESDSREAINYDVVIVGGGPAGLSAAIKLKQLCQQKDADLSVCVVEKGAELGAHILS  120

Query  468   GNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQL  647
             GNVFEPRALDEL P W+QE+ PIDVPV+SD F LLSKNRAFSLPSPF NKGNYVISLSQL
Sbjct  121   GNVFEPRALDELFPHWKQEEAPIDVPVTSDDFWLLSKNRAFSLPSPFHNKGNYVISLSQL  180

Query  648   VRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKG  827
             VRWLGQKAEELGVE+YPGFAASEIL+NE +EV GIATNDMGVAKDGSRKEN+Q GV LKG
Sbjct  181   VRWLGQKAEELGVEIYPGFAASEILFNEHNEVTGIATNDMGVAKDGSRKENYQRGVALKG  240

Query  828   RVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGW  1007
             RVTLLAEGCRGSL+E+VI KY LREKG GQHQTYALGIKEVWEID  KH+PG VLHT+GW
Sbjct  241   RVTLLAEGCRGSLSEKVIKKYNLREKGQGQHQTYALGIKEVWEIDVEKHQPGSVLHTLGW  300

Query  1008  PLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVL  1187
             PLD KTYGGSFLYHMK+RQVA+G VVALNYHNPFLNPYEE+Q+FK HPAIRPLLEGG VL
Sbjct  301   PLDQKTYGGSFLYHMKDRQVAVGFVVALNYHNPFLNPYEEYQRFKRHPAIRPLLEGGIVL  360

Query  1188  QYGARTLNEGGYQ  1226
             QYGAR LNEGGYQ
Sbjct  361   QYGARCLNEGGYQ  373


 Score =   402 bits (1032),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGML AES F  LQ G  +E FWDNLRSSWIW
Sbjct  379   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLVAESVFSTLQEGLKIEKFWDNLRSSWIW  438

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE GL+PGLA+SA+E YILKGRSP+T KHGKPDHEA +EA+   PIEY
Sbjct  439   EELYTARNYRPAFEYGLYPGLAISAVEHYILKGRSPVTLKHGKPDHEATSEAQVFSPIEY  498

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDGA++FD+ TS+YRSNTNHDHDQP+HL LKDP  PE VNLPKYAGPE+RYCPARVYE
Sbjct  499   PKPDGAVTFDVPTSLYRSNTNHDHDQPSHLLLKDPTVPENVNLPKYAGPEARYCPARVYE  558

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+ G++KL INAQNCLHCKAC IKDP QNI+WTVPEGGGGPGYT+M
Sbjct  559   YIPDETGDLKLQINAQNCLHCKACSIKDPRQNIEWTVPEGGGGPGYTIM  607



>ref|XP_007226965.1| hypothetical protein PRUPE_ppa002564mg [Prunus persica]
 gb|EMJ28164.1| hypothetical protein PRUPE_ppa002564mg [Prunus persica]
Length=658

 Score =   559 bits (1440),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/314 (83%), Positives = 290/314 (92%), Gaps = 0/314 (0%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
              R F SE  RE+I+YDVVIVGAGPAGLSAAIRLKQLCREK+ DLSVCVVEKGAEVGAHI+
Sbjct  111   TRSFCSEPDRESIQYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEVGAHII  170

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRAL+ELLPQW++E++PI VPV+SDKF  L+K+RAFSLPSPF NKGNYVISLSQ
Sbjct  171   SGNVFEPRALNELLPQWKEEESPITVPVTSDKFWFLTKDRAFSLPSPFSNKGNYVISLSQ  230

Query  645   LVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK  824
             LVRW+G KAEELGVE+YPGFAASEILY+ +D V+GI TNDMGVAKDGS+KENFQ G+ELK
Sbjct  231   LVRWMGVKAEELGVEIYPGFAASEILYDANDTVVGIGTNDMGVAKDGSKKENFQRGIELK  290

Query  825   GRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIG  1004
             GRVTLLAEGCRGSL+EQ++ KY LREKG+ QHQTYALGIKEVWEID  KH PG VLHT+G
Sbjct  291   GRVTLLAEGCRGSLSEQIMKKYNLREKGDAQHQTYALGIKEVWEIDEGKHDPGAVLHTLG  350

Query  1005  WPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTV  1184
             WPLD KTYGGSFLYHMK+RQ++IG VVALNYHNPFLNPYEEFQKFKHHPAI+PLLEGGTV
Sbjct  351   WPLDQKTYGGSFLYHMKDRQISIGFVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTV  410

Query  1185  LQYGARTLNEGGYQ  1226
             LQYGARTLNEGG+Q
Sbjct  411   LQYGARTLNEGGFQ  424


 Score =   396 bits (1018),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAE+   +L  GSN+E +WD LRSSWIW
Sbjct  430   VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAEATLSVLHEGSNLEKYWDALRSSWIW  489

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RN+RPAFE GL PGLA+SA+E YI+KGR+PLT KHGKPDHEA N A+   PI+Y
Sbjct  490   EELYKSRNFRPAFEYGLIPGLAISALEHYIMKGRAPLTLKHGKPDHEATNAAQFHSPIQY  549

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFDI TS++RSNTNH+HDQPAHLRL+DPK PELVNLP+Y+GPESRYCPARVYE
Sbjct  550   PKPDGVLSFDIPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYSGPESRYCPARVYE  609

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+ G++KL INAQNCLHCKACDIKDP QNI+WT PEGGGGPGY++M
Sbjct  610   YIPDEKGQLKLQINAQNCLHCKACDIKDPRQNIQWTAPEGGGGPGYSIM  658



>ref|XP_011091641.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Sesamum indicum]
Length=645

 Score =   549 bits (1415),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 275/365 (75%), Positives = 307/365 (84%), Gaps = 13/365 (4%)
 Frame = +3

Query  171   SSAKSKLSTTPINR-----FSS--FPNPCGKASRFGAESGYS-----LNGARGFSSESC-  311
             S  ++  ST P++R     FSS    NP   A   G   G+      + GAR FS E   
Sbjct  47    SCFRNSTSTEPLSRNRNGFFSSGYSRNPAKIADFGGNGCGFWRAQGLVAGARSFSGEPVS  106

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++ YDVVIVGAGPAGLSAAIRLKQLCREK+ DLSVCVVEKGAEVGAHILSGNVFEPRA
Sbjct  107   RESLNYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEVGAHILSGNVFEPRA  166

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKA  671
             L+ELLP W+QE+ PI VPVSSDKF LLSK RAF  PSPF N+GNYVISLSQLVRWLG KA
Sbjct  167   LNELLPNWKQEEAPIHVPVSSDKFWLLSKTRAFPCPSPFNNRGNYVISLSQLVRWLGLKA  226

Query  672   EELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEG  851
             EELGVE+YPGFAASEILY+ +D+VIGIATNDMGVAKDGS+K+NFQ GVELKGRVTL AEG
Sbjct  227   EELGVEIYPGFAASEILYDTTDKVIGIATNDMGVAKDGSKKDNFQPGVELKGRVTLFAEG  286

Query  852   CRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYG  1031
             CRGSL+E+VI K+ LRE+G GQHQTYALGIKEVWE+ A+KH+ G VLHT+GWPLD +TYG
Sbjct  287   CRGSLSEEVIRKFNLREQGQGQHQTYALGIKEVWEVSADKHQAGSVLHTLGWPLDSRTYG  346

Query  1032  GSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLN  1211
             GSFLYHMK+RQVA+G VVALNYHNPFLNPYEEFQ+FKHHPAI PLLEGGTVL+YGARTLN
Sbjct  347   GSFLYHMKDRQVAVGFVVALNYHNPFLNPYEEFQRFKHHPAISPLLEGGTVLEYGARTLN  406

Query  1212  EGGYQ  1226
             EGGYQ
Sbjct  407   EGGYQ  411


 Score =   400 bits (1027),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKG+HTAMKSGMLAAES F  L  GS +E FWD+L+SSWIW
Sbjct  417   VFPGGAIIGCSAGFLNVPKIKGSHTAMKSGMLAAESVFRTLHEGSPLEAFWDSLKSSWIW  476

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KEL+ ARNYRPAFE G FPGLALSA+E YILKGRSP T KHG+PDHEA  EA+   PI+Y
Sbjct  477   KELHSARNYRPAFEYGFFPGLALSALEHYILKGRSPWTLKHGRPDHEATAEAQLFRPIDY  536

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG ISFD+ TS+YRSNTNHDHDQPAHLRL+DPK PELVN+P YAGPESRYCPARVYE
Sbjct  537   PKPDGVISFDVPTSLYRSNTNHDHDQPAHLRLRDPKIPELVNVPVYAGPESRYCPARVYE  596

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D++G +KL INAQNCLHCKACDIKDP QNIKWTVPEGGGGP YT+M
Sbjct  597   YVADESGHLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPAYTIM  645



>ref|XP_002270682.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Vitis vinifera]
Length=676

 Score =   549 bits (1415),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/363 (74%), Positives = 304/363 (84%), Gaps = 23/363 (6%)
 Frame = +3

Query  204   INRFSSFPNPCGKASRFGAESGYSLNG----------------------ARGFSSESCRE  317
             ++R SSF  P    +RF + SGY LN                       +R FSSE  RE
Sbjct  81    LDRNSSFSGPQMAGNRFFS-SGYLLNCKNLKNGKGNRRGFLRVGSFVGESRAFSSEPDRE  139

Query  318   AIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALD  497
             ++EYDVVIVGAGP+GLSAAIRLKQ+CR K+ D SVCVVEKGAEVGAHILSGNVFEPRALD
Sbjct  140   SMEYDVVIVGAGPSGLSAAIRLKQMCRAKDVDFSVCVVEKGAEVGAHILSGNVFEPRALD  199

Query  498   ELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEE  677
             ELLP+W+QE+ PI+VPVSSDKF LL+K+RAFSLPSPF+NKGNY+ISLSQLVRWLG KAEE
Sbjct  200   ELLPEWKQEEAPINVPVSSDKFWLLTKDRAFSLPSPFDNKGNYIISLSQLVRWLGGKAEE  259

Query  678   LGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCR  857
             LGVE+YPGFAASEILY+ +  VIGI TNDMG+AKDGS+K+NFQ GVEL+GRVTLLAEGCR
Sbjct  260   LGVEIYPGFAASEILYDANHNVIGIGTNDMGIAKDGSKKDNFQRGVELRGRVTLLAEGCR  319

Query  858   GSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGS  1037
             GSL+E+V+  Y LREK   QHQTYALGIKE+WEID  KH+ G VLHT+GWPLDH+TYGGS
Sbjct  320   GSLSEKVLRDYNLREKAQAQHQTYALGIKEIWEIDEAKHKTGTVLHTLGWPLDHRTYGGS  379

Query  1038  FLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEG  1217
             FLYHM +RQV+IGLVVALNYHNPFLNPYEEFQK KHHPAI+PLL+GGTVLQYGARTLNEG
Sbjct  380   FLYHMNDRQVSIGLVVALNYHNPFLNPYEEFQKLKHHPAIKPLLKGGTVLQYGARTLNEG  439

Query  1218  GYQ  1226
             G+Q
Sbjct  440   GFQ  442


 Score =   396 bits (1017),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AFD+L  GS+ME +WD LR+SWIW
Sbjct  448   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFDVLHEGSSMEKYWDGLRNSWIW  507

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE GL PGLALSA+E Y+LKGRSPLT KHGKPDHEA + A+   PI+Y
Sbjct  508   EELHKARNYRPAFEYGLIPGLALSALEHYVLKGRSPLTLKHGKPDHEATDVAQLHSPIQY  567

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HL L+DP+ P+ VNLP +AGPESRYCPARVYE
Sbjct  568   PKPDGIVSFDVPTSLYRSNTNHDHDQPSHLHLRDPQIPDRVNLPDFAGPESRYCPARVYE  627

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ GE++L INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  628   YVPDEKGELRLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  676



>ref|XP_011037121.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Populus euphratica]
Length=620

 Score =   549 bits (1415),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/330 (79%), Positives = 291/330 (88%), Gaps = 4/330 (1%)
 Frame = +3

Query  237   GKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADL  416
              K   F    G+     R FSSE+ RE+IEYDVVIVGAGPAGLSAAIRLKQLC EK  DL
Sbjct  61    AKMRNFDKNQGF----VRRFSSEAQRESIEYDVVIVGAGPAGLSAAIRLKQLCSEKGVDL  116

Query  417   SVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSL  596
             SVCVVEKG EVGAHILSGNVFEPRALDELLP W++E+ PI+VPVSSDKF  L+K+RAFSL
Sbjct  117   SVCVVEKGPEVGAHILSGNVFEPRALDELLPHWKEEEAPINVPVSSDKFWFLTKDRAFSL  176

Query  597   PSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVA  776
             P PF+NKGNYVISLSQLVRW+G KAEE GVE+YPGFAASEI+Y+ +D V+GI TNDMG+A
Sbjct  177   PCPFDNKGNYVISLSQLVRWMGIKAEEFGVEIYPGFAASEIVYDANDSVVGIGTNDMGIA  236

Query  777   KDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWE  956
             KDGS+K+ FQ GVELKGRVTLLAEGCRGSL+E++I KYKLREKG+ QHQTYALGIKEVWE
Sbjct  237   KDGSKKDTFQRGVELKGRVTLLAEGCRGSLSEKLIKKYKLREKGHAQHQTYALGIKEVWE  296

Query  957   IDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQK  1136
             ID +KH+PG VLHTIGWPLD KTYGGSFLYHMK+RQV+IGLVV LNY NP+LNPYEEFQK
Sbjct  297   IDESKHKPGAVLHTIGWPLDQKTYGGSFLYHMKDRQVSIGLVVTLNYRNPYLNPYEEFQK  356

Query  1137  FKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             FKHHPAIRPLLEGGTV+QYGARTLNEGG Q
Sbjct  357   FKHHPAIRPLLEGGTVIQYGARTLNEGGIQ  386


 Score =   394 bits (1013),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L+ G++++++W+ L SSWIW
Sbjct  392   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGSLREGTSLKSYWETLGSSWIW  451

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
              ELY ARNYRPAFE G+ PG+A+SA+E YILKGRSP T KHGKPDHEA N A+   PIEY
Sbjct  452   DELYRARNYRPAFEYGVIPGMAISALEHYILKGRSPFTLKHGKPDHEATNAARLHSPIEY  511

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG  SFD+ TS++RSNTNHDHDQPAHLRLKDPK PE +NLP+YAGPESRYCPARVYE
Sbjct  512   PKPDGVFSFDVPTSLHRSNTNHDHDQPAHLRLKDPKIPETLNLPEYAGPESRYCPARVYE  571

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+SD+N ++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  572   YVSDENSQLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  620



>ref|XP_010672246.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris]
Length=639

 Score =   543 bits (1400),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/342 (77%), Positives = 301/342 (88%), Gaps = 5/342 (1%)
 Frame = +3

Query  213   FSSFP----NPCGKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIR  380
             +SS P    N CG  S F   +   +   RGF S+S RE++EYDVVIVGAGPAGLSAAIR
Sbjct  65    YSSNPRNLENLCGIGSGF-LRNHSLVQSKRGFCSDSGRESMEYDVVIVGAGPAGLSAAIR  123

Query  381   LKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDK  560
             LKQLC EK+ DLSVCVVEKGAEVGAHILSGNVFEPRALDEL+P+W+ E+ PID PVSSDK
Sbjct  124   LKQLCLEKDVDLSVCVVEKGAEVGAHILSGNVFEPRALDELIPEWKHEQAPIDTPVSSDK  183

Query  561   FLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDE  740
             F  LS++ A SLPSPF+NKGNYVISLSQLVRW+  KAEELGVE+YPGFAASEILYN++ E
Sbjct  184   FWFLSRDHALSLPSPFDNKGNYVISLSQLVRWMAMKAEELGVEIYPGFAASEILYNKNHE  243

Query  741   VIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQH  920
             VIGIAT+DMG++KDGSRK+NFQ GVELKG+VTLL+EGCRGSL+E++I +YKLR+KG  QH
Sbjct  244   VIGIATSDMGISKDGSRKDNFQRGVELKGQVTLLSEGCRGSLSEKIIREYKLRDKGKSQH  303

Query  921   QTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYH  1100
             QTYALGIKEVWEIDA+KH+PG VLHT+GWPLD+KTYGGSFLYHMK+  V+IGLVVALNY 
Sbjct  304   QTYALGIKEVWEIDASKHQPGFVLHTLGWPLDNKTYGGSFLYHMKDNLVSIGLVVALNYQ  363

Query  1101  NPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             NPFLNPYEEFQK KHHPAI+P+LEGGTV+QYGARTLNEGG+Q
Sbjct  364   NPFLNPYEEFQKLKHHPAIKPMLEGGTVIQYGARTLNEGGFQ  405


 Score =   398 bits (1022),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAESAFD+L  G  ME +WD L++SWIW
Sbjct  411   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDLLHEGLKMERYWDMLQTSWIW  470

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE GL PGLALSA+E YILKGRSP T KHGKPDHEA + A    PI Y
Sbjct  471   EELYEARNYRPAFEYGLVPGLALSALEHYILKGRSPWTLKHGKPDHEATDVANLHSPIHY  530

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQPAHLRLKDP  PE VNLP+YAGPESRYCPARVYE
Sbjct  531   PKPDGVVSFDVPTSLYRSNTNHDHDQPAHLRLKDPLVPEQVNLPEYAGPESRYCPARVYE  590

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ DD G++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  591   YLPDDVGDMKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  639



>ref|XP_010258523.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Nelumbo nucifera]
Length=661

 Score =   551 bits (1420),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 257/318 (81%), Positives = 291/318 (92%), Gaps = 0/318 (0%)
 Frame = +3

Query  273   SLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVG  452
             S  G+R FSSES RE+I YDVVIVGAGPAGLSAAIRLKQLCREK+ DLS+CVVEKGAEVG
Sbjct  110   SAGGSRTFSSESERESINYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSICVVEKGAEVG  169

Query  453   AHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVI  632
             AHI+SGNVFEPRALDEL P WRQE++P+ VPVSSDKF LL+K  AFSLPSPF+NKGNYVI
Sbjct  170   AHIISGNVFEPRALDELFPLWRQEESPVCVPVSSDKFWLLTKEHAFSLPSPFDNKGNYVI  229

Query  633   SLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHG  812
             SLSQLVRW+G KAEELGVE+YPGFAASEILY+ + +V+GI TNDMG++KDGS++ENFQ G
Sbjct  230   SLSQLVRWMGTKAEELGVEIYPGFAASEILYDANHKVVGIGTNDMGISKDGSKRENFQRG  289

Query  813   VELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVL  992
             VELKGR+TLLAEGCRGSL+E++I  Y LREKGN QHQTYALGIKEVWEID  KH+PG VL
Sbjct  290   VELKGRITLLAEGCRGSLSEKIIRDYNLREKGNAQHQTYALGIKEVWEIDEGKHKPGFVL  349

Query  993   HTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLE  1172
             HT+GWP+D KTYGGSFLYHMK+RQ++IGLV+ALNY NPFLNPYEEFQK KHHPAI+P+LE
Sbjct  350   HTVGWPIDSKTYGGSFLYHMKDRQISIGLVLALNYRNPFLNPYEEFQKLKHHPAIKPILE  409

Query  1173  GGTVLQYGARTLNEGGYQ  1226
             GGTVLQYGARTLNEGG+Q
Sbjct  410   GGTVLQYGARTLNEGGFQ  427


 Score =   390 bits (1001),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCS GFLNVPKIKGTHTAMKSGMLAAE+ F  LQ GS+ME +WDNL+ SW+W
Sbjct  433   VFPGGAIVGCSVGFLNVPKIKGTHTAMKSGMLAAEAVFHTLQEGSSMEAYWDNLKKSWVW  492

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE G+ PGLALSA+E YILKGRSPLT KHGKPDHEA + A    PI Y
Sbjct  493   EELYRARNYRPAFEYGMIPGLALSALEHYILKGRSPLTLKHGKPDHEATDVASVHSPIHY  552

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
              KPDG +SFD+ TS+YRSNTNH+HDQPAHL L+DP  PE VNLPKYAGPESRYCPARVYE
Sbjct  553   SKPDGLVSFDVPTSLYRSNTNHEHDQPAHLHLRDPTIPERVNLPKYAGPESRYCPARVYE  612

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ ++ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY++M
Sbjct  613   YVINEQGQQKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSIM  661



>ref|XP_007033905.1| Electron-transfer flavoprotein:ubiquinone oxidoreductase [Theobroma 
cacao]
 gb|EOY04831.1| Electron-transfer flavoprotein:ubiquinone oxidoreductase [Theobroma 
cacao]
Length=637

 Score =   546 bits (1408),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/314 (82%), Positives = 288/314 (92%), Gaps = 0/314 (0%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
              R FSSE+ RE+IEYDVVIVGAGPAGLSAAIR KQLC+EKNAD SVCVVEKGAEVGAHI+
Sbjct  90    VRSFSSEADRESIEYDVVIVGAGPAGLSAAIRFKQLCQEKNADFSVCVVEKGAEVGAHII  149

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRAL+ELLPQW+QE+ PI+VPVSSDKF  L+K+RA SLP PF NKGNYVISLSQ
Sbjct  150   SGNVFEPRALNELLPQWKQEEAPINVPVSSDKFWFLTKDRAISLPCPFNNKGNYVISLSQ  209

Query  645   LVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK  824
             LVRW+G KAEELGVE+YPGFAASEILY+  ++VIGI TNDMG+AKDGS+KENFQ GV LK
Sbjct  210   LVRWMGVKAEELGVEIYPGFAASEILYDAENKVIGIGTNDMGIAKDGSKKENFQRGVALK  269

Query  825   GRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIG  1004
             GR+TLLAEGCRGSL+++++ KYKLRE    QHQTYALGIKEVWEID NKH+PG VLHT+G
Sbjct  270   GRITLLAEGCRGSLSQKMMKKYKLRENVQAQHQTYALGIKEVWEIDENKHKPGAVLHTLG  329

Query  1005  WPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTV  1184
             WPLD KTYGGSF+YHM++RQ++IGLVVALNYHNPFLNPYEEFQK KHHP+IRPLLEGGTV
Sbjct  330   WPLDSKTYGGSFVYHMQDRQISIGLVVALNYHNPFLNPYEEFQKLKHHPSIRPLLEGGTV  389

Query  1185  LQYGARTLNEGGYQ  1226
             LQYGARTLNEGG+Q
Sbjct  390   LQYGARTLNEGGFQ  403


 Score =   391 bits (1004),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 200/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F +L  GSNME +WD LR SW+W
Sbjct  409   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAETTFGVLHEGSNMEAYWDALRDSWVW  468

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE GLFPGLA+SA+E Y+LKG+SP T KHGKPDHEA N A+   PI+Y
Sbjct  469   EELHKARNYRPAFEYGLFPGLAISALEHYVLKGKSPFTLKHGKPDHEATNVARLHSPIQY  528

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+LTS++RSNTNHDHDQPAHLRL+DP  P  VNLP+YAGPES YCPARVYE
Sbjct  529   PKPDGILSFDVLTSLHRSNTNHDHDQPAHLRLRDPNIPANVNLPEYAGPESHYCPARVYE  588

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+   +KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  589   YVPDEKNHLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  637



>ref|XP_009142929.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Brassica rapa]
Length=646

 Score =   543 bits (1400),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 271/394 (69%), Positives = 312/394 (79%), Gaps = 16/394 (4%)
 Frame = +3

Query  93    TIQHRFY------THATIVHLSQLKTMLKFILSSAKSKLS------TTPINRFSSFPNPC  236
             TI HRF       T+      +QL  +L   LSS  +  S      + P NRF S     
Sbjct  19    TIMHRFLLKLSSSTNPLRNSKNQLPLILPRFLSSTTASESPPPPRTSHPSNRFISRSGHP  78

Query  237   GKASRFGAESGYSLN----GARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREK  404
               A  F     +S      G R  SSE+ RE+IEYDV+I+GAGPAGLSAAIRLKQLC+EK
Sbjct  79    YSADSFRKSRAFSSKSRALGVRCISSEAGRESIEYDVLIIGAGPAGLSAAIRLKQLCQEK  138

Query  405   NADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNR  584
             NADLSVCVVEKGAEVG H++SGNVFEP ALDELLP WRQE+ PI+V  SSDKF  L+KNR
Sbjct  139   NADLSVCVVEKGAEVGGHVISGNVFEPLALDELLPHWRQEQAPIEVAASSDKFWFLTKNR  198

Query  585   AFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATND  764
             A SLPSPF+NKGNYVISLSQLVRWLG KAEELG+E+YPGF+ASE+LY+ SD+V+GIAT D
Sbjct  199   AISLPSPFDNKGNYVISLSQLVRWLGGKAEELGIEIYPGFSASEVLYDASDKVVGIATKD  258

Query  765   MGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIK  944
             MG++KDGS+KE FQ GV++KGRVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIK
Sbjct  259   MGISKDGSKKETFQPGVDIKGRVTLFAEGCRGSLSEKIIKKYKLREEVNAQHQTYALGIK  318

Query  945   EVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYE  1124
             EVWEID +KH PG+V+HT+GWPLD KTYGGSFLYHM  RQVA+GLVVALNY NPFLNPYE
Sbjct  319   EVWEIDESKHNPGEVVHTLGWPLDPKTYGGSFLYHMNNRQVALGLVVALNYKNPFLNPYE  378

Query  1125  EFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             EFQK KHHPAI+ +LEGGTVLQYGARTLNEGG+Q
Sbjct  379   EFQKLKHHPAIKRILEGGTVLQYGARTLNEGGFQ  412


 Score =   394 bits (1011),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 200/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L  GSNM T+WDNLRSSW+W
Sbjct  418   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGALHEGSNMSTYWDNLRSSWVW  477

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA+E Y+L+G+ P T KHGK DHEA + A+   PIEY
Sbjct  478   KELYSARNYRPAFEYGLIPGLAVSAMEHYVLRGKVPFTLKHGKADHEATDLARKWKPIEY  537

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HLRL+DPK PE VNLP+YA PESRYCPARVYE
Sbjct  538   PKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLRDPKIPEKVNLPEYAAPESRYCPARVYE  597

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y++M
Sbjct  598   YVEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSIM  646



>ref|XP_006478732.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform X2 [Citrus sinensis]
Length=641

 Score =   554 bits (1427),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/368 (73%), Positives = 308/368 (84%), Gaps = 17/368 (5%)
 Frame = +3

Query  165   ILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGA--------------RGFSS  302
             + +S K+    +P   F+   NPC  +S +   +G +L G               R F S
Sbjct  43    LANSIKTPSGYSPFRHFNQ--NPCFFSSGY-FPNGVNLKGFGRNESGESCAKLFFRSFCS  99

Query  303   ESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFE  482
             E CRE++ YDVVIVGAGPAGLSAAIRLKQLCREKN DLSVCVVEKGAEVGAHI+SGNVFE
Sbjct  100   EMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFE  159

Query  483   PRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLG  662
             PRAL+ELLPQW+QE+ PI VPVSSDKF  L+K+RAFSLPSPF N+GNYVISLSQLVRWLG
Sbjct  160   PRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLG  219

Query  663   QKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLL  842
              KAEELGVE+YPGFAASEILY+  ++VIGI TNDMG+AKDGS+KENFQ GVEL+GR+TLL
Sbjct  220   GKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLL  279

Query  843   AEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHK  1022
             AEGCRGSL+E++I  +KLREK + QHQTYALGIKEVWEID  KH PG++LHT+GWPLD K
Sbjct  280   AEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQK  339

Query  1023  TYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGAR  1202
             TYGGSFLYHM +RQ+A+GLVVALNYHNPFLNPYEEFQKFKHHPAI+PLLEGGTV+QYGAR
Sbjct  340   TYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGAR  399

Query  1203  TLNEGGYQ  1226
             TLNEGG Q
Sbjct  400   TLNEGGLQ  407


 Score =   382 bits (981),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGC+AGFLNVPKIKGTHTAMKSGMLAAE+ F +L    NME +WD LR+SW+W
Sbjct  413   VFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDLNMEIYWDTLRNSWVW  472

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL  ARNYRPAFE GL PGLA+  +E YIL+G+SP T KHGKPD+EA + A+   PIEY
Sbjct  473   QELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDYEATDAARLHSPIEY  532

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS++RSNTNH+HDQPAHLRL+DPK PELVNLP+YAGPESRYCPARVYE
Sbjct  533   PKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYE  592

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+  ++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  593   YVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  641



>ref|XP_004309803.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform 1 [Fragaria vesca subsp. 
vesca]
Length=575

 Score =   540 bits (1392),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +3

Query  288   RGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILS  467
             R F SE  R++I+YDVVIVGAGPAGLSAAIRLKQLCRE + DLSVCVVEKGAE+GAHILS
Sbjct  29    RTFCSEPQRDSIQYDVVIVGAGPAGLSAAIRLKQLCRENDTDLSVCVVEKGAELGAHILS  88

Query  468   GNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQL  647
             GNVFEPRALDELLP W+QE++PI VPVSSDKF  L+KN AF LP PF N+GNYVISLSQL
Sbjct  89    GNVFEPRALDELLPNWKQEESPITVPVSSDKFWFLTKNHAFPLPCPFNNRGNYVISLSQL  148

Query  648   VRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKG  827
             VRW+G KAEELGVE+YPGFAASEILY+ +D V+GI TNDMG++KDGS+KENFQ G+ELKG
Sbjct  149   VRWMGVKAEELGVEIYPGFAASEILYDSNDTVVGIRTNDMGISKDGSKKENFQPGIELKG  208

Query  828   RVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGW  1007
             RVTLLAEGCRGSL+E ++ KY LR KG+ QHQTYALGIKEVWEID  KH+PG V+HT+GW
Sbjct  209   RVTLLAEGCRGSLSENIMDKYNLRAKGHAQHQTYALGIKEVWEIDKEKHKPGAVIHTLGW  268

Query  1008  PLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVL  1187
             PLD KTYGGSFLYHMK+RQ+ IGLVVALNY NPFL+PYEEFQKFKHHPA++PLLEGGTVL
Sbjct  269   PLDQKTYGGSFLYHMKDRQICIGLVVALNYQNPFLSPYEEFQKFKHHPAVKPLLEGGTVL  328

Query  1188  QYGARTLNEGGYQ  1226
             QYGARTLNEGG+Q
Sbjct  329   QYGARTLNEGGFQ  341


 Score =   393 bits (1009),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIWK  1408
             FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L+ GSNM+ +WD+LR+SWIW+
Sbjct  348   FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFSALREGSNMDKYWDDLRNSWIWE  407

Query  1409  ELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEYP  1588
             ELY ARNYRPAFE G+ PGLA+SA+ERYI+KGR+ LT KHGKPD+EA N A+   PI+YP
Sbjct  408   ELYRARNYRPAFEYGVIPGLAISALERYIIKGRAALTLKHGKPDNEATNVAEFHSPIKYP  467

Query  1589  KPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYEY  1768
             KPDG +SFDILTS++RSNTNH+HDQPAHLRLKDPK PE+VNLP+YAGPESRYCPARVYEY
Sbjct  468   KPDGVLSFDILTSLHRSNTNHEHDQPAHLRLKDPKKPEVVNLPEYAGPESRYCPARVYEY  527

Query  1769  ISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             +  + G++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY++M
Sbjct  528   VPGETGQLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSIM  575



>ref|XP_006478731.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform X1 [Citrus sinensis]
Length=644

 Score =   553 bits (1426),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/368 (73%), Positives = 308/368 (84%), Gaps = 17/368 (5%)
 Frame = +3

Query  165   ILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGA--------------RGFSS  302
             + +S K+    +P   F+   NPC  +S +   +G +L G               R F S
Sbjct  43    LANSIKTPSGYSPFRHFNQ--NPCFFSSGY-FPNGVNLKGFGRNESGESCAKLFFRSFCS  99

Query  303   ESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFE  482
             E CRE++ YDVVIVGAGPAGLSAAIRLKQLCREKN DLSVCVVEKGAEVGAHI+SGNVFE
Sbjct  100   EMCRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFE  159

Query  483   PRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLG  662
             PRAL+ELLPQW+QE+ PI VPVSSDKF  L+K+RAFSLPSPF N+GNYVISLSQLVRWLG
Sbjct  160   PRALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLG  219

Query  663   QKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLL  842
              KAEELGVE+YPGFAASEILY+  ++VIGI TNDMG+AKDGS+KENFQ GVEL+GR+TLL
Sbjct  220   GKAEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLL  279

Query  843   AEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHK  1022
             AEGCRGSL+E++I  +KLREK + QHQTYALGIKEVWEID  KH PG++LHT+GWPLD K
Sbjct  280   AEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQK  339

Query  1023  TYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGAR  1202
             TYGGSFLYHM +RQ+A+GLVVALNYHNPFLNPYEEFQKFKHHPAI+PLLEGGTV+QYGAR
Sbjct  340   TYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGAR  399

Query  1203  TLNEGGYQ  1226
             TLNEGG Q
Sbjct  400   TLNEGGLQ  407


 Score =   377 bits (967),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 199/232 (86%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGC+AGFLNVPKIKGTHTAMKSGMLAAE+ F +L    NME +WD LR+SW+W
Sbjct  413   VFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDLNMEIYWDTLRNSWVW  472

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL  ARNYRPAFE GL PGLA+  +E YIL+G+SP T KHGKPD+EA + A+   PIEY
Sbjct  473   QELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDYEATDAARLHSPIEY  532

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS++RSNTNH+HDQPAHLRL+DPK PELVNLP+YAGPESRYCPARVYE
Sbjct  533   PKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYE  592

Query  1766  YISDDNGEVKLNINAQNCLHCK---ACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+  ++KL INAQNCLHCK   ACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  593   YVPDEKNQLKLQINAQNCLHCKDFQACDIKDPKQNIEWTVPEGGGGPGYSVM  644



>gb|EYU41104.1| hypothetical protein MIMGU_mgv1a004148mg [Erythranthe guttata]
Length=542

 Score =   536 bits (1380),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/305 (84%), Positives = 275/305 (90%), Gaps = 0/305 (0%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE + YDVVIVGAGPAGLSAAIRLKQLCRE + D SVCVVEKGAEVGAHILSGNVFEPRA
Sbjct  4     RETLNYDVVIVGAGPAGLSAAIRLKQLCRENDVDFSVCVVEKGAEVGAHILSGNVFEPRA  63

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKA  671
             L+ELLP W+QE+ PI VPVSSDKF LLS+ RAF  PSPF N GNYVISLSQLVRWLG KA
Sbjct  64    LNELLPNWKQEEAPIHVPVSSDKFWLLSETRAFPFPSPFNNHGNYVISLSQLVRWLGAKA  123

Query  672   EELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEG  851
             EELGVE+YPGFAASEILY+ SD+VIGIATNDMGVAKDGS+KE FQ GVELKGRVTL AEG
Sbjct  124   EELGVEIYPGFAASEILYDTSDKVIGIATNDMGVAKDGSKKETFQPGVELKGRVTLFAEG  183

Query  852   CRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYG  1031
             CRGSL+E++I K+ LREKG GQHQTYALGIKEVWEI   KH  G VLHT+GWPLD KTYG
Sbjct  184   CRGSLSEKIISKFNLREKGQGQHQTYALGIKEVWEISEEKHDAGSVLHTLGWPLDPKTYG  243

Query  1032  GSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLN  1211
             GSF+YHMK+RQVAIGLVVALNY NPFLNPYEEFQKFKHHPA+RPLLEGGTVL+YGARTLN
Sbjct  244   GSFIYHMKDRQVAIGLVVALNYRNPFLNPYEEFQKFKHHPAVRPLLEGGTVLEYGARTLN  303

Query  1212  EGGYQ  1226
             EGGYQ
Sbjct  304   EGGYQ  308


 Score =   394 bits (1013),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKG+HTA+KSGMLAAESAF  L   S +E FWD+L+SSWIW
Sbjct  314   VFPGGAIIGCSAGFLNVPKIKGSHTAIKSGMLAAESAFGTLHKESPLENFWDSLKSSWIW  373

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KEL+ ARNYRPAFE GLFPGLALSA+E Y++KGRSP T KHGKPDHEA +EAK    I+Y
Sbjct  374   KELHSARNYRPAFEYGLFPGLALSALEHYVMKGRSPWTLKHGKPDHEATDEAKMWRTIDY  433

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG ISFD+ TS+YRSNTNHDHDQPAHLRLKDPK PE VNLP Y GPE+RYCPARVYE
Sbjct  434   PKPDGVISFDMPTSLYRSNTNHDHDQPAHLRLKDPKNPENVNLPIYGGPETRYCPARVYE  493

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI+D+NG  KL INAQNCLHCKACDIKDP QNIKWTVPEGGGGPGYTVM
Sbjct  494   YIADENGCQKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYTVM  542



>ref|XP_006397507.1| hypothetical protein EUTSA_v10001353mg [Eutrema salsugineum]
 gb|ESQ38960.1| hypothetical protein EUTSA_v10001353mg [Eutrema salsugineum]
Length=637

 Score =   541 bits (1393),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/377 (69%), Positives = 306/377 (81%), Gaps = 21/377 (6%)
 Frame = +3

Query  159   KFILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNG------------------  284
             +FIL    S +++ P     S P P   A+RF +  GY  +                   
Sbjct  27    RFILPLLPSSITSNPFTASGSPPRPSIPANRFISRFGYPCSADLFRKSPTLCSNSTTFGV  86

Query  285   ---ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGA  455
                +R  SSE+ RE+IEYDV+IVGAGPAGLSAAIRLKQLC++ N DLSVCVVEKGAEVGA
Sbjct  87    IWSSRCISSEAGRESIEYDVLIVGAGPAGLSAAIRLKQLCQQNNIDLSVCVVEKGAEVGA  146

Query  456   HILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVIS  635
             HI+SGNVFEP ALDELLP WRQ++ PI++P SSDKF  L+K+RA SLPSPF+NKGNYVIS
Sbjct  147   HIISGNVFEPLALDELLPHWRQQQAPIEIPASSDKFWFLTKDRAISLPSPFDNKGNYVIS  206

Query  636   LSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGV  815
             LSQLVRWLG KAEELG E+YPGF+ASE+LY+ SD+V+GIAT DMG++KDGS+KENFQ GV
Sbjct  207   LSQLVRWLGGKAEELGTEIYPGFSASEVLYDASDKVVGIATRDMGISKDGSKKENFQPGV  266

Query  816   ELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLH  995
             ++KGRVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIKEVWEID +KH PG+V+H
Sbjct  267   DIKGRVTLFAEGCRGSLSEKIIKKYKLREEVNAQHQTYALGIKEVWEIDESKHNPGEVVH  326

Query  996   TIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEG  1175
             T+GWPLD KTYGGSFLYHM +RQ+A+GLVVALNY NPFLNPYEEFQK KHHPAI+ +LEG
Sbjct  327   TLGWPLDPKTYGGSFLYHMNDRQIALGLVVALNYKNPFLNPYEEFQKLKHHPAIKRVLEG  386

Query  1176  GTVLQYGARTLNEGGYQ  1226
             GTVLQYGARTLNEGG+Q
Sbjct  387   GTVLQYGARTLNEGGFQ  403


 Score =   387 bits (995),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L  G NM T+WDNLR SW+W
Sbjct  409   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGALHEGLNMNTYWDNLRDSWVW  468

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA+E Y+LKG+ P T KHGK DHEA + A+   PIEY
Sbjct  469   KELYAARNYRPAFEYGLLPGLAVSAMEHYVLKGKVPFTLKHGKADHEATDLARKCTPIEY  528

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HLRLKDPK PE +N P+YA PESRYCPARVYE
Sbjct  529   PKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLKDPKIPEKLNFPEYAAPESRYCPARVYE  588

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y++M
Sbjct  589   YVEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSLM  637



>emb|CDX79827.1| BnaA05g03290D [Brassica napus]
Length=626

 Score =   540 bits (1390),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/373 (71%), Positives = 305/373 (82%), Gaps = 10/373 (3%)
 Frame = +3

Query  138   SQLKTMLKFILSSAKSKLS------TTPINRFSSFPNPCGKASRFGAESGYSLN----GA  287
             +QL  +L   LSS  +  S      + P NRF S       A  F     +S N    G 
Sbjct  20    NQLPLILPRFLSSTTASESPPPSRTSHPSNRFLSRSGYPYSADSFRKSRAFSSNSRALGV  79

Query  288   RGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILS  467
             R  SSE+ RE+IEYDV+I+GAGPAGLSAAIRLKQLC+EKN DLSVCVVEKGAEVG H++S
Sbjct  80    RCISSEAGRESIEYDVLIIGAGPAGLSAAIRLKQLCQEKNTDLSVCVVEKGAEVGGHVIS  139

Query  468   GNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQL  647
             GNVFEP ALDELLP WRQE+ PI+V  SSDKF  L+KNRA SLPSPF+NKGNYVISLSQL
Sbjct  140   GNVFEPLALDELLPHWRQEQAPIEVAASSDKFWFLTKNRAISLPSPFDNKGNYVISLSQL  199

Query  648   VRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKG  827
             VRWLG KAEELG+E+YPGF+ASE+LY+ SD+V+GIAT DMG++KDGS+KE FQ GV++KG
Sbjct  200   VRWLGGKAEELGIEIYPGFSASEVLYDASDKVVGIATKDMGISKDGSKKETFQPGVDIKG  259

Query  828   RVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGW  1007
             RVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIKEVWEID +KH PG+V+HT+GW
Sbjct  260   RVTLFAEGCRGSLSEKIIKKYKLREEVNAQHQTYALGIKEVWEIDESKHNPGEVVHTLGW  319

Query  1008  PLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVL  1187
             PLD KTYGGSFLYHM  RQVA+GLVVALNY NPFLNPYEEFQK KHHPAI+ +LEGGTVL
Sbjct  320   PLDPKTYGGSFLYHMNNRQVALGLVVALNYKNPFLNPYEEFQKLKHHPAIKRILEGGTVL  379

Query  1188  QYGARTLNEGGYQ  1226
             QYGARTLNEGG+Q
Sbjct  380   QYGARTLNEGGFQ  392


 Score =   387 bits (995),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 196/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L  G NM T+WD LR SW+W
Sbjct  398   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGALHEGLNMNTYWDTLRGSWVW  457

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA+E Y+LKG+ P T KHGK DHEA + A+   PIEY
Sbjct  458   KELYSARNYRPAFEYGLIPGLAVSAMEHYVLKGKVPFTLKHGKADHEATDLARKWKPIEY  517

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HLRLKDPK PE VNLP+Y  PESRYCPARVYE
Sbjct  518   PKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLKDPKIPEKVNLPEYGAPESRYCPARVYE  577

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y+VM
Sbjct  578   YVEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSVM  626



>emb|CBI36719.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   532 bits (1370),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/302 (82%), Positives = 279/302 (92%), Gaps = 0/302 (0%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVGAGP+GLSAAIRLKQ+CR K+ D SVCVVEKGAEVGAHILSGNVFEPRALDE
Sbjct  1     MEYDVVIVGAGPSGLSAAIRLKQMCRAKDVDFSVCVVEKGAEVGAHILSGNVFEPRALDE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEEL  680
             LLP+W+QE+ PI+VPVSSDKF LL+K+RAFSLPSPF+NKGNY+ISLSQLVRWLG KAEEL
Sbjct  61    LLPEWKQEEAPINVPVSSDKFWLLTKDRAFSLPSPFDNKGNYIISLSQLVRWLGGKAEEL  120

Query  681   GVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRG  860
             GVE+YPGFAASEILY+ +  VIGI TNDMG+AKDGS+K+NFQ GVEL+GRVTLLAEGCRG
Sbjct  121   GVEIYPGFAASEILYDANHNVIGIGTNDMGIAKDGSKKDNFQRGVELRGRVTLLAEGCRG  180

Query  861   SLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSF  1040
             SL+E+V+  Y LREK   QHQTYALGIKE+WEID  KH+ G VLHT+GWPLDH+TYGGSF
Sbjct  181   SLSEKVLRDYNLREKAQAQHQTYALGIKEIWEIDEAKHKTGTVLHTLGWPLDHRTYGGSF  240

Query  1041  LYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGG  1220
             LYHM +RQV+IGLVVALNYHNPFLNPYEEFQK KHHPAI+PLL+GGTVLQYGARTLNEGG
Sbjct  241   LYHMNDRQVSIGLVVALNYHNPFLNPYEEFQKLKHHPAIKPLLKGGTVLQYGARTLNEGG  300

Query  1221  YQ  1226
             +Q
Sbjct  301   FQ  302


 Score =   395 bits (1015),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AFD+L  GS+ME +WD LR+SWIW
Sbjct  308   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFDVLHEGSSMEKYWDGLRNSWIW  367

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE GL PGLALSA+E Y+LKGRSPLT KHGKPDHEA + A+   PI+Y
Sbjct  368   EELHKARNYRPAFEYGLIPGLALSALEHYVLKGRSPLTLKHGKPDHEATDVAQLHSPIQY  427

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HL L+DP+ P+ VNLP +AGPESRYCPARVYE
Sbjct  428   PKPDGIVSFDVPTSLYRSNTNHDHDQPSHLHLRDPQIPDRVNLPDFAGPESRYCPARVYE  487

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ GE++L INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  488   YVPDEKGELRLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  536



>ref|XP_010506212.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like [Camelina sativa]
Length=624

 Score =   537 bits (1383),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 253/317 (80%), Positives = 288/317 (91%), Gaps = 1/317 (0%)
 Frame = +3

Query  276   LNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGA  455
             +NG RG SSE+ RE+IEYDV+IVGAGPAGLSAA+RLKQL +EKN DLSVCVVEKGAEVG 
Sbjct  75    VNG-RGISSEAGRESIEYDVLIVGAGPAGLSAAMRLKQLSQEKNVDLSVCVVEKGAEVGG  133

Query  456   HILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVIS  635
             HI+SGNVFEP ALDELLP WRQE TPI +P SSDKF  L+K+RA SLPSPF+NKGNYVIS
Sbjct  134   HIISGNVFEPVALDELLPHWRQEHTPIKIPASSDKFWFLTKDRAISLPSPFDNKGNYVIS  193

Query  636   LSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGV  815
             LSQLVRWLG KAEELG E+YPGF+ASE+LY+ SD+V+GIAT DMG++KDGS+KENFQ GV
Sbjct  194   LSQLVRWLGGKAEELGTEIYPGFSASEVLYDASDKVVGIATKDMGISKDGSKKENFQPGV  253

Query  816   ELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLH  995
             ++KGRVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIKEVWEID +KH PG+V+H
Sbjct  254   DIKGRVTLFAEGCRGSLSERIIKKYKLREEVNAQHQTYALGIKEVWEIDESKHNPGEVVH  313

Query  996   TIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEG  1175
             T+GWPLD KTYGGSFLYHM +RQVA+GLVVALNYHNPFLNPYEEFQK KHHPAI+ +LEG
Sbjct  314   TLGWPLDRKTYGGSFLYHMNDRQVALGLVVALNYHNPFLNPYEEFQKLKHHPAIKRILEG  373

Query  1176  GTVLQYGARTLNEGGYQ  1226
             GTVLQYGARTLNEGG+Q
Sbjct  374   GTVLQYGARTLNEGGFQ  390


 Score =   389 bits (998),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +L  G NM T+WDNL+ SW+W
Sbjct  396   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVLHEGINMNTYWDNLKDSWVW  455

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA+E YILKG+ P T KHGK DHEA N A+   PIEY
Sbjct  456   KELYAARNYRPAFEYGLLPGLAVSAMEHYILKGKVPFTLKHGKADHEATNLARKCTPIEY  515

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HLRL+DPK PE VN P+YA PESRYCPARVYE
Sbjct  516   PKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLRDPKIPEKVNFPEYAAPESRYCPARVYE  575

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y+++
Sbjct  576   YVEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSLV  624



>emb|CDY17928.1| BnaC04g02910D [Brassica napus]
Length=612

 Score =   535 bits (1378),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/356 (72%), Positives = 299/356 (84%), Gaps = 9/356 (3%)
 Frame = +3

Query  186   KLSTTPINRFSSFPNPCGKASRFGAES-----GYSLN----GARGFSSESCREAIEYDVV  338
             +L    +N F+S   P   A+ + A+S      +S      G R  SSE+ REAIEYDVV
Sbjct  23    RLILPSLNLFASGSPPPPSANPYSADSFRKSRAFSSKSRALGVRCISSEAGREAIEYDVV  82

Query  339   IVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWR  518
             I+GAGPAGLSAAIRLKQLC+EKN DLSVCVVEKGAEVG H++SGNVFEP ALDELLP WR
Sbjct  83    IIGAGPAGLSAAIRLKQLCQEKNTDLSVCVVEKGAEVGGHVISGNVFEPLALDELLPHWR  142

Query  519   QEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYP  698
             QE+ PI+V  SSDKF  L+K+RA  LPSPF+NKGNY+ISLSQLVRWLG KAEELG+E+YP
Sbjct  143   QEQAPIEVAASSDKFWFLTKDRAIPLPSPFDNKGNYIISLSQLVRWLGGKAEELGIEIYP  202

Query  699   GFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQV  878
             GF+ASE+LYN SDEV+GIAT DMG++KDGS+KE FQ GV++KGRVTL AEGCRGSL+E++
Sbjct  203   GFSASEVLYNASDEVVGIATKDMGISKDGSKKETFQPGVDIKGRVTLFAEGCRGSLSEKI  262

Query  879   IGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKE  1058
             I KYKLRE+ N QHQTYALGIKEVWEID +KH PG+V+H +GWPLD KTYGGSFLYHM +
Sbjct  263   IKKYKLREEVNAQHQTYALGIKEVWEIDESKHNPGEVIHALGWPLDPKTYGGSFLYHMND  322

Query  1059  RQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             RQVA+GLVVALNY NPFLNPYEEFQK KHHPAI+ +LEGGTVLQYGARTLNEGG+Q
Sbjct  323   RQVALGLVVALNYKNPFLNPYEEFQKLKHHPAIKRILEGGTVLQYGARTLNEGGFQ  378


 Score =   390 bits (1002),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L  GSNM T+WD+LR SW+W
Sbjct  384   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGALHEGSNMNTYWDSLRGSWVW  443

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA+E Y+LKG+ P T KHGK DHEA + A+   PIEY
Sbjct  444   KELYAARNYRPAFEYGLIPGLAVSAMEHYVLKGKVPFTLKHGKADHEATDLARKCKPIEY  503

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HLRLKDPK PE VNLP+Y  PESRYCPARVYE
Sbjct  504   PKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLKDPKIPEKVNLPEYGAPESRYCPARVYE  563

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y+VM
Sbjct  564   YVEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSVM  612



>ref|XP_006442991.1| hypothetical protein CICLE_v10019615mg [Citrus clementina]
 gb|ESR56231.1| hypothetical protein CICLE_v10019615mg [Citrus clementina]
Length=541

 Score =   543 bits (1399),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/306 (83%), Positives = 284/306 (93%), Gaps = 0/306 (0%)
 Frame = +3

Query  309   CREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPR  488
             CRE++ YDVVIVGAGPAGLSAAIRLKQLCREKN DLSVCVVEKGAEVGAHI+SGNVFEPR
Sbjct  2     CRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPR  61

Query  489   ALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQK  668
             AL+ELLPQW+QE+ PI VPVSSDKF  L+K+RAFSLPSPF N+GNYVISLSQLVRWLG K
Sbjct  62    ALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGK  121

Query  669   AEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAE  848
             AEELGVE+YPGFAASEILY+  ++VIGI TNDMG+AKDGS+KENFQ GVEL+GR+TLLAE
Sbjct  122   AEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAE  181

Query  849   GCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTY  1028
             GCRGSL+E++I  +KLREK + QHQTYALGIKEVWEID  KH PG++LHT+GWPLD KTY
Sbjct  182   GCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTY  241

Query  1029  GGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTL  1208
             GGSFLYHM +RQ+A+GLVVALNYHNPFLNPYEEFQKFKHHPAI+PLLEGGTV+QYGARTL
Sbjct  242   GGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTL  301

Query  1209  NEGGYQ  1226
             NEGG Q
Sbjct  302   NEGGLQ  307


 Score =   382 bits (980),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGC+AGFLNVPKIKGTHTAMKSGMLAAE+ F +L    NME +WD LR+SW+W
Sbjct  313   VFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDLNMEIYWDTLRNSWVW  372

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL  ARNYRPAFE GL PGLA+  +E YIL+G+SP T KHGKPD+EA + A+   PIEY
Sbjct  373   QELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDYEATDAARLHSPIEY  432

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS++RSNTNH+HDQPAHLRL+DPK PELVNLP+YAGPESRYCPARVYE
Sbjct  433   PKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYE  492

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+  ++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  493   YVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  541



>ref|XP_006295895.1| hypothetical protein CARUB_v10025025mg [Capsella rubella]
 gb|EOA28793.1| hypothetical protein CARUB_v10025025mg [Capsella rubella]
Length=624

 Score =   540 bits (1392),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/359 (74%), Positives = 304/359 (85%), Gaps = 7/359 (2%)
 Frame = +3

Query  168   LSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYS----LNG--ARGFSSESCREAIEY  329
              +S  S  + +P NR S +P       +    S  S    LNG  +R  SSE+ RE+IEY
Sbjct  33    FTSFSSASTPSPANR-SGYPYSVELFRKLSPLSSNSRTLGLNGRISRCISSEAGRESIEY  91

Query  330   DVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLP  509
             DV+IVGAGPAGLSAAIRLKQL +EKN DLSVCVVEKGAEVG HI+SGNVFEP ALDELLP
Sbjct  92    DVLIVGAGPAGLSAAIRLKQLSQEKNIDLSVCVVEKGAEVGGHIISGNVFEPVALDELLP  151

Query  510   QWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVE  689
              WRQE+TPI++P SSDKF  L+K+RA SLPSPF+NKGNYVISLSQLVRWLG KAEELG E
Sbjct  152   HWRQEQTPIEIPASSDKFWFLTKDRAISLPSPFDNKGNYVISLSQLVRWLGGKAEELGTE  211

Query  690   LYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLA  869
             +YPGF+ASE+LY+ SD+V+GIAT DMG++KDGS+KENFQ GV++KGRVTL AEGCRGSL+
Sbjct  212   IYPGFSASEVLYDASDKVVGIATKDMGISKDGSKKENFQSGVDIKGRVTLFAEGCRGSLS  271

Query  870   EQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYH  1049
             E++I KYKLRE+ N QHQTYALGIKEVWEID +KH PG+V+HT+GWPLD KTYGGSFLYH
Sbjct  272   ERIIKKYKLREEVNAQHQTYALGIKEVWEIDESKHNPGEVVHTLGWPLDPKTYGGSFLYH  331

Query  1050  MKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             M +RQVAIGLVVALNYHNPFLNPYEEFQK KHHPAI+ +LEGGTVLQYGARTLNEGG+Q
Sbjct  332   MDDRQVAIGLVVALNYHNPFLNPYEEFQKLKHHPAIKRILEGGTVLQYGARTLNEGGFQ  390


 Score =   384 bits (986),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 196/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +L  G NM T+WDNLR SW+W
Sbjct  396   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVLHEGINMNTYWDNLRDSWVW  455

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAF+ GL PGLALSA+E Y+LKG+ P T KHGK DHEA N A+   PIEY
Sbjct  456   KELYAARNYRPAFKYGLLPGLALSAMEHYVLKGKVPFTLKHGKADHEATNLARKCTPIEY  515

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
              KPDG +SFD+ TS+YRSNTNHDHDQ +HLRL+D K PE VNLP+YA PESRYCPARVYE
Sbjct  516   AKPDGVLSFDVPTSLYRSNTNHDHDQLSHLRLRDSKIPEKVNLPEYAAPESRYCPARVYE  575

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y++M
Sbjct  576   YVEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSLM  624



>ref|XP_008222598.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Prunus mume]
Length=657

 Score =   531 bits (1367),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/314 (80%), Positives = 281/314 (89%), Gaps = 0/314 (0%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
              R F SES RE+I+YDVVIVGAGPAGLSAAIRLKQLCREK+ DLSVCVVEKGAEVGAHI+
Sbjct  111   TRSFCSESDRESIQYDVVIVGAGPAGLSAAIRLKQLCREKDVDLSVCVVEKGAEVGAHII  170

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRAL+ELLPQW++E++PI VPV+SDKF  L+K+RAFSLPSPF NKGNYVISLSQ
Sbjct  171   SGNVFEPRALNELLPQWKEEESPITVPVTSDKFWFLTKDRAFSLPSPFSNKGNYVISLSQ  230

Query  645   LVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK  824
             LVRW+G KAEELGVE+YPGFAASEILY+ +D VIGI TNDMGVAKDGS+KENFQ G+ELK
Sbjct  231   LVRWMGVKAEELGVEIYPGFAASEILYDANDTVIGIGTNDMGVAKDGSKKENFQRGIELK  290

Query  825   GRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIG  1004
             GRVTLLAEGCRGSL+EQ++ KY LREKG+ QHQTYALGIKEVWEID  KH PG VLHT+G
Sbjct  291   GRVTLLAEGCRGSLSEQIMKKYNLREKGDAQHQTYALGIKEVWEIDEGKHNPGAVLHTLG  350

Query  1005  WPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTV  1184
             WPLD KTYGGSFLYHMK+RQ+++G VVALNYHNPFLNPYEEFQ  K    +    EGGTV
Sbjct  351   WPLDQKTYGGSFLYHMKDRQISVGFVVALNYHNPFLNPYEEFQVTKSLVFLNDQNEGGTV  410

Query  1185  LQYGARTLNEGGYQ  1226
             LQYGARTLNEGG+Q
Sbjct  411   LQYGARTLNEGGFQ  424


 Score =   392 bits (1008),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAE+   +L  GSNME +WD LRSSWIW
Sbjct  430   VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAEATLSVLHEGSNMEKYWDALRSSWIW  489

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RN+RPAFE GL PGLA+SA+E YI+KGR+PLT KHGKPDHE  N A+   PI+Y
Sbjct  490   EELYKSRNFRPAFEYGLIPGLAISALEHYIMKGRAPLTLKHGKPDHET-NAAQFHSPIQY  548

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFDI TS++RSNTNH+HDQPAHLRL+DPK PELVNLP+Y+GPESRYCPARVYE
Sbjct  549   PKPDGVLSFDIPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYSGPESRYCPARVYE  608

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+ G++KL INAQNCLHCKACDIKDP QNI+WT PEGGGGPGY++M
Sbjct  609   YIPDEKGQLKLQINAQNCLHCKACDIKDPRQNIQWTAPEGGGGPGYSIM  657



>ref|XP_003546985.2| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like [Glycine max]
Length=618

 Score =   540 bits (1390),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/310 (79%), Positives = 286/310 (92%), Gaps = 0/310 (0%)
 Frame = +3

Query  297   SSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNV  476
             ++ S R++IEYDVVIVGAGPAGLSAAIRLKQ+CRE+NADLSVCV+EKGAEVGAHILSGNV
Sbjct  75    TASSDRDSIEYDVVIVGAGPAGLSAAIRLKQMCRERNADLSVCVLEKGAEVGAHILSGNV  134

Query  477   FEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRW  656
             FEPRAL+ELLPQW++++ PI  PVSSDKF  L+K RA SLPSPF NKGNYVISLSQLVRW
Sbjct  135   FEPRALNELLPQWKEQEAPITTPVSSDKFWFLTKGRAISLPSPFNNKGNYVISLSQLVRW  194

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG KAEELGVE+YPGFAASE+LY+ +++VIGI TNDMG++KDGS+KENFQHGVE+KGR+T
Sbjct  195   LGAKAEELGVEIYPGFAASEVLYDANNKVIGIGTNDMGISKDGSKKENFQHGVEIKGRIT  254

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             LLAEGCRGSL+E+++ KY LREKG  +HQTYALGIKEVWEID  KH+PG V+HT+GWPLD
Sbjct  255   LLAEGCRGSLSEKIMKKYNLREKGGSEHQTYALGIKEVWEIDEKKHQPGAVIHTLGWPLD  314

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
             HKTYGGSFLYHMK++Q++IGLVVALNY NPF+NPYEEFQK KHHPAI+  LEGGTV+QYG
Sbjct  315   HKTYGGSFLYHMKDKQISIGLVVALNYQNPFMNPYEEFQKLKHHPAIKSFLEGGTVIQYG  374

Query  1197  ARTLNEGGYQ  1226
             ARTLNEGG+Q
Sbjct  375   ARTLNEGGFQ  384


 Score =   383 bits (984),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGF+NVPKIKGTHTAMKSGMLAAE  F  L  G +M+ +WD LR+SWIW
Sbjct  390   VFPGGAIIGCSAGFMNVPKIKGTHTAMKSGMLAAEVTFGALNEGLDMDMYWDALRNSWIW  449

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ +RNYRPAFE GL PGLALS +E YI KGR P+T KHGKPDHEA+N AKS  PI Y
Sbjct  450   EELHKSRNYRPAFEYGLIPGLALSGLEHYIFKGRHPVTLKHGKPDHEAMNAAKSHSPIHY  509

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PK DG +SFD+ TS++RSNTNH+HDQP HLRL+DPK PELVNLP YA PESRYCPARVYE
Sbjct  510   PKADGVLSFDVPTSLHRSNTNHEHDQPPHLRLRDPKIPELVNLPVYAAPESRYCPARVYE  569

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+  ++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  570   YVADEQNQMKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  618



>ref|NP_181868.1| electron-transfer flavoprotein--ubiquinone oxidoreductase [Arabidopsis 
thaliana]
 sp|O22854.1|ETFQO_ARATH RecName: Full=Electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial; Short=ETF-QO; Short=ETF-ubiquinone 
oxidoreductase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB64328.1| putative electron transfer flavoprotein ubiquinone oxidoreductase 
[Arabidopsis thaliana]
 gb|AEC10261.1| electron-transfer flavoprotein--ubiquinone oxidoreductase [Arabidopsis 
thaliana]
Length=633

 Score =   536 bits (1380),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/333 (76%), Positives = 293/333 (88%), Gaps = 2/333 (1%)
 Frame = +3

Query  228   NPCGKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKN  407
             +P    SR    +G  +  +R  SSE+ RE+IEYDV+IVGAGPAGLSAAIRLKQL +EKN
Sbjct  69    SPLNPNSRILGVNG--ITSSRCISSEAVRESIEYDVLIVGAGPAGLSAAIRLKQLSQEKN  126

Query  408   ADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA  587
              DLSVCVVEKGAEVG HI+SGNVFEP ALDELLP WRQE  PI++P SSDKF  L+K+RA
Sbjct  127   IDLSVCVVEKGAEVGGHIISGNVFEPLALDELLPHWRQEHAPIEIPASSDKFWFLTKDRA  186

Query  588   FSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDM  767
             FSLPSPF+NKGNYVISLSQLVRWLG KAEELG E+YPGF+ASE+L++ SD+V+GIAT DM
Sbjct  187   FSLPSPFDNKGNYVISLSQLVRWLGGKAEELGTEIYPGFSASEVLFDASDKVVGIATKDM  246

Query  768   GVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKE  947
             G++KDGS+KENFQ GV++KGRVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIKE
Sbjct  247   GISKDGSKKENFQPGVDIKGRVTLFAEGCRGSLSERIIKKYKLREEVNAQHQTYALGIKE  306

Query  948   VWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEE  1127
             VWEID +KH PG+V+HT+GWPLD KTYGGSFLYHM +RQVA+GLVVALNYHNPFLNPYEE
Sbjct  307   VWEIDESKHNPGEVIHTLGWPLDPKTYGGSFLYHMNDRQVALGLVVALNYHNPFLNPYEE  366

Query  1128  FQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             FQK KHHPAI+ +LEGGTVLQYGARTLNEGG+Q
Sbjct  367   FQKLKHHPAIKGILEGGTVLQYGARTLNEGGFQ  399


 Score =   385 bits (989),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 196/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L  G NM T+WDNLR SW+W
Sbjct  405   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGALHEGLNMNTYWDNLRDSWVW  464

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA+E Y+LKG+ P T KHGK DHEA + A+   PI Y
Sbjct  465   KELYAARNYRPAFEYGLLPGLAISAMEHYVLKGKVPFTLKHGKADHEATDLARKWTPIVY  524

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HLRL+DPK PE VN P+YA PESRYCPARVYE
Sbjct  525   PKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLRDPKIPEKVNFPEYAAPESRYCPARVYE  584

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y++M
Sbjct  585   YIEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSLM  633



>ref|XP_010508435.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Camelina sativa]
Length=624

 Score =   531 bits (1369),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/317 (79%), Positives = 287/317 (91%), Gaps = 1/317 (0%)
 Frame = +3

Query  276   LNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGA  455
             +NG R  SSE+ RE+IEYDV+IVGAGPAGLSAAIRLKQL +EKN DLSVCVVEKGAEVG 
Sbjct  75    VNG-RSISSEAGRESIEYDVLIVGAGPAGLSAAIRLKQLSQEKNIDLSVCVVEKGAEVGG  133

Query  456   HILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVIS  635
             HI+SGNVFEP ALDELLP WRQE TPI++P SSDKF  L+K+RA SLPSPF+NKGNYVIS
Sbjct  134   HIISGNVFEPVALDELLPHWRQEHTPIEIPASSDKFWFLTKDRAISLPSPFDNKGNYVIS  193

Query  636   LSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGV  815
             LSQLVRWLG KAEELG E+YPGF+ASE+LY+ SD+V+GIAT DMG++KDGS+KENFQ GV
Sbjct  194   LSQLVRWLGGKAEELGTEIYPGFSASEVLYDASDKVVGIATKDMGISKDGSKKENFQPGV  253

Query  816   ELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLH  995
             ++KGRVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIKEVWEID +KH PG+V+H
Sbjct  254   DIKGRVTLFAEGCRGSLSERIIKKYKLREEVNAQHQTYALGIKEVWEIDESKHNPGEVVH  313

Query  996   TIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEG  1175
             T+GWPLD KTYGGSFLYHM +RQVA+GLVVALNYHNPFLNPYEEFQK K HPAI+ +LEG
Sbjct  314   TLGWPLDPKTYGGSFLYHMNDRQVALGLVVALNYHNPFLNPYEEFQKLKPHPAIKRILEG  373

Query  1176  GTVLQYGARTLNEGGYQ  1226
             GTVLQYGARTLNEGG+Q
Sbjct  374   GTVLQYGARTLNEGGFQ  390


 Score =   389 bits (999),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +L  G NM T+WDNL+ SW+W
Sbjct  396   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVLHEGINMNTYWDNLKDSWVW  455

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA+E Y+LKG+ P T KHGK DHEA N A+   PIEY
Sbjct  456   KELYAARNYRPAFEYGLLPGLAVSAMEHYVLKGKVPFTLKHGKADHEATNLARKCTPIEY  515

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HLRL+DPK PE VN P+YA PESRYCPARVYE
Sbjct  516   PKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLRDPKIPEKVNFPEYAAPESRYCPARVYE  575

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y++M
Sbjct  576   YVEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSLM  624



>gb|KHG21413.1| Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial 
[Gossypium arboreum]
Length=665

 Score =   523 bits (1348),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/346 (73%), Positives = 287/346 (83%), Gaps = 38/346 (11%)
 Frame = +3

Query  288   RGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILS  467
             R +SSE+ RE+I+YDVVIVGAGPAGLSAAIR KQLC+EKNAD SVCVVEKGAEVGAHILS
Sbjct  91    RNYSSETDRESIDYDVVIVGAGPAGLSAAIRFKQLCQEKNADFSVCVVEKGAEVGAHILS  150

Query  468   GNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQL  647
             GNVFEPRAL+ELLPQW+ E+ PI+VPVSSDKF LL+K+RA SLPSPF+NKGNYVISLSQL
Sbjct  151   GNVFEPRALNELLPQWKDEEAPINVPVSSDKFWLLTKDRAISLPSPFDNKGNYVISLSQL  210

Query  648   VRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKG  827
             VRW+G KAEELGVE+YPGFAASEILY+E + V+GI TNDMGVAKDGSRKENFQ     +G
Sbjct  211   VRWMGVKAEELGVEIYPGFAASEILYDEDNNVVGIGTNDMGVAKDGSRKENFQ-----RG  265

Query  828   RVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGW  1007
             R+TLLAEGCRGSL+++++ +YKLREK   QHQTYALGIKEVWEID  KH+PG VLHT+GW
Sbjct  266   RITLLAEGCRGSLSQKIMKEYKLREKVQAQHQTYALGIKEVWEIDEKKHKPGAVLHTLGW  325

Query  1008  PLDHKTYGGSFLYHMKERQ---------------------------------VAIGLVVA  1088
             PLD KTYGGSFLYHMK+RQ                                 ++IGLVVA
Sbjct  326   PLDSKTYGGSFLYHMKDRQHCVMRLGVGFSHRTALFLMNNGYGSGLRIPEVMISIGLVVA  385

Query  1089  LNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             LNYHNPFLNPYEEFQK KHHP+I+PLLEGGTVLQYGARTLNEGG+Q
Sbjct  386   LNYHNPFLNPYEEFQKLKHHPSIKPLLEGGTVLQYGARTLNEGGFQ  431


 Score =   395 bits (1016),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F +L  GSNME +WD LRSSW+W
Sbjct  437   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFGVLHEGSNMEAYWDALRSSWVW  496

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE GLFPGLALSA+E Y+LKG+SP TFKHGKPDHEA N AK    I+Y
Sbjct  497   EELHRARNYRPAFEYGLFPGLALSALEHYVLKGKSPFTFKHGKPDHEATNVAKLHSSIQY  556

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS++RSNTNH+HDQPAHLRL+DP  PE VNLP+YAGPESRYCPARVYE
Sbjct  557   PKPDGVLSFDVPTSLHRSNTNHNHDQPAHLRLRDPNIPETVNLPEYAGPESRYCPARVYE  616

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ ++  ++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  617   YVPNEKNQLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  665



>ref|XP_006397506.1| hypothetical protein EUTSA_v10001353mg [Eutrema salsugineum]
 gb|ESQ38959.1| hypothetical protein EUTSA_v10001353mg [Eutrema salsugineum]
Length=635

 Score =   541 bits (1394),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/377 (69%), Positives = 306/377 (81%), Gaps = 21/377 (6%)
 Frame = +3

Query  159   KFILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNG------------------  284
             +FIL    S +++ P     S P P   A+RF +  GY  +                   
Sbjct  27    RFILPLLPSSITSNPFTASGSPPRPSIPANRFISRFGYPCSADLFRKSPTLCSNSTTFGV  86

Query  285   ---ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGA  455
                +R  SSE+ RE+IEYDV+IVGAGPAGLSAAIRLKQLC++ N DLSVCVVEKGAEVGA
Sbjct  87    IWSSRCISSEAGRESIEYDVLIVGAGPAGLSAAIRLKQLCQQNNIDLSVCVVEKGAEVGA  146

Query  456   HILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVIS  635
             HI+SGNVFEP ALDELLP WRQ++ PI++P SSDKF  L+K+RA SLPSPF+NKGNYVIS
Sbjct  147   HIISGNVFEPLALDELLPHWRQQQAPIEIPASSDKFWFLTKDRAISLPSPFDNKGNYVIS  206

Query  636   LSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGV  815
             LSQLVRWLG KAEELG E+YPGF+ASE+LY+ SD+V+GIAT DMG++KDGS+KENFQ GV
Sbjct  207   LSQLVRWLGGKAEELGTEIYPGFSASEVLYDASDKVVGIATRDMGISKDGSKKENFQPGV  266

Query  816   ELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLH  995
             ++KGRVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIKEVWEID +KH PG+V+H
Sbjct  267   DIKGRVTLFAEGCRGSLSEKIIKKYKLREEVNAQHQTYALGIKEVWEIDESKHNPGEVVH  326

Query  996   TIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEG  1175
             T+GWPLD KTYGGSFLYHM +RQ+A+GLVVALNY NPFLNPYEEFQK KHHPAI+ +LEG
Sbjct  327   TLGWPLDPKTYGGSFLYHMNDRQIALGLVVALNYKNPFLNPYEEFQKLKHHPAIKRVLEG  386

Query  1176  GTVLQYGARTLNEGGYQ  1226
             GTVLQYGARTLNEGG+Q
Sbjct  387   GTVLQYGARTLNEGGFQ  403


 Score =   378 bits (970),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 195/229 (85%), Gaps = 2/229 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L  G NM T+WDNLR SW+W
Sbjct  409   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGALHEGLNMNTYWDNLRDSWVW  468

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA+E Y+LKG+ P T KHGK DHEA + A+   PIEY
Sbjct  469   KELYAARNYRPAFEYGLLPGLAVSAMEHYVLKGKVPFTLKHGKADHEATDLARKCTPIEY  528

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HLRLKDPK PE +N P+YA PESRYCPARV  
Sbjct  529   PKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLKDPKIPEKLNFPEYAAPESRYCPARV--  586

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y++M
Sbjct  587   YVEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSLM  635



>ref|XP_003597528.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Medicago 
truncatula]
Length=606

 Score =   538 bits (1385),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/367 (70%), Positives = 302/367 (82%), Gaps = 20/367 (5%)
 Frame = +3

Query  171   SSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGA  350
             S +KSK + T I  F++   PC  ++   +    S    R F +   R++IEYDVVIVGA
Sbjct  11    SKSKSKNALTIIRTFNNL-QPCNASTHANSRVPIS----RNFCTAPERDSIEYDVVIVGA  65

Query  351   GPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKT  530
             GPAGLSAAIRLKQLCRE + DLSVCV+EKG+EVGAHILSGNVFEPRALDELLPQW+Q++ 
Sbjct  66    GPAGLSAAIRLKQLCRENDTDLSVCVLEKGSEVGAHILSGNVFEPRALDELLPQWKQQEA  125

Query  531   PIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAA  710
             PI  PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQLVRW+G KAEELGVE+YPGFAA
Sbjct  126   PISTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQLVRWMGAKAEELGVEIYPGFAA  185

Query  711   SEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKY  890
             SEILY+  ++VIGI TNDMG++KDGS+KE FQ GVE+KG++TLL+EGCRGSL+EQ++ KY
Sbjct  186   SEILYDSDNKVIGIGTNDMGISKDGSKKETFQRGVEVKGQITLLSEGCRGSLSEQIMKKY  245

Query  891   KLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVA  1070
              LREKG  +HQTYALGIKEVWEID  KH+PG VLHT+GWPLDHKTYGGSFLYHMK+RQ++
Sbjct  246   NLREKGGAEHQTYALGIKEVWEIDEEKHQPGAVLHTLGWPLDHKTYGGSFLYHMKDRQIS  305

Query  1071  IGLVVALNYHNPFLNPYEEF---------------QKFKHHPAIRPLLEGGTVLQYGART  1205
             +GLVVALNY NPF+NPYEEF               QKFKHHPAI+P LEGGTV+QYGART
Sbjct  306   LGLVVALNYQNPFMNPYEEFQFFSPCLSPVSHLVDQKFKHHPAIKPFLEGGTVIQYGART  365

Query  1206  LNEGGYQ  1226
             LNEGG+Q
Sbjct  366   LNEGGFQ  372


 Score =   381 bits (979),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 196/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +   G +M T+WD LR+SWIW
Sbjct  378   VFPGGAIVGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVFNEGLDMNTYWDALRNSWIW  437

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAF+ GL PGLALS +E YILKGR P+T KHGKPDHEA N A+   PI Y
Sbjct  438   EELYKSRNYRPAFKYGLIPGLALSGLEHYILKGRHPITLKHGKPDHEATNAAELHSPIHY  497

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG  SFD+ TS++RSNTNH+HDQP HLRL+DPK PEL NLP +A PESRYCPARVYE
Sbjct  498   PKPDGVFSFDVPTSLHRSNTNHEHDQPPHLRLRDPKIPELTNLPVFAAPESRYCPARVYE  557

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y +D+  ++KL INAQNCLHCKACDIKDP QNIKWTVPEGGGGPGY+VM
Sbjct  558   YAADEQNQLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM  606



>ref|XP_010517901.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like [Camelina sativa]
Length=623

 Score =   530 bits (1365),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 250/317 (79%), Positives = 287/317 (91%), Gaps = 1/317 (0%)
 Frame = +3

Query  276   LNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGA  455
             +NG R  SSE+ RE+IEYDV+IVGAGPAGLSAAIRLKQL +EKN DLSVCVVEKGAEVG 
Sbjct  74    VNG-RSISSEAGRESIEYDVLIVGAGPAGLSAAIRLKQLSQEKNVDLSVCVVEKGAEVGG  132

Query  456   HILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVIS  635
             HI+SGNVFEP ALDELLP WRQE TPI++P SSDKF  L+K+RA SLPSPF+NKGNYVIS
Sbjct  133   HIISGNVFEPVALDELLPHWRQEHTPIEIPASSDKFWFLTKDRAISLPSPFDNKGNYVIS  192

Query  636   LSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGV  815
             LSQLVRWLG KAEELG E+YPGF+ASE+LY+ SD+++GIAT DMG++KDGS+KENFQ GV
Sbjct  193   LSQLVRWLGGKAEELGTEIYPGFSASEVLYDASDKLVGIATKDMGISKDGSKKENFQPGV  252

Query  816   ELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLH  995
             ++KGRVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIKEVWEI  +KH PG+V+H
Sbjct  253   DIKGRVTLFAEGCRGSLSERIIKKYKLREEVNAQHQTYALGIKEVWEIHESKHNPGEVVH  312

Query  996   TIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEG  1175
             T+GWPL+ KTYGGSFLYHM +RQVA+GLVVALNYHNPFLNPYEEFQK KHHPAI+ +LEG
Sbjct  313   TLGWPLEPKTYGGSFLYHMNDRQVALGLVVALNYHNPFLNPYEEFQKLKHHPAIKRILEG  372

Query  1176  GTVLQYGARTLNEGGYQ  1226
             GTVLQYGARTLNEGG+Q
Sbjct  373   GTVLQYGARTLNEGGFQ  389


 Score =   389 bits (998),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +L  G NM T+WDNL+ SW+W
Sbjct  395   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVLHEGINMNTYWDNLKDSWVW  454

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PG+A+SA+E Y+LKG+ P T KHGK DHEA N A+   PIEY
Sbjct  455   KELYAARNYRPAFEYGLLPGMAVSAMEHYVLKGKVPYTLKHGKADHEATNHARKCTPIEY  514

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG  SFD+ TS+YRSNTNHDHDQP+HLRL+DPK PE VN P+YA PESRYCPARVYE
Sbjct  515   PKPDGVFSFDVPTSLYRSNTNHDHDQPSHLRLRDPKIPEKVNFPEYAAPESRYCPARVYE  574

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y++M
Sbjct  575   YVEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSLM  623



>ref|XP_004147657.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like [Cucumis sativus]
 gb|KGN57247.1| hypothetical protein Csa_3G173020 [Cucumis sativus]
Length=659

 Score =   535 bits (1379),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/317 (79%), Positives = 286/317 (90%), Gaps = 0/317 (0%)
 Frame = +3

Query  276   LNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGA  455
             LN  R FSS + RE+IEYDVVI+GAGPAGLSAAIRLKQ+C+EK  DLSVCVVEKGAEVGA
Sbjct  109   LNMVRRFSSGAERESIEYDVVIIGAGPAGLSAAIRLKQMCQEKGVDLSVCVVEKGAEVGA  168

Query  456   HILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVIS  635
             HILSGNVFEPRALDEL+P W++++ PI+VPV+SDKF  L+KNRAFSLP PF N+GNYVIS
Sbjct  169   HILSGNVFEPRALDELIPTWKEDEAPINVPVTSDKFWFLTKNRAFSLPCPFNNEGNYVIS  228

Query  636   LSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGV  815
             LSQLVRW+G KAEELGVE+YPGFAASE+LY+ +D VIGI TNDMGVAKDGS+K+N+Q GV
Sbjct  229   LSQLVRWMGMKAEELGVEIYPGFAASEVLYDTTDAVIGIRTNDMGVAKDGSKKDNYQLGV  288

Query  816   ELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLH  995
             EL+GR+TLLAEGCRGS++E++I KY LR+K N QHQTYALGIKEVWEID  KH PG VLH
Sbjct  289   ELRGRITLLAEGCRGSISEKLIKKYSLRKKVNAQHQTYALGIKEVWEIDEGKHDPGAVLH  348

Query  996   TIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEG  1175
             T+GWPLD KTYGGSFLYHMK+RQ++IGLVVALNY NPFLNPYEEFQK KHHPAI+ LLEG
Sbjct  349   TLGWPLDRKTYGGSFLYHMKDRQISIGLVVALNYQNPFLNPYEEFQKLKHHPAIKDLLEG  408

Query  1176  GTVLQYGARTLNEGGYQ  1226
             GTV+QYGARTLNEGG Q
Sbjct  409   GTVVQYGARTLNEGGLQ  425


 Score =   382 bits (981),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L   S M+ +WD+L+SSWIW
Sbjct  431   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFATLHRASKMDVYWDSLQSSWIW  490

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE+GL PGL +SA+E Y+LKGRSPLT KHGKPDHEA N A    PI+Y
Sbjct  491   EELYRARNYRPAFEHGLIPGLTISALEHYVLKGRSPLTLKHGKPDHEATNVASLHTPIDY  550

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPD  +SFD+ TS++RSNTNH+HDQPAHLRL+D + PE VNL +YA PESRYCPARVYE
Sbjct  551   PKPDNLLSFDVPTSLHRSNTNHEHDQPAHLRLRDARIPEEVNLKEYAAPESRYCPARVYE  610

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+N ++KL INAQNCLHCKACDIKDP QNI+W+VPEGGGGPGY+VM
Sbjct  611   YIPDENDQMKLQINAQNCLHCKACDIKDPKQNIEWSVPEGGGGPGYSVM  659



>ref|XP_008439064.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Cucumis melo]
Length=661

 Score =   538 bits (1385),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/317 (79%), Positives = 287/317 (91%), Gaps = 0/317 (0%)
 Frame = +3

Query  276   LNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGA  455
             LN  R FSSE+ RE+IEYDVVI+GAGPAGLSAAIRLKQ+C+EK  DLSVCVVEKGAEVGA
Sbjct  111   LNMVRRFSSEAERESIEYDVVIIGAGPAGLSAAIRLKQMCQEKGVDLSVCVVEKGAEVGA  170

Query  456   HILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVIS  635
             HILSGNVFEPRALDEL+P W++++ PI+VPV+SDKF  L+KNRAFSLP PF N+GNYVIS
Sbjct  171   HILSGNVFEPRALDELIPTWKEDEAPINVPVTSDKFWFLTKNRAFSLPCPFNNEGNYVIS  230

Query  636   LSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGV  815
             LSQLVRWLG KAEELGVE+YPGFAASE+LY+ +D VIGI TNDMGVAKDGS+K+N+Q GV
Sbjct  231   LSQLVRWLGMKAEELGVEIYPGFAASEVLYDTTDTVIGIRTNDMGVAKDGSKKDNYQLGV  290

Query  816   ELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLH  995
             EL+GR+TLLAEGCRGS++E++I KY LR+K N QHQTYALGIKEVWEID  KH PG VLH
Sbjct  291   ELRGRITLLAEGCRGSISEKLIKKYSLRKKVNAQHQTYALGIKEVWEIDEGKHDPGAVLH  350

Query  996   TIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEG  1175
             T+GWPLD KTYGGSFLYHMK+RQ++IGLVVALNY NPFLNPYEEFQK KHHPAI+ LL+G
Sbjct  351   TLGWPLDRKTYGGSFLYHMKDRQISIGLVVALNYQNPFLNPYEEFQKLKHHPAIKDLLKG  410

Query  1176  GTVLQYGARTLNEGGYQ  1226
             GTV+QYGARTLNEGG Q
Sbjct  411   GTVVQYGARTLNEGGLQ  427


 Score =   379 bits (973),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L G SNM+ +WD+L+SSWI 
Sbjct  433   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFATLHGASNMDVYWDSLQSSWIR  492

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE+GL  GL +SA+E Y+LKGRSPLT KHGKPDHEA N A    PI Y
Sbjct  493   EELYRARNYRPAFEHGLISGLTISALEHYVLKGRSPLTLKHGKPDHEATNVASLHTPINY  552

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPD  +SFD+ TS++RSNTNH+HDQPAHLRL+D + PE VNL +YA PESRYCPARVYE
Sbjct  553   PKPDNILSFDVPTSLHRSNTNHEHDQPAHLRLRDARIPEEVNLKEYAAPESRYCPARVYE  612

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+N ++KL INAQNCLHCKACDIKDP QNI+W+VPEGGGGPGY+VM
Sbjct  613   YIPDENDQMKLQINAQNCLHCKACDIKDPKQNIEWSVPEGGGGPGYSVM  661



>ref|XP_009389187.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=633

 Score =   536 bits (1380),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/353 (73%), Positives = 298/353 (84%), Gaps = 12/353 (3%)
 Frame = +3

Query  201   PINRFSSFPNPCGKASRFGAESGYS----------LNGARGFSSESC-REAIEYDVVIVG  347
             P NRFSSF +P  +AS F     +           ++  RG    S  RE++EYDVVIVG
Sbjct  48    PSNRFSSFRDPPSRAS-FAPSICFPDWSPGLRRRVVSRTRGLCGGSGDRESLEYDVVIVG  106

Query  348   AGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEK  527
             AGPAGLSAAIRLKQ+C E+NADLSVCV+EKG EVGAHI+SGNVFEPRALDEL+PQWR E 
Sbjct  107   AGPAGLSAAIRLKQMCLERNADLSVCVLEKGPEVGAHIISGNVFEPRALDELIPQWRHEG  166

Query  528   TPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFA  707
              PI+VPVSSDKF LL++N +  LPSPF+NKGNYVISLSQLVRW+  KAEE+GVE+YPGFA
Sbjct  167   APIEVPVSSDKFWLLTENHSLQLPSPFDNKGNYVISLSQLVRWMAMKAEEVGVEIYPGFA  226

Query  708   ASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGK  887
             ASEILY+E+  VIG+ATNDMGVAKDGS++E FQ GVELKGRVTLLAEGCRGSL+E++I  
Sbjct  227   ASEILYDENHRVIGVATNDMGVAKDGSKRETFQRGVELKGRVTLLAEGCRGSLSEKMIRA  286

Query  888   YKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQV  1067
             +KLREK  GQHQTYALGIKEVWEI+  KH+PG VLHT+GWPLD KTYGGSFLYHM  RQ+
Sbjct  287   HKLREKVQGQHQTYALGIKEVWEIEEGKHKPGSVLHTVGWPLDMKTYGGSFLYHMSNRQI  346

Query  1068  AIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             AIGLV+ALNYHNP+LNPY+EFQKFKHHPAI+PLL GGTVL+YGARTLNEGG+Q
Sbjct  347   AIGLVIALNYHNPYLNPYDEFQKFKHHPAIKPLLMGGTVLEYGARTLNEGGFQ  399


 Score =   380 bits (977),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 198/236 (84%), Gaps = 0/236 (0%)
 Frame = +2

Query  1205  FKRRRLSVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDN  1384
             F+    SV PGGA+IGCSAGFL+VPKIKGTHTAMKSGMLA E+AF  L  G+ MET+WDN
Sbjct  398   FQSIPYSVVPGGAIIGCSAGFLDVPKIKGTHTAMKSGMLAGEAAFRTLVEGATMETYWDN  457

Query  1385  LRSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAK  1564
             L+ SWIW++L  ARNYRPAF+ GL PGLA SA+ERY+ +GR PLT KHGKPDHEA + A 
Sbjct  458   LKKSWIWEDLKRARNYRPAFKYGLIPGLAFSALERYVFRGRLPLTLKHGKPDHEATDIAS  517

Query  1565  SSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRY  1744
                PI+YPKPDG ISFD+ TS+YRSNTNH+HDQPAHL L+D   PELVNLP YAGPESRY
Sbjct  518   LHAPIQYPKPDGQISFDVPTSLYRSNTNHEHDQPAHLHLRDSTVPELVNLPLYAGPESRY  577

Query  1745  CPARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             CPARVYEY  D+N  +KL+INAQNCLHCKACDIKDP QNIKWTVPEGGGGPGYT+M
Sbjct  578   CPARVYEYTPDENHRLKLHINAQNCLHCKACDIKDPRQNIKWTVPEGGGGPGYTIM  633



>ref|XP_002880044.1| electron-transfer flavoprotein:ubiquinone oxidoreductase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56303.1| electron-transfer flavoprotein:ubiquinone oxidoreductase [Arabidopsis 
lyrata subsp. lyrata]
Length=629

 Score =   531 bits (1369),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/333 (77%), Positives = 290/333 (87%), Gaps = 3/333 (1%)
 Frame = +3

Query  228   NPCGKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKN  407
             +P    SR    +G S   +R  SSE  RE+IEYDV+IVGAGPAGLSAAIRLKQL +EKN
Sbjct  66    SPLSSNSRTLGVNGIS---SRCISSEPGRESIEYDVLIVGAGPAGLSAAIRLKQLSQEKN  122

Query  408   ADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA  587
              DLSVCVVEKGAEVG HI+SGNVFEP ALDELLP WRQE  PI++P SSDKF  L+K RA
Sbjct  123   IDLSVCVVEKGAEVGGHIISGNVFEPVALDELLPHWRQEHAPIEIPASSDKFWFLTKERA  182

Query  588   FSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDM  767
              SLPSPF+NKGNYVISLSQLVRWLG KAEELG E+YPGF+ASE+LY+ SD+V+GIAT DM
Sbjct  183   ISLPSPFDNKGNYVISLSQLVRWLGGKAEELGTEIYPGFSASEVLYDASDKVVGIATKDM  242

Query  768   GVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKE  947
             G++KDGS+KENFQ GV++KGRVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIKE
Sbjct  243   GISKDGSKKENFQPGVDIKGRVTLFAEGCRGSLSERIIKKYKLREEVNAQHQTYALGIKE  302

Query  948   VWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEE  1127
             VWEID +KH PG+V+HT+GWPLD KTYGGSFLYHM +RQVA+GLVVALNYHNPFLNPYEE
Sbjct  303   VWEIDESKHNPGEVIHTLGWPLDPKTYGGSFLYHMNDRQVALGLVVALNYHNPFLNPYEE  362

Query  1128  FQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             FQK KHHPAI+ +LEGGTVLQYGARTLNEGG+Q
Sbjct  363   FQKLKHHPAIKRILEGGTVLQYGARTLNEGGFQ  395


 Score =   384 bits (986),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF ++  G +M T+WDNLR SW+W
Sbjct  401   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVIHEGLHMNTYWDNLRDSWVW  460

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA+E Y+LKG+ P T KHGK DHEA + A+   PI Y
Sbjct  461   KELYAARNYRPAFEYGLLPGLAVSAMEHYVLKGKVPFTLKHGKADHEATDLARKCTPIVY  520

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQP+HLRL+DPK PE VN P+YA PESRYCPARVYE
Sbjct  521   PKPDGVLSFDVPTSLYRSNTNHDHDQPSHLRLRDPKIPEKVNFPEYAAPESRYCPARVYE  580

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP Y++M
Sbjct  581   YIEDEEGKPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPAYSLM  629



>ref|XP_004486907.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform X7 [Cicer arietinum]
Length=587

 Score =   534 bits (1376),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/314 (78%), Positives = 286/314 (91%), Gaps = 0/314 (0%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
             +  F +   R++IEYDVV+VGAGPAGLSAAIRLKQLCRE + DLSVCV+EKGAEVGAHI+
Sbjct  40    SHNFCTTPNRDSIEYDVVVVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGAEVGAHIV  99

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRAL+ELLPQW+Q++ PI+ PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQ
Sbjct  100   SGNVFEPRALNELLPQWKQQEAPINTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQ  159

Query  645   LVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK  824
             LVRW+G KAEELGVE+YPGFAASEILY+ +++VIGI TNDMG++KDGS+KE FQ GVE+K
Sbjct  160   LVRWMGAKAEELGVEIYPGFAASEILYDANNKVIGIGTNDMGISKDGSKKETFQRGVEVK  219

Query  825   GRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIG  1004
             GR+TLLAEGCRGSL+E+++ +Y LREKG  +HQTYALGIKEVWEID  KH+PG VLHT+G
Sbjct  220   GRLTLLAEGCRGSLSEKIMKQYNLREKGGAEHQTYALGIKEVWEIDEEKHQPGAVLHTLG  279

Query  1005  WPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTV  1184
             WPLDHKTYGGSFLYHMK+RQ+++GLVVALNY NPF+NPYEEFQK KHHPAI+P LEGGTV
Sbjct  280   WPLDHKTYGGSFLYHMKDRQISLGLVVALNYQNPFMNPYEEFQKLKHHPAIKPFLEGGTV  339

Query  1185  LQYGARTLNEGGYQ  1226
             +QYGARTLNEGG+Q
Sbjct  340   IQYGARTLNEGGFQ  353


 Score =   381 bits (979),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGM+AAE+AF +L  G +M T+WD LR+SWIW
Sbjct  359   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMVAAEAAFGVLNEGLDMNTYWDALRNSWIW  418

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAFE GL PGLA S +E YILKGR P+T KHGKPDHEA N A+   PI Y
Sbjct  419   EELYKSRNYRPAFEYGLIPGLAFSGLEHYILKGRHPITLKHGKPDHEATNPARLHSPIHY  478

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PK DG +SFD+ TS++RSNTNH+HDQP HLRL+DPK PEL NLP YA PESRYCPARVYE
Sbjct  479   PKADGVLSFDVPTSLHRSNTNHEHDQPPHLRLRDPKIPELTNLPVYAAPESRYCPARVYE  538

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+  ++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  539   YVADEQNQLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  587



>ref|XP_002529480.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
 gb|EEF32890.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
Length=609

 Score =   529 bits (1362),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +3

Query  288   RGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILS  467
             + FS E  RE+IEYDVVIVGAGPAGLSAAIRLKQLC E+  D SVCVVEKGAEVGAHI+S
Sbjct  63    KSFSVEPERESIEYDVVIVGAGPAGLSAAIRLKQLCSERGLDFSVCVVEKGAEVGAHIIS  122

Query  468   GNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQL  647
             GNVF+PRALDEL+PQW+QEK PI VP SSDKF  L+++RA+SLPSPF+NKGNYVISLS+L
Sbjct  123   GNVFDPRALDELIPQWKQEKAPISVPTSSDKFWFLTEDRAYSLPSPFDNKGNYVISLSEL  182

Query  648   VRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKG  827
             VRW+  KAEE+GVE+YPGFAASEILYNE++ V+GI TNDMG++K+GS+K+NFQHGVELKG
Sbjct  183   VRWMAVKAEEVGVEIYPGFAASEILYNETNNVVGIGTNDMGISKNGSKKDNFQHGVELKG  242

Query  828   RVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGW  1007
             R+TLLAEGCRGSL+E++I KYKLREK N QHQTYALGIKEVWEID +KH+PG V HT+GW
Sbjct  243   RITLLAEGCRGSLSEKIIKKYKLREKVNAQHQTYALGIKEVWEIDESKHKPGAVFHTLGW  302

Query  1008  PLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVL  1187
             PLD KTYGGSFLYHMK+ QV+IGLVVALNY NP+L+PY+EFQK KHHPAI+ +LEGGTV+
Sbjct  303   PLDPKTYGGSFLYHMKDNQVSIGLVVALNYRNPYLSPYDEFQKLKHHPAIKSVLEGGTVI  362

Query  1188  QYGARTLNEGGYQ  1226
             QYGARTLNEGG Q
Sbjct  363   QYGARTLNEGGIQ  375


 Score =   387 bits (993),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L  GSN+E +W+ LR+SWIW
Sbjct  381   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGALHDGSNLELYWEKLRNSWIW  440

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE+GL PG+A+ A+E YILKG+SP T KHGKPDHEA   A+   P+EY
Sbjct  441   EELHKARNYRPAFEHGLIPGMAICALEHYILKGKSPFTLKHGKPDHEATEIAQIHSPVEY  500

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS++RSNTNH+HDQPAHL L++ K PELVNLP+Y GPESRYCPARVYE
Sbjct  501   PKPDGVLSFDVPTSLHRSNTNHEHDQPAHLYLRNHKIPELVNLPEYDGPESRYCPARVYE  560

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+SD+ G++KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYT+M
Sbjct  561   YVSDERGQLKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTIM  609



>ref|XP_006858861.1| hypothetical protein AMTR_s00066p00191280 [Amborella trichopoda]
 gb|ERN20328.1| hypothetical protein AMTR_s00066p00191280 [Amborella trichopoda]
Length=553

 Score =   527 bits (1357),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/311 (77%), Positives = 287/311 (92%), Gaps = 0/311 (0%)
 Frame = +3

Query  294   FSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGN  473
             FSSE+ RE++E+DVV+VGAGPAGLSAAIRLKQLC+E + DLSVCVVEKGAEVGAHILSGN
Sbjct  9     FSSEASRESLEFDVVVVGAGPAGLSAAIRLKQLCKESDTDLSVCVVEKGAEVGAHILSGN  68

Query  474   VFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVR  653
             VFEPRAL+ELLP+W+++  PI++PVSSDKF  L+++RAFSLP PF+N GNYVISLSQLVR
Sbjct  69    VFEPRALNELLPRWKEDGAPIEIPVSSDKFWFLTQDRAFSLPPPFDNHGNYVISLSQLVR  128

Query  654   WLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRV  833
             W+G KAEELGVE+YPGFAASEILY+ ++ V+G+ TNDMGVA+DGS+KENFQHGVELKGR+
Sbjct  129   WMGTKAEELGVEIYPGFAASEILYDANNRVVGVVTNDMGVARDGSKKENFQHGVELKGRI  188

Query  834   TLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPL  1013
             TLLAEGCRGS+++++I  +KLR K + ++QTYALGIKEVWE+D  KH+PG VLHT+GWPL
Sbjct  189   TLLAEGCRGSISQKIIRDHKLRLKAHAENQTYALGIKEVWEVDDAKHKPGLVLHTLGWPL  248

Query  1014  DHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
             DHKTYGG+FLYHMK+RQV+IGLVVALNY NP+LNPYEEFQKFK HP+IRPLLEGG VLQY
Sbjct  249   DHKTYGGTFLYHMKDRQVSIGLVVALNYQNPYLNPYEEFQKFKQHPSIRPLLEGGNVLQY  308

Query  1194  GARTLNEGGYQ  1226
             GARTLNEGG+Q
Sbjct  309   GARTLNEGGFQ  319


 Score =   388 bits (996),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 200/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKG+HTAMKSGMLAAE+AF++   G+ M+T+WD LR SW+W
Sbjct  325   VFPGGALIGCSAGFLNVPKIKGSHTAMKSGMLAAEAAFNVFHRGAEMDTYWDLLRKSWVW  384

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE GL PGLA+SA+E YI +GR PLT KHGKPDHEA   A +  PI Y
Sbjct  385   EELHRARNYRPAFEYGLIPGLAISALEHYIFRGRLPLTLKHGKPDHEATYVAAAHKPIVY  444

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+LTS+YRSNTNHDHDQP HLRLKDP  P+LVNLP+YAGPESRYCPARVYE
Sbjct  445   PKPDGVVSFDLLTSLYRSNTNHDHDQPVHLRLKDPSIPQLVNLPQYAGPESRYCPARVYE  504

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+ G +KL INAQNCLHCKACDIKDP QNI+W VPEGGGGPGYT+M
Sbjct  505   YVADEKGCMKLQINAQNCLHCKACDIKDPKQNIEWNVPEGGGGPGYTIM  553



>ref|XP_010069282.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Eucalyptus grandis]
Length=602

 Score =   532 bits (1371),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/318 (78%), Positives = 287/318 (90%), Gaps = 1/318 (0%)
 Frame = +3

Query  276   LNGARGFSSESC-REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVG  452
             L GAR F SE+  RE+IEYDVV+VGAGPAGLSAAIRLKQLCRE++ DLSVCVVEKGA+VG
Sbjct  51    LGGARTFGSETGGRESIEYDVVVVGAGPAGLSAAIRLKQLCRERDFDLSVCVVEKGAQVG  110

Query  453   AHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVI  632
             AH+LSGNVFEPRAL+ELLP WR E+ P+DVPVSSDKF  L+K+RAF+LP PF+N+GNYVI
Sbjct  111   AHVLSGNVFEPRALNELLPDWRNEEAPVDVPVSSDKFWYLTKDRAFALPCPFDNRGNYVI  170

Query  633   SLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHG  812
             SLSQL  W+G KAEELGVE+YPGFAA E+LY+ +D V+GI TNDMG++KDGS+KE FQHG
Sbjct  171   SLSQLTWWMGVKAEELGVEIYPGFAAGEVLYDSNDNVVGIGTNDMGISKDGSKKETFQHG  230

Query  813   VELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVL  992
             VELKG++TLLAEGCRGSL+E++I K+ LR K   Q+QTYALGIKEVWEID NKH PG VL
Sbjct  231   VELKGKLTLLAEGCRGSLSEKIISKFNLRRKVQAQNQTYALGIKEVWEIDENKHEPGAVL  290

Query  993   HTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLE  1172
             HT+GWPLDHKTYGGSFLYHMK+RQV+IGLV+ALNY NP+LNPYEEFQKFKHHPAI+ LLE
Sbjct  291   HTLGWPLDHKTYGGSFLYHMKDRQVSIGLVIALNYQNPYLNPYEEFQKFKHHPAIKSLLE  350

Query  1173  GGTVLQYGARTLNEGGYQ  1226
             GGTV+QYGARTLNEGG+Q
Sbjct  351   GGTVIQYGARTLNEGGFQ  368


 Score =   382 bits (980),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +L  GS+ME +WD LR SWIW
Sbjct  374   VFPGGAIVGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFSVLSEGSSMEVYWDFLRKSWIW  433

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KEL  +RNYRPAF+ GL PGLA+  +E Y+ KGR P T KHGKPDHEA N AK   PIEY
Sbjct  434   KELKKSRNYRPAFDYGLLPGLAICGLEHYLFKGRLPFTLKHGKPDHEATNVAKLHTPIEY  493

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             P+ +G +SFD+ TS++RSNTNH+HDQPAHLRL+DP  PE VNLP+YAGPESRYCPARVYE
Sbjct  494   PRAEGILSFDVPTSLHRSNTNHEHDQPAHLRLRDPTIPESVNLPEYAGPESRYCPARVYE  553

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ GE+KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  554   YVPDEKGELKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  602



>ref|XP_007150442.1| hypothetical protein PHAVU_005G153800g [Phaseolus vulgaris]
 gb|ESW22436.1| hypothetical protein PHAVU_005G153800g [Phaseolus vulgaris]
Length=622

 Score =   539 bits (1388),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/381 (69%), Positives = 306/381 (80%), Gaps = 17/381 (4%)
 Frame = +3

Query  87    GTTIQHRFYTHATIVHLSQLKTMLKFILSSAKSKLSTTPINRFSSFPNPCGKASRFGAES  266
              TT     +TH T +H           L S +  L+ +    FS+ P          A S
Sbjct  24    ATTTSQCLHTHITTLHTPNANNSHN--LFSPRYSLAFS----FSTPP----------ARS  67

Query  267   GYSLNGARGFSSESC-REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGA  443
                +  +R F + S  RE IEYDVVIVGAGPAGLSAAIRLKQ+CRE+NADL+VCV++KGA
Sbjct  68    SSRVPTSRTFCTASSERETIEYDVVIVGAGPAGLSAAIRLKQMCRERNADLTVCVLDKGA  127

Query  444   EVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGN  623
             EVGAHI+SGNVFEPRAL+ELLPQW++++ PI  PVSSDKF  L+K  A SLPSPF NKGN
Sbjct  128   EVGAHIISGNVFEPRALNELLPQWKEQEAPITTPVSSDKFWFLTKGSAISLPSPFSNKGN  187

Query  624   YVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENF  803
             YVISLSQLVRW+G KAEELGVE+YPGFAA+EILY+ +D+VIGI TNDMG+AKDGS+KENF
Sbjct  188   YVISLSQLVRWMGAKAEELGVEIYPGFAANEILYDANDKVIGIGTNDMGIAKDGSKKENF  247

Query  804   QHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPG  983
             Q GVE+KGR+TLLAEGCRGSL+E+++ KY LREKG  +HQTYALGIKEVWEID  KH+PG
Sbjct  248   QRGVEIKGRITLLAEGCRGSLSEKIMKKYNLREKGGAEHQTYALGIKEVWEIDEEKHQPG  307

Query  984   DVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRP  1163
              V+HT+GWPLDHKTYGGSFLYHMK+ Q++IGLVVALNY NPFLNPYEEFQK KHHPAI+P
Sbjct  308   AVIHTLGWPLDHKTYGGSFLYHMKDNQISIGLVVALNYQNPFLNPYEEFQKLKHHPAIKP  367

Query  1164  LLEGGTVLQYGARTLNEGGYQ  1226
              LEGGTV+QYGARTLNEGG+Q
Sbjct  368   FLEGGTVIQYGARTLNEGGFQ  388


 Score =   375 bits (963),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 194/229 (85%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGF+NVPKIKGTHTAMKSGMLAAE  F  L  G +M+T+WD LR+SWIW
Sbjct  394   VFPGGAIIGCSAGFMNVPKIKGTHTAMKSGMLAAEVTFSALNEGVDMDTYWDALRNSWIW  453

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ +RNYRPAFE GL PGLALS +E YI KGR   T KHGKPDHEA N A+   PI Y
Sbjct  454   EELHKSRNYRPAFEYGLIPGLALSGLEHYIFKGRHSFTLKHGKPDHEATNAARFHSPIHY  513

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PK DG +SFD+ +S++RSNTNH+HDQP HLRL+DPK+PEL+NLP YA PESRYCPARVYE
Sbjct  514   PKADGVLSFDVPSSLHRSNTNHEHDQPPHLRLRDPKSPELINLPVYAAPESRYCPARVYE  573

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y +D+  ++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  574   YAADEKNQMKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  622



>ref|XP_010527997.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X2 [Tarenaya hassleriana]
Length=651

 Score =   543 bits (1399),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/333 (77%), Positives = 292/333 (88%), Gaps = 3/333 (1%)
 Frame = +3

Query  237   GKASRFGAESGYSLNGA---RGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKN  407
             G  ++      + LNG+   R  S+ S RE+IEYDVVIVGAGPAGLSAAIRLKQLC+EKN
Sbjct  85    GYWTKVNNSRNFGLNGSGSVRNLSNGSGRESIEYDVVIVGAGPAGLSAAIRLKQLCQEKN  144

Query  408   ADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA  587
             ADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQE+ PI VP SSDKF  L+K+RA
Sbjct  145   ADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEQAPIQVPASSDKFWFLTKDRA  204

Query  588   FSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDM  767
              SLPSPF+N+GNYVISLSQL RWLG KAEELG E+YPGFAASE+L++ +D V+GI T DM
Sbjct  205   LSLPSPFDNRGNYVISLSQLARWLGGKAEELGTEIYPGFAASEVLFDANDNVVGIGTKDM  264

Query  768   GVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKE  947
             G+AKDGS+KENFQ GV +KGRVTL+AEGCRGSL+E++I KYKLRE+ + QHQTYALGIKE
Sbjct  265   GIAKDGSKKENFQPGVNIKGRVTLIAEGCRGSLSEKIIKKYKLREEVHAQHQTYALGIKE  324

Query  948   VWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEE  1127
             VWE+D NKH+PG+VLHT+GWPLD KTYGGSF+YHM +RQVAIG VVALNYHNPFLNPYEE
Sbjct  325   VWEVDENKHKPGEVLHTLGWPLDQKTYGGSFMYHMSDRQVAIGFVVALNYHNPFLNPYEE  384

Query  1128  FQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             FQK KHHPAI+  LEGG+VLQYGARTLNEGG+Q
Sbjct  385   FQKLKHHPAIKATLEGGSVLQYGARTLNEGGFQ  417


 Score =   369 bits (948),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  +  G NM T+WDNLR+SW+W
Sbjct  423   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFSAIHEGLNMNTYWDNLRNSWVW  482

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA E Y+L+G++P T KHGKPDHEA N A+   PIEY
Sbjct  483   KELYAARNYRPAFEYGLLPGLAISAAEHYLLRGKAPFTLKHGKPDHEATNLARLHTPIEY  542

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+  S+YRSNTNHDHDQP+HLRL+DPK PE VNLP YA PESRYCPARVYE
Sbjct  543   PKPDGLLSFDMANSLYRSNTNHDHDQPSHLRLRDPKIPENVNLPDYAAPESRYCPARVYE  602

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+ G+ +L+INAQNCLHCKACDIKDP QNI+WTVP GGGGP Y++M
Sbjct  603   YVADEEGKPRLHINAQNCLHCKACDIKDPKQNIEWTVPGGGGGPSYSLM  651



>gb|KDP43883.1| hypothetical protein JCGZ_20893 [Jatropha curcas]
Length=536

 Score =   534 bits (1376),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 250/302 (83%), Positives = 280/302 (93%), Gaps = 0/302 (0%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVGAGPAGLSAAIR KQLCREK ADLSVCV+EKGAEVGAHI+SGNVFEPRALDE
Sbjct  1     MEYDVVIVGAGPAGLSAAIRFKQLCREKGADLSVCVLEKGAEVGAHIISGNVFEPRALDE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEEL  680
             LLPQW+QE+ P+ VP SSDKF  L+K+RA+SLPSPF+NKGNYVISLSQLVRW+G KAEE 
Sbjct  61    LLPQWKQEEAPVTVPASSDKFWFLTKDRAYSLPSPFDNKGNYVISLSQLVRWMGVKAEEF  120

Query  681   GVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRG  860
             GVE+YPGFAASE+LY+ +D VIGIATNDMG+AKDGS+KENFQ GVELKGRV LLAEGCRG
Sbjct  121   GVEIYPGFAASEVLYDANDSVIGIATNDMGIAKDGSKKENFQRGVELKGRVILLAEGCRG  180

Query  861   SLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSF  1040
             SL+E++I KYKLREK N QHQTYALGIKEVWEID +KH+PG +LHT+GWPLD KTYGGSF
Sbjct  181   SLSEKLIRKYKLREKVNAQHQTYALGIKEVWEIDESKHKPGAILHTLGWPLDRKTYGGSF  240

Query  1041  LYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGG  1220
             LYHMK+RQV+IGLVVALNY NP+L+PYEEFQK KHHPAI+PLLEGGTV+QYGARTLNEGG
Sbjct  241   LYHMKDRQVSIGLVVALNYRNPYLSPYEEFQKLKHHPAIKPLLEGGTVIQYGARTLNEGG  300

Query  1221  YQ  1226
              Q
Sbjct  301   IQ  302


 Score =   377 bits (967),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGF+NVPKIKGTHTAMKSGMLAAE+AF  L  GSN+E +W+ LR+SWIW
Sbjct  308   VFPGGAIIGCSAGFINVPKIKGTHTAMKSGMLAAEAAFGTLHEGSNLELYWETLRNSWIW  367

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE GL PG+A+SA+E YILKG+S  T KHGKPDHE+ + A+    IEY
Sbjct  368   EELHKARNYRPAFEYGLIPGMAISALEHYILKGKSQFTLKHGKPDHESTDLAQLHSAIEY  427

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFDI TS++RSNTNH+HDQPAHL L++P  PELVN P+YAGPESRYCPARVYE
Sbjct  428   PKPDGVLSFDIPTSLHRSNTNHEHDQPAHLLLRNPTIPELVNWPEYAGPESRYCPARVYE  487

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+SDD    KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  488   YVSDDQTPPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  536



>ref|XP_010527913.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Tarenaya hassleriana]
Length=661

 Score =   542 bits (1397),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/333 (77%), Positives = 292/333 (88%), Gaps = 3/333 (1%)
 Frame = +3

Query  237   GKASRFGAESGYSLNGA---RGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKN  407
             G  ++      + LNG+   R  S+ S RE+IEYDVVIVGAGPAGLSAAIRLKQLC+EKN
Sbjct  85    GYWTKVNNSRNFGLNGSGSVRNLSNGSGRESIEYDVVIVGAGPAGLSAAIRLKQLCQEKN  144

Query  408   ADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA  587
             ADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQE+ PI VP SSDKF  L+K+RA
Sbjct  145   ADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEQAPIQVPASSDKFWFLTKDRA  204

Query  588   FSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDM  767
              SLPSPF+N+GNYVISLSQL RWLG KAEELG E+YPGFAASE+L++ +D V+GI T DM
Sbjct  205   LSLPSPFDNRGNYVISLSQLARWLGGKAEELGTEIYPGFAASEVLFDANDNVVGIGTKDM  264

Query  768   GVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKE  947
             G+AKDGS+KENFQ GV +KGRVTL+AEGCRGSL+E++I KYKLRE+ + QHQTYALGIKE
Sbjct  265   GIAKDGSKKENFQPGVNIKGRVTLIAEGCRGSLSEKIIKKYKLREEVHAQHQTYALGIKE  324

Query  948   VWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEE  1127
             VWE+D NKH+PG+VLHT+GWPLD KTYGGSF+YHM +RQVAIG VVALNYHNPFLNPYEE
Sbjct  325   VWEVDENKHKPGEVLHTLGWPLDQKTYGGSFMYHMSDRQVAIGFVVALNYHNPFLNPYEE  384

Query  1128  FQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             FQK KHHPAI+  LEGG+VLQYGARTLNEGG+Q
Sbjct  385   FQKLKHHPAIKATLEGGSVLQYGARTLNEGGFQ  417


 Score =   367 bits (943),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  +  G NM T+WDNLR+SW+W
Sbjct  423   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFSAIHEGLNMNTYWDNLRNSWVW  482

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KELY ARNYRPAFE GL PGLA+SA E Y+L+G++P T KHGKPDHEA N A+   PIEY
Sbjct  483   KELYAARNYRPAFEYGLLPGLAISAAEHYLLRGKAPFTLKHGKPDHEATNLARLHTPIEY  542

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+  S+YRSNTNHDHDQP+HLRL+DPK PE VNLP YA PESRYCPARVYE
Sbjct  543   PKPDGLLSFDMANSLYRSNTNHDHDQPSHLRLRDPKIPENVNLPDYAAPESRYCPARVYE  602

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+ G+ +L+INAQNCLHCKACDIKDP QNI+WTVP GGGGP Y+++
Sbjct  603   YVADEEGKPRLHINAQNCLHCKACDIKDPKQNIEWTVPGGGGGPSYSLI  651



>ref|XP_010933769.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X2 [Elaeis guineensis]
Length=627

 Score =   527 bits (1357),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/345 (74%), Positives = 293/345 (85%), Gaps = 9/345 (3%)
 Frame = +3

Query  219   SFPNPCGKA--SRFGAESG------YSLNGARGFSSESC-REAIEYDVVIVGAGPAGLSA  371
             S P P  ++  SRF   S       +S  G R FS ES  REA+ YDVVIVGAGPAGLSA
Sbjct  49    SVPTPPNRSPLSRFHLVSTNLSSLIHSTGGTRRFSGESGGREALHYDVVIVGAGPAGLSA  108

Query  372   AIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVS  551
             AIRLKQLCR +N DLSVCV+EKG+EVGAHI+SGNVFEPRALDEL+P WR E  PI+VPVS
Sbjct  109   AIRLKQLCRARNTDLSVCVLEKGSEVGAHIISGNVFEPRALDELIPCWRDEGAPIEVPVS  168

Query  552   SDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNE  731
              DKF LL++NRA SLPSPF+NKGNYVISLSQLVRW+  KAEELGVE+YPGFAASEILY+E
Sbjct  169   HDKFWLLTENRALSLPSPFDNKGNYVISLSQLVRWMATKAEELGVEIYPGFAASEILYDE  228

Query  732   SDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGN  911
              D+V+G+ATNDMGVAKDGS+KE FQ GVELKG +TLLAEGCRGSL+E++I  YKLR+KG 
Sbjct  229   DDKVVGVATNDMGVAKDGSKKETFQRGVELKGHITLLAEGCRGSLSEKIIRDYKLRDKGQ  288

Query  912   GQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVAL  1091
             GQHQTYA+GIKEVWEI+  KH PG VLHT+GWPLD KTYGGSFLYHM  RQ++IGLV+AL
Sbjct  289   GQHQTYAIGIKEVWEIEEGKHVPGTVLHTVGWPLDMKTYGGSFLYHMNNRQISIGLVIAL  348

Query  1092  NYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             NY NP+L+P++EFQK KHHPAI+ LLEGG+VLQYGARTLNEGG+Q
Sbjct  349   NYRNPYLSPFDEFQKLKHHPAIKSLLEGGSVLQYGARTLNEGGFQ  393


 Score =   383 bits (984),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAG++NVPKIKGTHTAMKSGMLAAE+AF++L GG+ ME +WD+L+ SWIW
Sbjct  399   VFPGGAIIGCSAGYINVPKIKGTHTAMKSGMLAAEAAFNVLDGGAQMEMYWDSLKRSWIW  458

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAFE GL PGLA SA+ERY+ +GR PLT KHGKPDHEA + A    PI+Y
Sbjct  459   EELYRSRNYRPAFEYGLIPGLAFSALERYVFRGRLPLTLKHGKPDHEATDIAGVHTPIQY  518

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             P+PDG +SFD+ TS+YRSNTNH+HDQPAHLRL+DP  PE VNLP YAGPESRYCPARVYE
Sbjct  519   PRPDGRVSFDVPTSLYRSNTNHEHDQPAHLRLRDPTIPERVNLPLYAGPESRYCPARVYE  578

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTV  1909
             Y+ D+   +KL+INAQNCLHCKACD+KDP QNI+WTVPEGGGGPGYT+
Sbjct  579   YVPDEKHGMKLHINAQNCLHCKACDVKDPKQNIEWTVPEGGGGPGYTI  626



>ref|XP_004160647.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like [Cucumis sativus]
Length=668

 Score =   525 bits (1352),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 250/326 (77%), Positives = 285/326 (87%), Gaps = 9/326 (3%)
 Frame = +3

Query  276   LNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGA  455
             LN  R FSS + RE+IEYDVVI+GAGPAGLSAAIRLKQ+C+EK  DLSVCVVEKGAEVGA
Sbjct  109   LNMVRRFSSGAERESIEYDVVIIGAGPAGLSAAIRLKQMCQEKGVDLSVCVVEKGAEVGA  168

Query  456   HILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVIS  635
             HILSGNVFEPRALDEL+P W++++ PI+VPV+SDKF  L+KNRAFSLP PF N+GNYVIS
Sbjct  169   HILSGNVFEPRALDELIPTWKEDEAPINVPVTSDKFWFLTKNRAFSLPCPFNNEGNYVIS  228

Query  636   LSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGV  815
             LSQLVRW+G KAEELGVE+YPGFAASE+LY+ +D VIGI TNDMGVAKDGS+K+N+Q GV
Sbjct  229   LSQLVRWMGMKAEELGVEIYPGFAASEVLYDTTDAVIGIRTNDMGVAKDGSKKDNYQLGV  288

Query  816   ELKGRVTLLAEGCRGSLAE---------QVIGKYKLREKGNGQHQTYALGIKEVWEIDAN  968
             EL+GR+TLLAEGCRGS++E         ++  KY LR+K N QHQTYALGIKEVWEID  
Sbjct  289   ELRGRITLLAEGCRGSISEVSRIICFCLKINKKYSLRKKVNAQHQTYALGIKEVWEIDEG  348

Query  969   KHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHH  1148
             KH PG VLHT+GWPLD KTYGGSFLYHMK+RQ++IGLVVALNY NPFLNPYEEFQK KHH
Sbjct  349   KHDPGAVLHTLGWPLDRKTYGGSFLYHMKDRQISIGLVVALNYQNPFLNPYEEFQKLKHH  408

Query  1149  PAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             PAI+ LLEGGTV+QYGARTLNEGG Q
Sbjct  409   PAIKDLLEGGTVVQYGARTLNEGGLQ  434


 Score =   382 bits (981),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L   S M+ +WD+L+SSWIW
Sbjct  440   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFATLHRASKMDVYWDSLQSSWIW  499

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE+GL PGL +SA+E Y+LKGRSPLT KHGKPDHEA N A    PI+Y
Sbjct  500   EELYRARNYRPAFEHGLIPGLTISALEHYVLKGRSPLTLKHGKPDHEATNVASLHTPIDY  559

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPD  +SFD+ TS++RSNTNH+HDQPAHLRL+D + PE VNL +YA PESRYCPARVYE
Sbjct  560   PKPDNLLSFDVPTSLHRSNTNHEHDQPAHLRLRDARIPEEVNLKEYAAPESRYCPARVYE  619

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+N ++KL INAQNCLHCKACDIKDP QNI+W+VPEGGGGPGY+VM
Sbjct  620   YIPDENDQMKLQINAQNCLHCKACDIKDPKQNIEWSVPEGGGGPGYSVM  668



>ref|XP_004486906.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform X6 [Cicer arietinum]
Length=603

 Score =   525 bits (1351),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/330 (74%), Positives = 286/330 (87%), Gaps = 16/330 (5%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
             +  F +   R++IEYDVV+VGAGPAGLSAAIRLKQLCRE + DLSVCV+EKGAEVGAHI+
Sbjct  40    SHNFCTTPNRDSIEYDVVVVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGAEVGAHIV  99

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRAL+ELLPQW+Q++ PI+ PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQ
Sbjct  100   SGNVFEPRALNELLPQWKQQEAPINTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQ  159

Query  645   LVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK  824
             LVRW+G KAEELGVE+YPGFAASEILY+ +++VIGI TNDMG++KDGS+KE FQ GVE+K
Sbjct  160   LVRWMGAKAEELGVEIYPGFAASEILYDANNKVIGIGTNDMGISKDGSKKETFQRGVEVK  219

Query  825   GRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIG  1004
             GR+TLLAEGCRGSL+E+++ +Y LREKG  +HQTYALGIKEVWEID  KH+PG VLHT+G
Sbjct  220   GRLTLLAEGCRGSLSEKIMKQYNLREKGGAEHQTYALGIKEVWEIDEEKHQPGAVLHTLG  279

Query  1005  WPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEF----------------QK  1136
             WPLDHKTYGGSFLYHMK+RQ+++GLVVALNY NPF+NPYEEF                QK
Sbjct  280   WPLDHKTYGGSFLYHMKDRQISLGLVVALNYQNPFMNPYEEFQFFILPTLSPVSRLVDQK  339

Query  1137  FKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
              KHHPAI+P LEGGTV+QYGARTLNEGG+Q
Sbjct  340   LKHHPAIKPFLEGGTVIQYGARTLNEGGFQ  369


 Score =   382 bits (980),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGM+AAE+AF +L  G +M T+WD LR+SWIW
Sbjct  375   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMVAAEAAFGVLNEGLDMNTYWDALRNSWIW  434

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAFE GL PGLA S +E YILKGR P+T KHGKPDHEA N A+   PI Y
Sbjct  435   EELYKSRNYRPAFEYGLIPGLAFSGLEHYILKGRHPITLKHGKPDHEATNPARLHSPIHY  494

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PK DG +SFD+ TS++RSNTNH+HDQP HLRL+DPK PEL NLP YA PESRYCPARVYE
Sbjct  495   PKADGVLSFDVPTSLHRSNTNHEHDQPPHLRLRDPKIPELTNLPVYAAPESRYCPARVYE  554

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+  ++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  555   YVADEQNQLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  603



>ref|XP_010933768.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Elaeis guineensis]
Length=634

 Score =   526 bits (1356),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/345 (74%), Positives = 293/345 (85%), Gaps = 9/345 (3%)
 Frame = +3

Query  219   SFPNPCGKA--SRFGAESG------YSLNGARGFSSESC-REAIEYDVVIVGAGPAGLSA  371
             S P P  ++  SRF   S       +S  G R FS ES  REA+ YDVVIVGAGPAGLSA
Sbjct  49    SVPTPPNRSPLSRFHLVSTNLSSLIHSTGGTRRFSGESGGREALHYDVVIVGAGPAGLSA  108

Query  372   AIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVS  551
             AIRLKQLCR +N DLSVCV+EKG+EVGAHI+SGNVFEPRALDEL+P WR E  PI+VPVS
Sbjct  109   AIRLKQLCRARNTDLSVCVLEKGSEVGAHIISGNVFEPRALDELIPCWRDEGAPIEVPVS  168

Query  552   SDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNE  731
              DKF LL++NRA SLPSPF+NKGNYVISLSQLVRW+  KAEELGVE+YPGFAASEILY+E
Sbjct  169   HDKFWLLTENRALSLPSPFDNKGNYVISLSQLVRWMATKAEELGVEIYPGFAASEILYDE  228

Query  732   SDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGN  911
              D+V+G+ATNDMGVAKDGS+KE FQ GVELKG +TLLAEGCRGSL+E++I  YKLR+KG 
Sbjct  229   DDKVVGVATNDMGVAKDGSKKETFQRGVELKGHITLLAEGCRGSLSEKIIRDYKLRDKGQ  288

Query  912   GQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVAL  1091
             GQHQTYA+GIKEVWEI+  KH PG VLHT+GWPLD KTYGGSFLYHM  RQ++IGLV+AL
Sbjct  289   GQHQTYAIGIKEVWEIEEGKHVPGTVLHTVGWPLDMKTYGGSFLYHMNNRQISIGLVIAL  348

Query  1092  NYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             NY NP+L+P++EFQK KHHPAI+ LLEGG+VLQYGARTLNEGG+Q
Sbjct  349   NYRNPYLSPFDEFQKLKHHPAIKSLLEGGSVLQYGARTLNEGGFQ  393


 Score =   377 bits (969),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAG++NVPKIKGTHTAMKSGMLAAE+AF++L GG+ ME +WD+L+ SWIW
Sbjct  399   VFPGGAIIGCSAGYINVPKIKGTHTAMKSGMLAAEAAFNVLDGGAQMEMYWDSLKRSWIW  458

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAFE GL PGLA SA+ERY+ +GR PLT KHGKPDHEA + A    PI+Y
Sbjct  459   EELYRSRNYRPAFEYGLIPGLAFSALERYVFRGRLPLTLKHGKPDHEATDIAGVHTPIQY  518

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             P+PDG +SFD+ TS+YRSNTNH+HDQPAHLRL+DP  PE VNLP YAGPESRYCPARVYE
Sbjct  519   PRPDGRVSFDVPTSLYRSNTNHEHDQPAHLRLRDPTIPERVNLPLYAGPESRYCPARVYE  578

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPG  1900
             Y+ D+   +KL+INAQNCLHCKACD+KDP QNI+WTVPEGGGGPG
Sbjct  579   YVPDEKHGMKLHINAQNCLHCKACDVKDPKQNIEWTVPEGGGGPG  623



>ref|XP_004486905.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform X5 [Cicer arietinum]
Length=613

 Score =   520 bits (1339),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/340 (72%), Positives = 286/340 (84%), Gaps = 26/340 (8%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
             +  F +   R++IEYDVV+VGAGPAGLSAAIRLKQLCRE + DLSVCV+EKGAEVGAHI+
Sbjct  40    SHNFCTTPNRDSIEYDVVVVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGAEVGAHIV  99

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRAL+ELLPQW+Q++ PI+ PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQ
Sbjct  100   SGNVFEPRALNELLPQWKQQEAPINTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQ  159

Query  645   LVRWLGQKAEELGVELYPGFAASE--------------------------ILYNESDEVI  746
             LVRW+G KAEELGVE+YPGFAASE                          ILY+ +++VI
Sbjct  160   LVRWMGAKAEELGVEIYPGFAASEVFPIFRICLNVTTLYLLLFTGVFPCQILYDANNKVI  219

Query  747   GIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQT  926
             GI TNDMG++KDGS+KE FQ GVE+KGR+TLLAEGCRGSL+E+++ +Y LREKG  +HQT
Sbjct  220   GIGTNDMGISKDGSKKETFQRGVEVKGRLTLLAEGCRGSLSEKIMKQYNLREKGGAEHQT  279

Query  927   YALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNP  1106
             YALGIKEVWEID  KH+PG VLHT+GWPLDHKTYGGSFLYHMK+RQ+++GLVVALNY NP
Sbjct  280   YALGIKEVWEIDEEKHQPGAVLHTLGWPLDHKTYGGSFLYHMKDRQISLGLVVALNYQNP  339

Query  1107  FLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             F+NPYEEFQK KHHPAI+P LEGGTV+QYGARTLNEGG+Q
Sbjct  340   FMNPYEEFQKLKHHPAIKPFLEGGTVIQYGARTLNEGGFQ  379


 Score =   381 bits (979),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGM+AAE+AF +L  G +M T+WD LR+SWIW
Sbjct  385   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMVAAEAAFGVLNEGLDMNTYWDALRNSWIW  444

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAFE GL PGLA S +E YILKGR P+T KHGKPDHEA N A+   PI Y
Sbjct  445   EELYKSRNYRPAFEYGLIPGLAFSGLEHYILKGRHPITLKHGKPDHEATNPARLHSPIHY  504

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PK DG +SFD+ TS++RSNTNH+HDQP HLRL+DPK PEL NLP YA PESRYCPARVYE
Sbjct  505   PKADGVLSFDVPTSLHRSNTNHEHDQPPHLRLRDPKIPELTNLPVYAAPESRYCPARVYE  564

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+  ++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  565   YVADEQNQLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  613



>gb|KCW57577.1| hypothetical protein EUGRSUZ_H00345 [Eucalyptus grandis]
Length=536

 Score =   517 bits (1332),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/302 (78%), Positives = 275/302 (91%), Gaps = 0/302 (0%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             + YDVV+VGAGPAGLSAAIRLKQLCRE++ DLSVCVVEKGA+VGAH+LSGNVFEPRAL+E
Sbjct  1     MRYDVVVVGAGPAGLSAAIRLKQLCRERDFDLSVCVVEKGAQVGAHVLSGNVFEPRALNE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEEL  680
             LLP WR E+ P+DVPVSSDKF  L+K+RAF+LP PF+N+GNYVISLSQL  W+G KAEEL
Sbjct  61    LLPDWRNEEAPVDVPVSSDKFWYLTKDRAFALPCPFDNRGNYVISLSQLTWWMGVKAEEL  120

Query  681   GVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRG  860
             GVE+YPGFAA E+LY+ +D V+GI TNDMG++KDGS+KE FQHGVELKG++TLLAEGCRG
Sbjct  121   GVEIYPGFAAGEVLYDSNDNVVGIGTNDMGISKDGSKKETFQHGVELKGKLTLLAEGCRG  180

Query  861   SLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSF  1040
             SL+E++I K+ LR K   Q+QTYALGIKEVWEID NKH PG VLHT+GWPLDHKTYGGSF
Sbjct  181   SLSEKIISKFNLRRKVQAQNQTYALGIKEVWEIDENKHEPGAVLHTLGWPLDHKTYGGSF  240

Query  1041  LYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGG  1220
             LYHMK+RQV+IGLV+ALNY NP+LNPYEEFQKFKHHPAI+ LLEGGTV+QYGARTLNEGG
Sbjct  241   LYHMKDRQVSIGLVIALNYQNPYLNPYEEFQKFKHHPAIKSLLEGGTVIQYGARTLNEGG  300

Query  1221  YQ  1226
             +Q
Sbjct  301   FQ  302


 Score =   382 bits (982),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +L  GS+ME +WD LR SWIW
Sbjct  308   VFPGGAIVGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFSVLSEGSSMEVYWDFLRKSWIW  367

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KEL  +RNYRPAF+ GL PGLA+  +E Y+ KGR P T KHGKPDHEA N AK   PIEY
Sbjct  368   KELKKSRNYRPAFDYGLLPGLAICGLEHYLFKGRLPFTLKHGKPDHEATNVAKLHTPIEY  427

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             P+ +G +SFD+ TS++RSNTNH+HDQPAHLRL+DP  PE VNLP+YAGPESRYCPARVYE
Sbjct  428   PRAEGILSFDVPTSLHRSNTNHEHDQPAHLRLRDPTIPESVNLPEYAGPESRYCPARVYE  487

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ D+ GE+KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  488   YVPDEKGELKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  536



>ref|XP_004486902.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform X2 [Cicer arietinum]
Length=653

 Score =   521 bits (1341),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/340 (72%), Positives = 286/340 (84%), Gaps = 26/340 (8%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
             +  F +   R++IEYDVV+VGAGPAGLSAAIRLKQLCRE + DLSVCV+EKGAEVGAHI+
Sbjct  40    SHNFCTTPNRDSIEYDVVVVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGAEVGAHIV  99

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRAL+ELLPQW+Q++ PI+ PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQ
Sbjct  100   SGNVFEPRALNELLPQWKQQEAPINTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQ  159

Query  645   LVRWLGQKAEELGVELYPGFAASE--------------------------ILYNESDEVI  746
             LVRW+G KAEELGVE+YPGFAASE                          ILY+ +++VI
Sbjct  160   LVRWMGAKAEELGVEIYPGFAASEVFPIFRICLNVTTLYLLLFTGVFPCQILYDANNKVI  219

Query  747   GIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQT  926
             GI TNDMG++KDGS+KE FQ GVE+KGR+TLLAEGCRGSL+E+++ +Y LREKG  +HQT
Sbjct  220   GIGTNDMGISKDGSKKETFQRGVEVKGRLTLLAEGCRGSLSEKIMKQYNLREKGGAEHQT  279

Query  927   YALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNP  1106
             YALGIKEVWEID  KH+PG VLHT+GWPLDHKTYGGSFLYHMK+RQ+++GLVVALNY NP
Sbjct  280   YALGIKEVWEIDEEKHQPGAVLHTLGWPLDHKTYGGSFLYHMKDRQISLGLVVALNYQNP  339

Query  1107  FLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             F+NPYEEFQK KHHPAI+P LEGGTV+QYGARTLNEGG+Q
Sbjct  340   FMNPYEEFQKLKHHPAIKPFLEGGTVIQYGARTLNEGGFQ  379


 Score =   362 bits (928),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/269 (64%), Positives = 198/269 (74%), Gaps = 40/269 (15%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGM+AAE+AF +L  G +M T+WD LR+SWIW
Sbjct  385   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMVAAEAAFGVLNEGLDMNTYWDALRNSWIW  444

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERY-------------------------------  1492
             +ELY +RNYRPAFE GL PGLA S +E+Y                               
Sbjct  445   EELYKSRNYRPAFEYGLIPGLAFSGLEQYDLIFLMDFIFFTSNWRVLFSVLPLFLSWNFT  504

Query  1493  ---------ILKGRSPLTFKHGKPDHEAINEAKSSLPIEYPKPDGAISFDILTSVYRSNT  1645
                      ILKGR P+T KHGKPDHEA N A+   PI YPK DG +SFD+ TS++RSNT
Sbjct  505   YPCVFPVSYILKGRHPITLKHGKPDHEATNPARLHSPIHYPKADGVLSFDVPTSLHRSNT  564

Query  1646  NHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYEYISDDNGEVKLNINAQNCLH  1825
             NH+HDQP HLRL+DPK PEL NLP YA PESRYCPARVYEY++D+  ++KL INAQNCLH
Sbjct  565   NHEHDQPPHLRLRDPKIPELTNLPVYAAPESRYCPARVYEYVADEQNQLKLQINAQNCLH  624

Query  1826  CKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             CKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  625   CKACDIKDPKQNIEWTVPEGGGGPGYSVM  653



>ref|XP_004309804.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform 2 [Fragaria vesca subsp. 
vesca]
Length=549

 Score =   541 bits (1394),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +3

Query  288   RGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILS  467
             R F SE  R++I+YDVVIVGAGPAGLSAAIRLKQLCRE + DLSVCVVEKGAE+GAHILS
Sbjct  29    RTFCSEPQRDSIQYDVVIVGAGPAGLSAAIRLKQLCRENDTDLSVCVVEKGAELGAHILS  88

Query  468   GNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQL  647
             GNVFEPRALDELLP W+QE++PI VPVSSDKF  L+KN AF LP PF N+GNYVISLSQL
Sbjct  89    GNVFEPRALDELLPNWKQEESPITVPVSSDKFWFLTKNHAFPLPCPFNNRGNYVISLSQL  148

Query  648   VRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKG  827
             VRW+G KAEELGVE+YPGFAASEILY+ +D V+GI TNDMG++KDGS+KENFQ G+ELKG
Sbjct  149   VRWMGVKAEELGVEIYPGFAASEILYDSNDTVVGIRTNDMGISKDGSKKENFQPGIELKG  208

Query  828   RVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGW  1007
             RVTLLAEGCRGSL+E ++ KY LR KG+ QHQTYALGIKEVWEID  KH+PG V+HT+GW
Sbjct  209   RVTLLAEGCRGSLSENIMDKYNLRAKGHAQHQTYALGIKEVWEIDKEKHKPGAVIHTLGW  268

Query  1008  PLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVL  1187
             PLD KTYGGSFLYHMK+RQ+ IGLVVALNY NPFL+PYEEFQKFKHHPA++PLLEGGTVL
Sbjct  269   PLDQKTYGGSFLYHMKDRQICIGLVVALNYQNPFLSPYEEFQKFKHHPAVKPLLEGGTVL  328

Query  1188  QYGARTLNEGGYQ  1226
             QYGARTLNEGG+Q
Sbjct  329   QYGARTLNEGGFQ  341


 Score =   340 bits (873),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIWK  1408
             FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L+ GSNM+ +WD+LR+SWIW+
Sbjct  348   FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFSALREGSNMDKYWDDLRNSWIWE  407

Query  1409  ELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEYP  1588
             ELY ARNYRPAFE G+ PGLA+SA+ERYI+KGR+ LT KHGKPD+EA N A+   PI+YP
Sbjct  408   ELYRARNYRPAFEYGVIPGLAISALERYIIKGRAALTLKHGKPDNEATNVAEFHSPIKYP  467

Query  1589  KPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYEY  1768
             KPDG +SFDILTS++RSNTNH+HDQPAHLRLKDPK PE+VNLP+YAGPESRYCPARVYEY
Sbjct  468   KPDGVLSFDILTSLHRSNTNHEHDQPAHLRLKDPKKPEVVNLPEYAGPESRYCPARVYEY  527

Query  1769  ISDDNGEVKLNINAQNCLHCK  1831
             +  + G++KL INAQNCLHCK
Sbjct  528   VPGETGQLKLQINAQNCLHCK  548



>ref|XP_004982609.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like [Setaria italica]
Length=582

 Score =   495 bits (1275),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/307 (78%), Positives = 279/307 (91%), Gaps = 0/307 (0%)
 Frame = +3

Query  306   SCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEP  485
             S REA+ YDVVIVGAGPAGL+AAIRLKQLCR  +ADLSVCV+EKG+EVGAH+LSGNVFEP
Sbjct  42    SGREALSYDVVIVGAGPAGLAAAIRLKQLCRAADADLSVCVLEKGSEVGAHVLSGNVFEP  101

Query  486   RALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQ  665
             RALDEL+P+WRQE  PI VPVSSDKF LL+KNRA++LPSPF+NKGNYVISLSQLVRW+  
Sbjct  102   RALDELIPKWRQEDAPIRVPVSSDKFWLLTKNRAWTLPSPFDNKGNYVISLSQLVRWMAT  161

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             KAEELGVE+YPGFAASEILY+E+  V G+ATND+G+AKDG+++E FQ GVEL+GR+TLLA
Sbjct  162   KAEELGVEVYPGFAASEILYDENQIVTGVATNDVGIAKDGTKRETFQPGVELRGRITLLA  221

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL+E++I  +KLRE+G GQHQTYALGIKE+WEI+  KH PG V+HT+GWPLD KT
Sbjct  222   EGCRGSLSEKIIRNHKLRERGQGQHQTYALGIKEIWEIEEGKHEPGSVIHTVGWPLDKKT  281

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+ +RQ+AIGLVVALNY NPFL+PY+EFQKFK HPA+R LLEGGT +QYGART
Sbjct  282   YGGSFLYHLDDRQLAIGLVVALNYRNPFLSPYDEFQKFKQHPAVRKLLEGGTAIQYGART  341

Query  1206  LNEGGYQ  1226
             LNEGG+Q
Sbjct  342   LNEGGFQ  348


 Score =   384 bits (985),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  354   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKALIEGSSMELYWENLKKSWIW  413

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE G  PG+ LSA+ERYI KG++P T KHGKPDHEA + A    PI+Y
Sbjct  414   EELHKARNYRPAFEYGFIPGMGLSALERYIFKGKTPYTLKHGKPDHEATDAANMHAPIQY  473

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG I+FD+ TS+YRSNTNH+HDQP HLRL+DP  PE VNLP YAGPESRYCPARVYE
Sbjct  474   PKPDGQITFDVPTSLYRSNTNHEHDQPPHLRLRDPTLPEKVNLPVYAGPESRYCPARVYE  533

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+SD+ G+ KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  534   YVSDEKGDPKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  582



>sp|Q337B8.1|ETFQO_ORYSJ RecName: Full=Electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial; Short=ETF-QO; Short=ETF-ubiquinone 
oxidoreductase; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABB47884.1| Electron transfer flavoprotein-ubiquinone oxidoreductase,mitochondrial 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
Length=575

 Score =   494 bits (1273),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/305 (77%), Positives = 280/305 (92%), Gaps = 0/305 (0%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA+ YDVV+VGAGPAGL+AAIRLKQLCR+ + DLSVCV+EKG+EVGAH+LSGNVFEPRA
Sbjct  37    REAMSYDVVVVGAGPAGLAAAIRLKQLCRDADTDLSVCVLEKGSEVGAHVLSGNVFEPRA  96

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKA  671
             LDEL+P+WRQE TPI VPVSSDKF LL+KN+A++LPSPF+NKGNYVISLSQ+VRW+  KA
Sbjct  97    LDELIPKWRQEDTPIRVPVSSDKFWLLTKNKAWTLPSPFDNKGNYVISLSQMVRWMASKA  156

Query  672   EELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEG  851
             EELGVE+YPGFAASEILY+E+  V G+ATND+G+AKDGS++E FQ GVEL+GR+TLLAEG
Sbjct  157   EELGVEVYPGFAASEILYDENQIVTGVATNDVGIAKDGSKRETFQPGVELRGRMTLLAEG  216

Query  852   CRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYG  1031
             CRGSL+E++I  +KLRE G GQHQTYALGIKEVWEI+  KH+PG V+HT+GWPLD KTYG
Sbjct  217   CRGSLSEKIIRNHKLRESGQGQHQTYALGIKEVWEIEEGKHKPGSVIHTVGWPLDSKTYG  276

Query  1032  GSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLN  1211
             GSF+YH+ +RQ+AIGLVVALNY NPF++PY+EFQKFK HPA+R +L+GGTVLQYGARTLN
Sbjct  277   GSFMYHLDDRQLAIGLVVALNYQNPFMSPYDEFQKFKQHPAVRTILDGGTVLQYGARTLN  336

Query  1212  EGGYQ  1226
             EGG+Q
Sbjct  337   EGGFQ  341


 Score =   383 bits (984),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  347   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKTLVEGSSMELYWENLKKSWIW  406

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE G  PG+ALSA+ERY+ KG+SP T KHG PDHEA + A    PI+Y
Sbjct  407   EELYRARNYRPAFEYGFIPGIALSALERYVFKGKSPFTLKHGIPDHEATDMASLHSPIQY  466

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG ISFD+ TS+YRS+TNH+HDQP HLRL+DP  PE VNLP YAGPES YCPARVYE
Sbjct  467   PKPDGQISFDVPTSLYRSSTNHEHDQPPHLRLRDPTVPERVNLPLYAGPESHYCPARVYE  526

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+ G+ KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  527   YVTDEKGDQKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  575



>gb|AAK39567.1|AC025296_2 putative electron transfer oxidoreductase [Oryza sativa Japonica 
Group]
Length=536

 Score =   489 bits (1258),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/302 (76%), Positives = 277/302 (92%), Gaps = 0/302 (0%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             + YDVV+VGAGPAGL+AAIRLKQLCR+ + DLSVCV+EKG+EVGAH+LSGNVFEPRALDE
Sbjct  1     MSYDVVVVGAGPAGLAAAIRLKQLCRDADTDLSVCVLEKGSEVGAHVLSGNVFEPRALDE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEEL  680
             L+P+WRQE TPI VPVSSDKF LL+KN+A++LPSPF+NKGNYVISLSQ+VRW+  KAEEL
Sbjct  61    LIPKWRQEDTPIRVPVSSDKFWLLTKNKAWTLPSPFDNKGNYVISLSQMVRWMASKAEEL  120

Query  681   GVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRG  860
             GVE+YPGFAASEILY+E+  V G+ATND+G+AKDGS++E FQ GVEL+GR+TLLAEGCRG
Sbjct  121   GVEVYPGFAASEILYDENQIVTGVATNDVGIAKDGSKRETFQPGVELRGRMTLLAEGCRG  180

Query  861   SLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSF  1040
             SL+E++I  +KLRE G GQHQTYALGIKEVWEI+  KH+PG V+HT+GWPLD KTYGGSF
Sbjct  181   SLSEKIIRNHKLRESGQGQHQTYALGIKEVWEIEEGKHKPGSVIHTVGWPLDSKTYGGSF  240

Query  1041  LYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGG  1220
             +YH+ +RQ+AIGLVVALNY NPF++PY+EFQKFK HPA+R +L+GGTVLQYGARTLNEGG
Sbjct  241   MYHLDDRQLAIGLVVALNYQNPFMSPYDEFQKFKQHPAVRTILDGGTVLQYGARTLNEGG  300

Query  1221  YQ  1226
             +Q
Sbjct  301   FQ  302


 Score =   383 bits (984),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  308   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKTLVEGSSMELYWENLKKSWIW  367

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE G  PG+ALSA+ERY+ KG+SP T KHG PDHEA + A    PI+Y
Sbjct  368   EELYRARNYRPAFEYGFIPGIALSALERYVFKGKSPFTLKHGIPDHEATDMASLHSPIQY  427

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG ISFD+ TS+YRS+TNH+HDQP HLRL+DP  PE VNLP YAGPES YCPARVYE
Sbjct  428   PKPDGQISFDVPTSLYRSSTNHEHDQPPHLRLRDPTVPERVNLPLYAGPESHYCPARVYE  487

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+ G+ KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  488   YVTDEKGDQKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  536



>ref|XP_008673346.1| PREDICTED: uncharacterized protein LOC100280392 isoform X1 [Zea 
mays]
 gb|ACN27884.1| unknown [Zea mays]
 tpg|DAA49303.1| TPA: hypothetical protein ZEAMMB73_777537 [Zea mays]
Length=584

 Score =   493 bits (1268),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/307 (77%), Positives = 279/307 (91%), Gaps = 0/307 (0%)
 Frame = +3

Query  306   SCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEP  485
             S REA+ YDVVIVGAGPAGL+AAIRLKQLCR  + DLSVCV+EKG+EVGAH+LSGNVFEP
Sbjct  44    SGREALSYDVVIVGAGPAGLAAAIRLKQLCRAADTDLSVCVLEKGSEVGAHVLSGNVFEP  103

Query  486   RALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQ  665
             RALDEL+P+WRQE +PI VPVSSDKF LL+KN+A++LPSPF+NKGNYVISLSQLVRW+  
Sbjct  104   RALDELIPKWRQEDSPIRVPVSSDKFWLLTKNQAWTLPSPFDNKGNYVISLSQLVRWMAT  163

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             KAEELGVE+YPGFAASEILY+E+  V G+ATND+G+AKDG+++E FQ GVEL+GR+TLLA
Sbjct  164   KAEELGVEVYPGFAASEILYDENQIVTGVATNDVGIAKDGTKRETFQPGVELRGRITLLA  223

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL+E++I  +KLRE+G GQHQTYALGIKEVWEI+  KH PG V+HT+GWPLD KT
Sbjct  224   EGCRGSLSEKIIRNHKLRERGQGQHQTYALGIKEVWEIEEGKHNPGSVIHTVGWPLDTKT  283

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+ +RQ+AIGLVVALNY NPFL+PY+EFQKFK HPA+R LLEGGT +QYGART
Sbjct  284   YGGSFLYHLDDRQLAIGLVVALNYRNPFLSPYDEFQKFKQHPAVRKLLEGGTAIQYGART  343

Query  1206  LNEGGYQ  1226
             LNEGG+Q
Sbjct  344   LNEGGFQ  350


 Score =   379 bits (974),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             +FPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  356   IFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKSLVEGSSMELYWENLKKSWIW  415

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE GL PG+ LSA+ERYI KG+SP T KHG+PDHEA + A    PI+Y
Sbjct  416   EELHKARNYRPAFEYGLIPGMVLSALERYIFKGKSPYTLKHGRPDHEATDTANLHAPIQY  475

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG I+FD+ TS+YRSNTNH+HDQP HLRL+DP  PE VN+  YA PESRYCPARVYE
Sbjct  476   PKPDGHITFDVPTSLYRSNTNHEHDQPPHLRLRDPTVPERVNVALYAAPESRYCPARVYE  535

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YISD+ G+ KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  536   YISDEKGDPKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  584



>ref|XP_006661958.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like [Oryza brachyantha]
Length=536

 Score =   484 bits (1245),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 233/302 (77%), Positives = 273/302 (90%), Gaps = 0/302 (0%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             + YDVVIVGAGPAGL+AAIRLKQLCR  + DLSVCV+EKG+EVGAH+LSGNVFEPRALDE
Sbjct  1     MSYDVVIVGAGPAGLAAAIRLKQLCRAADTDLSVCVLEKGSEVGAHVLSGNVFEPRALDE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEEL  680
             L+P+WRQ   PI VPVSSDKF LL+KNRA+SLPSPF+NKGNYVISLSQLVRW+  KAEEL
Sbjct  61    LIPKWRQYDAPIRVPVSSDKFWLLTKNRAWSLPSPFDNKGNYVISLSQLVRWMAIKAEEL  120

Query  681   GVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRG  860
             GVE+YPGFAASEILY+E+ +V G+ATND+G+AKDGS++E +Q GVEL+GR+TLLAEGCRG
Sbjct  121   GVEVYPGFAASEILYDENQKVTGVATNDVGIAKDGSKRETYQPGVELRGRMTLLAEGCRG  180

Query  861   SLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSF  1040
             SL+E++I  +KLRE G GQHQTYALGIKEVWEI+  KH+PG V+HT+GWPLD  TYGGSF
Sbjct  181   SLSEKIIRNHKLRESGQGQHQTYALGIKEVWEIEEGKHKPGSVVHTVGWPLDSNTYGGSF  240

Query  1041  LYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGG  1220
             +YH+  RQ+AIGLVVALNY NPF++PY+EFQKFK HPAIR +LEGGTVLQYGARTLNEGG
Sbjct  241   IYHLDNRQLAIGLVVALNYRNPFMSPYDEFQKFKQHPAIRKILEGGTVLQYGARTLNEGG  300

Query  1221  YQ  1226
             +Q
Sbjct  301   FQ  302


 Score =   388 bits (996),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  308   VFPGGAIMGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKALTEGSSMELYWENLKKSWIW  367

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAF+ G  PG+ALSA+ERYI KG+SP T KHG+PDHEA + A    PI+Y
Sbjct  368   EELYRARNYRPAFKYGFVPGIALSAVERYIFKGKSPFTLKHGRPDHEATDMASLHSPIQY  427

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG ISFD+ TS+YRS+TNH+HDQP HLRL+DP  PE VNLP YAGPESRYCPARVYE
Sbjct  428   PKPDGQISFDVPTSLYRSSTNHEHDQPPHLRLRDPTVPERVNLPLYAGPESRYCPARVYE  487

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+SDD G+ KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  488   YVSDDKGDQKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  536



>gb|EEE51267.1| hypothetical protein OsJ_32159 [Oryza sativa Japonica Group]
Length=582

 Score =   487 bits (1254),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/312 (75%), Positives = 280/312 (90%), Gaps = 7/312 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA+ YDVV+VGAGPAGL+AAIRLKQLCR+ + DLSVCV+EKG+EVGAH+LSGNVFEPRA
Sbjct  37    REAMSYDVVVVGAGPAGLAAAIRLKQLCRDADTDLSVCVLEKGSEVGAHVLSGNVFEPRA  96

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKA  671
             LDEL+P+WRQE TPI VPVSSDKF LL+KN+A++LPSPF+NKGNYVISLSQ+VRW+  KA
Sbjct  97    LDELIPKWRQEDTPIRVPVSSDKFWLLTKNKAWTLPSPFDNKGNYVISLSQMVRWMASKA  156

Query  672   EELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK-------GR  830
             EELGVE+YPGFAASEILY+E+  V G+ATND+G+AKDGS++E FQ GVEL+       GR
Sbjct  157   EELGVEVYPGFAASEILYDENQIVTGVATNDVGIAKDGSKRETFQPGVELRGDYLENAGR  216

Query  831   VTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWP  1010
             +TLLAEGCRGSL+E++I  +KLRE G GQHQTYALGIKEVWEI+  KH+PG V+HT+GWP
Sbjct  217   MTLLAEGCRGSLSEKIIRNHKLRESGQGQHQTYALGIKEVWEIEEGKHKPGSVIHTVGWP  276

Query  1011  LDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQ  1190
             LD KTYGGSF+YH+ +RQ+AIGLVVALNY NPF++PY+EFQKFK HPA+R +L+GGTVLQ
Sbjct  277   LDSKTYGGSFMYHLDDRQLAIGLVVALNYQNPFMSPYDEFQKFKQHPAVRTILDGGTVLQ  336

Query  1191  YGARTLNEGGYQ  1226
             YGARTLNEGG+Q
Sbjct  337   YGARTLNEGGFQ  348


 Score =   383 bits (983),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  354   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKTLVEGSSMELYWENLKKSWIW  413

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE G  PG+ALSA+ERY+ KG+SP T KHG PDHEA + A    PI+Y
Sbjct  414   EELYRARNYRPAFEYGFIPGIALSALERYVFKGKSPFTLKHGIPDHEATDMASLHSPIQY  473

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG ISFD+ TS+YRS+TNH+HDQP HLRL+DP  PE VNLP YAGPES YCPARVYE
Sbjct  474   PKPDGQISFDVPTSLYRSSTNHEHDQPPHLRLRDPTVPERVNLPLYAGPESHYCPARVYE  533

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+ G+ KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  534   YVTDEKGDQKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  582



>ref|XP_002466941.1| hypothetical protein SORBIDRAFT_01g017140 [Sorghum bicolor]
 gb|EER93939.1| hypothetical protein SORBIDRAFT_01g017140 [Sorghum bicolor]
Length=586

 Score =   494 bits (1273),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/307 (78%), Positives = 280/307 (91%), Gaps = 0/307 (0%)
 Frame = +3

Query  306   SCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEP  485
             S REA+ YDVVIVGAGPAGL+AAIRLKQLCR  +ADLSVCV+EKG+EVGAH+LSGNVFEP
Sbjct  46    SGREALSYDVVIVGAGPAGLAAAIRLKQLCRAADADLSVCVLEKGSEVGAHVLSGNVFEP  105

Query  486   RALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQ  665
             RALDEL+P WRQE +PI VPVSSDKF LL+KN+A++LPSPF+NKGNYVISLSQLVRW+G 
Sbjct  106   RALDELIPNWRQEDSPIRVPVSSDKFWLLTKNQAWTLPSPFDNKGNYVISLSQLVRWMGT  165

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             KAEELGVE+YPGFAASEILY+E+  V G+ATND+G+AKDG+++E FQ GVEL+GR+TL A
Sbjct  166   KAEELGVEVYPGFAASEILYDENQIVTGVATNDVGIAKDGTKRETFQPGVELRGRITLFA  225

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL+E++I  +KLRE+G GQHQTYALGIKEVWEI+  KH+PG V+HT+GWPLD KT
Sbjct  226   EGCRGSLSEKIIRNHKLRERGQGQHQTYALGIKEVWEIEEGKHKPGSVIHTVGWPLDTKT  285

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+ +RQ+AIGLVVALNY NPFL+PY+EFQKFK HPA+R LLEGGT +QYGART
Sbjct  286   YGGSFLYHLDDRQLAIGLVVALNYRNPFLSPYDEFQKFKQHPAVRELLEGGTAIQYGART  345

Query  1206  LNEGGYQ  1226
             LNEGG+Q
Sbjct  346   LNEGGFQ  352


 Score =   373 bits (957),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 195/229 (85%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  358   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKSLVEGSSMELYWENLKKSWIW  417

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ A   + AFE G  PG+ALSA+ERYI KG+SP T KHG+PDHEA + A   +PI+Y
Sbjct  418   EELHKAEGEKKAFEYGFIPGMALSALERYIFKGKSPYTLKHGRPDHEATDTANLHVPIQY  477

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG I+FD+ TS+YRSNTNH+HDQP HLRL+DP  PE VN+P YAGPESRYCPARVYE
Sbjct  478   PKPDGQITFDVPTSLYRSNTNHEHDQPPHLRLRDPTIPEQVNVPLYAGPESRYCPARVYE  537

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+SD+ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  538   YVSDEKGDPKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  586



>gb|EEC67310.1| hypothetical protein OsI_34318 [Oryza sativa Indica Group]
Length=582

 Score =   480 bits (1235),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/312 (74%), Positives = 278/312 (89%), Gaps = 7/312 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA+ YDVV+VGAGPAGL+AAIRLKQLCR+ + DLSVCV+++G EVGAH+LSGNVFEPRA
Sbjct  37    REAMSYDVVVVGAGPAGLAAAIRLKQLCRDADTDLSVCVLDEGLEVGAHVLSGNVFEPRA  96

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKA  671
             LDEL+ +WRQE TPI VPVSSDKF LL+KN+A++LPSPF+NKGNYVISLSQ+VRW+  KA
Sbjct  97    LDELIRKWRQEDTPIRVPVSSDKFWLLTKNKAWTLPSPFDNKGNYVISLSQMVRWMASKA  156

Query  672   EELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK-------GR  830
             EELGVE+YPGFAASEILY+E+  V G+ATND+G+AKDGS++E FQ GVEL+       GR
Sbjct  157   EELGVEVYPGFAASEILYDENQIVTGVATNDVGIAKDGSKRETFQPGVELRGDYLENAGR  216

Query  831   VTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWP  1010
             +TLLAEGCRGSL+E++I  +KLRE G GQHQTYALGIKEVWEI+  KH+PG V+HT+GWP
Sbjct  217   MTLLAEGCRGSLSEKIIRNHKLRESGQGQHQTYALGIKEVWEIEEGKHKPGSVIHTVGWP  276

Query  1011  LDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQ  1190
             LD KTYGGSF+YH+ +RQ+AIGLVVALNY NPF++PY+EFQKFK HPA+R +L+GGTVLQ
Sbjct  277   LDSKTYGGSFMYHLDDRQLAIGLVVALNYQNPFMSPYDEFQKFKQHPAVRTILDGGTVLQ  336

Query  1191  YGARTLNEGGYQ  1226
             YGARTLNEGG+Q
Sbjct  337   YGARTLNEGGFQ  348


 Score =   385 bits (990),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  354   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKTLVEGSSMELYWENLKKSWIW  413

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE G  PG+ALSA+ERY+ KG+SP T KHG PDHEA + A    PI+Y
Sbjct  414   EELYRARNYRPAFEYGFIPGIALSALERYVFKGKSPFTLKHGIPDHEATDMASLHSPIQY  473

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG ISFD+ TS+YRS+TNH+HDQP HLRL+DP  PE VNLP YAGPESRYCPARVYE
Sbjct  474   PKPDGQISFDVPTSLYRSSTNHEHDQPPHLRLRDPTVPERVNLPLYAGPESRYCPARVYE  533

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+ G+ KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  534   YVTDEKGDQKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  582



>tpg|DAA49304.1| TPA: hypothetical protein ZEAMMB73_777537 [Zea mays]
Length=591

 Score =   486 bits (1250),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/314 (75%), Positives = 279/314 (89%), Gaps = 7/314 (2%)
 Frame = +3

Query  306   SCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEP  485
             S REA+ YDVVIVGAGPAGL+AAIRLKQLCR  + DLSVCV+EKG+EVGAH+LSGNVFEP
Sbjct  44    SGREALSYDVVIVGAGPAGLAAAIRLKQLCRAADTDLSVCVLEKGSEVGAHVLSGNVFEP  103

Query  486   RALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQ  665
             RALDEL+P+WRQE +PI VPVSSDKF LL+KN+A++LPSPF+NKGNYVISLSQLVRW+  
Sbjct  104   RALDELIPKWRQEDSPIRVPVSSDKFWLLTKNQAWTLPSPFDNKGNYVISLSQLVRWMAT  163

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK-------  824
             KAEELGVE+YPGFAASEILY+E+  V G+ATND+G+AKDG+++E FQ GVEL+       
Sbjct  164   KAEELGVEVYPGFAASEILYDENQIVTGVATNDVGIAKDGTKRETFQPGVELRASDFENT  223

Query  825   GRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIG  1004
             GR+TLLAEGCRGSL+E++I  +KLRE+G GQHQTYALGIKEVWEI+  KH PG V+HT+G
Sbjct  224   GRITLLAEGCRGSLSEKIIRNHKLRERGQGQHQTYALGIKEVWEIEEGKHNPGSVIHTVG  283

Query  1005  WPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTV  1184
             WPLD KTYGGSFLYH+ +RQ+AIGLVVALNY NPFL+PY+EFQKFK HPA+R LLEGGT 
Sbjct  284   WPLDTKTYGGSFLYHLDDRQLAIGLVVALNYRNPFLSPYDEFQKFKQHPAVRKLLEGGTA  343

Query  1185  LQYGARTLNEGGYQ  1226
             +QYGARTLNEGG+Q
Sbjct  344   IQYGARTLNEGGFQ  357


 Score =   380 bits (975),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             +FPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  363   IFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKSLVEGSSMELYWENLKKSWIW  422

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE GL PG+ LSA+ERYI KG+SP T KHG+PDHEA + A    PI+Y
Sbjct  423   EELHKARNYRPAFEYGLIPGMVLSALERYIFKGKSPYTLKHGRPDHEATDTANLHAPIQY  482

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG I+FD+ TS+YRSNTNH+HDQP HLRL+DP  PE VN+  YA PESRYCPARVYE
Sbjct  483   PKPDGHITFDVPTSLYRSNTNHEHDQPPHLRLRDPTVPERVNVALYAAPESRYCPARVYE  542

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YISD+ G+ KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  543   YISDEKGDPKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  591



>ref|XP_003571956.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Brachypodium distachyon]
Length=580

 Score =   491 bits (1263),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/332 (73%), Positives = 285/332 (86%), Gaps = 11/332 (3%)
 Frame = +3

Query  240   KASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLS  419
             +   +GAE+   L+G R        EA+ YDVV+VGAGPAGL+AAIRLKQLCR  + DLS
Sbjct  23    RPPNWGAETARWLSGGR--------EALNYDVVVVGAGPAGLAAAIRLKQLCRAADTDLS  74

Query  420   VCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLP  599
             VCV+EKGAEVGAH+LSGNVFEPRALDEL+P+WRQE  PI VPVSSDKF +L+KN+A++LP
Sbjct  75    VCVLEKGAEVGAHVLSGNVFEPRALDELIPKWRQEDAPIRVPVSSDKFWMLTKNKAWTLP  134

Query  600   SPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDE---VIGIATNDMG  770
             SPF+NKGNYVISLSQLVRW+  KAEELG+E+YPGFAASEILY+E+DE   V G+ATND+G
Sbjct  135   SPFDNKGNYVISLSQLVRWMAVKAEELGIEIYPGFAASEILYDENDENQIVAGVATNDVG  194

Query  771   VAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEV  950
             +AKDG+++E FQ GVEL+GR+TLLAEGCRGSL+E +I  YKLRE G GQHQTYALGIKEV
Sbjct  195   IAKDGTKRETFQPGVELRGRITLLAEGCRGSLSETIIRNYKLRESGQGQHQTYALGIKEV  254

Query  951   WEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEF  1130
             WEI+  KH PG V+HT+GWPLD KTYGGSFLYH+ +RQ+AIGLVVALNY NPFL+PY+EF
Sbjct  255   WEIEEGKHEPGSVVHTVGWPLDTKTYGGSFLYHLDDRQLAIGLVVALNYRNPFLSPYDEF  314

Query  1131  QKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             QKFK HPAI  LLEGGT LQYGARTLNEGG+Q
Sbjct  315   QKFKQHPAIGTLLEGGTCLQYGARTLNEGGFQ  346


 Score =   374 bits (961),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKG+HTAMKSGMLAAE+ F  L  GS+M+ + +NL+ SWIW
Sbjct  352   VFPGGAIIGCSAGFLNVPKIKGSHTAMKSGMLAAEATFKALVEGSSMDLYGENLKKSWIW  411

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE G  PG+ALSA+ERYI KG+SP T KHG+PDHEA + A    PI+Y
Sbjct  412   EELYRARNYRPAFEYGFIPGMALSAVERYIFKGKSPFTLKHGEPDHEATDPANLHSPIQY  471

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ +S+YRSNTNH+HDQP HLRL+DP   E VNLP+YAG ESRYCPARVYE
Sbjct  472   PKPDGQVSFDVPSSLYRSNTNHEHDQPPHLRLRDPTVLERVNLPQYAGLESRYCPARVYE  531

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+SD+NG  KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYT+M
Sbjct  532   YVSDENGNPKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTIM  580



>ref|XP_010933770.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X3 [Elaeis guineensis]
Length=611

 Score =   476 bits (1226),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/345 (70%), Positives = 271/345 (79%), Gaps = 32/345 (9%)
 Frame = +3

Query  219   SFPNPCGKA--SRFGAESG------YSLNGARGFSSESC-REAIEYDVVIVGAGPAGLSA  371
             S P P  ++  SRF   S       +S  G R FS ES  REA+ YDVVIVGAGPAGLSA
Sbjct  49    SVPTPPNRSPLSRFHLVSTNLSSLIHSTGGTRRFSGESGGREALHYDVVIVGAGPAGLSA  108

Query  372   AIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVS  551
             AIRLKQLCR +N DLSVCV+EKG+EVGAHI+SGNVFEPRALDEL+P WR E  PI+VPVS
Sbjct  109   AIRLKQLCRARNTDLSVCVLEKGSEVGAHIISGNVFEPRALDELIPCWRDEGAPIEVPVS  168

Query  552   SDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNE  731
              DKF LL++NRA SLPSPF+NKGNYVISLSQLVRW+  KAEELGVE+YPGFAASEILY+E
Sbjct  169   HDKFWLLTENRALSLPSPFDNKGNYVISLSQLVRWMATKAEELGVEIYPGFAASEILYDE  228

Query  732   SDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGN  911
              D+V+G+ATNDMGVAKDGS+KE FQ GVELKG +TLLAEGCRGSL+E++I  YKLR+KG 
Sbjct  229   DDKVVGVATNDMGVAKDGSKKETFQRGVELKGHITLLAEGCRGSLSEKIIRDYKLRDKGQ  288

Query  912   GQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVAL  1091
             GQHQTYA+GIKEVWEI+  KH PG VLHT+GWPLD KTYGGSFLYHM  R          
Sbjct  289   GQHQTYAIGIKEVWEIEEGKHVPGTVLHTVGWPLDMKTYGGSFLYHMNNR----------  338

Query  1092  NYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
                          QK KHHPAI+ LLEGG+VLQYGARTLNEGG+Q
Sbjct  339   -------------QKLKHHPAIKSLLEGGSVLQYGARTLNEGGFQ  370


 Score =   377 bits (968),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAG++NVPKIKGTHTAMKSGMLAAE+AF++L GG+ ME +WD+L+ SWIW
Sbjct  376   VFPGGAIIGCSAGYINVPKIKGTHTAMKSGMLAAEAAFNVLDGGAQMEMYWDSLKRSWIW  435

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAFE GL PGLA SA+ERY+ +GR PLT KHGKPDHEA + A    PI+Y
Sbjct  436   EELYRSRNYRPAFEYGLIPGLAFSALERYVFRGRLPLTLKHGKPDHEATDIAGVHTPIQY  495

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             P+PDG +SFD+ TS+YRSNTNH+HDQPAHLRL+DP  PE VNLP YAGPESRYCPARVYE
Sbjct  496   PRPDGRVSFDVPTSLYRSNTNHEHDQPAHLRLRDPTIPERVNLPLYAGPESRYCPARVYE  555

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPG  1900
             Y+ D+   +KL+INAQNCLHCKACD+KDP QNI+WTVPEGGGGPG
Sbjct  556   YVPDEKHGMKLHINAQNCLHCKACDVKDPKQNIEWTVPEGGGGPG  600



>ref|XP_010672247.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris]
Length=600

 Score =   455 bits (1170),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/342 (68%), Positives = 265/342 (77%), Gaps = 44/342 (13%)
 Frame = +3

Query  213   FSSFP----NPCGKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIR  380
             +SS P    N CG  S F   +   +   RGF S+S RE++EYDVVIVGAGPAGLSAAIR
Sbjct  65    YSSNPRNLENLCGIGSGF-LRNHSLVQSKRGFCSDSGRESMEYDVVIVGAGPAGLSAAIR  123

Query  381   LKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDK  560
             LKQLC EK+ DLSVCVVEKGAEVGAHILSGNVFEPRALDEL+P+W+ E+ PID PVSSDK
Sbjct  124   LKQLCLEKDVDLSVCVVEKGAEVGAHILSGNVFEPRALDELIPEWKHEQAPIDTPVSSDK  183

Query  561   FLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDE  740
             F  LS++ A SLPSPF+NKGNYVISLSQLVRW+  KAEELGVE+YPGFAASEILYN++ E
Sbjct  184   FWFLSRDHALSLPSPFDNKGNYVISLSQLVRWMAMKAEELGVEIYPGFAASEILYNKNHE  243

Query  741   VIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQH  920
             VIGIAT+DMG++KDGSRK+NFQ GVELKG+VTLL+EGCRGSL+E++I +YKLR+KG  QH
Sbjct  244   VIGIATSDMGISKDGSRKDNFQRGVELKGQVTLLSEGCRGSLSEKIIREYKLRDKGKSQH  303

Query  921   QTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYH  1100
             QTYALGIKE                                       V+IGLVVALNY 
Sbjct  304   QTYALGIKE---------------------------------------VSIGLVVALNYQ  324

Query  1101  NPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             NPFLNPYEEFQK KHHPAI+P+LEGGTV+QYGARTLNEGG+Q
Sbjct  325   NPFLNPYEEFQKLKHHPAIKPMLEGGTVIQYGARTLNEGGFQ  366


 Score =   398 bits (1023),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAESAFD+L  G  ME +WD L++SWIW
Sbjct  372   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDLLHEGLKMERYWDMLQTSWIW  431

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE GL PGLALSA+E YILKGRSP T KHGKPDHEA + A    PI Y
Sbjct  432   EELYEARNYRPAFEYGLVPGLALSALEHYILKGRSPWTLKHGKPDHEATDVANLHSPIHY  491

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS+YRSNTNHDHDQPAHLRLKDP  PE VNLP+YAGPESRYCPARVYE
Sbjct  492   PKPDGVVSFDVPTSLYRSNTNHDHDQPAHLRLKDPLVPEQVNLPEYAGPESRYCPARVYE  551

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ DD G++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  552   YLPDDVGDMKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  600



>gb|ABB47885.1| Electron transfer flavoprotein-ubiquinone oxidoreductase,mitochondrial 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
Length=572

 Score =   468 bits (1203),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/312 (73%), Positives = 272/312 (87%), Gaps = 17/312 (5%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA+ YDVV+VGAGPAGL+AAIRLKQLCR+ + DLSVCV+EKG+EVGAH+LSGNVFEPRA
Sbjct  37    REAMSYDVVVVGAGPAGLAAAIRLKQLCRDADTDLSVCVLEKGSEVGAHVLSGNVFEPRA  96

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKA  671
             LDEL+P+WRQE TPI VPVSSDKF LL+KN+A++LPSPF+NKGNYVISLSQ+VRW+  KA
Sbjct  97    LDELIPKWRQEDTPIRVPVSSDKFWLLTKNKAWTLPSPFDNKGNYVISLSQMVRWMASKA  156

Query  672   EELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKG-------R  830
             EELGVE+YPGFAA          + G+ATND+G+AKDGS++E FQ GVEL+G       R
Sbjct  157   EELGVEVYPGFAA----------ITGVATNDVGIAKDGSKRETFQPGVELRGDYLENAGR  206

Query  831   VTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWP  1010
             +TLLAEGCRGSL+E++I  +KLRE G GQHQTYALGIKEVWEI+  KH+PG V+HT+GWP
Sbjct  207   MTLLAEGCRGSLSEKIIRNHKLRESGQGQHQTYALGIKEVWEIEEGKHKPGSVIHTVGWP  266

Query  1011  LDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQ  1190
             LD KTYGGSF+YH+ +RQ+AIGLVVALNY NPF++PY+EFQKFK HPA+R +L+GGTVLQ
Sbjct  267   LDSKTYGGSFMYHLDDRQLAIGLVVALNYQNPFMSPYDEFQKFKQHPAVRTILDGGTVLQ  326

Query  1191  YGARTLNEGGYQ  1226
             YGARTLNEGG+Q
Sbjct  327   YGARTLNEGGFQ  338


 Score =   382 bits (982),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  344   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKTLVEGSSMELYWENLKKSWIW  403

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE G  PG+ALSA+ERY+ KG+SP T KHG PDHEA + A    PI+Y
Sbjct  404   EELYRARNYRPAFEYGFIPGIALSALERYVFKGKSPFTLKHGIPDHEATDMASLHSPIQY  463

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG ISFD+ TS+YRS+TNH+HDQP HLRL+DP  PE VNLP YAGPES YCPARVYE
Sbjct  464   PKPDGQISFDVPTSLYRSSTNHEHDQPPHLRLRDPTVPERVNLPLYAGPESHYCPARVYE  523

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y++D+ G+ KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  524   YVTDEKGDQKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  572



>ref|XP_004486904.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform X4 [Cicer arietinum]
Length=618

 Score =   520 bits (1340),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/340 (72%), Positives = 286/340 (84%), Gaps = 26/340 (8%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
             +  F +   R++IEYDVV+VGAGPAGLSAAIRLKQLCRE + DLSVCV+EKGAEVGAHI+
Sbjct  40    SHNFCTTPNRDSIEYDVVVVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGAEVGAHIV  99

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRAL+ELLPQW+Q++ PI+ PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQ
Sbjct  100   SGNVFEPRALNELLPQWKQQEAPINTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQ  159

Query  645   LVRWLGQKAEELGVELYPGFAASE--------------------------ILYNESDEVI  746
             LVRW+G KAEELGVE+YPGFAASE                          ILY+ +++VI
Sbjct  160   LVRWMGAKAEELGVEIYPGFAASEVFPIFRICLNVTTLYLLLFTGVFPCQILYDANNKVI  219

Query  747   GIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQT  926
             GI TNDMG++KDGS+KE FQ GVE+KGR+TLLAEGCRGSL+E+++ +Y LREKG  +HQT
Sbjct  220   GIGTNDMGISKDGSKKETFQRGVEVKGRLTLLAEGCRGSLSEKIMKQYNLREKGGAEHQT  279

Query  927   YALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNP  1106
             YALGIKEVWEID  KH+PG VLHT+GWPLDHKTYGGSFLYHMK+RQ+++GLVVALNY NP
Sbjct  280   YALGIKEVWEIDEEKHQPGAVLHTLGWPLDHKTYGGSFLYHMKDRQISLGLVVALNYQNP  339

Query  1107  FLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             F+NPYEEFQK KHHPAI+P LEGGTV+QYGARTLNEGG+Q
Sbjct  340   FMNPYEEFQKLKHHPAIKPFLEGGTVIQYGARTLNEGGFQ  379


 Score =   327 bits (839),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGM+AAE+AF +L  G +M T+WD LR+SWIW
Sbjct  385   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMVAAEAAFGVLNEGLDMNTYWDALRNSWIW  444

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAFE GL PGLA S +E YILKGR P+T KHGKPDHEA N A+   PI Y
Sbjct  445   EELYKSRNYRPAFEYGLIPGLAFSGLEHYILKGRHPITLKHGKPDHEATNPARLHSPIHY  504

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PK DG +SFD+ TS++RSNTNH+HDQP HLRL+DPK PEL NLP YA PESRYCPARVYE
Sbjct  505   PKADGVLSFDVPTSLHRSNTNHEHDQPPHLRLRDPKIPELTNLPVYAAPESRYCPARVYE  564

Query  1766  YISDDNGEVKLNINAQNCLHCKA  1834
             Y++D+  ++KL INAQNCLHCK 
Sbjct  565   YVADEQNQLKLQINAQNCLHCKV  587



>ref|XP_004486903.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform X3 [Cicer arietinum]
Length=632

 Score =   535 bits (1377),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/314 (78%), Positives = 286/314 (91%), Gaps = 0/314 (0%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
             +  F +   R++IEYDVV+VGAGPAGLSAAIRLKQLCRE + DLSVCV+EKGAEVGAHI+
Sbjct  40    SHNFCTTPNRDSIEYDVVVVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGAEVGAHIV  99

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRAL+ELLPQW+Q++ PI+ PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQ
Sbjct  100   SGNVFEPRALNELLPQWKQQEAPINTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQ  159

Query  645   LVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK  824
             LVRW+G KAEELGVE+YPGFAASEILY+ +++VIGI TNDMG++KDGS+KE FQ GVE+K
Sbjct  160   LVRWMGAKAEELGVEIYPGFAASEILYDANNKVIGIGTNDMGISKDGSKKETFQRGVEVK  219

Query  825   GRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIG  1004
             GR+TLLAEGCRGSL+E+++ +Y LREKG  +HQTYALGIKEVWEID  KH+PG VLHT+G
Sbjct  220   GRLTLLAEGCRGSLSEKIMKQYNLREKGGAEHQTYALGIKEVWEIDEEKHQPGAVLHTLG  279

Query  1005  WPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTV  1184
             WPLDHKTYGGSFLYHMK+RQ+++GLVVALNY NPF+NPYEEFQK KHHPAI+P LEGGTV
Sbjct  280   WPLDHKTYGGSFLYHMKDRQISLGLVVALNYQNPFMNPYEEFQKLKHHPAIKPFLEGGTV  339

Query  1185  LQYGARTLNEGGYQ  1226
             +QYGARTLNEGG+Q
Sbjct  340   IQYGARTLNEGGFQ  353


 Score =   308 bits (789),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 172/243 (71%), Gaps = 40/243 (16%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGM+AAE+AF +L  G +M T+WD LR+SWIW
Sbjct  359   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMVAAEAAFGVLNEGLDMNTYWDALRNSWIW  418

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERY-------------------------------  1492
             +ELY +RNYRPAFE GL PGLA S +E+Y                               
Sbjct  419   EELYKSRNYRPAFEYGLIPGLAFSGLEQYDLIFLMDFIFFTSNWRVLFSVLPLFLSWNFT  478

Query  1493  ---------ILKGRSPLTFKHGKPDHEAINEAKSSLPIEYPKPDGAISFDILTSVYRSNT  1645
                      ILKGR P+T KHGKPDHEA N A+   PI YPK DG +SFD+ TS++RSNT
Sbjct  479   YPCVFPVSYILKGRHPITLKHGKPDHEATNPARLHSPIHYPKADGVLSFDVPTSLHRSNT  538

Query  1646  NHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYEYISDDNGEVKLNINAQNCLH  1825
             NH+HDQP HLRL+DPK PEL NLP YA PESRYCPARVYEY++D+  ++KL INAQNCLH
Sbjct  539   NHEHDQPPHLRLRDPKIPELTNLPVYAAPESRYCPARVYEYVADEQNQLKLQINAQNCLH  598

Query  1826  CKA  1834
             CK 
Sbjct  599   CKV  601



>gb|AES67779.2| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago 
truncatula]
Length=542

 Score =   548 bits (1412),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/352 (73%), Positives = 302/352 (86%), Gaps = 5/352 (1%)
 Frame = +3

Query  171   SSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGA  350
             S +KSK + T I  F++   PC  ++   +    S    R F +   R++IEYDVVIVGA
Sbjct  11    SKSKSKNALTIIRTFNNL-QPCNASTHANSRVPIS----RNFCTAPERDSIEYDVVIVGA  65

Query  351   GPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKT  530
             GPAGLSAAIRLKQLCRE + DLSVCV+EKG+EVGAHILSGNVFEPRALDELLPQW+Q++ 
Sbjct  66    GPAGLSAAIRLKQLCRENDTDLSVCVLEKGSEVGAHILSGNVFEPRALDELLPQWKQQEA  125

Query  531   PIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAA  710
             PI  PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQLVRW+G KAEELGVE+YPGFAA
Sbjct  126   PISTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQLVRWMGAKAEELGVEIYPGFAA  185

Query  711   SEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKY  890
             SEILY+  ++VIGI TNDMG++KDGS+KE FQ GVE+KG++TLL+EGCRGSL+EQ++ KY
Sbjct  186   SEILYDSDNKVIGIGTNDMGISKDGSKKETFQRGVEVKGQITLLSEGCRGSLSEQIMKKY  245

Query  891   KLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVA  1070
              LREKG  +HQTYALGIKEVWEID  KH+PG VLHT+GWPLDHKTYGGSFLYHMK+RQ++
Sbjct  246   NLREKGGAEHQTYALGIKEVWEIDEEKHQPGAVLHTLGWPLDHKTYGGSFLYHMKDRQIS  305

Query  1071  IGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             +GLVVALNY NPF+NPYEEFQKFKHHPAI+P LEGGTV+QYGARTLNEGG+Q
Sbjct  306   LGLVVALNYQNPFMNPYEEFQKFKHHPAIKPFLEGGTVIQYGARTLNEGGFQ  357


 Score =   292 bits (748),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +   G +M T+WD LR+SWIW
Sbjct  363   VFPGGAIVGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVFNEGLDMNTYWDALRNSWIW  422

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAF+ GL PGLALS +E YILKGR P+T KHGKPDHEA N A+   PI Y
Sbjct  423   EELYKSRNYRPAFKYGLIPGLALSGLEHYILKGRHPITLKHGKPDHEATNAAELHSPIHY  482

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG  SFD+ TS++RSNTNH+HDQP HLRL+DPK PEL NLP +A PESRYCPARVYE
Sbjct  483   PKPDGVFSFDVPTSLHRSNTNHEHDQPPHLRLRDPKIPELTNLPVFAAPESRYCPARVYE  542



>ref|XP_006442990.1| hypothetical protein CICLE_v10019615mg [Citrus clementina]
 gb|ESR56230.1| hypothetical protein CICLE_v10019615mg [Citrus clementina]
Length=492

 Score =   545 bits (1403),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/306 (83%), Positives = 284/306 (93%), Gaps = 0/306 (0%)
 Frame = +3

Query  309   CREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPR  488
             CRE++ YDVVIVGAGPAGLSAAIRLKQLCREKN DLSVCVVEKGAEVGAHI+SGNVFEPR
Sbjct  2     CRESMAYDVVIVGAGPAGLSAAIRLKQLCREKNVDLSVCVVEKGAEVGAHIISGNVFEPR  61

Query  489   ALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQK  668
             AL+ELLPQW+QE+ PI VPVSSDKF  L+K+RAFSLPSPF N+GNYVISLSQLVRWLG K
Sbjct  62    ALNELLPQWKQEEAPIRVPVSSDKFWFLTKDRAFSLPSPFSNRGNYVISLSQLVRWLGGK  121

Query  669   AEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAE  848
             AEELGVE+YPGFAASEILY+  ++VIGI TNDMG+AKDGS+KENFQ GVEL+GR+TLLAE
Sbjct  122   AEELGVEIYPGFAASEILYDADNKVIGIGTNDMGIAKDGSKKENFQRGVELRGRITLLAE  181

Query  849   GCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTY  1028
             GCRGSL+E++I  +KLREK + QHQTYALGIKEVWEID  KH PG++LHT+GWPLD KTY
Sbjct  182   GCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTY  241

Query  1029  GGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTL  1208
             GGSFLYHM +RQ+A+GLVVALNYHNPFLNPYEEFQKFKHHPAI+PLLEGGTV+QYGARTL
Sbjct  242   GGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTL  301

Query  1209  NEGGYQ  1226
             NEGG Q
Sbjct  302   NEGGLQ  307


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGC+AGFLNVPKIKGTHTAMKSGMLAAE+ F +L    NME +WD LR+SW+W
Sbjct  313   VFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDLNMEIYWDTLRNSWVW  372

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL  ARNYRPAFE GL PGLA+  +E YIL+G+SP T KHGKPD+EA + A+   PIEY
Sbjct  373   QELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDYEATDAARLHSPIEY  432

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG +SFD+ TS++RSNTNH+HDQPAHLRL+DPK PELVNLP+YAGPESRYCPARVYE
Sbjct  433   PKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYE  492



>ref|XP_004486901.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like isoform X1 [Cicer arietinum]
Length=658

 Score =   520 bits (1340),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/340 (72%), Positives = 286/340 (84%), Gaps = 26/340 (8%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
             +  F +   R++IEYDVV+VGAGPAGLSAAIRLKQLCRE + DLSVCV+EKGAEVGAHI+
Sbjct  40    SHNFCTTPNRDSIEYDVVVVGAGPAGLSAAIRLKQLCRENDTDLSVCVLEKGAEVGAHIV  99

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQ  644
             SGNVFEPRAL+ELLPQW+Q++ PI+ PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQ
Sbjct  100   SGNVFEPRALNELLPQWKQQEAPINTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQ  159

Query  645   LVRWLGQKAEELGVELYPGFAASE--------------------------ILYNESDEVI  746
             LVRW+G KAEELGVE+YPGFAASE                          ILY+ +++VI
Sbjct  160   LVRWMGAKAEELGVEIYPGFAASEVFPIFRICLNVTTLYLLLFTGVFPCQILYDANNKVI  219

Query  747   GIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQT  926
             GI TNDMG++KDGS+KE FQ GVE+KGR+TLLAEGCRGSL+E+++ +Y LREKG  +HQT
Sbjct  220   GIGTNDMGISKDGSKKETFQRGVEVKGRLTLLAEGCRGSLSEKIMKQYNLREKGGAEHQT  279

Query  927   YALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNP  1106
             YALGIKEVWEID  KH+PG VLHT+GWPLDHKTYGGSFLYHMK+RQ+++GLVVALNY NP
Sbjct  280   YALGIKEVWEIDEEKHQPGAVLHTLGWPLDHKTYGGSFLYHMKDRQISLGLVVALNYQNP  339

Query  1107  FLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             F+NPYEEFQK KHHPAI+P LEGGTV+QYGARTLNEGG+Q
Sbjct  340   FMNPYEEFQKLKHHPAIKPFLEGGTVIQYGARTLNEGGFQ  379


 Score =   308 bits (789),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 172/243 (71%), Gaps = 40/243 (16%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGM+AAE+AF +L  G +M T+WD LR+SWIW
Sbjct  385   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMVAAEAAFGVLNEGLDMNTYWDALRNSWIW  444

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERY-------------------------------  1492
             +ELY +RNYRPAFE GL PGLA S +E+Y                               
Sbjct  445   EELYKSRNYRPAFEYGLIPGLAFSGLEQYDLIFLMDFIFFTSNWRVLFSVLPLFLSWNFT  504

Query  1493  ---------ILKGRSPLTFKHGKPDHEAINEAKSSLPIEYPKPDGAISFDILTSVYRSNT  1645
                      ILKGR P+T KHGKPDHEA N A+   PI YPK DG +SFD+ TS++RSNT
Sbjct  505   YPCVFPVSYILKGRHPITLKHGKPDHEATNPARLHSPIHYPKADGVLSFDVPTSLHRSNT  564

Query  1646  NHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYEYISDDNGEVKLNINAQNCLH  1825
             NH+HDQP HLRL+DPK PEL NLP YA PESRYCPARVYEY++D+  ++KL INAQNCLH
Sbjct  565   NHEHDQPPHLRLRDPKIPELTNLPVYAAPESRYCPARVYEYVADEQNQLKLQINAQNCLH  624

Query  1826  CKA  1834
             CK 
Sbjct  625   CKV  627



>ref|XP_001752925.1| predicted protein [Physcomitrella patens]
 gb|EDQ82429.1| predicted protein [Physcomitrella patens]
Length=537

 Score =   459 bits (1182),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 220/302 (73%), Positives = 263/302 (87%), Gaps = 1/302 (0%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVG GPAGL AAIRLKQLC+EK +DLSVCVVEK  EVGAHILSGNV+EPRAL E
Sbjct  1     MEYDVVIVGGGPAGLGAAIRLKQLCQEKGSDLSVCVVEKAPEVGAHILSGNVYEPRALSE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEEL  680
             L P W+++  P+ VPV++DKF  L++ RA  LPSPF N+GNYVISLSQLVRWLG KAEEL
Sbjct  61    LFPDWKEQDAPVKVPVTADKFWYLTEKRAIPLPSPFNNQGNYVISLSQLVRWLGAKAEEL  120

Query  681   GVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRG  860
             GVE+YPGFAASE+LY E+D V+GIATNDMG+AKDGS+K  FQ G+ELKGR+T   EGCRG
Sbjct  121   GVEVYPGFAASEVLY-ENDRVVGIATNDMGIAKDGSKKSIFQRGIELKGRLTFFGEGCRG  179

Query  861   SLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSF  1040
             SL+E ++ KY+LRE+   QHQTYALGIKEVWE++ +KH PG VLHT+G+PLD++TYGG+F
Sbjct  180   SLSETILKKYQLREQVQAQHQTYALGIKEVWEVEESKHIPGYVLHTVGYPLDYRTYGGTF  239

Query  1041  LYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGG  1220
             LYHM  RQVAIGLVVAL+Y NP+L+PYEE+Q+FK HP+IRP+LEGG V+QYGARTLNEGG
Sbjct  240   LYHMDNRQVAIGLVVALDYKNPYLSPYEEYQRFKQHPSIRPMLEGGKVIQYGARTLNEGG  299

Query  1221  YQ  1226
             +Q
Sbjct  300   FQ  301


 Score =   345 bits (884),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 189/232 (81%), Gaps = 2/232 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS--NMETFWDNLRSS  1396
             + FPGGA++G SAGFLNVPKIKG+HTA+KSGM+AAE+AF+ L      +ME +W  L+ S
Sbjct  306   TAFPGGALLGDSAGFLNVPKIKGSHTALKSGMVAAEAAFEALGKSEQPSMEAYWTALQKS  365

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+W+EL   RN RPAF  GL PG+  +A++ Y+L+G+ P T +HG  DH+    A    P
Sbjct  366   WVWQELKSVRNIRPAFHYGLLPGMTHAALDHYLLRGKIPFTLRHGPSDHKCTEPASKHRP  425

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I Y KPDG ISFD+LTS+YRS+TNH+HDQP HLRL+DP+ PE VNLPKYAGPESRYCPAR
Sbjct  426   ISYAKPDGVISFDLLTSLYRSSTNHEHDQPPHLRLRDPQIPESVNLPKYAGPESRYCPAR  485

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYEY++D+N ++KLNINAQNCLHCKACDIKDPTQNI+WTVPEGGGGPGYTVM
Sbjct  486   VYEYVTDENDKMKLNINAQNCLHCKACDIKDPTQNIQWTVPEGGGGPGYTVM  537



>ref|XP_002977361.1| hypothetical protein SELMODRAFT_151870 [Selaginella moellendorffii]
 gb|EFJ21365.1| hypothetical protein SELMODRAFT_151870 [Selaginella moellendorffii]
Length=538

 Score =   454 bits (1169),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 219/302 (73%), Positives = 265/302 (88%), Gaps = 1/302 (0%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             ++YDVVIVGAGPAGL+AAIRLKQLC  +  +LSVCVVEKGAEVG+HILSGNVFEPR+L E
Sbjct  1     MDYDVVIVGAGPAGLAAAIRLKQLCDREKRELSVCVVEKGAEVGSHILSGNVFEPRSLSE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEEL  680
             L P W+++  P+++PVS DKF LLS   A  LPSPF N GNYVISLSQLVRWLG KAEEL
Sbjct  61    LFPDWKKQGAPVEIPVSEDKFWLLSSKHAIPLPSPFRNHGNYVISLSQLVRWLGTKAEEL  120

Query  681   GVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRG  860
             GVE+YPGF+ASE+LY++ + V+GIATNDMG+AK+GS+K  FQ G+EL+GR+TLLAEGCRG
Sbjct  121   GVEIYPGFSASEVLYDD-NRVVGIATNDMGIAKNGSKKSTFQKGMELRGRLTLLAEGCRG  179

Query  861   SLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSF  1040
              L+E+VI KY+LR++   QHQTYALGIKEVWE++ +KHRPG VLHT+GWPL+ KTYGGSF
Sbjct  180   YLSEEVIRKYQLRKQSGAQHQTYALGIKEVWEVEESKHRPGFVLHTVGWPLNTKTYGGSF  239

Query  1041  LYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGG  1220
             LYHM  RQVA+GLVVAL+Y NP+L+PYEE+Q+FK HP+IRP+LEGG V+QYGARTLNEGG
Sbjct  240   LYHMANRQVAVGLVVALDYQNPYLSPYEEYQRFKQHPSIRPMLEGGKVVQYGARTLNEGG  299

Query  1221  YQ  1226
             +Q
Sbjct  300   FQ  301


 Score =   347 bits (890),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 189/233 (81%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS---NMETFWDNLRS  1393
             +VFPGGA+IGCSAGF+NVPKIKG HTAMKSG+LAAE+AF+ L  GS    ++++W+ L++
Sbjct  306   TVFPGGALIGCSAGFVNVPKIKGAHTAMKSGLLAAETAFEQLAKGSEPAKLDSYWERLQN  365

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SWIW EL  ARN RPAF  GL PGLA+SA E YI KG+ P T KHG+PDH +   +K   
Sbjct  366   SWIWDELNAARNIRPAFHYGLLPGLAVSAFEHYISKGKLPYTLKHGRPDHLSTEVSKKHK  425

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ISFD+LTS+YRSNTNH+HDQP+HL L+DP  PE VNL  YAG ESRYCPA
Sbjct  426   PIDYPKPDGVISFDLLTSLYRSNTNHEHDQPSHLLLRDPSIPEKVNLIDYAGLESRYCPA  485

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             RVYEYI D+N ++ L INAQNCLHCKACDIKDP QNIKWT PEG GGPGY++M
Sbjct  486   RVYEYIPDENEKLTLQINAQNCLHCKACDIKDPPQNIKWTTPEGAGGPGYSIM  538



>ref|XP_002974941.1| hypothetical protein SELMODRAFT_150233 [Selaginella moellendorffii]
 gb|EFJ23726.1| hypothetical protein SELMODRAFT_150233 [Selaginella moellendorffii]
Length=538

 Score =   452 bits (1164),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 218/302 (72%), Positives = 264/302 (87%), Gaps = 1/302 (0%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             ++YDVVIVGAGPAGL+AAIRLKQLC  +  +LSVCVVEKGAEVG+HILSGNVFEPR+L E
Sbjct  1     MDYDVVIVGAGPAGLAAAIRLKQLCDREKRELSVCVVEKGAEVGSHILSGNVFEPRSLTE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEEL  680
             L P W+++  P+++PVS DKF LLS   A  LPSPF N GNYVISLSQLVRWLG KAEEL
Sbjct  61    LFPDWKKQGAPVEIPVSEDKFWLLSSKHAIPLPSPFRNHGNYVISLSQLVRWLGTKAEEL  120

Query  681   GVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRG  860
             GVE+YPGF+ASE+LY++ + V+GIATNDMG+AK+G +K  FQ G+EL+GR+TLLAEGCRG
Sbjct  121   GVEIYPGFSASEVLYDD-NRVVGIATNDMGIAKNGCKKSTFQKGMELRGRLTLLAEGCRG  179

Query  861   SLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSF  1040
              L+E+VI KY+LR++   QHQTYALGIKEVWE++ +KHRPG VLHT+GWPL+ KTYGGSF
Sbjct  180   YLSEEVIRKYQLRKQSGAQHQTYALGIKEVWEVEESKHRPGFVLHTVGWPLNTKTYGGSF  239

Query  1041  LYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGG  1220
             LYHM  RQVA+GLVVAL+Y NP+L+PYEE+Q+FK HP+IRP+LEGG V+QYGARTLNEGG
Sbjct  240   LYHMANRQVAVGLVVALDYQNPYLSPYEEYQRFKQHPSIRPMLEGGKVVQYGARTLNEGG  299

Query  1221  YQ  1226
             +Q
Sbjct  300   FQ  301


 Score =   347 bits (890),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 189/233 (81%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS---NMETFWDNLRS  1393
             +VFPGGA+IGCSAGF+NVPKIKG HTAMKSG+LAAE+AF+ L  GS    ++++W+ L++
Sbjct  306   TVFPGGALIGCSAGFVNVPKIKGAHTAMKSGLLAAETAFEQLSKGSEPAKLDSYWERLQN  365

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SWIW EL  ARN RPAF  GL PGLA+SA E YI KG+ P T KHG+PDH +   +K   
Sbjct  366   SWIWDELNAARNIRPAFHYGLLPGLAVSAFEHYISKGKLPYTLKHGRPDHLSTEVSKKHK  425

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ISFD+LTS+YRSNTNH+HDQP+HL L+DP  PE VNL  YAG ESRYCPA
Sbjct  426   PIDYPKPDGVISFDLLTSLYRSNTNHEHDQPSHLLLRDPSIPEKVNLIDYAGLESRYCPA  485

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             RVYEYI D+N ++ L INAQNCLHCKACDIKDP QNIKWT PEG GGPGY++M
Sbjct  486   RVYEYIPDENEKLTLQINAQNCLHCKACDIKDPPQNIKWTTPEGAGGPGYSIM  538



>ref|XP_009604480.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X2 [Nicotiana tomentosiformis]
Length=438

 Score =   400 bits (1028),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAES F  LQ G  M+ FWDNLRSSWIW
Sbjct  210   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAESVFSTLQEGLKMDYFWDNLRSSWIW  269

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE GL+PGLA+SAIE YILKGRSP+T KHGKPD+EA +EA+   PIEY
Sbjct  270   EELYTARNYRPAFEYGLYPGLAISAIEHYILKGRSPVTLKHGKPDYEATSEAQLFSPIEY  329

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDGA+SFD+ TS+YRSNTNHDHDQP+HL LKDP  PE VNLPKYAGPE+RYCPARVYE
Sbjct  330   PKPDGAVSFDVPTSLYRSNTNHDHDQPSHLLLKDPTVPENVNLPKYAGPEARYCPARVYE  389

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+ G++KL INAQNCLHCKAC IKDP QNI+WTVPEGGGGPGYT+M
Sbjct  390   YIPDETGDLKLQINAQNCLHCKACSIKDPRQNIEWTVPEGGGGPGYTIM  438


 Score =   364 bits (934),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  633   SLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHG  812
             SLSQLVRWLGQKAEELGVE+YPGFAASEIL+NE +EV GIATNDMGVAKDGSRKEN+Q G
Sbjct  7     SLSQLVRWLGQKAEELGVEIYPGFAASEILFNEHNEVTGIATNDMGVAKDGSRKENYQRG  66

Query  813   VELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVL  992
             V LKGRVTLLAEGCRGSL+++VI KY LREKG GQHQTYALGIKEVWEID +KH+PG VL
Sbjct  67    VALKGRVTLLAEGCRGSLSDKVIKKYNLREKGQGQHQTYALGIKEVWEIDVDKHQPGSVL  126

Query  993   HTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLE  1172
             HT+GWPLD KTYGGSFLYHMK+RQVA+G VVALNYHNPFLNPYEE+Q+FK HPAIRPLLE
Sbjct  127   HTLGWPLDQKTYGGSFLYHMKDRQVAVGFVVALNYHNPFLNPYEEYQRFKCHPAIRPLLE  186

Query  1173  GGTVLQYGARTLNEGGYQ  1226
             GGTVLQYGAR LNEGGYQ
Sbjct  187   GGTVLQYGARCLNEGGYQ  204



>gb|KEH39482.1| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago 
truncatula]
Length=513

 Score =   548 bits (1413),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/352 (73%), Positives = 302/352 (86%), Gaps = 5/352 (1%)
 Frame = +3

Query  171   SSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGA  350
             S +KSK + T I  F++   PC  ++   +    S    R F +   R++IEYDVVIVGA
Sbjct  11    SKSKSKNALTIIRTFNNL-QPCNASTHANSRVPIS----RNFCTAPERDSIEYDVVIVGA  65

Query  351   GPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKT  530
             GPAGLSAAIRLKQLCRE + DLSVCV+EKG+EVGAHILSGNVFEPRALDELLPQW+Q++ 
Sbjct  66    GPAGLSAAIRLKQLCRENDTDLSVCVLEKGSEVGAHILSGNVFEPRALDELLPQWKQQEA  125

Query  531   PIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAA  710
             PI  PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQLVRW+G KAEELGVE+YPGFAA
Sbjct  126   PISTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQLVRWMGAKAEELGVEIYPGFAA  185

Query  711   SEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKY  890
             SEILY+  ++VIGI TNDMG++KDGS+KE FQ GVE+KG++TLL+EGCRGSL+EQ++ KY
Sbjct  186   SEILYDSDNKVIGIGTNDMGISKDGSKKETFQRGVEVKGQITLLSEGCRGSLSEQIMKKY  245

Query  891   KLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVA  1070
              LREKG  +HQTYALGIKEVWEID  KH+PG VLHT+GWPLDHKTYGGSFLYHMK+RQ++
Sbjct  246   NLREKGGAEHQTYALGIKEVWEIDEEKHQPGAVLHTLGWPLDHKTYGGSFLYHMKDRQIS  305

Query  1071  IGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             +GLVVALNY NPF+NPYEEFQKFKHHPAI+P LEGGTV+QYGARTLNEGG+Q
Sbjct  306   LGLVVALNYQNPFMNPYEEFQKFKHHPAIKPFLEGGTVIQYGARTLNEGGFQ  357


 Score =   214 bits (546),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +   G +M T+WD LR+SWIW
Sbjct  363   VFPGGAIVGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVFNEGLDMNTYWDALRNSWIW  422

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAF+ GL PGLALS +E YILKGR P+T KHGKPDHEA N A+   PI Y
Sbjct  423   EELYKSRNYRPAFKYGLIPGLALSGLEHYILKGRHPITLKHGKPDHEATNAAELHSPIHY  482

Query  1586  PKPDGAISFDILTSVYR  1636
             PKPDG  SFD+ TS++R
Sbjct  483   PKPDGVFSFDVPTSLHR  499



>ref|XP_009775905.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X2 [Nicotiana sylvestris]
Length=438

 Score =   400 bits (1029),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKGTHTAMKSGML AES F  LQ G  +E FWDNLRSSWIW
Sbjct  210   VFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLVAESVFSTLQEGLKIEKFWDNLRSSWIW  269

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE GL+PGLA+SA+E YILKGRSP+T KHGKPDHEA +EA+   PIEY
Sbjct  270   EELYTARNYRPAFEYGLYPGLAISAVEHYILKGRSPVTLKHGKPDHEATSEAQVFSPIEY  329

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDGA++FD+ TS+YRSNTNHDHDQP+HL LKDP  PE VNLPKYAGPE+RYCPARVYE
Sbjct  330   PKPDGAVTFDVPTSLYRSNTNHDHDQPSHLLLKDPTVPENVNLPKYAGPEARYCPARVYE  389

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YI D+ G++KL INAQNCLHCKAC IKDP QNI+WTVPEGGGGPGYT+M
Sbjct  390   YIPDETGDLKLQINAQNCLHCKACSIKDPRQNIEWTVPEGGGGPGYTIM  438


 Score =   362 bits (930),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  633   SLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHG  812
             SLSQLVRWLGQKAEELGVE+YPGFAASEIL+NE +EV GIATNDMGVAKDGSRKEN+Q G
Sbjct  7     SLSQLVRWLGQKAEELGVEIYPGFAASEILFNEHNEVTGIATNDMGVAKDGSRKENYQRG  66

Query  813   VELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVL  992
             V LKGRVTLLAEGCRGSL+E+VI KY LREKG GQHQTYALGIKEVWEID  KH+PG VL
Sbjct  67    VALKGRVTLLAEGCRGSLSEKVIKKYNLREKGQGQHQTYALGIKEVWEIDVEKHQPGSVL  126

Query  993   HTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLE  1172
             HT+GWPLD KTYGGSFLYHMK+RQVA+G VVALNYHNPFLNPYEE+Q+FK HPAIRPLLE
Sbjct  127   HTLGWPLDQKTYGGSFLYHMKDRQVAVGFVVALNYHNPFLNPYEEYQRFKRHPAIRPLLE  186

Query  1173  GGTVLQYGARTLNEGGYQ  1226
             GG VLQYGAR LNEGGYQ
Sbjct  187   GGIVLQYGARCLNEGGYQ  204



>gb|KEH39481.1| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago 
truncatula]
Length=507

 Score =   548 bits (1413),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/352 (73%), Positives = 302/352 (86%), Gaps = 5/352 (1%)
 Frame = +3

Query  171   SSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGA  350
             S +KSK + T I  F++   PC  ++   +    S    R F +   R++IEYDVVIVGA
Sbjct  11    SKSKSKNALTIIRTFNNL-QPCNASTHANSRVPIS----RNFCTAPERDSIEYDVVIVGA  65

Query  351   GPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKT  530
             GPAGLSAAIRLKQLCRE + DLSVCV+EKG+EVGAHILSGNVFEPRALDELLPQW+Q++ 
Sbjct  66    GPAGLSAAIRLKQLCRENDTDLSVCVLEKGSEVGAHILSGNVFEPRALDELLPQWKQQEA  125

Query  531   PIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAA  710
             PI  PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQLVRW+G KAEELGVE+YPGFAA
Sbjct  126   PISTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQLVRWMGAKAEELGVEIYPGFAA  185

Query  711   SEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKY  890
             SEILY+  ++VIGI TNDMG++KDGS+KE FQ GVE+KG++TLL+EGCRGSL+EQ++ KY
Sbjct  186   SEILYDSDNKVIGIGTNDMGISKDGSKKETFQRGVEVKGQITLLSEGCRGSLSEQIMKKY  245

Query  891   KLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVA  1070
              LREKG  +HQTYALGIKEVWEID  KH+PG VLHT+GWPLDHKTYGGSFLYHMK+RQ++
Sbjct  246   NLREKGGAEHQTYALGIKEVWEIDEEKHQPGAVLHTLGWPLDHKTYGGSFLYHMKDRQIS  305

Query  1071  IGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             +GLVVALNY NPF+NPYEEFQKFKHHPAI+P LEGGTV+QYGARTLNEGG+Q
Sbjct  306   LGLVVALNYQNPFMNPYEEFQKFKHHPAIKPFLEGGTVIQYGARTLNEGGFQ  357


 Score =   214 bits (545),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +   G +M T+WD LR+SWIW
Sbjct  363   VFPGGAIVGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVFNEGLDMNTYWDALRNSWIW  422

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY +RNYRPAF+ GL PGLALS +E YILKGR P+T KHGKPDHEA N A+   PI Y
Sbjct  423   EELYKSRNYRPAFKYGLIPGLALSGLEHYILKGRHPITLKHGKPDHEATNAAELHSPIHY  482

Query  1586  PKPDGAISFDILTSVYR  1636
             PKPDG  SFD+ TS++R
Sbjct  483   PKPDGVFSFDVPTSLHR  499



>ref|XP_006372846.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Populus 
trichocarpa]
 gb|ERP50643.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Populus 
trichocarpa]
Length=424

 Score =   395 bits (1015),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VF GGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L+ G++++++W+ LRSSWIW
Sbjct  196   VFSGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGSLREGTSLKSYWETLRSSWIW  255

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
              EL+ ARNYRPAFE G+ PG+A+SA+ERYILKGRSP T KHGKPDHE+ N A+   PIEY
Sbjct  256   DELHQARNYRPAFEYGVIPGMAISALERYILKGRSPFTLKHGKPDHESTNAARLHSPIEY  315

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG  SFD+ TS++RSNTNHDHDQPAHLRLKDPK PE +NLP+YAGPESRYCPARVYE
Sbjct  316   PKPDGVFSFDVPTSLHRSNTNHDHDQPAHLRLKDPKIPETLNLPEYAGPESRYCPARVYE  375

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YISD+N ++KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY+VM
Sbjct  376   YISDENSQLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM  424


 Score =   343 bits (879),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             +G KAEE GVE+YPGFAASEILY+ +D V+GI TNDMG+AKDGS+K+ FQ GVELKGRVT
Sbjct  1     MGIKAEEFGVEIYPGFAASEILYDANDSVVGIGTNDMGIAKDGSKKDTFQRGVELKGRVT  60

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             LLAEGCRGSL+E++I KYKLREKG+ QHQTYALGIKEVWEID +KH+PG VLHTIGWPLD
Sbjct  61    LLAEGCRGSLSEKLIKKYKLREKGHAQHQTYALGIKEVWEIDESKHKPGAVLHTIGWPLD  120

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
              KTYGGSFLYHMK+RQV+IGLVVALNYHNP+LNPYEEFQKFKHHPAIRPLLEGGTV+QYG
Sbjct  121   QKTYGGSFLYHMKDRQVSIGLVVALNYHNPYLNPYEEFQKFKHHPAIRPLLEGGTVIQYG  180

Query  1197  ARTLNEGGYQ  1226
             ARTLNEGG Q
Sbjct  181   ARTLNEGGIQ  190



>ref|XP_005715486.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Chondrus 
crispus]
 emb|CDF35667.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Chondrus 
crispus]
Length=630

 Score =   429 bits (1102),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 254/307 (83%), Gaps = 5/307 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE + YDVVIVGAGPAGLSAAIRL+QL  + + DLSVCV+EK AEVGAH+LSGNVFEPRA
Sbjct  92    REQLSYDVVIVGAGPAGLSAAIRLRQLADQADEDLSVCVLEKAAEVGAHVLSGNVFEPRA  151

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             +DELLPQWR+   P+ V  ++D+F+ L+++R F LP+P   +N GNY+ISLS++ RWL +
Sbjct  152   MDELLPQWRK-SAPLGVQAANDRFVFLTEDRQFPLPTPPQMKNHGNYIISLSEMTRWLAE  210

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AEE GVE+YPGF+ASE+LY E   V G+ATND G+AKDGS+KEN+Q G+E+ GRV+LLA
Sbjct  211   QAEEAGVEVYPGFSASEMLYKEDGSVRGVATNDFGIAKDGSKKENYQPGIEIVGRVSLLA  270

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EG RGSL + V  ++ LRE    QHQTYALG+KEVW++D  KH PG ++H+IG+P+D +T
Sbjct  271   EGARGSLTKAVESRFGLRE--GKQHQTYALGLKEVWQVDPAKHEPGKIVHSIGYPMDLQT  328

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYHM E +VAIG VVAL+Y NP+L+P++EFQ++K HP++RPLLEGG VLQYGART
Sbjct  329   YGGSFLYHMTESRVAIGFVVALDYENPYLSPFQEFQRYKAHPSVRPLLEGGEVLQYGART  388

Query  1206  LNEGGYQ  1226
             LNEGG Q
Sbjct  389   LNEGGLQ  395


 Score =   306 bits (783),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 174/228 (76%), Gaps = 1/228 (0%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML-QGGSNMETFWDNLRSSWIW  1405
             F GGA+IGC+AGF+NVPKIKGTHTA KSGMLAAE+ F+ L +G  + + + + LR SW+W
Sbjct  402   FEGGALIGCAAGFVNVPKIKGTHTAQKSGMLAAEAVFENLKEGRDSAQGYEERLRQSWVW  461

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
              EL   RN RP F+ GL PGLA +A+E Y+ +GRSP T  HG PDH A   A+ +  IEY
Sbjct  462   DELSVVRNIRPGFKYGLLPGLANAALESYVTRGRSPWTISHGHPDHLATKPAREAKQIEY  521

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG ++FDILTS+  S T+HDHD+  HL LKD   PE +NLP Y  PESR+CPA+VYE
Sbjct  522   PKPDGKVTFDILTSLSLSGTDHDHDERCHLVLKDDSVPEKLNLPLYDAPESRFCPAKVYE  581

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTV  1909
             Y+  + G++ L INAQNCLHCKACDIKDP+QNI+WTVP+GGGGP YTV
Sbjct  582   YVEKEAGKMALQINAQNCLHCKACDIKDPSQNIEWTVPQGGGGPKYTV  629



>ref|XP_005646544.1| hypothetical protein COCSUDRAFT_37226 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22000.1| hypothetical protein COCSUDRAFT_37226 [Coccomyxa subellipsoidea 
C-169]
Length=544

 Score =   416 bits (1068),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 241/304 (79%), Gaps = 3/304 (1%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDV IVGAGPAGLSAAI+LKQ+C+E   ++SVCVVEKG+EVGAHILSGNV EPRAL E
Sbjct  1     MEYDVCIVGAGPAGLSAAIKLKQMCQEAGEEISVCVVEKGSEVGAHILSGNVLEPRALTE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAE  674
             L+P+W+ E  P+ VP + D+F  L++  A  LP+P    NKGNYVISLS+LVRWLG+KA+
Sbjct  61    LIPEWKAEGAPLHVPATDDRFFYLTRKHALRLPNPPQMHNKGNYVISLSELVRWLGEKAD  120

Query  675   ELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGC  854
              LGVE+YPGFAASE+LY +   V GIATND G+ KDG  K+ +  G+E++ R TL AEGC
Sbjct  121   GLGVEIYPGFAASEVLY-QRGAVAGIATNDFGIGKDGRPKDTYARGMEIRARATLFAEGC  179

Query  855   RGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGG  1034
             RGSL+E+V+ +Y LRE+     QTYA+G+KEVWE+   K +PG V HT+G+PLD   YGG
Sbjct  180   RGSLSEEVMKRYNLREEAGSDPQTYAIGLKEVWEVAPEKAKPGHVWHTVGYPLDQSIYGG  239

Query  1035  SFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNE  1214
             SFLYHM   +VA+GLVVAL+Y +P+LNPY+EFQ++K HP IR LLEGGTVLQYGAR LNE
Sbjct  240   SFLYHMSANRVALGLVVALDYRDPYLNPYQEFQRWKSHPKIRALLEGGTVLQYGARCLNE  299

Query  1215  GGYQ  1226
             GG Q
Sbjct  300   GGLQ  303


 Score =   317 bits (813),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 177/235 (75%), Gaps = 7/235 (3%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS-------NMETFWDNL  1387
             FPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+AF  L   S       ++  + D L
Sbjct  310   FPGGALIGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFTELTSTSAESGAAADLAAYEDAL  369

Query  1388  RSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKS  1567
             ++SW+W+EL   RN RP+F  G +PGLALSA++  +L+GR+P T +H   DHEA+  A  
Sbjct  370   KASWVWEELERERNIRPSFHFGFWPGLALSAVDTILLRGRAPWTLRHRHADHEALQPASG  429

Query  1568  SLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYC  1747
               P EYP PDG ++F +  S+YRS TNHDHDQPAHLRL++   P  VN P YAGPE RYC
Sbjct  430   FAPREYPAPDGQVTFALNDSLYRSGTNHDHDQPAHLRLRNAGVPAAVNWPIYAGPEGRYC  489

Query  1748  PARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             PA VYEY +D++G  KL INAQNCLHCKACDIKDPTQNI+WT PEGGGGP YT+M
Sbjct  490   PAGVYEYATDEHGREKLQINAQNCLHCKACDIKDPTQNIRWTTPEGGGGPAYTMM  544



>ref|XP_010258524.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010258525.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X2 [Nelumbo nucifera]
Length=424

 Score =   389 bits (998),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCS GFLNVPKIKGTHTAMKSGMLAAE+ F  LQ GS+ME +WDNL+ SW+W
Sbjct  196   VFPGGAIVGCSVGFLNVPKIKGTHTAMKSGMLAAEAVFHTLQEGSSMEAYWDNLKKSWVW  255

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +ELY ARNYRPAFE G+ PGLALSA+E YILKGRSPLT KHGKPDHEA + A    PI Y
Sbjct  256   EELYRARNYRPAFEYGMIPGLALSALEHYILKGRSPLTLKHGKPDHEATDVASVHSPIHY  315

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
              KPDG +SFD+ TS+YRSNTNH+HDQPAHL L+DP  PE VNLPKYAGPESRYCPARVYE
Sbjct  316   SKPDGLVSFDVPTSLYRSNTNHEHDQPAHLHLRDPTIPERVNLPKYAGPESRYCPARVYE  375

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             Y+ ++ G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGY++M
Sbjct  376   YVINEQGQQKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSIM  424


 Score =   332 bits (851),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             +G KAEELGVE+YPGFAASEILY+ + +V+GI TNDMG++KDGS++ENFQ GVELKGR+T
Sbjct  1     MGTKAEELGVEIYPGFAASEILYDANHKVVGIGTNDMGISKDGSKRENFQRGVELKGRIT  60

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             LLAEGCRGSL+E++I  Y LREKGN QHQTYALGIKEVWEID  KH+PG VLHT+GWP+D
Sbjct  61    LLAEGCRGSLSEKIIRDYNLREKGNAQHQTYALGIKEVWEIDEGKHKPGFVLHTVGWPID  120

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
              KTYGGSFLYHMK+RQ++IGLV+ALNY NPFLNPYEEFQK KHHPAI+P+LEGGTVLQYG
Sbjct  121   SKTYGGSFLYHMKDRQISIGLVLALNYRNPFLNPYEEFQKLKHHPAIKPILEGGTVLQYG  180

Query  1197  ARTLNEGGYQ  1226
             ARTLNEGG+Q
Sbjct  181   ARTLNEGGFQ  190



>ref|XP_005702759.1| electron-transferring-flavoprotein dehydrogenase [Galdieria sulphuraria]
 gb|EME26239.1| electron-transferring-flavoprotein dehydrogenase [Galdieria sulphuraria]
Length=575

 Score =   404 bits (1037),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 187/317 (59%), Positives = 248/317 (78%), Gaps = 6/317 (2%)
 Frame = +3

Query  288   RGFSS--ESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHI  461
             R FSS  E  RE +EYD+VIVGAGPAGLSAAIR KQ C+E   DL VC++EKG+EVGAHI
Sbjct  20    RTFSSVSEEARERLEYDLVIVGAGPAGLSAAIRFKQKCQESGVDLGVCILEKGSEVGAHI  79

Query  462   LSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVIS  635
             LSGNVFEP++L ELLP + +   P+      D+F  L+++RAF LP+P    NKGN+VIS
Sbjct  80    LSGNVFEPKSLKELLPDYEKRNPPLHTSAKKDEFYFLTQSRAFRLPTPPQMHNKGNFVIS  139

Query  636   LSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGV  815
             LS+L RWL  +AE+LGVE+YPGFAA   +Y+   +V G+ TND G+AKDGS+K +FQ GV
Sbjct  140   LSELTRWLATEAEQLGVEIYPGFAAKSPVYDSKGKVCGVVTNDFGIAKDGSKKPSFQPGV  199

Query  816   ELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLH  995
             E++G+VTLLAEGCRGS++++V+  + L  + N   Q+YALG+KEVW++   KH+ G V+H
Sbjct  200   EVRGKVTLLAEGCRGSISKEVMKHFDL--QSNCDPQSYALGVKEVWKVPEEKHQAGLVVH  257

Query  996   TIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEG  1175
             T+GWPLD +TYGGSF+YHM + ++A+GLV++L+Y NP+L+PY+E QKFK HP I  +LEG
Sbjct  258   TVGWPLDSRTYGGSFIYHMSDSRIALGLVISLDYENPYLSPYQELQKFKTHPKISKMLEG  317

Query  1176  GTVLQYGARTLNEGGYQ  1226
             G V+QYGAR+LNEGG+Q
Sbjct  318   GEVIQYGARSLNEGGFQ  334


 Score =   306 bits (784),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 172/235 (73%), Gaps = 7/235 (3%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN-------METFWDNL  1387
             FPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAESAF+ L G          +E +   L
Sbjct  341   FPGGALIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFEYLNGSKQYSEGEVELENYERAL  400

Query  1388  RSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKS  1567
             R+SW++ EL   RN RP F  GL  GL  +AIE YI  G+S  T       +E++  A S
Sbjct  401   RNSWVYDELSRERNIRPGFRWGLIGGLTNAAIETYIFHGKSFWTLHLPHEANESLKPASS  460

Query  1568  SLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYC  1747
             S  I YPKPDG ++FDILTSV  S TNHDHDQP HL++KD K  E VN   YAGPESRYC
Sbjct  461   SKKIVYPKPDGKLTFDILTSVALSGTNHDHDQPPHLKVKDSKVAEEVNWKLYAGPESRYC  520

Query  1748  PARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             PARVYEY+ DD+G+ KL INAQNCLHCKACDIKDP QNI+WTVPEGGGGP YTVM
Sbjct  521   PARVYEYVEDDSGQPKLQINAQNCLHCKACDIKDPKQNIQWTVPEGGGGPKYTVM  575



>gb|KEH39483.1| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago 
truncatula]
Length=450

 Score =   550 bits (1416),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/352 (73%), Positives = 302/352 (86%), Gaps = 5/352 (1%)
 Frame = +3

Query  171   SSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGA  350
             S +KSK + T I  F++   PC  ++   +    S    R F +   R++IEYDVVIVGA
Sbjct  11    SKSKSKNALTIIRTFNNL-QPCNASTHANSRVPIS----RNFCTAPERDSIEYDVVIVGA  65

Query  351   GPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKT  530
             GPAGLSAAIRLKQLCRE + DLSVCV+EKG+EVGAHILSGNVFEPRALDELLPQW+Q++ 
Sbjct  66    GPAGLSAAIRLKQLCRENDTDLSVCVLEKGSEVGAHILSGNVFEPRALDELLPQWKQQEA  125

Query  531   PIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAA  710
             PI  PVSSDKF  L+KNRA SLPSPF+NKGNYVISLSQLVRW+G KAEELGVE+YPGFAA
Sbjct  126   PISTPVSSDKFWFLTKNRAISLPSPFDNKGNYVISLSQLVRWMGAKAEELGVEIYPGFAA  185

Query  711   SEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKY  890
             SEILY+  ++VIGI TNDMG++KDGS+KE FQ GVE+KG++TLL+EGCRGSL+EQ++ KY
Sbjct  186   SEILYDSDNKVIGIGTNDMGISKDGSKKETFQRGVEVKGQITLLSEGCRGSLSEQIMKKY  245

Query  891   KLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVA  1070
              LREKG  +HQTYALGIKEVWEID  KH+PG VLHT+GWPLDHKTYGGSFLYHMK+RQ++
Sbjct  246   NLREKGGAEHQTYALGIKEVWEIDEEKHQPGAVLHTLGWPLDHKTYGGSFLYHMKDRQIS  305

Query  1071  IGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             +GLVVALNY NPF+NPYEEFQKFKHHPAI+P LEGGTV+QYGARTLNEGG+Q
Sbjct  306   LGLVVALNYQNPFMNPYEEFQKFKHHPAIKPFLEGGTVIQYGARTLNEGGFQ  357


 Score =   146 bits (369),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA++GCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +   G +M T+WD LR+SWIW
Sbjct  363   VFPGGAIVGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVFNEGLDMNTYWDALRNSWIW  422

Query  1406  KELYHARNYRPAFENGLFPGLALSAIER  1489
             +ELY +RNYRPAF+ GL PGLALS +E+
Sbjct  423   EELYKSRNYRPAFKYGLIPGLALSGLEQ  450



>ref|WP_007677348.1| electron transfer flavoprotein [alpha proteobacterium BAL199]
 gb|EDP62863.1| Dehydrogenase [alpha proteobacterium BAL199]
Length=548

 Score =   398 bits (1023),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 237/307 (77%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++E DVVIVGAGP+GL+AAIRLKQLC E   DLSV V+EKGAEVGAHILSG V EPRA
Sbjct  5     RESMECDVVIVGAGPSGLAAAIRLKQLCAEAGTDLSVVVLEKGAEVGAHILSGAVIEPRA  64

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL P W++   P++ P + D+F+ L+   A+ LP+P    N GNY++SL  + RWLG+
Sbjct  65    LNELFPDWKERGAPLNTPAADDRFMFLTAKGAYRLPTPPQMNNHGNYIVSLGNVCRWLGE  124

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +A ELG+E+YPGFAA+E+LY++   V G+AT DMG+ KDG +  + Q G+EL  +VTL  
Sbjct  125   QATELGIEIYPGFAAAEVLYHDDGSVKGVATGDMGIGKDGQKTASHQPGMELHAKVTLFG  184

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL E +  ++ LRE  +   QTY + +KE+WE+D  KH+PG ++HT+GWPLD +T
Sbjct  185   EGCRGSLTEGLFERFALRE--DCDPQTYGIALKELWEVDQAKHKPGTIVHTVGWPLDGET  242

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+++ QV+IG VV L+Y NPFL+P+EEFQ+FK HP++RPLLEGG  + YGAR 
Sbjct  243   YGGSFLYHLEDNQVSIGFVVGLDYKNPFLSPFEEFQRFKQHPSVRPLLEGGRRISYGARA  302

Query  1206  LNEGGYQ  1226
             LNEGG+Q
Sbjct  303   LNEGGFQ  309


 Score =   290 bits (741),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 171/235 (73%), Gaps = 7/235 (3%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS-----NMETFWDNLR  1390
             VFPGGA++GC AGFLNVPKIKG+HTAMKSGMLAAE+AFD L+ G+      +  + + L+
Sbjct  315   VFPGGAIMGCGAGFLNVPKIKGSHTAMKSGMLAAEAAFDALKDGAVGAGVMLNDYPERLK  374

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
              SW+W EL+ ARN RPAF  GLF G+A SA++ ++ +G++P T  H  PDHE++  A  S
Sbjct  375   QSWVWDELHRARNIRPAFHLGLFAGIAYSAVDTFLFRGKAPWTLHH-HPDHESLRPAAQS  433

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
             +PI YPKPDG ISFD L+SV+ SNTNH+ +QPAHL L+D   P   NL  Y  PE RYCP
Sbjct  434   IPINYPKPDGMISFDRLSSVFLSNTNHEENQPAHLTLRDASVPIDHNLAVYDAPEQRYCP  493

Query  1751  ARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE + D +G   +L INAQNC+HCK CDIKDP QNI W VPEGGGGP Y  M
Sbjct  494   AGVYEIVRDADGSNPRLQINAQNCVHCKTCDIKDPLQNIHWVVPEGGGGPVYPNM  548



>ref|NP_001146788.1| uncharacterized protein LOC100280392 [Zea mays]
 gb|ACL54753.1| unknown [Zea mays]
Length=431

 Score =   380 bits (976),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             +FPGGA+IGCSAGFLNVPKIKGTHTAMKSGMLAAE+ F  L  GS+ME +W+NL+ SWIW
Sbjct  203   IFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFKSLVEGSSMELYWENLKKSWIW  262

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL+ ARNYRPAFE GL PG+ LSA+ERYI KG+SP T KHG+PDHEA + A    PI+Y
Sbjct  263   EELHKARNYRPAFEYGLIPGMVLSALERYIFKGKSPYTLKHGRPDHEATDTANLHAPIQY  322

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPDG I+FD+ TS+YRSNTNH+HDQP HLRL+DP  PE VN+  YA PESRYCPARVYE
Sbjct  323   PKPDGHITFDVPTSLYRSNTNHEHDQPPHLRLRDPTVPERVNVALYAAPESRYCPARVYE  382

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YISD+ G+ KL+INAQNCLHCKACDIKDP QNI+WTVPEGGGGPGYTVM
Sbjct  383   YISDEKGDPKLHINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYTVM  431


 Score =   306 bits (783),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 170/197 (86%), Gaps = 7/197 (4%)
 Frame = +3

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELK----  824
             +  KAEELGVE+YPGFAASEILY+E+  V G+ATND+G+AKDG+++E FQ GVEL+    
Sbjct  1     MATKAEELGVEVYPGFAASEILYDENQIVTGVATNDVGIAKDGTKRETFQPGVELRASDF  60

Query  825   ---GRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLH  995
                GR+TLLAEGCRGSL+E++I  +KLRE+G GQHQTYALGIKEVWEI+  KH PG V+H
Sbjct  61    ENTGRITLLAEGCRGSLSEKIIRNHKLRERGQGQHQTYALGIKEVWEIEEGKHNPGSVIH  120

Query  996   TIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEG  1175
             T+GWPLD KTYGGSFLYH+ +RQ+AIGLVVALNY NPFL+PY+EFQKFK HPA+R LLEG
Sbjct  121   TVGWPLDTKTYGGSFLYHLDDRQLAIGLVVALNYRNPFLSPYDEFQKFKQHPAVRKLLEG  180

Query  1176  GTVLQYGARTLNEGGYQ  1226
             GT +QYGARTLNEGG+Q
Sbjct  181   GTAIQYGARTLNEGGFQ  197



>ref|WP_018719670.1| electron transfer flavoprotein [Arhodomonas aquaeolei]
Length=545

 Score =   380 bits (976),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 231/307 (75%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE ++YDVVIVG GP+GL+A+IRL Q  RE   +LSVCV+EKG+E+GAHILSG V +PRA
Sbjct  3     RERMDYDVVIVGGGPSGLAASIRLMQRAREAGQELSVCVLEKGSEIGAHILSGAVLDPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+ELL  WR    P+  PV+ D+F+LL +  A  LP+P    N+GNY++SL  L RWL +
Sbjct  63    LEELLADWRDRGAPLHTPVTEDRFVLLGERSARRLPTPPQMANEGNYIVSLGNLCRWLAE  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGFAA+E+LY++   V G+AT DMG+  DG+   N + GVEL  R TL A
Sbjct  123   QAEALGVEIYPGFAAAEVLYHDDGSVKGVATGDMGLNPDGTPGANHEPGVELHARQTLFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL +++  ++ LR       QTY LGIKE+WE+D ++H+PG V+HT+GWP+D KT
Sbjct  183   EGCRGSLTKRLFERFDLR--AGADPQTYGLGIKELWEVDPSQHQPGLVIHTVGWPMDPKT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+++ QVA+G VV L+Y NP+L+P+EE Q+FK HPAIRP  EGG  + YGAR 
Sbjct  241   YGGSFLYHLEDNQVAVGFVVGLDYDNPYLSPFEEMQRFKTHPAIRPTFEGGRRISYGARA  300

Query  1206  LNEGGYQ  1226
             ++EGGYQ
Sbjct  301   ISEGGYQ  307


 Score =   296 bits (758),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 172/234 (74%), Gaps = 6/234 (3%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG-----GSNMETFWDNLR  1390
              FPGGA+IG +AGFLN P+IKG+HTAMKSGM AAE+ F+ L G     G+ +  + + LR
Sbjct  313   TFPGGALIGDTAGFLNTPRIKGSHTAMKSGMTAAEAVFEALTGEAAEAGAEVSAYPEQLR  372

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
              SW+W ELY ARN RPAF  GL+P +A SAI+ Y+ +G++P TF H   DHE +     +
Sbjct  373   RSWLWDELYRARNIRPAFRWGLWPAIAYSAIDTYLFRGKAPWTFHH-HADHEQLRAKDQA  431

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI+YP+PDG ++FD L+SV+ SNTNH+ +QP HL L+D   P  VNL +YAGPE+RYCP
Sbjct  432   TPIDYPRPDGVVTFDRLSSVFISNTNHEENQPCHLTLRDKDVPVRVNLERYAGPEARYCP  491

Query  1751  ARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE++ DD+G  +L INAQNC+HCK CDIKDPTQNI W VPEGGGGP Y  M
Sbjct  492   AGVYEFVEDDSGNPQLQINAQNCVHCKTCDIKDPTQNIDWVVPEGGGGPNYPNM  545



>dbj|BAJ34227.1| unnamed protein product [Thellungiella halophila]
Length=403

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/377 (69%), Positives = 306/377 (81%), Gaps = 21/377 (6%)
 Frame = +3

Query  159   KFILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNG------------------  284
             +FIL    S +++ P     S P P   A+RF +  GY  +                   
Sbjct  27    RFILPLLPSSITSNPFTASGSPPRPSIPANRFISRFGYPCSADLFRKSPTLCSNSTTFGV  86

Query  285   ---ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGA  455
                +R  SSE+ RE+IEYDV+IVGAGPAGLSAAIRLKQLC++ N DLSVCVVEKGAEVGA
Sbjct  87    IWSSRCISSEAGRESIEYDVLIVGAGPAGLSAAIRLKQLCQQNNIDLSVCVVEKGAEVGA  146

Query  456   HILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYVIS  635
             HI+SGNVFEP ALDELLP WRQ++ PI++P SSDKF  L+K+RA SLPSPF+NKGNYVIS
Sbjct  147   HIISGNVFEPLALDELLPHWRQQQAPIEIPASSDKFWFLTKDRAISLPSPFDNKGNYVIS  206

Query  636   LSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGV  815
             LSQLVRWLG KAEELG E+YPGF+ASE+LY+ SD+V+GIAT DMG++KDGS+KENFQ GV
Sbjct  207   LSQLVRWLGGKAEELGTEIYPGFSASEVLYDASDKVVGIATRDMGISKDGSKKENFQPGV  266

Query  816   ELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLH  995
             ++KGRVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIKEVWEID +KH PG+V+H
Sbjct  267   DIKGRVTLFAEGCRGSLSEKIIKKYKLREEVNAQHQTYALGIKEVWEIDESKHNPGEVVH  326

Query  996   TIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEG  1175
             T+GWPLD KTYGGSFLYHM +RQ+A+GLVVALNY NPFLNPYEEFQK KHHPAI+ +LEG
Sbjct  327   TLGWPLDPKTYGGSFLYHMNDRQIALGLVVALNYKNPFLNPYEEFQKLKHHPAIKRVLEG  386

Query  1176  GTVLQYGARTLNEGGYQ  1226
             GTVLQYGARTLNEGG+Q
Sbjct  387   GTVLQYGARTLNEGGFQ  403



>ref|WP_018719334.1| electron transfer flavoprotein [Arhodomonas aquaeolei]
Length=547

 Score =   380 bits (975),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/309 (57%), Positives = 231/309 (75%), Gaps = 4/309 (1%)
 Frame = +3

Query  306   SCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEP  485
             S RE+++YDVVIVG GP+GL+A+IRL Q   E    LSVCV+EKG+E+GAHILSG V +P
Sbjct  3     SERESMDYDVVIVGGGPSGLAASIRLMQRATETGQALSVCVLEKGSEIGAHILSGAVLDP  62

Query  486   RALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWL  659
             RAL+ELLP WR    P+  PV+ D+FLLL +  A  LP+P    N+GNY++SL  L RWL
Sbjct  63    RALEELLPDWRDRGAPLHTPVAEDRFLLLGERSARRLPTPPQMANEGNYIVSLGNLCRWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
              ++AE L VE+YPGFAA+E+LY+E   V G+AT DMG+  DG+   N + GVEL  R TL
Sbjct  123   AEQAEALDVEIYPGFAAAEVLYHEDGSVKGVATGDMGLNPDGTPGPNHEPGVELHARQTL  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGCRGSL + +  +++LR   +   QTY LGIKE+WE+D  +H+PG V+HT+GWP+D 
Sbjct  183   FAEGCRGSLTKALFERFELR--ADADPQTYGLGIKELWEVDPAQHQPGLVVHTVGWPMDS  240

Query  1020  KTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGA  1199
             +TYGGSFLYH+++ QVA+G VV L+Y NP+L+P+EE Q+FK HPAIRP  EGG  + YGA
Sbjct  241   RTYGGSFLYHLEDNQVAVGFVVGLDYDNPYLSPFEEMQRFKTHPAIRPTFEGGRRISYGA  300

Query  1200  RTLNEGGYQ  1226
             R ++EGGYQ
Sbjct  301   RAISEGGYQ  309


 Score =   293 bits (750),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 6/234 (3%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG-----GSNMETFWDNLR  1390
              FPGGA+IG +AGFLN P+IKG+HTAMKSGM AAE+ F+ L G     G+ +  + + LR
Sbjct  315   TFPGGALIGDTAGFLNTPRIKGSHTAMKSGMTAAETVFEALTGEAAEAGAEVSAYPERLR  374

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
              +W+W EL+ ARN RPAF  GL+P +A SAI+ Y+ +G++P TF H   DHE +     +
Sbjct  375   RTWLWDELHRARNIRPAFRWGLWPAMAYSAIDTYLFRGKAPWTFHH-HADHEQLRAKDEA  433

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI+YPKPDG ++FD L+SV+ SNTNH+  QP HL L+D   P  VNL +YAGPE+RYCP
Sbjct  434   TPIDYPKPDGVVTFDRLSSVFISNTNHEESQPCHLTLRDDDVPVRVNLERYAGPEARYCP  493

Query  1751  ARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE++ DD G  +L INAQNC+HCK CDIKDPTQNI W VPEGGGGP Y  M
Sbjct  494   AGVYEFVEDDAGNPRLQINAQNCVHCKTCDIKDPTQNIDWVVPEGGGGPNYPNM  547



>gb|AAM53303.1| biotin synthase Bio B [Arabidopsis thaliana]
 gb|AAN15692.1| biotin synthase Bio B [Arabidopsis thaliana]
Length=401

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/335 (76%), Positives = 294/335 (88%), Gaps = 2/335 (1%)
 Frame = +3

Query  228   NPCGKASRFGAESGYSLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKN  407
             +P    SR    +G  +  +R  SSE+ RE+IEYDV+IVGAGPAGLSAAIRLKQL +EKN
Sbjct  69    SPLNPNSRILGVNG--ITSSRCISSEAVRESIEYDVLIVGAGPAGLSAAIRLKQLSQEKN  126

Query  408   ADLSVCVVEKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA  587
              DLSVCVVEKGAEVG HI+SGNVFEP ALDELLP WRQE  PI++P SSDKF  L+K+RA
Sbjct  127   IDLSVCVVEKGAEVGGHIISGNVFEPLALDELLPHWRQEHAPIEIPASSDKFWFLTKDRA  186

Query  588   FSLPSPFENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDM  767
             FSLPSPF+NKGNYVISLSQLVRWLG KAEELG E+YPGF+ASE+L++ SD+V+GIAT DM
Sbjct  187   FSLPSPFDNKGNYVISLSQLVRWLGGKAEELGTEIYPGFSASEVLFDASDKVVGIATKDM  246

Query  768   GVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKE  947
             G++KDGS+KENFQ GV++KGRVTL AEGCRGSL+E++I KYKLRE+ N QHQTYALGIKE
Sbjct  247   GISKDGSKKENFQPGVDIKGRVTLFAEGCRGSLSERIIKKYKLREEVNAQHQTYALGIKE  306

Query  948   VWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEE  1127
             VWEID +KH PG+V+HT+GWPLD KTYGGSFLYHM +RQVA+GLVVALNYHNPFLNPYEE
Sbjct  307   VWEIDESKHNPGEVIHTLGWPLDPKTYGGSFLYHMNDRQVALGLVVALNYHNPFLNPYEE  366

Query  1128  FQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQCS  1232
             FQK KHHPAI+ +LEGGTVLQYGARTLNEGG+Q S
Sbjct  367   FQKLKHHPAIKGILEGGTVLQYGARTLNEGGFQVS  401



>ref|XP_010234895.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X2 [Brachypodium distachyon]
Length=465

 Score =   492 bits (1266),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/328 (74%), Positives = 284/328 (87%), Gaps = 11/328 (3%)
 Frame = +3

Query  252   FGAESGYSLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVV  431
             +GAE+   L+G R        EA+ YDVV+VGAGPAGL+AAIRLKQLCR  + DLSVCV+
Sbjct  27    WGAETARWLSGGR--------EALNYDVVVVGAGPAGLAAAIRLKQLCRAADTDLSVCVL  78

Query  432   EKGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFE  611
             EKGAEVGAH+LSGNVFEPRALDEL+P+WRQE  PI VPVSSDKF +L+KN+A++LPSPF+
Sbjct  79    EKGAEVGAHVLSGNVFEPRALDELIPKWRQEDAPIRVPVSSDKFWMLTKNKAWTLPSPFD  138

Query  612   NKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDE---VIGIATNDMGVAKD  782
             NKGNYVISLSQLVRW+  KAEELG+E+YPGFAASEILY+E+DE   V G+ATND+G+AKD
Sbjct  139   NKGNYVISLSQLVRWMAVKAEELGIEIYPGFAASEILYDENDENQIVAGVATNDVGIAKD  198

Query  783   GSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEID  962
             G+++E FQ GVEL+GR+TLLAEGCRGSL+E +I  YKLRE G GQHQTYALGIKEVWEI+
Sbjct  199   GTKRETFQPGVELRGRITLLAEGCRGSLSETIIRNYKLRESGQGQHQTYALGIKEVWEIE  258

Query  963   ANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFK  1142
               KH PG V+HT+GWPLD KTYGGSFLYH+ +RQ+AIGLVVALNY NPFL+PY+EFQKFK
Sbjct  259   EGKHEPGSVVHTVGWPLDTKTYGGSFLYHLDDRQLAIGLVVALNYRNPFLSPYDEFQKFK  318

Query  1143  HHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
              HPAI  LLEGGT LQYGARTLNEGG+Q
Sbjct  319   QHPAIGTLLEGGTCLQYGARTLNEGGFQ  346


 Score =   177 bits (450),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKG+HTAMKSGMLAAE+ F  L  GS+M+ + +NL+ SWIW
Sbjct  352   VFPGGAIIGCSAGFLNVPKIKGSHTAMKSGMLAAEATFKALVEGSSMDLYGENLKKSWIW  411

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             +ELY ARNYRPAFE G  PG+ALSA+ERYI KG+SP T KHG+PDHEA +
Sbjct  412   EELYRARNYRPAFEYGFIPGMALSAVERYIFKGKSPFTLKHGEPDHEATD  461



>ref|WP_008943254.1| electron transfer flavoprotein [Oceanibaculum indicum]
 gb|EKE78531.1| dehydrogenase [Oceanibaculum indicum P24]
Length=546

 Score =   401 bits (1031),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 243/307 (79%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVGAGP+GLSAAIRLKQ+C E   D+SVC+VEKG+EVGAHILSG V EPRA
Sbjct  3     RESMEYDVVIVGAGPSGLSAAIRLKQICAETGKDVSVCIVEKGSEVGAHILSGAVLEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL+P W+++  P++ P + D+F+ L++++AF LP+P    N GNY++SL  + RWLG+
Sbjct  63    LNELIPDWKEKGAPLNTPAADDRFMFLTESKAFKLPTPPQMNNHGNYIVSLGNVCRWLGE  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGFAA+E+LY+E+  V G+AT DMG+ KDG +  N+  GVEL  ++TL A
Sbjct  123   QAEALGVEIYPGFAAAEVLYDENGAVRGVATGDMGIGKDGEQTANYTPGVELHAKITLFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL++ +  K++LR+  +   QT+ +GIKE+WEID  KH+PG V H+IGWP+D  T
Sbjct  183   EGCRGSLSKGLFQKFELRK--DCDPQTFGIGIKELWEIDPEKHKPGLVWHSIGWPMDTNT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++  Q+A+G V+ L+Y NP+L+P++EFQ+FK HPA++P  EG   + YGAR 
Sbjct  241   YGGSFLYHLEGNQMAVGFVIGLDYQNPYLSPFDEFQRFKLHPAVKPFFEGARRISYGARA  300

Query  1206  LNEGGYQ  1226
             LNEGG+Q
Sbjct  301   LNEGGFQ  307


 Score =   267 bits (682),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 170/235 (72%), Gaps = 7/235 (3%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQ-----GGSNMETFWDNLR  1390
              FPGGA+IGC+AGFLNVPKIKGTHTAMKSGMLAAE+AF+ L       G  +  + + L+
Sbjct  313   TFPGGALIGCTAGFLNVPKIKGTHTAMKSGMLAAEAAFEALTQEGAGNGIELTAYPEALK  372

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
             +SW+W ELY  RN RPAF  G++ GLA SA++ Y+ +G++P T ++   DH  + +A   
Sbjct  373   ASWVWGELYGVRNIRPAFHYGMWSGLAYSALDTYLFRGKAPWTLRN-HADHPQLKKASEC  431

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI+YPKPDG I+FD L+SV+ SNTNH+ +QPAHL L+D   P  VNL  Y  PE RYCP
Sbjct  432   TPIDYPKPDGKITFDKLSSVFISNTNHEENQPAHLTLRDKSVPIEVNLALYDAPEQRYCP  491

Query  1751  ARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE + DD+G   +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  492   AGVYEIVRDDDGSNPRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPNYPNM  546



>ref|XP_004352386.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Dictyostelium 
fasciculatum]
 gb|EGG16061.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Dictyostelium 
fasciculatum]
Length=1219

 Score =   388 bits (996),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 188/368 (51%), Positives = 254/368 (69%), Gaps = 21/368 (6%)
 Frame = +3

Query  147   KTMLKFILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGARGFSSESC-----  311
             + ML+F      + +S T +N   SF  P      +        N  RGFS+ S      
Sbjct  621   RKMLRFQRVLNNNNISKTVLN---SFIKPSTTTVYY--------NNNRGFSTSSSNEDLG  669

Query  312   -REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPR  488
              R++ ++DVVIVGAGP+GLSAAIR+KQLC+E+  DL VCVVEKGAEVG+HILSG V +P 
Sbjct  670   PRDSDQFDVVIVGAGPSGLSAAIRIKQLCQEQGKDLRVCVVEKGAEVGSHILSGAVLQPT  729

Query  489   ALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLG  662
             ALDEL+P W+++  P++ PV  D F  L+++    LP+P    N+GNY++S+  +VRWLG
Sbjct  730   ALDELIPDWKEKGAPLNTPVKEDAFYFLTESNKIRLPTPRLLHNEGNYIVSMGNVVRWLG  789

Query  663   QKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLL  842
             Q+AEE+GVE+YPGFAASE+LY E   V GIAT+D+G+ KDG    +F  G+EL+  +TL 
Sbjct  790   QQAEEMGVEIYPGFAASEVLYKEDGSVDGIATSDVGIGKDGKPTSHFTRGMELRAPLTLF  849

Query  843   AEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHK  1022
             AEGCRGSL + +  K+ LR+  +   QT+ LGIKE+W++     + G V+HT+G PL   
Sbjct  850   AEGCRGSLTKTLFSKFDLRD--DCDVQTFGLGIKELWQVKPEVFQAGKVVHTLGHPLSTD  907

Query  1023  TYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGAR  1202
             TYGGSF+YHM++  V+IGLVV L+Y NP+LNPY+EFQ+ K HP  R +LEGG  +QYGAR
Sbjct  908   TYGGSFMYHMEDNLVSIGLVVGLDYENPYLNPYQEFQRMKQHPVFRSVLEGGQCIQYGAR  967

Query  1203  TLNEGGYQ  1226
             T+NEGG Q
Sbjct  968   TINEGGLQ  975


 Score =   281 bits (718),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 168/239 (70%), Gaps = 10/239 (4%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML-----QGGSN----METFW  1378
             +FPGGA+IGC+AGF+NVPKIKG H AMK+GMLAAE+AF+ L     +  SN    +E + 
Sbjct  981   IFPGGALIGCTAGFVNVPKIKGNHNAMKTGMLAAEAAFESLIKQKEEEESNKAIVLENYP  1040

Query  1379  DNLRSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINE  1558
             + L+ SW+W +L   +N RP+F  G  PGL  SA+E YI +G +P T  HGKPDH+    
Sbjct  1041  EKLKKSWVWSDLKEVKNIRPSFHWGFLPGLIYSALEMYIFRGNAPWTLSHGKPDHQRTKP  1100

Query  1559  AKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPES  1738
             A  S  I YPKPDG ++FD++TSV RS TNH+ +QPAHL+++D K  E VN   Y GPE 
Sbjct  1101  ASESTKITYPKPDGLVTFDLMTSVSRSGTNHEENQPAHLKVRDYKVAERVNRDIYDGPEG  1160

Query  1739  RYCPARVYEYISDDNGEVK-LNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             R+CPA VYE++  D  + K L INAQNC+HCK CDIKDPTQNI +TVPEG GGP Y  M
Sbjct  1161  RFCPAGVYEWVEKDGQKDKQLQINAQNCVHCKTCDIKDPTQNIDFTVPEGTGGPQYGSM  1219



>ref|WP_027300957.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Rhodospirillales 
bacterium URHD0088]
Length=539

 Score =   400 bits (1028),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 188/308 (61%), Positives = 235/308 (76%), Gaps = 4/308 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE +EYDVVIVGAGP+GL+AAIRLKQL    + +L+VCV+EKG+EVGAHILSG VFEPRA
Sbjct  3     RETMEYDVVIVGAGPSGLAAAIRLKQLAAAADRELAVCVIEKGSEVGAHILSGAVFEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             LDEL+P W+    P++ P   D+F+LL+  RA  LP+P    N GNY+ISL  L RWL  
Sbjct  63    LDELIPDWKTRGAPLNTPAVEDRFVLLTATRAIRLPTPPQMNNHGNYIISLGNLCRWLAG  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGFAA+E+LY+ES  V G+AT  MG+ KDG   ++F  GVEL G+ TL A
Sbjct  123   QAEALGVEIYPGFAAAEVLYDESGRVRGVATGSMGLGKDGKPTDHFTPGVELIGKETLFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL + +  ++KLRE  +   QT+ +GIKE+WE++  KH PG V HTIGWPLD+ T
Sbjct  183   EGCRGSLTKTLFERFKLREGVD--PQTFGIGIKELWEVEPEKHHPGLVTHTIGWPLDNST  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++  QVA+G VV L+Y NPFL+P+EEFQ+FK HPAIRPL EGG  + YGAR 
Sbjct  241   YGGSFLYHLENNQVAVGFVVGLDYRNPFLSPFEEFQRFKTHPAIRPLFEGGRRISYGARA  300

Query  1206  LNEGGYQC  1229
             LNEGG+Q 
Sbjct  301   LNEGGFQA  308


 Score =   267 bits (683),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 160/229 (70%), Gaps = 4/229 (2%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIWK  1408
             FPGG++IGC+AGFLNV KIKG+HTAMKSGM+AAE+ F  L G S    +   +  SW+W 
Sbjct  314   FPGGSIIGCAAGFLNVAKIKGSHTAMKSGMVAAETVFARLDGRSG--DYRKAMSESWVWD  371

Query  1409  ELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEYP  1588
             EL   RN RP+F  GL+ GLA SA++ Y+ +G +P T  H   DH  +++A  + PI YP
Sbjct  372   ELQRVRNIRPSFRWGLWGGLAYSALDTYVFRGNAPWTMHH-HADHLQLDKAADAKPIAYP  430

Query  1589  KPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYEY  1768
             KPDG +SFD L+SV+ SNTNH+ +QPAHL+LKDP     VN   Y  PE RYCPA VYE 
Sbjct  431   KPDGKVSFDRLSSVFISNTNHEENQPAHLQLKDPDLAISVNYVLYDSPEQRYCPAGVYEI  490

Query  1769  I-SDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             + + D G  +L INAQNC+HCK CDIKDP QNI W VPEGGGGP Y  M
Sbjct  491   VDAPDGGHKRLQINAQNCVHCKTCDIKDPAQNINWVVPEGGGGPNYPNM  539



>ref|WP_029133943.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Sedimenticola 
selenatireducens]
Length=542

 Score =   386 bits (992),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 237/307 (77%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA+E+DVVIVGAGP+GLSAAIRL QL  +   +L++CVVEKG+EVGAHILSG V EPRA
Sbjct  3     REAMEFDVVIVGAGPSGLSAAIRLAQLANQNEQELTICVVEKGSEVGAHILSGAVLEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL+P W++   P+D P S D+F+ L++ ++ S+P+P    N GNY+ISL    RWL +
Sbjct  63    LNELIPDWKERGAPLDTPASEDRFVYLTEKKSISMPNPPQMHNAGNYIISLGNFCRWLAE  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE+LG+E++PGFAA+E+LY+E+  V GIAT DMGV + G + +N++ G+EL  + T+ +
Sbjct  123   QAEQLGIEIFPGFAAAEVLYDENGAVRGIATGDMGVGRSGEKTDNYEPGIELHAKQTIFS  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL ++++ ++ LRE  +   QTY +GIKE+WEID  K +PG ++H+IGWPLD +T
Sbjct  183   EGCRGSLTKELMERFNLREGVD--PQTYGIGIKELWEIDPAKVKPGTIMHSIGWPLDSQT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+ E QV +G VV L+Y NP L+P+EEFQ+FK HP IRPL EGG  + YGAR 
Sbjct  241   YGGSFLYHLSENQVVVGFVVGLDYKNPHLSPFEEFQRFKTHPDIRPLFEGGRRVSYGARA  300

Query  1206  LNEGGYQ  1226
             L+EGG Q
Sbjct  301   LSEGGLQ  307


 Score =   281 bits (718),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 168/231 (73%), Gaps = 3/231 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML--QGGSNMETFWDNLRSSW  1399
              FPGG ++G +AGFLNVPKIKGTHTAMKS M+AAE+ F+ +  +G   ++T+ + LR SW
Sbjct  313   TFPGGLLVGDTAGFLNVPKIKGTHTAMKSAMVAAEAIFEQISDEGHKEIKTYPERLRQSW  372

Query  1400  IWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPI  1579
             +W+EL   RN RP F  GL+ GL  +A+E Y+ +G++P T  H  PDHE + +A     I
Sbjct  373   LWEELNQVRNIRPGFSKGLWFGLFNAALETYLFRGKAPWTLHH-HPDHEQLGKAADYPRI  431

Query  1580  EYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARV  1759
             +YPKPDG I+FD L+SV+ SNTNH+ DQP HL+LKDP+ P  VNL  Y  PE RYCPA V
Sbjct  432   DYPKPDGKITFDRLSSVFISNTNHEEDQPIHLKLKDPEVPIKVNLALYDAPEQRYCPAGV  491

Query  1760  YEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YE + ++  + +L INAQNC+HCK CDIKDPTQNI WTVPEGGGGP Y  M
Sbjct  492   YEILQEEGQQPQLQINAQNCVHCKTCDIKDPTQNINWTVPEGGGGPNYPNM  542



>ref|WP_019644428.1| electron transfer flavoprotein [Novispirillum itersonii]
Length=545

 Score =   388 bits (996),  Expect(2) = 4e-180, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 237/307 (77%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++E+DVVIVG GP+GLSAAIRLKQL +   AD+SVCV+EKG+E+GAHILSG V EPRA
Sbjct  3     RESMEFDVVIVGGGPSGLSAAIRLKQLAQADGADISVCVIEKGSEIGAHILSGAVIEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL+P W+++  P+  P + D FL L++++AF LP+P      GNY++SL  + RWLGQ
Sbjct  63    LNELIPDWKEKGAPLHTPATDDNFLFLTESKAFKLPTPPQMHGAGNYIVSLGNVTRWLGQ  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AEELGVE+YPGFA +E+LY+E+  V G+AT DMG+ ++G +   +Q G+EL  + T+ A
Sbjct  123   QAEELGVEIYPGFAGAEVLYDETGAVRGVATGDMGLTREGEQGPMYQPGMELLAKQTIFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSLA+Q+  KY LR+  +   QTY +GIKE+WE++ +KH+PG V+HTIGWP+   T
Sbjct  183   EGCRGSLAKQLTDKYGLRDGVD--PQTYGIGIKELWEVEPSKHQPGKVVHTIGWPMKTDT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++  QVA+G V+ L+Y NP L+P++EFQ+FK HP IR   EGG  + YGAR 
Sbjct  241   YGGSFLYHLENNQVAVGFVIGLDYANPHLSPFDEFQRFKTHPEIRKTFEGGRRIAYGARA  300

Query  1206  LNEGGYQ  1226
             LNEGG+Q
Sbjct  301   LNEGGFQ  307


 Score =   273 bits (699),  Expect(2) = 4e-180, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 163/235 (69%), Gaps = 8/235 (3%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG----GSNMETFWDNLRS  1393
              FPGG  IGCSAGFLNVPKIKGTHTAMKSGM+AAE+ F+ L+     G  +  + D ++ 
Sbjct  313   TFPGGVTIGCSAGFLNVPKIKGTHTAMKSGMVAAEAIFEALKAEAAAGKEVTAYSDMMKK  372

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+W+EL+  RN RP+F  GL  GL  SA+  Y+ KG+ P TF++   DH  +  A    
Sbjct  373   SWVWQELHEVRNIRPSFHKGLLFGLGYSALSTYVFKGKEPWTFRN-HDDHTCLRPAAEMP  431

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
              I+YPKPDG +SFD L+SV+ S+TNH+ DQP HL LK+   P  VNL  + GPE R+CPA
Sbjct  432   KIDYPKPDGVVSFDKLSSVFLSSTNHEEDQPCHLTLKNKDVPVAVNLKVFDGPEQRFCPA  491

Query  1754  RVYEYISD--DNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYEY+ D   NG+ +L INAQNC+HCK CDIKDPTQNI W VP+GG GP Y  M
Sbjct  492   GVYEYVDDAATNGK-RLQINAQNCVHCKTCDIKDPTQNINWVVPQGGEGPNYPNM  545



>gb|EIE75850.1| hypothetical protein RO3G_00554 [Rhizopus delemar RA 99-880]
Length=614

 Score =   363 bits (933),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 173/305 (57%), Positives = 226/305 (74%), Gaps = 6/305 (2%)
 Frame = +3

Query  324   EYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDEL  503
             E DVVIVG GPAGLSAAIRLKQL   ++ ++ V VVEK  E+GAH LSG V EPRALDEL
Sbjct  71    ETDVVIVGGGPAGLSAAIRLKQLANAQDKEVRVMVVEKAGELGAHSLSGAVLEPRALDEL  130

Query  504   LPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAEE  677
             +P W+++  P++ PV+ D    L+K+ +  LP P    NKGNY++SL+  V+WLG++AEE
Sbjct  131   IPDWKEKGAPLNTPVTHDSMRFLTKSLSIPLPHPPQMNNKGNYIVSLNNFVKWLGEQAEE  190

Query  678   LGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCR  857
             LGVE+YPGFAAS+ILYNE   V G+A ND+G+ K+   K+ ++ G+++K +VTLL EGC 
Sbjct  191   LGVEIYPGFAASDILYNEDGSVRGVALNDVGLDKNFEPKDTYERGMQIKAKVTLLGEGCH  250

Query  858   GSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGS  1037
             GSL + +  K+ LR++     Q Y LG+KEVWE+   KH+PG V+H++GWP+D  TY GS
Sbjct  251   GSLTKSLTKKFDLRKESGP--QKYGLGLKEVWEVSPEKHKPGHVIHSVGWPVDMHTYSGS  308

Query  1038  FLYHMK-ERQ-VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLN  1211
             FLYH + ER  VAIG VV L+Y NP+LNPY+ FQ FKHHP+I+ LLEGG  + YGAR LN
Sbjct  309   FLYHFEPERHLVAIGFVVGLDYENPYLNPYKTFQMFKHHPSIKSLLEGGKCISYGARALN  368

Query  1212  EGGYQ  1226
             EGGYQ
Sbjct  369   EGGYQ  373


 Score =   296 bits (758),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 176/234 (75%), Gaps = 7/234 (3%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNMETFWDNLRSS  1396
             VFPGGA+IGC+AGFLNVPKIKGTHTAMKSGMLAAESAFD L   +G   ++ + D +++S
Sbjct  379   VFPGGALIGCTAGFLNVPKIKGTHTAMKSGMLAAESAFDRLFEEEGAIVLDNYEDKIKNS  438

Query  1397  WIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
             W++ ELY  RN  P+F +  GL+ GLA S ++  +LKGR P TFKH K D E +  A  S
Sbjct  439   WVYDELYQVRNIIPSFHSPLGLYGGLAYSGLDTLLLKGRVPWTFKHKKADWECMKTAAES  498

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI+YPKPDG ISFD+LT+V R+ TNH  +QP HLR++D K P   NL  + GPE+R+CP
Sbjct  499   KPIDYPKPDGVISFDLLTNVSRTGTNHAENQPIHLRIRDTKKPVERNLALFDGPENRFCP  558

Query  1751  ARVYEYISDDN--GEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYT  1906
             A VYEY+ D+N  GE +L IN+QNC+HCK CDIKDP+QNI WTVPEGGGGP Y 
Sbjct  559   AGVYEYVEDENKPGEKRLQINSQNCIHCKTCDIKDPSQNIDWTVPEGGGGPQYV  612



>ref|WP_037461408.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Skermanella 
stibiiresistens]
Length=544

 Score =   374 bits (961),  Expect(2) = 2e-179, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 233/307 (76%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE +EYDVVIVGAGP+GLSAAIRLKQL  E   ++SVCV+EKG+EVGAH+LSG V EPRA
Sbjct  3     REVMEYDVVIVGAGPSGLSAAIRLKQLAAEHEREVSVCVLEKGSEVGAHLLSGAVLEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL+P W+++  P++ P + D FL L++ ++  LP+P    N GNY+ISL    RWL  
Sbjct  63    LNELIPDWKEKGAPLNTPATEDHFLYLTEKKSVKLPNPPQMNNHGNYIISLGAFGRWLAA  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AEELGVE+YPGFAA+E+LY E   V G+AT DMG+ KDG   + F  G+EL  + T+ A
Sbjct  123   QAEELGVEIYPGFAAAEVLYAEDGTVKGVATGDMGIGKDGQPTDAFTPGMELHAKQTIFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSLA+ ++ ++KLR+  +   QTY +GIKE+WEI+  KH+ G V+HT+GWP+D KT
Sbjct  183   EGCRGSLAKGLMERFKLRDGVD--PQTYGIGIKELWEIEPAKHKQGLVVHTVGWPMDAKT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGS++YHM+  QV+IG V+ L+Y NP L+P++EFQ+FK HP +R  LEGG  + YGAR 
Sbjct  241   YGGSWMYHMENNQVSIGFVIGLDYENPHLSPFDEFQRFKLHPDVRKYLEGGRRISYGARA  300

Query  1206  LNEGGYQ  1226
             L+EGG+Q
Sbjct  301   LSEGGFQ  307


 Score =   285 bits (729),  Expect(2) = 2e-179, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 172/233 (74%), Gaps = 5/233 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNMETFWDNLRSS  1396
              FPGG++IG +AGFLNVPKIKG HTAMKSGML AE+ FD L     GS +  + D ++SS
Sbjct  313   TFPGGSLIGDTAGFLNVPKIKGNHTAMKSGMLCAEAIFDHLGDEAAGSEVTDYPDRVKSS  372

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+W+ELYH RN RP+F  GL+ G+A SA++ ++L+G++P TFK+   DH  + +A  +  
Sbjct  373   WLWEELYHVRNIRPSFRRGLWGGIAYSALDTFVLRGKAPWTFKN-HADHLQLKKASEAPK  431

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VNL +Y  PE RYCPA 
Sbjct  432   IAYPKPDGVLTFDKLSSVFISNTNHEENQPAHLTLKDPSIPIKVNLAEYDAPEQRYCPAG  491

Query  1757  VYEYISDDNG-EVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE + +D+G   +L INAQNC+HCK CDIKDPTQNI W VPEGGGGP Y  M
Sbjct  492   VYEIVREDSGANPRLQINAQNCVHCKTCDIKDPTQNINWVVPEGGGGPNYPNM  544



>ref|WP_009539099.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Caenispirillum 
salinarum]
 gb|EKV32611.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Caenispirillum 
salinarum AK4]
Length=544

 Score =   378 bits (971),  Expect(2) = 4e-179, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 228/307 (74%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++E+DVV+VGAGPAGLSAAIRL+QL  E + + SVCV+EKG+EVGAHILSG V E RA
Sbjct  3     RESMEFDVVVVGAGPAGLSAAIRLRQLAMENDKECSVCVIEKGSEVGAHILSGAVVETRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             LDEL+P W+ +  P+ V    D FL L++ +A  LP+P    N GNY++SL  + RWLG+
Sbjct  63    LDELIPDWKDKGAPLTVEAKDDSFLFLTEGKATKLPTPPQMHNHGNYIVSLGNVCRWLGE  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE L VE+YPGFAA+E+LYNE   V G+AT DMGV+K G +   ++ GVEL  + T+ A
Sbjct  123   QAEALEVEVYPGFAAAEVLYNEDGSVKGVATGDMGVSKSGEKTAAYEPGVELHAKYTIFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRG+L + +  K+ LR+  +   QTY +GIKE+WEI   K +PG V+HTIGWPLD  T
Sbjct  183   EGCRGNLTKTLFDKFDLRK--DCDPQTYGIGIKELWEIAPEKSKPGSVVHTIGWPLDSHT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSF+YH+   Q+AIG VV L+Y NP L+P++EFQ+FKHHPAI+ LLEGG  + YGAR 
Sbjct  241   YGGSFIYHLDNNQLAIGFVVGLDYQNPHLSPFDEFQRFKHHPAIKTLLEGGRRVSYGARA  300

Query  1206  LNEGGYQ  1226
             L EGG Q
Sbjct  301   LTEGGVQ  307


 Score =   280 bits (715),  Expect(2) = 4e-179, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 166/233 (71%), Gaps = 5/233 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNMETFWDNLRSS  1396
              FPGG ++G +AGFLNVPKIKGTHT MKS MLAA+S F  L   +    + ++ D +++S
Sbjct  313   TFPGGVLVGDTAGFLNVPKIKGTHTCMKSAMLAADSIFAELGKDEPAKEVTSYTDAVKNS  372

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+W ELY  RN RP+F  GL+  LA SA++ Y+ +G++P TFK+   DH A+ +AK    
Sbjct  373   WVWDELYKVRNVRPSFHKGLWYALAYSALDTYLFRGKAPWTFKN-HADHTALKKAKDCPK  431

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I+YPKPDG ISFD L+SV+ SNTNH  DQP HL LKD K P   NLP++ GPE RYCPA 
Sbjct  432   IDYPKPDGVISFDKLSSVFISNTNHAEDQPVHLTLKDDKVPTGTNLPEFDGPEQRYCPAG  491

Query  1757  VYEYISD-DNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYEY+ D D G  KL INAQNC+HCK CDIKDPTQNI W VP+GG GP Y  M
Sbjct  492   VYEYVEDEDQGGRKLQINAQNCVHCKTCDIKDPTQNINWVVPQGGDGPNYPNM  544



>dbj|GAM20797.1| hypothetical protein SAMD00019534_039720, partial [Acytostelium 
subglobosum LB1]
Length=614

 Score =   386 bits (991),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 193/370 (52%), Positives = 262/370 (71%), Gaps = 14/370 (4%)
 Frame = +3

Query  150   TMLKFILSSAKSKLSTTPINRFSSFPNPCGKASRFG----AESGYSLNGARGFSSESC--  311
             TMLK + ++  SK  ++  +   SF       + FG    + SG S +  R +S+ +   
Sbjct  2     TMLK-LFTNIASKNQSSSQSLLVSFGRRAAYTTPFGGGIISNSGRSRSIFRYYSTSTSEE  60

Query  312   ---REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFE  482
                RE+ ++DVVIVGAGP+GLSAAI+LKQL +  N +L VCVVEKGAEVG+HILSG V +
Sbjct  61    LGERESDQFDVVIVGAGPSGLSAAIKLKQLAQAANTELRVCVVEKGAEVGSHILSGAVLQ  120

Query  483   PRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFE--NKGNYVISLSQLVRW  656
             P AL+EL+P W++   P++ PV+ DKF  L++  +  LP+P    N+GNY+ISL  L++W
Sbjct  121   PTALNELIPDWKERGAPLNTPVTEDKFYFLTEKYSVRLPTPLHLHNEGNYIISLGNLMKW  180

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             +GQ+AEELGVE+YPGFAASE+LY++   V GIAT+DMG+ KDG    +F  G+EL+ R T
Sbjct  181   MGQQAEELGVEIYPGFAASEVLYDDKGTVKGIATSDMGIGKDGKPTSHFTRGMELRARCT  240

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRGSL + +I K+ L +  + Q QTY LGIKE+W+I    H+ G  LHTIG+P+D
Sbjct  241   LFAEGCRGSLTKTLIKKFALDK--DVQGQTYGLGIKEIWQIKPENHKAGLTLHTIGFPMD  298

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGG F+YH++   ++IGLVV L+Y NP+LNPY+EFQK K HP I+P+LEG T +QYG
Sbjct  299   LNTYGGGFVYHLENNLMSIGLVVGLDYSNPYLNPYQEFQKMKLHPLIKPMLEGATCVQYG  358

Query  1197  ARTLNEGGYQ  1226
             ART+NEGG Q
Sbjct  359   ARTINEGGVQ  368


 Score =   270 bits (690),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 172/241 (71%), Gaps = 12/241 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML--QGGSNMET--------F  1375
             VFPGGA+IGCSAGF+NVPKIKG H AMKSGMLAAE+ FD L  +G +  ET        +
Sbjct  374   VFPGGALIGCSAGFVNVPKIKGNHNAMKSGMLAAEAVFDELTKEGAAEQETEKPLMLSAY  433

Query  1376  WDNLRSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
                L++SW+W++LY  RNYRP F  GL P LAL A+E YI +G+ P+T KH   D+E + 
Sbjct  434   PTKLKNSWVWEDLYAVRNYRPMFHWGLLPALALGALEMYIFRGKLPITLKHASRDNETLK  493

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK    ++YPKPDG  +FD++TSV RS TNH+ +QPAHL++++    E VN  KY GPE
Sbjct  494   PAKDCKKLQYPKPDGVYTFDLMTSVMRSGTNHEENQPAHLKVRNMSVAEKVNRDKYDGPE  553

Query  1736  SRYCPARVYEYISDDNGE--VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTV  1909
              R+CPA VYE+I  +  E   KL INAQNCLHCK CDIKDPTQNI +TVPEGGGGP Y+ 
Sbjct  554   GRFCPAGVYEWIELEGKEDKKKLQINAQNCLHCKTCDIKDPTQNIDYTVPEGGGGPNYSN  613

Query  1910  M  1912
             M
Sbjct  614   M  614



>gb|KEH39484.1| electron transfer flavoprotein ubiquinone oxidoreductase [Medicago 
truncatula]
Length=388

 Score =   380 bits (975),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 173/236 (73%), Positives = 198/236 (84%), Gaps = 0/236 (0%)
 Frame = +2

Query  1205  FKRRRLSVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDN  1384
             F+     VFPGGA++GCSAGFLNVPKIKGTHTAMKSGMLAAE+AF +   G +M T+WD 
Sbjct  153   FQSVPYPVFPGGAIVGCSAGFLNVPKIKGTHTAMKSGMLAAEAAFGVFNEGLDMNTYWDA  212

Query  1385  LRSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAK  1564
             LR+SWIW+ELY +RNYRPAF+ GL PGLALS +E YILKGR P+T KHGKPDHEA N A+
Sbjct  213   LRNSWIWEELYKSRNYRPAFKYGLIPGLALSGLEHYILKGRHPITLKHGKPDHEATNAAE  272

Query  1565  SSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRY  1744
                PI YPKPDG  SFD+ TS++RSNTNH+HDQP HLRL+DPK PEL NLP +A PESRY
Sbjct  273   LHSPIHYPKPDGVFSFDVPTSLHRSNTNHEHDQPPHLRLRDPKIPELTNLPVFAAPESRY  332

Query  1745  CPARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             CPARVYEY +D+  ++KL INAQNCLHCKACDIKDP QNIKWTVPEGGGGPGY+VM
Sbjct  333   CPARVYEYAADEQNQLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM  388


 Score =   275 bits (704),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  765   MGVAKDGSRKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIK  944
             MG++KDGS+KE FQ GVE+KG++TLL+EGCRGSL+EQ++ KY LREKG  +HQTYALGIK
Sbjct  1     MGISKDGSKKETFQRGVEVKGQITLLSEGCRGSLSEQIMKKYNLREKGGAEHQTYALGIK  60

Query  945   EVWEIDANKHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYE  1124
             EVWEID  KH+PG VLHT+GWPLDHKTYGGSFLYHMK+RQ+++GLVVALNY NPF+NPYE
Sbjct  61    EVWEIDEEKHQPGAVLHTLGWPLDHKTYGGSFLYHMKDRQISLGLVVALNYQNPFMNPYE  120

Query  1125  EFQKFKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             EFQKFKHHPAI+P LEGGTV+QYGARTLNEGG+Q
Sbjct  121   EFQKFKHHPAIKPFLEGGTVIQYGARTLNEGGFQ  154



>emb|CEI86823.1| Putative Electron transfer flavoprotein ubiquinone oxidoreductase 
[Rhizopus microsporus]
Length=615

 Score =   361 bits (926),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 169/305 (55%), Positives = 224/305 (73%), Gaps = 6/305 (2%)
 Frame = +3

Query  324   EYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDEL  503
             E DVVI+G GPAGLSAAIRLKQL  E+  +  V VVEK  EVGAH LSG V EPRAL+EL
Sbjct  70    ETDVVIIGGGPAGLSAAIRLKQLANEQGKECRVMVVEKAGEVGAHTLSGAVLEPRALNEL  129

Query  504   LPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAEE  677
             +P W+++  P++ PV+ D    L+K  +  LP P    NKGNY++SLS  V+WLG++AEE
Sbjct  130   IPDWKEKGAPLNTPVTKDSMRFLTKTLSIPLPHPPQMNNKGNYIVSLSNFVKWLGEQAEE  189

Query  678   LGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCR  857
             LGVE+YPGFAAS++LYNE   V G+A ND+G+ K+   K+N++ G++++ +VTL AEGC 
Sbjct  190   LGVEIYPGFAASDVLYNEDGSVRGVALNDVGLDKNFEPKDNYERGMQIQAKVTLFAEGCH  249

Query  858   GSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGS  1037
             GSL + ++ K+ LR++     Q Y +G+KEVWE+   KH+PG V H++GWP D  TY GS
Sbjct  250   GSLTKGLVKKFDLRKESG--PQKYGIGLKEVWEVQPEKHQPGLVTHSVGWPADMHTYAGS  307

Query  1038  FLYHMK-ERQ-VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLN  1211
             F+YH + ER  VAIG VV L+Y NP+LNPY+ FQ FKHHP+I+P LEGG  + YGAR +N
Sbjct  308   FMYHFEPERHLVAIGFVVGLDYENPYLNPYKTFQMFKHHPSIKPTLEGGKCISYGARAIN  367

Query  1212  EGGYQ  1226
             EGG+Q
Sbjct  368   EGGFQ  372


 Score =   294 bits (753),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 176/236 (75%), Gaps = 9/236 (4%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML-----QGGSNMETFWDNLR  1390
             VFPGGA+IGC+AGFLNVPKIKGTHTAMKS MLAAESAFD+L     +G   +  + ++++
Sbjct  378   VFPGGALIGCTAGFLNVPKIKGTHTAMKSAMLAAESAFDVLFNQQPEGPIVLNNYEESIK  437

Query  1391  SSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAK  1564
             +SW++KELY  RN  P+F +  GLF GLA S ++  ILKGR+P TFKH K D E +  A 
Sbjct  438   NSWVYKELYQVRNLVPSFHSPLGLFGGLAYSGLDSLILKGRTPWTFKHKKADWECMKTAG  497

Query  1565  SSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRY  1744
                PIEYPKPDG ISFD+LT+V R+ TNH  +QP HLR++D   P   NL  + GPE+R+
Sbjct  498   ECKPIEYPKPDGVISFDLLTNVSRTGTNHAENQPVHLRIRDAAKPVERNLAIFDGPENRF  557

Query  1745  CPARVYEYISDDN--GEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYT  1906
             CPA VYEY+ D+N  GE +L IN+QNC+HCK CDIKDP+QNI WTVPEGGGGP Y 
Sbjct  558   CPAGVYEYVDDENKPGEKRLQINSQNCIHCKTCDIKDPSQNIDWTVPEGGGGPQYV  613



>gb|EWY36007.1| electron transfer flavoprotein [Skermanella stibiiresistens SB22]
Length=539

 Score =   370 bits (951),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 231/304 (76%), Gaps = 4/304 (1%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVGAGP+GLSAAIRLKQL  E   ++SVCV+EKG+EVGAH+LSG V EPRAL+E
Sbjct  1     MEYDVVIVGAGPSGLSAAIRLKQLAAEHEREVSVCVLEKGSEVGAHLLSGAVLEPRALNE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAE  674
             L+P W+++  P++ P + D FL L++ ++  LP+P    N GNY+ISL    RWL  +AE
Sbjct  61    LIPDWKEKGAPLNTPATEDHFLYLTEKKSVKLPNPPQMNNHGNYIISLGAFGRWLAAQAE  120

Query  675   ELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGC  854
             ELGVE+YPGFAA+E+LY E   V G+AT DMG+ KDG   + F  G+EL  + T+ AEGC
Sbjct  121   ELGVEIYPGFAAAEVLYAEDGTVKGVATGDMGIGKDGQPTDAFTPGMELHAKQTIFAEGC  180

Query  855   RGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGG  1034
             RGSLA+ ++ ++KLR+  +   QTY +GIKE+WEI+  KH+ G V+HT+GWP+D KTYGG
Sbjct  181   RGSLAKGLMERFKLRDGVD--PQTYGIGIKELWEIEPAKHKQGLVVHTVGWPMDAKTYGG  238

Query  1035  SFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNE  1214
             S++YHM+  QV+IG V+ L+Y NP L+P++EFQ+FK HP +R  LEGG  + YGAR L+E
Sbjct  239   SWMYHMENNQVSIGFVIGLDYENPHLSPFDEFQRFKLHPDVRKYLEGGRRISYGARALSE  298

Query  1215  GGYQ  1226
             GG+Q
Sbjct  299   GGFQ  302


 Score =   285 bits (728),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 172/233 (74%), Gaps = 5/233 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNMETFWDNLRSS  1396
              FPGG++IG +AGFLNVPKIKG HTAMKSGML AE+ FD L     GS +  + D ++SS
Sbjct  308   TFPGGSLIGDTAGFLNVPKIKGNHTAMKSGMLCAEAIFDHLGDEAAGSEVTDYPDRVKSS  367

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+W+ELYH RN RP+F  GL+ G+A SA++ ++L+G++P TFK+   DH  + +A  +  
Sbjct  368   WLWEELYHVRNIRPSFRRGLWGGIAYSALDTFVLRGKAPWTFKN-HADHLQLKKASEAPK  426

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VNL +Y  PE RYCPA 
Sbjct  427   IAYPKPDGVLTFDKLSSVFISNTNHEENQPAHLTLKDPSIPIKVNLAEYDAPEQRYCPAG  486

Query  1757  VYEYISDDNG-EVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE + +D+G   +L INAQNC+HCK CDIKDPTQNI W VPEGGGGP Y  M
Sbjct  487   VYEIVREDSGANPRLQINAQNCVHCKTCDIKDPTQNINWVVPEGGGGPNYPNM  539



>ref|WP_028220220.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
oxyphila]
Length=557

 Score =   384 bits (985),  Expect(2) = 4e-178, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 231/308 (75%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGVEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             +DEL+P W+++  P++VPV+ D+FL L++N A     ++LP  F+N GNYVISL+ + RW
Sbjct  73    IDELIPDWKEQGAPLNVPVTEDQFLFLTENGAKAVPNWALPDNFKNHGNYVISLANVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+LYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEVLYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+  K KL +  +   Q Y +GIKE+WEID  KH+PG V+HT GWPL+
Sbjct  193   LFAEGCRGHLGRQLNEKLKLGK--DADPQVYGIGIKELWEIDPAKHKPGLVIHTAGWPLE  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYH+   QV +G VV L Y NP+L+P+EEFQ++K HPAIR  LEGG  + YG
Sbjct  251   KDTYGGSFLYHIDNNQVMVGFVVGLAYQNPYLSPFEEFQRYKTHPAIRKYLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAMTAGG  318


 Score =   271 bits (693),  Expect(2) = 4e-178, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 160/232 (69%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSS  1396
             VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + +  + S
Sbjct  326   VFPGGALVGDDAGFLNAARIKGSHAAIKTGMLAAEAAFDAVQAGRQSDELTAYPEAFKQS  385

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W++ ELY ARN++     GL+ G  +  IE+ +L G  P T  H   DHE +  A    P
Sbjct  386   WLYTELYKARNFKQWMSKGLYLGTLMVGIEQKLLGGNVPWTLHHQHRDHEMLRPASQCKP  445

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA 
Sbjct  446   IEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEGRFCPAA  505

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  506   VYEFVKNDDGSDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_019255388.1| dehydrogenase [Burkholderia thailandensis]
Length=557

 Score =   382 bits (982),  Expect(2) = 4e-178, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P+DV V+ D+FL L++  AF     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLDVDVTEDRFLFLTEKSAFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MG+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ ++KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDQFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   272 bits (695),  Expect(2) = 4e-178, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 163/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++KG  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMSKGLYLGTLMVGVEQKLMKGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_029009999.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Azospirillum 
halopraeferens]
Length=547

 Score =   372 bits (955),  Expect(2) = 7e-178, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 227/307 (74%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE +EYDVVIVGAGP+GLSAAIRLKQ   E  ++LSVCV+EKG+EVGAH+LSG VFEPRA
Sbjct  6     REVMEYDVVIVGAGPSGLSAAIRLKQRAAEAGSELSVCVIEKGSEVGAHLLSGAVFEPRA  65

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             LDEL P W+    P+  P   D+FL L+++RA  LP+P    N GNY+ISL  L +WL +
Sbjct  66    LDELFPDWKDRGAPLHTPAREDRFLFLTESRATRLPTPPQMHNHGNYIISLGNLGKWLAE  125

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+Y GFA +E+L++++  V G+AT DMG+ KDG   + +  GVEL  R T+ A
Sbjct  126   QAEALGVEIYAGFAGAEVLFDDTGAVRGVATGDMGIGKDGRPTDAYTPGVELHARQTIFA  185

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL + ++  + LR+  +   QTY +GIKEVWEID  K +PG ++HTIGWP+D KT
Sbjct  186   EGCRGSLTKGLMQTFHLRDGVD--PQTYGIGIKEVWEIDPAKSQPGLIVHTIGWPMDPKT  243

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+    V++G V+ L+Y NP L+P+EEFQ++K HPAIR   EGG  + YGAR 
Sbjct  244   YGGSFLYHLDNNLVSVGFVIGLDYRNPNLSPFEEFQRYKTHPAIRTTFEGGRRIAYGARA  303

Query  1206  LNEGGYQ  1226
             L+EGG+Q
Sbjct  304   LSEGGFQ  310


 Score =   282 bits (721),  Expect(2) = 7e-178, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 168/233 (72%), Gaps = 5/233 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS---NMETFWDNLRSS  1396
              FPGG ++G +AGFLNVPKIKG HTAMKSGMLAAE+ FD L  G+    +  + D L+ S
Sbjct  316   TFPGGLLVGDAAGFLNVPKIKGNHTAMKSGMLAAEAVFDHLTSGTADREVTDYPDRLKRS  375

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+W EL+  RN RP F+ GL+ GLA +A E   +KGRSP T  H   DH  + +A  +  
Sbjct  376   WVWSELHAVRNIRPGFQKGLWAGLANAAFET-AMKGRSPWTLHHRHADHATLLKAGEAPK  434

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I+YPKPDG ISFD L+SVY SNTNH+  QPAHLRLKDP+TP  VNL  Y  PE+RYCPA 
Sbjct  435   IDYPKPDGKISFDRLSSVYLSNTNHEEHQPAHLRLKDPETPIRVNLALYDAPETRYCPAG  494

Query  1757  VYEYISDDNG-EVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE + +++G   +L INAQNC+HCK CDIKDPTQNI+W VPEGGGGP Y  M
Sbjct  495   VYEIVRNEDGTNPRLQINAQNCVHCKTCDIKDPTQNIEWVVPEGGGGPNYPGM  547



>emb|CDS06384.1| hypothetical protein LRAMOSA08912 [Absidia idahoensis var. thermophila]
Length=629

 Score =   379 bits (972),  Expect(2) = 1e-177, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 226/305 (74%), Gaps = 6/305 (2%)
 Frame = +3

Query  324   EYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDEL  503
             E DVVIVGAGPAGLSAAIRLKQL  E + +L V VVEK  EVGAH LSG V EPRAL+EL
Sbjct  79    ETDVVIVGAGPAGLSAAIRLKQLANEADKELRVMVVEKAGEVGAHTLSGAVLEPRALNEL  138

Query  504   LPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAEE  677
             +P W++   P++ PV+SD    L+   A  LP P    NKGNY++SLS  V+WLG++AEE
Sbjct  139   IPDWQERGAPLNTPVTSDNMRFLTSTMAIPLPHPPQMNNKGNYIVSLSNFVKWLGEQAEE  198

Query  678   LGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCR  857
             LGVE+YPGF  SE+ YNE   V GI  ND+G+ K+   K+ ++ G+ +K +VTL AEGC 
Sbjct  199   LGVEIYPGFGGSEVRYNEDGSVAGINLNDVGLDKNFEPKDTYERGMAIKAKVTLFAEGCH  258

Query  858   GSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGS  1037
             GSL++ VI K+ LR+  + QHQ Y +G+KEVWE+D  KH+PG V+H+IGWP D  TY GS
Sbjct  259   GSLSKTVINKFDLRK--DSQHQKYGIGLKEVWEVDPAKHQPGTVIHSIGWPTDMNTYAGS  316

Query  1038  FLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLN  1211
             FLYH +  +  VAIG VV L+Y NP+L+PY+EFQ+FKHHP+++PLLEGG  + YGAR +N
Sbjct  317   FLYHFEPEKHLVAIGYVVGLDYENPYLSPYKEFQRFKHHPSVKPLLEGGKCISYGARAIN  376

Query  1212  EGGYQ  1226
             EGGYQ
Sbjct  377   EGGYQ  381


 Score =   275 bits (702),  Expect(2) = 1e-177, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 170/240 (71%), Gaps = 14/240 (6%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML--QGGSNMET--------FW  1378
             FPGGA+IGCSAGFLN+PKIKGTHTAMKSGMLAAE+A++ +  QG +  ET        + 
Sbjct  388   FPGGALIGCSAGFLNLPKIKGTHTAMKSGMLAAEAAYEKIIGQGENEAETQEPIMLDNYE  447

Query  1379  DNLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAI  1552
             D+ ++SW+  ELY  RN +P+F    GL  G+  S +   I KG+ P TFKH K D E++
Sbjct  448   DSFKNSWVHDELYAVRNCQPSFHTSLGLLGGVLYSGLTTMITKGKEPWTFKHKKTDWESL  507

Query  1553  NEAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGP  1732
               A  S PI+YPKPDG ISFD+LT+V R+ TNH  +QP HLRL+D   P   NL  + GP
Sbjct  508   KPAAESKPIDYPKPDGVISFDLLTNVARTGTNHAENQPVHLRLRDKDVPVERNLAVFDGP  567

Query  1733  ESRYCPARVYEYISDDN--GEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYT  1906
             E+R+CPA VYEY+ D+   G+ +L IN+QNC+HCK CDIKDP+QNI WTVPEGGGGP Y 
Sbjct  568   ENRFCPAGVYEYVEDEANPGQKRLQINSQNCIHCKTCDIKDPSQNIDWTVPEGGGGPQYV  627



>gb|KFI08173.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Massilia 
sp. BSC265]
Length=558

 Score =   376 bits (965),  Expect(2) = 1e-177, Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 229/310 (74%), Gaps = 7/310 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA+EYDVVIVG GPAGLSAAIRLKQL  EK  ++SVCV+EKG E+GAHILSG V +P A
Sbjct  14    REAMEYDVVIVGGGPAGLSAAIRLKQLAAEKGQEVSVCVLEKGGELGAHILSGAVMDPIA  73

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L+EL+P W+++  P+  PV+ D+ L L++ +A     F +P    N GNYVISL+ +VRW
Sbjct  74    LNELIPDWKEKGAPLHTPVTEDQVLFLTEAKAIRTPNFMVPKMLTNHGNYVISLANVVRW  133

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+LYN+   V G+AT +MGV +DG    +FQ G+EL  + T
Sbjct  134   LGQQAESLGVEIFPGFPAAEVLYNDDGSVKGVATGNMGVKRDGEPGSDFQLGMELHAKYT  193

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEG RG L  Q++ KY L  KG    QTY +GIKE+WEID +KH+PG V+HT GWPLD
Sbjct  194   LFAEGSRGHLGRQLMAKYDLN-KGK-DPQTYGIGIKELWEIDPSKHKPGLVIHTAGWPLD  251

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
             + TYGGSFLYH++  QVA+G VV L Y NP+L+PYEEFQ++K HPAIR   EGG  + YG
Sbjct  252   NSTYGGSFLYHLENNQVAVGFVVGLAYQNPYLSPYEEFQRYKTHPAIRHFFEGGKRISYG  311

Query  1197  ARTLNEGGYQ  1226
             AR +  GG Q
Sbjct  312   ARAITAGGLQ  321


 Score =   277 bits (708),  Expect(2) = 1e-177, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 164/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IGC AGFLN  +IKG+H A+K+GMLAAESAF  L  G     + ++      
Sbjct  326   TVFPGGALIGCDAGFLNTSRIKGSHAAIKTGMLAAESAFAALGEGRQHDELVSYPAAFEQ  385

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+ +EL+ ARN++P    GL+ G  ++ I++ + +G++P T  H   DHEA+  A    
Sbjct  386   SWLHEELHVARNFKPWMSKGLYIGTIMTGIDQMVFRGKAPWTLHHKHADHEALRPASQFQ  445

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH  DQP HL LK+P  P  VNL KYAGPE RYCPA
Sbjct  446   PIAYPKPDGKLTFDRLSSVFISNTNHAEDQPIHLTLKNPSIPVDVNLAKYAGPEQRYCPA  505

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYEY+ +D+G+ +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  506   GVYEYVKNDDGKDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  558



>gb|EIF64680.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 1258a]
 gb|EIF67099.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 1258b]
Length=581

 Score =   383 bits (984),  Expect(2) = 1e-177, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  37    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  96

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  97    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  156

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  157   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  216

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  217   LFCEGARGHLGRQLMDKFKL--NANSDPQAYGIGIKELWEIDTVKHKPGLVIHTAGWPLS  274

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  275   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  334

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  335   ARAITAGG  342


 Score =   270 bits (689),  Expect(2) = 1e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  349   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  408

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  409   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  468

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  469   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  528

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  529   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  581



>emb|CEG65208.1| Putative Electron transfer flavoprotein ubiquinone oxidoreductase 
[Rhizopus microsporus]
Length=615

 Score =   358 bits (918),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 223/305 (73%), Gaps = 6/305 (2%)
 Frame = +3

Query  324   EYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDEL  503
             E DVVI+G GPAGLSAAIRLKQL  E+  +  V VVEK  EVGAH LSG V EPRAL+EL
Sbjct  70    ETDVVIIGGGPAGLSAAIRLKQLANEQGKECRVMVVEKAGEVGAHTLSGAVLEPRALNEL  129

Query  504   LPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAEE  677
             +P W+++  P++ PV+ D    L+K  +  LP P    NKGNY++SLS  V+WLG++AEE
Sbjct  130   IPDWKEKGAPLNTPVTKDSMRFLTKTLSIPLPHPPQMNNKGNYIVSLSNFVKWLGEQAEE  189

Query  678   LGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCR  857
             LGVE+YPGFAAS++LYNE   V G+A ND+G+ K+   K+N++ G++++ +VTL AEGC 
Sbjct  190   LGVEIYPGFAASDVLYNEDGSVRGVALNDVGLDKNFEPKDNYERGMQIQAKVTLFAEGCH  249

Query  858   GSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGS  1037
             GSL + ++ K+ LR++     Q Y +G+KEVWE+   KH+PG V H++GWP D  TY GS
Sbjct  250   GSLTKGLVKKFDLRKESG--PQKYGIGLKEVWEVQPEKHQPGLVTHSVGWPADMHTYAGS  307

Query  1038  FLYHMK-ERQ-VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLN  1211
             F+YH + ER  VAIG VV L+Y NP+LNPY+ FQ FKHHP+I+  LEGG  + YGAR +N
Sbjct  308   FMYHFEPERHLVAIGFVVGLDYENPYLNPYKTFQTFKHHPSIKSTLEGGKCISYGARAIN  367

Query  1212  EGGYQ  1226
             EGG+Q
Sbjct  368   EGGFQ  372


 Score =   295 bits (754),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 176/236 (75%), Gaps = 9/236 (4%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML-----QGGSNMETFWDNLR  1390
             VFPGGA+IGC+AGFLNVPKIKGTHTAMKS MLAAESAFD+L     +G   +  + ++++
Sbjct  378   VFPGGALIGCTAGFLNVPKIKGTHTAMKSAMLAAESAFDVLFNQQPEGPIVLNNYEESIK  437

Query  1391  SSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAK  1564
             +SW++KELY  RN  P+F +  GLF GLA S ++  ILKGR+P TFKH K D E +  A 
Sbjct  438   NSWVYKELYQVRNLVPSFHSPLGLFGGLAYSGLDSLILKGRTPWTFKHKKADWECMKTAG  497

Query  1565  SSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRY  1744
                PIEYPKPDG ISFD+LT+V R+ TNH  +QP HLR++D   P   NL  + GPE+R+
Sbjct  498   ECKPIEYPKPDGVISFDLLTNVSRTGTNHAENQPVHLRIRDAAKPVERNLAIFDGPENRF  557

Query  1745  CPARVYEYISDDN--GEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYT  1906
             CPA VYEY+ D+N  GE +L IN+QNC+HCK CDIKDP+QNI WTVPEGGGGP Y 
Sbjct  558   CPAGVYEYVDDENKPGEKRLQINSQNCIHCKTCDIKDPSQNIDWTVPEGGGGPQYV  613



>gb|EDU07603.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 1655]
Length=581

 Score =   383 bits (983),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  37    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  96

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  97    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPSWALPDNFKNHGNYVISLGNVTRW  156

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  157   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  216

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  217   LFCEGARGHLGRQLMDKFKL--NANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  274

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  275   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  334

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  335   ARAITAGG  342


 Score =   270 bits (689),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  349   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  408

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  409   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  468

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  469   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  528

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  529   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  581



>ref|WP_025405091.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
thailandensis]
 gb|AHI64749.1| FAD binding domain protein [Burkholderia thailandensis H0587]
 gb|AIP61622.1| FAD binding domain protein [Burkholderia thailandensis]
Length=557

 Score =   382 bits (982),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P+DV V+ D+FL L++  AF     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLDVDVTEDRFLFLTEKSAFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MG+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ ++KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDQFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   270 bits (689),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMSKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_004526827.1| dehydrogenase [Burkholderia pseudomallei]
 ref|YP_001058732.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 668]
 ref|YP_001065986.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 1106a]
 ref|YP_006274944.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 1026b]
 ref|YP_006652548.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei BPC006]
 gb|ABN83217.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
pseudomallei 668]
 gb|ABN91173.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 1106a]
 gb|EBA46415.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 305]
 gb|EDO91917.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei Pasteur 52237]
 gb|EDS86914.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei S13]
 gb|EEC33210.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
pseudomallei 576]
 gb|EES26577.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
pseudomallei 1106b]
 gb|EET09734.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
pseudomallei 1710a]
 gb|EIF65947.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 1026a]
 gb|EIF76624.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 354e]
 gb|EIF80948.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 354a]
 gb|AFI66546.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 1026b]
 gb|AFR15637.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei BPC006]
Length=581

 Score =   383 bits (983),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  37    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  96

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  97    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  156

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  157   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  216

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  217   LFCEGARGHLGRQLMDKFKL--NANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  274

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  275   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  334

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  335   ARAITAGG  342


 Score =   270 bits (689),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  349   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  408

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  409   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  468

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  469   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  528

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  529   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  581



>ref|WP_038756861.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei]
 gb|KGC60377.1| FAD binding domain protein [Burkholderia pseudomallei]
Length=557

 Score =   382 bits (982),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   270 bits (690),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYSDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_019957592.1| electron transfer flavoprotein [Vitreoscilla stercoraria]
Length=552

 Score =   370 bits (951),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 230/307 (75%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R+++++DVV+VGAGP+GLSAAIRLKQL  + + ++S+CVVEKG+EVGAHILSG V +P +
Sbjct  7     RDSMQFDVVVVGAGPSGLSAAIRLKQLADKADKEISICVVEKGSEVGAHILSGAVIDPIS  66

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L EL P W++   P+D PV+ D    L ++ A  LP+P  F+N GNY+ISL  L RWL +
Sbjct  67    LTELFPNWKELGAPLDCPVTEDALFFLKEDSAKQLPTPPNFQNHGNYIISLGLLTRWLAE  126

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE +G+E+YPGFAA+E+LY+    V GIAT DMG+ KDG   +NF  G+EL  + T+ +
Sbjct  127   QAEGMGIEIYPGFAAAEVLYHADGSVRGIATGDMGIGKDGEMTDNFAPGMELLAQQTIFS  186

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL + +I K++L +  +   QTY +GIKE+WEID  K +PG V HT+GWPLD KT
Sbjct  187   EGCRGSLTKGLIQKFQLDK--DSDVQTYGIGIKELWEIDPAKAKPGYVQHTMGWPLDTKT  244

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+ + QVA+G V+ L+Y NP+L+P+EEFQ+FK HP IR + EGG  + YGAR 
Sbjct  245   YGGSFLYHLNDNQVAVGFVIGLDYENPYLSPFEEFQRFKTHPEIRKVFEGGRRIAYGARA  304

Query  1206  LNEGGYQ  1226
             ++EGG Q
Sbjct  305   ISEGGLQ  311


 Score =   281 bits (720),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 167/235 (71%), Gaps = 7/235 (3%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQ-------GGSNMETFWDNL  1387
             FPGG ++G +AGFLNVP+IKGTHTAMKSGMLAAE+ F  L+           + T+    
Sbjct  318   FPGGVLVGDAAGFLNVPRIKGTHTAMKSGMLAAETVFAALEESQESYETAKEVATYQTAF  377

Query  1388  RSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKS  1567
               SW++ EL+  RN RP+F+ G++P +A SAIE Y+ KG+SP T KH   DH ++ +A +
Sbjct  378   EQSWLYTELHGVRNIRPSFKWGMWPAMAFSAIETYLFKGKSPWTLKHHGSDHSSLKKAAN  437

Query  1568  SLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYC  1747
             S+ I YPKPDG ++FD L+SV+ S TNH+ +QPAHL+LK+P     VN  +YA PE+RYC
Sbjct  438   SVKINYPKPDGVLTFDRLSSVFLSGTNHEENQPAHLKLKNPDVAIKVNFDEYASPETRYC  497

Query  1748  PARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             PA VYE +  D+G+ +L INAQNC+HCK CDIKDPTQNI WT PEG GGP Y  M
Sbjct  498   PAGVYEIVEQDDGKPRLQINAQNCVHCKTCDIKDPTQNINWTCPEGSGGPNYATM  552



>dbj|BAK03836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   504 bits (1298),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 245/319 (77%), Positives = 285/319 (89%), Gaps = 2/319 (1%)
 Frame = +3

Query  270   YSLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEV  449
             +S   AR FS+E  REA+ YDVVIVGAGPAGL+AAIRLKQLCR  + DLSVCV+EKGAEV
Sbjct  28    WSAAAARWFSAE--REAMSYDVVIVGAGPAGLAAAIRLKQLCRAADTDLSVCVLEKGAEV  85

Query  450   GAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSPFENKGNYV  629
             GAH+LSGNVFEPRALDEL+P+WRQE  PI VPVSSDKF +L+KN+A++LPSPF+NKGNYV
Sbjct  86    GAHVLSGNVFEPRALDELIPEWRQEDAPIRVPVSSDKFWMLTKNKAWTLPSPFDNKGNYV  145

Query  630   ISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQH  809
             ISLSQLVRW+  KAEELGVE+YPGFAASEIL +E+  V G+ATND+G+AKDGS++E FQ 
Sbjct  146   ISLSQLVRWMSVKAEELGVEVYPGFAASEILCDENQIVTGVATNDVGIAKDGSKRETFQP  205

Query  810   GVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDV  989
             GVEL+GR+TLLAEGCRGSL+E++I  YKLRE G GQHQTYALGIKEVWEI+  KH+PG V
Sbjct  206   GVELRGRITLLAEGCRGSLSEKIITNYKLRESGQGQHQTYALGIKEVWEIEEGKHKPGSV  265

Query  990   LHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLL  1169
             +HT+GWPLD KTYGGSFLYH+ +RQ+AIGLVVALNY NPF++PY+EFQKFK HPAIR LL
Sbjct  266   IHTVGWPLDMKTYGGSFLYHLDDRQLAIGLVVALNYRNPFISPYDEFQKFKQHPAIRTLL  325

Query  1170  EGGTVLQYGARTLNEGGYQ  1226
             EGGTVLQYGARTLNEGG+Q
Sbjct  326   EGGTVLQYGARTLNEGGFQ  344


 Score =   148 bits (373),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
             VFPGGA+IGCSAGFLNVPKIKG+HTAMKSGMLAAE+ F  L  GS+M+ +W+NL+ SWIW
Sbjct  350   VFPGGAIIGCSAGFLNVPKIKGSHTAMKSGMLAAEATFKALVEGSSMDLYWENLKKSWIW  409

Query  1406  KELYHARNYRPAFENGLFPGLALSAIER  1489
              ELY ARNYRPAFE G  PG+ALSA+ER
Sbjct  410   DELYRARNYRPAFEYGFIPGMALSAVER  437



>ref|WP_038714431.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei]
Length=557

 Score =   383 bits (983),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDTVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (688),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>emb|CCA16231.1| electrontransferringflavoprotein dehydrogenase puta [Albugo laibachii 
Nc14]
Length=610

 Score =   402 bits (1033),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 243/314 (77%), Gaps = 10/314 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA++YDV++VG GPA LSAAIRLKQL  EK  DLSVCV+EKGAE+G+HI+SGNVFE RA
Sbjct  47    REAMDYDVLLVGGGPASLSAAIRLKQLSLEKGTDLSVCVIEKGAEIGSHIVSGNVFETRA  106

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS---PFE--NKGNYVISLSQLVRW  656
             LDEL+P W ++K P+D  V+ D FL LS+ +++ LP+   P E  N GNYVISLS+L RW
Sbjct  107   LDELIPDWEEKKAPLDTRVTQDSFLFLSEKKSWKLPNFLLPAEQHNLGNYVISLSKLTRW  166

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG++AEELGVE+YPGF+A+E+LY E   V GIAT D+G+ KDG  K  F  G+EL  RVT
Sbjct  167   LGEQAEELGVEIYPGFSAAEVLYREDGAVYGIATRDVGIGKDGGPKSTFARGMELHSRVT  226

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             LL EGCRGS +E+VI K++LR + N Q QTY LGIKEVW I   KH+PG V HT+GWPL 
Sbjct  227   LLGEGCRGSCSEEVIRKFQLRGE-NTQPQTYGLGIKEVWRIPKEKHQPGLVQHTLGWPLQ  285

Query  1017  H----KTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTV  1184
             +    KT+GGSF+YHM+E  V IGLVV L+Y NP++NPYEEFQ+FK HP+I+ +L+GG  
Sbjct  286   NQLLDKTFGGSFMYHMEEDLVQIGLVVGLDYENPYINPYEEFQRFKMHPSIKEMLDGGEC  345

Query  1185  LQYGARTLNEGGYQ  1226
             L YGAR LNEGGY 
Sbjct  346   LAYGARCLNEGGYH  359


 Score =   249 bits (637),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 160/247 (65%), Gaps = 19/247 (8%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAF-------------DMLQGGSNM  1366
              FPGGA+IGCS GFLN  KIKGTHTAMKSGMLAAE+ F             DM     ++
Sbjct  365   TFPGGALIGCSPGFLNSVKIKGTHTAMKSGMLAAEAVFHALASNAGDSAEIDMTAPPPDI  424

Query  1367  ETFWDNLRSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHE  1546
              ++   + +SWI +EL   RN   +F  GL PGL  +A   +I +G+ P T  +  PD  
Sbjct  425   LSYESAVENSWIIEELKPVRNVHASFHYGLLPGLLHAAFSSFITRGKEPWTIPNKIPDSA  484

Query  1547  AINEAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPK---TPELVNLP  1717
                 AK   PI+YPKPDG ISFD+L+++ RS TNH+HDQPAHLR+K PK    P  V+ P
Sbjct  485   KTRPAKEFAPIDYPKPDGVISFDLLSNLQRSGTNHNHDQPAHLRVK-PKLASAPTQVSYP  543

Query  1718  KYAGPESRYCPARVYEYI--SDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGG  1891
              YAGPE R+CPA+VYEY   S+ NG  +L INAQNC+HCK C IK P + I WTVPEGGG
Sbjct  544   VYAGPEQRFCPAKVYEYTDGSEANGTPQLVINAQNCVHCKCCSIKTPEEYIDWTVPEGGG  603

Query  1892  GPGYTVM  1912
             GP Y +M
Sbjct  604   GPAYELM  610



>ref|WP_009966388.1| dehydrogenase [Burkholderia pseudomallei]
 gb|KGS32338.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR4378]
Length=557

 Score =   382 bits (982),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (688),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLMINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|XP_001701999.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Chlamydomonas 
reinhardtii]
 gb|EDP06974.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Chlamydomonas 
reinhardtii]
Length=543

 Score =   372 bits (955),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 232/307 (76%), Gaps = 5/307 (2%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             + YDV++VGAGPAGLSAAIRLK   +    D+SVCV+EKGAEVG+HILSGNV E +ALDE
Sbjct  1     MRYDVLVVGAGPAGLSAAIRLKTSSQAAGKDISVCVIEKGAEVGSHILSGNVLETKALDE  60

Query  501   LLPQWRQE-KTPIDVPVSSDKF-LLLSKNRAFSLPSP--FENKG-NYVISLSQLVRWLGQ  665
             L+P+W+++   PI V V+SD F +L S   +  LP+P    NK  NYV+SLS++ RWL +
Sbjct  61    LIPEWKEDPDCPIKVKVTSDAFRVLASPTWSLRLPTPPTMHNKNKNYVVSLSEVTRWLAK  120

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+Y GFA   +LYN    V G+ATND G+AK G  K NF  GV+L+ RVTLLA
Sbjct  121   RAEALGVEIYSGFAGKNLLYNWDGVVEGVATNDFGIAKSGQPKSNFAPGVDLRARVTLLA  180

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL+E+VI ++ LR+    QHQTYALGIKEVW++   +H+ G V+HT+G+P  H T
Sbjct  181   EGCRGSLSEEVISRFGLRQAAGAQHQTYALGIKEVWQVPEAQHKAGTVVHTVGFPASHNT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGG F+YHM +++VA+G V+ L+Y NP +N ++EFQ++K HPA+R  +EGGT LQYGART
Sbjct  241   YGGGFIYHMADQKVALGYVIGLDYDNPHINTFQEFQRWKQHPAVRKHIEGGTCLQYGART  300

Query  1206  LNEGGYQ  1226
             LNEGG Q
Sbjct  301   LNEGGLQ  307


 Score =   280 bits (715),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 163/230 (71%), Gaps = 2/230 (1%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETF-WDNLRSSWIW  1405
             FPGGA++GCSAGFLNVPKIKGTHTAM SG+ A E+AF  L        + W  L  SW+W
Sbjct  314   FPGGALVGCSAGFLNVPKIKGTHTAMMSGLAAGEAAFRQLTSDKAPAKYSWHLLWRSWVW  373

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             +EL   RN RP F  GL PGL  +A++ Y+L+G+ P T +HG+PD+E +    ++     
Sbjct  374   EELTAVRNIRPGFRAGLIPGLLHAALDAYVLRGKEPWTLRHGRPDNEHLKPLSAAPAPPA  433

Query  1586  PKP-DGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVY  1762
                 DG +SFD+ TS+YRS TNH+HDQP+HL++KD    E  NLP Y GPE+RYCPA VY
Sbjct  434   YAKPDGVVSFDLPTSLYRSGTNHEHDQPSHLKIKDEGEFERSNLPHYGGPETRYCPAGVY  493

Query  1763  EYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             EY +D  G  KL++NAQNCLHCKACDIKDP +NIKWTVPEGG GP YT M
Sbjct  494   EYRADQYGRQKLHVNAQNCLHCKACDIKDPGRNIKWTVPEGGQGPSYTAM  543



>ref|WP_025986024.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei]
Length=557

 Score =   382 bits (982),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAETLGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (688),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_004556915.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei]
 gb|EMP77000.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei MSHR1043]
 gb|AIP04080.1| FAD binding domain protein [Burkholderia pseudomallei]
Length=557

 Score =   382 bits (982),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPSWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (688),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_004193882.1| MULTISPECIES: dehydrogenase [Burkholderia]
 ref|YP_108559.1| electron transport protein [Burkholderia pseudomallei K96243]
 ref|YP_102804.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
mallei ATCC 23344]
 ref|YP_333270.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 1710b]
 ref|YP_992884.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia mallei SAVP1]
 ref|YP_001026221.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
mallei NCTC 10229]
 ref|YP_001080504.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
mallei NCTC 10247]
 ref|YP_008742615.1| FAD binding domain protein [Burkholderia pseudomallei NCTC 13179]
 emb|CAH35960.1| putative electron transport protein [Burkholderia pseudomallei 
K96243]
 gb|AAU49277.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Burkholderia mallei ATCC 23344]
 gb|ABA49065.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 1710b]
 gb|ABM50949.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia mallei SAVP1]
 gb|ABN01466.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia mallei NCTC 10229]
 gb|ABO04644.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia mallei NCTC 10247]
 gb|EDK56421.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia mallei FMH]
 gb|EDK60583.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia mallei JHU]
 gb|EDK85595.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia mallei 2002721280]
 gb|EDO84955.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei 406e]
 gb|EDP89697.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia mallei ATCC 10399]
 gb|EEH24329.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
pseudomallei Pakistan 9]
 gb|EEP85751.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
mallei GB8 horse 4]
 gb|EES43444.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia mallei PRL-20]
 gb|AGZ28588.1| FAD binding domain protein [Burkholderia pseudomallei NCTC 13179]
 gb|AHE32559.1| FAD binding domain protein [Burkholderia pseudomallei NAU20B-16]
 gb|AHE26388.1| FAD binding domain protein [Burkholderia pseudomallei NCTC 13178]
 gb|AHG36153.1| FAD binding domain protein [Burkholderia pseudomallei MSHR511]
 gb|AHG66731.1| FAD binding domain protein [Burkholderia pseudomallei MSHR146]
 gb|AHK64190.1| FAD binding domain protein [Burkholderia pseudomallei MSHR520]
 gb|EXJ02180.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei MSHR6137]
 gb|KEO67457.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei MSHR5855]
 emb|CDU28177.1| putative electron transport protein [Burkholderia pseudomallei]
 gb|AIO52443.1| FAD binding domain protein [Burkholderia mallei]
 gb|AIO56975.1| FAD binding domain protein [Burkholderia mallei]
 gb|AIO64735.1| FAD binding domain protein [Burkholderia mallei]
 gb|AIO81738.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
mallei]
 gb|AIO87406.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|AIO89432.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|AIO95447.1| FAD binding domain protein [Burkholderia pseudomallei 576]
 gb|AIO12465.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|AIP15344.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|AIP21368.1| FAD binding domain protein [Burkholderia pseudomallei MSHR5855]
 gb|AIP39780.1| FAD binding domain protein [Burkholderia pseudomallei MSHR5848]
 gb|AIP49004.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR5858]
 gb|AIP52533.1| FAD binding domain protein [Burkholderia pseudomallei HBPUB10134a]
 gb|AIP60690.1| FAD binding domain protein [Burkholderia pseudomallei HBPUB10303a]
 gb|AIP72123.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei]
 gb|AIP75528.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
mallei]
 gb|AIP81129.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei]
 gb|KGC21986.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGC28593.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGC29833.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGC37468.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGC45647.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGC47617.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGC60495.1| FAD binding domain protein [Burkholderia mallei]
 gb|KGC67453.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGC72174.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGC84050.1| FAD binding domain protein [Burkholderia pseudomallei Pasteur 
52237]
 gb|KGC85570.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGC91533.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGD02293.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
mallei]
 gb|KGD05130.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGD11346.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei]
 gb|KGD20467.1| FAD binding domain protein [Burkholderia sp. BGJ]
 gb|KGD27724.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGD29751.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGD41758.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGD42189.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGD49945.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|KGD58676.1| FAD binding domain protein [Burkholderia pseudomallei]
 gb|AIS28838.1| FAD binding domain protein [Burkholderia mallei NCTC 10247]
 gb|AIS48685.1| FAD binding domain protein [Burkholderia sp. BGK]
 gb|AIS86622.1| FAD binding domain protein [Burkholderia pseudomallei NAU35A-3]
 gb|AIV52601.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR1153]
 gb|AIV59249.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR2243]
 gb|AIV71183.1| FAD binding domain protein [Burkholderia pseudomallei MSHR62]
 gb|AIV83977.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR3965]
 gb|AIV97902.1| FAD binding domain protein [Burkholderia pseudomallei A79A]
 gb|AIV89804.1| FAD binding domain protein [Burkholderia pseudomallei B03]
 gb|AIV76680.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
sp. TSV202]
 gb|AIV64442.1| FAD binding domain protein [Burkholderia pseudomallei K42]
 gb|AIV47432.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei TSV 48]
 gb|KGR97106.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR7504]
 gb|KGS25655.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR7343]
 gb|KGS44204.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei ABCPW 107]
 gb|KGS50594.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR5613]
 gb|KGS52506.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR5492]
 gb|KGS57264.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR5609]
 gb|KGS61062.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR4868]
 gb|KGS62556.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR7527]
 gb|KGS76008.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR7500]
 gb|KGS87543.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR5596]
 gb|KGU63345.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR983]
 gb|KGU72100.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4304]
 gb|KGU77712.1| FAD binding domain protein [Burkholderia pseudomallei MSHR465J]
 gb|KGU96039.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4372]
 gb|KGV01545.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4032]
 gb|KGV05330.1| FAD binding domain protein [Burkholderia pseudomallei TSV 43]
 gb|KGV08083.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4503]
 gb|KGV14944.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4300]
 gb|KGV23479.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4462]
 gb|KGV33372.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4308]
 gb|KGV35076.1| FAD binding domain protein [Burkholderia pseudomallei TSV 31]
 gb|KGV35938.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR4012]
 gb|KGV56386.1| FAD binding domain protein [Burkholderia pseudomallei BDU 2]
 gb|KGV63501.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4003]
 gb|KGV69773.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4375]
 gb|KGV73533.1| FAD binding domain protein [Burkholderia pseudomallei MSHR3964]
 gb|KGV86986.1| FAD binding domain protein [Burkholderia pseudomallei MSHR3951]
 gb|KGV89485.1| FAD binding domain protein [Burkholderia pseudomallei ABCPW 30]
 gb|KGV99728.1| FAD binding domain protein [Burkholderia pseudomallei MSHR3960]
 gb|KGW10545.1| FAD binding domain protein [Burkholderia pseudomallei TSV 25]
 gb|KGW22897.1| FAD binding domain protein [Burkholderia pseudomallei MSHR733]
 gb|KGW36015.1| FAD binding domain protein [Burkholderia pseudomallei MSHR3016]
 gb|KGW41412.1| FAD binding domain protein [Burkholderia pseudomallei MSHR1000]
 gb|KGW51327.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR684]
 gb|KGW54833.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR303]
 gb|KGW63853.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR1029]
 gb|KGW70449.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR3458]
 gb|KGW78036.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR2990]
 gb|KGW87597.1| FAD binding domain protein [Burkholderia pseudomallei MSHR456]
 gb|KGW91383.1| FAD binding domain protein [Burkholderia pseudomallei MSHR332]
 gb|KGW98995.1| FAD binding domain protein [Burkholderia pseudomallei MSHR449]
 gb|KGX03904.1| FAD binding domain protein [Burkholderia pseudomallei MSHR640]
 gb|KGX10362.1| FAD binding domain protein [Burkholderia sp. ABCPW 1]
 gb|KGX23145.1| FAD binding domain protein [Burkholderia sp. MSHR4009]
 gb|KGX25003.1| FAD binding domain protein [Burkholderia sp. MSHR4018]
 gb|KGX38600.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR3335]
 gb|KGX44863.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR2138]
 gb|KGX47123.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR3709]
 gb|KGX60826.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei TSV32]
 gb|KGX61841.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei TSV5]
 gb|KGX62740.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei TSV44]
 gb|KGX71916.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei TSV28]
 gb|KGX76498.1| FAD binding domain protein [Burkholderia pseudomallei MSHR435]
 gb|KGX99445.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei A79D]
 gb|KGY00414.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei A79C]
Length=557

 Score =   382 bits (981),  Expect(2) = 4e-177, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (688),  Expect(2) = 4e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_038728634.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei]
 gb|KGU77447.1| FAD binding domain protein [Burkholderia pseudomallei MSHR543]
 gb|KGV76786.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4299]
 gb|KGW62106.1| FAD binding domain protein [Burkholderia pseudomallei MSHR1357]
Length=557

 Score =   382 bits (982),  Expect(2) = 4e-177, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (687),  Expect(2) = 4e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWITPEGGGGPNYPNM  557



>ref|WP_013046532.1| electron transfer flavoprotein [Candidatus Puniceispirillum marinum]
 ref|YP_003551989.1| dehydrogenase [Candidatus Puniceispirillum marinum IMCC1322]
 gb|ADE39905.1| Dehydrogenase [Candidatus Puniceispirillum marinum IMCC1322]
Length=544

 Score =   382 bits (981),  Expect(2) = 4e-177, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 228/307 (74%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE +E+DVVIVG GP+GLSAAIRLKQL  +   DL VC++EKG+EVGAHILSG V EPRA
Sbjct  3     RETMEFDVVIVGGGPSGLSAAIRLKQLANDAGRDLDVCLIEKGSEVGAHILSGAVLEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL+P W+ +  P+D PV+SDKF+ L++ ++  +P+P    N GNY+ISL    RWLG 
Sbjct  63    LNELIPDWKDKNAPLDTPVTSDKFMFLTETKSVRMPTPPSMNNHGNYIISLGNFCRWLGD  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGF A+EILY+E+  V G+AT DMG+ KDG   +N+  G+EL G+ T+ A
Sbjct  123   QAEALGVEIYPGFPAAEILYDENGAVRGVATGDMGIGKDGEPTDNYMRGMELIGKQTIFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRG L + +   + LRE  +   QTYA+GIKE+W+ID  K +PG   H+IGWPL   T
Sbjct  183   EGCRGHLTKNLFDTFDLREGKD--PQTYAIGIKELWDIDPAKAKPGLAWHSIGWPLATDT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+   QVA+G VV L+Y NP L+P+EEFQ+FK HPA+R + EGG  + YGAR 
Sbjct  241   YGGSFLYHLNGNQVAVGYVVGLDYSNPHLSPFEEFQRFKTHPAVRDVFEGGRRVSYGARA  300

Query  1206  LNEGGYQ  1226
             LNEGG+Q
Sbjct  301   LNEGGFQ  307


 Score =   269 bits (687),  Expect(2) = 4e-177, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 162/233 (70%), Gaps = 5/233 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAF---DMLQGGSNMETFWDNLRSS  1396
              FPGG ++GC+AGFLNVPKIKGTHTAMKSGM+AAE+ F   D +  G    ++ D L +S
Sbjct  313   TFPGGCMVGCTAGFLNVPKIKGTHTAMKSGMVAAEAIFEALDNIDAGHEPASYADKLAAS  372

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+WKELY  RN RP F  GL+ GLA +A++ Y+L G++P T +H   DH  +  A  +  
Sbjct  373   WLWKELYKVRNIRPGFAKGLWLGLAHAALDTYVLFGKAPWTLRH-HADHTQLRMAADAPK  431

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ISFD  +SV+ S TNH+ +QPAHL LKD   P   NL  Y  PE RYCPA 
Sbjct  432   IEYPKPDGIISFDRNSSVFLSGTNHEENQPAHLTLKDASIPITHNLALYDAPEQRYCPAG  491

Query  1757  VYEYISDDNGEV-KLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE +  D+G+  +L INAQNC+HCK CDIKDP+QNI W  PEGGGGP Y  M
Sbjct  492   VYEIVHGDSGDDPRLQINAQNCVHCKTCDIKDPSQNIVWVTPEGGGGPNYPNM  544



>ref|WP_015601903.1| FAD binding domain protein [Burkholderia thailandensis]
 ref|YP_007918832.1| FAD binding domain protein [Burkholderia thailandensis MSMB121]
 gb|AGK48734.1| FAD binding domain protein [Burkholderia thailandensis MSMB121]
Length=557

 Score =   381 bits (978),  Expect(2) = 5e-177, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P+ V V+ D+FL L++  AF     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLTVDVTEDRFLFLTEKSAFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MG+ +DG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGIGRDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   QTY +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKL--AANSDPQTYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAIAAGG  318


 Score =   270 bits (690),  Expect(2) = 5e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMSKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_038771746.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei]
 gb|KGS06112.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR5608]
Length=557

 Score =   382 bits (981),  Expect(2) = 5e-177, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LG+E++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGIEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (688),  Expect(2) = 5e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_019015990.1| hypothetical protein [Elioraea tepidiphila]
Length=546

 Score =   367 bits (941),  Expect(2) = 6e-177, Method: Compositional matrix adjust.
 Identities = 185/308 (60%), Positives = 232/308 (75%), Gaps = 5/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA+E+DVVIVGAGPAGL+AAIRLKQ       ++SVCV+EKGAEVGAHILSG V EPRA
Sbjct  7     REAMEFDVVIVGAGPAGLAAAIRLKQAAGSAGREISVCVLEKGAEVGAHILSGAVLEPRA  66

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             LDELLP W+    PI+ P   D+FL L+  RAF +P+P    N GN+++SL Q+ RWLG 
Sbjct  67    LDELLPDWQALGAPIETPAREDRFLYLTATRAFRMPTPPQMHNSGNWIVSLGQVCRWLGA  126

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGFAA+EIL+ E D V+G+AT DMG+A+DG+RK ++Q G+EL+   TL A
Sbjct  127   QAEALGVEIYPGFAAAEILF-EGDRVVGVATGDMGIARDGTRKPSYQPGMELRATYTLFA  185

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL +Q+  ++ LRE    Q QTYA+GIKE+WE+  + H+PG +LHTIGWPL   T
Sbjct  186   EGCRGSLTKQLERRFALRE--GRQPQTYAIGIKELWEVPKSTHQPGLILHTIGWPLASDT  243

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH  E  ++ G VV L+Y NP+L+P+EE Q+FK HPAIRP  EG   + YGAR 
Sbjct  244   YGGSFLYHWGENLMSYGFVVGLDYPNPWLSPFEETQRFKTHPAIRPFFEGAKRIAYGARA  303

Query  1206  LNEGGYQC  1229
             LNEGG Q 
Sbjct  304   LNEGGLQA  311


 Score =   284 bits (727),  Expect(2) = 6e-177, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 170/232 (73%), Gaps = 4/232 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGG--SNMETFWDNLRSSW  1399
             VFPGGA+IGC AGFLNVPKIKG+HTAMKSGMLAAE+  + L G     +E +   L  SW
Sbjct  316   VFPGGALIGCGAGFLNVPKIKGSHTAMKSGMLAAEAVVEALVGARPDVLEAYPSALERSW  375

Query  1400  IWKELYHARNYRPAFEN-GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             + +EL  ARN RPAF   GL+ GLA + ++ Y+L+GR+P TF H  PDHE++ EA ++  
Sbjct  376   VREELARARNIRPAFAKFGLWGGLAYAGLDTYLLRGRAPWTFGH-HPDHESLKEASAAPR  434

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I+YPKPDG ++FD L+SV+ SNTNH+ DQP+HLRL DP      NL +Y GPE+RYCPA 
Sbjct  435   IDYPKPDGVLTFDRLSSVFLSNTNHEEDQPSHLRLADPAVAVAHNLARYGGPEARYCPAG  494

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++  + G+ +L +NAQNC+HCK CDIKDP QNI W  PEGGGGP Y  M
Sbjct  495   VYEFVGVEEGQPRLVVNAQNCVHCKTCDIKDPKQNITWVTPEGGGGPVYASM  546



>ref|WP_035532860.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
sacchari]
 gb|KHD18560.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
sacchari]
Length=546

 Score =   380 bits (975),  Expect(2) = 6e-177, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 230/308 (75%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  2     RESMEYDVVIVGGGPAGLSAAIRLKQLGAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  61

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL+P W+++  P++VPV+ D+FL LS+N A     ++LP  F+N GNYVISL+ + RW
Sbjct  62    IGELIPDWKEQGAPLNVPVTEDQFLFLSENSAKTVPNWALPDNFKNHGNYVISLANVTRW  121

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+L+N+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  122   LGQQAEALGVEIFPGFPAAEVLFNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  181

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+   +KL +  +   Q Y +GIKE+WEID  KH+PG V+HT GWPL+
Sbjct  182   LFAEGCRGHLGRQLNEHFKLGK--DADPQVYGIGIKELWEIDPAKHKPGLVIHTAGWPLE  239

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYH    QV +G V+ L Y NP+L+P+EEFQ++K HPAIR  LEGG  + YG
Sbjct  240   KDTYGGSFLYHTDNNQVMVGFVIGLAYQNPYLSPFEEFQRYKTHPAIRKYLEGGKRVSYG  299

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  300   ARAMTAGG  307


 Score =   271 bits (693),  Expect(2) = 6e-177, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 160/232 (69%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSS  1396
             VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + +  + S
Sbjct  315   VFPGGALVGDDAGFLNAARIKGSHAAIKTGMLAAEAAFDAVQAGRQSDELAAYPEAFKQS  374

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    P
Sbjct  375   WLYTELYKARNFKQWMSKGLYLGTLMVGVEQKLMGGNVPWTLHHQHRDHEMLKPASQCKP  434

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  +NL  YAGPESR+CPA 
Sbjct  435   IEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDATVPVGINLKTYAGPESRFCPAG  494

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++ DD  E +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  495   VYEFVKDDADEDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  546



>ref|WP_028466187.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Nisaea 
denitrificans]
Length=544

 Score =   381 bits (979),  Expect(2) = 6e-177, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 229/307 (75%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVGAGP+GLSAAIRL+QL  E   DLSVCV+EKG+EVGAHILSG V EPRA
Sbjct  3     RESMEYDVVIVGAGPSGLSAAIRLRQLSAEHGQDLSVCVLEKGSEVGAHILSGAVMEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             + EL P W++   P++ PV+ D+F+ L++N    +P P    N GNY++SL  + RWL +
Sbjct  63    MAELFPDWQERGAPLNTPVTQDRFMFLTRNSGIQMPCPPQMNNHGNYIVSLGNVCRWLAE  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGFAA+E+LY+E+  V G+AT DMG+ KDG +  N+  G+EL  + TL A
Sbjct  123   QAEALGVEIYPGFAAAEVLYDENGAVRGVATGDMGIGKDGEQTANYTQGIELHAKQTLFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EG RGSL + +  ++ LRE  +   QTY LGIKE+WE+D   H+ G V+HT+GWP+D KT
Sbjct  183   EGVRGSLTKTLFERFDLREGVD--PQTYGLGIKELWEVDPAVHQQGLVVHTVGWPVDGKT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++  QVA+G V+ L+Y NP L+P+EEFQ++K HP IRP  EG   + YGAR 
Sbjct  241   YGGSFLYHLENNQVAVGYVIGLDYENPHLSPFEEFQRYKTHPKIRPFFEGARRISYGARA  300

Query  1206  LNEGGYQ  1226
             +NEGG+Q
Sbjct  301   INEGGFQ  307


 Score =   270 bits (689),  Expect(2) = 6e-177, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 161/234 (69%), Gaps = 7/234 (3%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQ--GGSNMET--FWDNLRS  1393
              FPGGA++GCSAGFLNVPKIKG+HTAMKSGM AAE+ FD ++   G+ ME   +   +  
Sbjct  313   TFPGGAILGCSAGFLNVPKIKGSHTAMKSGMTAAEALFDTMKDGAGAGMEISDYRTRMEK  372

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             +W+W EL   RN RP F+ G   G+A + +E  + KG+SP T  H   DHE++  A    
Sbjct  373   TWVWDELKAVRNIRPGFKAGFLMGMANAGVET-LFKGKSPWTLHH-HHDHESLRPAAQCE  430

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
              I YPKPDG +SFD L+SV+ SNTNH+ +QPAHL LKDP  P   NL  Y  PE RYCPA
Sbjct  431   KIAYPKPDGKVSFDRLSSVFLSNTNHEENQPAHLTLKDPSVPVEYNLAIYDAPEQRYCPA  490

Query  1754  RVYEYISDDNGEV-KLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE + DD+G   +L INAQNC+HCK CDIKDPTQNI W VPEGGGGP Y  M
Sbjct  491   GVYEIMRDDDGSNPRLQINAQNCVHCKTCDIKDPTQNINWVVPEGGGGPNYPNM  544



>ref|WP_027194283.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
sprentiae]
Length=556

 Score =   378 bits (970),  Expect(2) = 6e-177, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EKN ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  12    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKNVEIGVCVLEKGSEIGAHILSGAVMDPRA  71

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L+EL+P W++   P++VPV+ D+FL LS+ RA     ++LP  F+N GNYVISL+ + RW
Sbjct  72    LNELMPDWKERNAPLNVPVTEDRFLFLSETRAKSVPNWALPENFKNHGNYVISLANVTRW  131

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+LYNE   V G+AT ++G+ KDG    NFQ G+EL  + T
Sbjct  132   LGQQAEALGVEIFPGFPAAEVLYNEDGSVKGVATGNVGIGKDGEPTGNFQLGMELHAKYT  191

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EGCRG L  Q+   +KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  192   LFGEGCRGHLGRQLNDNFKL--GNNADPQVYGIGIKELWEIDPAKHQPGLVIHTAGWPLK  249

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYH+   QV +G VV L Y NP+L+P+EEFQ++K HP IR  LEGG  + YG
Sbjct  250   PDTYGGSFLYHIDNNQVMVGFVVGLAYRNPYLSPFEEFQRYKTHPEIRGFLEGGKRVSYG  309

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  310   ARAITAGG  317


 Score =   273 bits (697),  Expect(2) = 6e-177, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 161/232 (69%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSS  1396
             VFPGGA++G  AGFLN   IKG+H A+K+GMLAA +AFD LQ G +   +  + +  + S
Sbjct  325   VFPGGALVGDDAGFLNASLIKGSHAAIKTGMLAAHAAFDALQAGRHHDELAAYPEAFKQS  384

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+++ELY ARN++     GL+ G  +  IE+ +L G  P T +H   DHE +  A    P
Sbjct  385   WLYRELYKARNFKQWMSKGLYLGSLMVGIEQKLLGGNVPWTLRHQHRDHETLKPASQCQP  444

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL L+D   P  VNL  YAGPESR+CPA 
Sbjct  445   IEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLRDTSVPVNVNLRTYAGPESRFCPAG  504

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYEY+ DD  E +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   VYEYVKDDQQEDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  556



>ref|WP_006026499.1| dehydrogenase [Burkholderia thailandensis]
 gb|EIP87532.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
thailandensis MSMB43]
Length=557

 Score =   380 bits (977),  Expect(2) = 7e-177, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P+ V V+ D+FL L++  AF     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLTVGVTEDRFLFLTEKSAFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MG+ +DG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGIGRDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   QTY +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKL--AANSDPQTYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAIAAGG  318


 Score =   270 bits (689),  Expect(2) = 7e-177, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMSKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWITPEGGGGPNYPNM  557



>ref|WP_035990382.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
caribensis]
 gb|ETY78005.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
caribensis MBA4]
Length=557

 Score =   378 bits (970),  Expect(2) = 7e-177, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 230/308 (75%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQ   EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQRAAEKGVEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L+EL+P W+++  P+DV V+ D+FL LS+  A     ++LP  F+N GNYVISL+ + RW
Sbjct  73    LNELIPDWKEKGAPLDVEVTEDRFLFLSETGAKSVPNWALPDNFKNHGNYVISLANVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGFAA+E+LYN+   V G+AT ++G+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFAAAEVLYNDDGSVKGVATGNLGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q+  ++KLR+  +   Q Y +GIKE+WEID  KH+PG V+HT GWPLD
Sbjct  193   LFCEGARGHLGRQLSDRFKLRDGAD--PQVYGIGIKELWEIDPAKHKPGLVIHTAGWPLD  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
              +TYGGSFLYH+   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   TQTYGGSFLYHIDNNQVMVGFVVGLGYSNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   273 bits (697),  Expect(2) = 7e-177, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 162/231 (70%), Gaps = 3/231 (1%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSSW  1399
             FPGGA++G  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + ++ ++SW
Sbjct  327   FPGGALVGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPESFKTSW  386

Query  1400  IWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPI  1579
             +  ELY ARN++     GL+ G  +  IE+ +L G  P T  H   DHE +  A    PI
Sbjct  387   LHTELYRARNFKQWMSKGLYLGTLMVGIEQKLLGGNVPWTLHHQHWDHEMLKPASQCKPI  446

Query  1580  EYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARV  1759
             EYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VNL  YAGPESRYCPA V
Sbjct  447   EYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDPSVPVKVNLQTYAGPESRYCPAAV  506

Query  1760  YEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  507   YEFVKNDDGSERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_020054063.1| hypothetical protein [alpha proteobacterium SCGC AAA015-N04]
Length=535

 Score =   388 bits (996),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 173/304 (57%), Positives = 239/304 (79%), Gaps = 4/304 (1%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVV+VGAGP+GLSAAI+LKQL ++ N++LSVCV+EKG+EVGAHI+SG V E RALDE
Sbjct  1     MEYDVVVVGAGPSGLSAAIKLKQLSKKANSELSVCVIEKGSEVGAHIVSGAVIETRALDE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAE  674
             L+P+W+ + +P+    +SDKFL L+K +++ LP+P    NKGNY+ISLS   +WL Q+AE
Sbjct  61    LIPEWKTKNSPLKTQATSDKFLYLTKTKSYQLPTPPQMHNKGNYIISLSDFTKWLAQQAE  120

Query  675   ELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGC  854
             EL VE+YPGF+ASE+L++E+++V+G+AT DMG  KDGS   NF+ G+EL+ + T+ +EGC
Sbjct  121   ELEVEIYPGFSASEVLFDENNKVVGVATCDMGRLKDGSEGPNFERGIELRAKQTIFSEGC  180

Query  855   RGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGG  1034
             RG L + ++ K+ L    +   QTY +GIKE+WE+  +K +PG ++HT GWPLD+ TYGG
Sbjct  181   RGHLGKVLMEKFNLN--SDNSPQTYGIGIKELWEVSPDKSQPGSIMHTTGWPLDNDTYGG  238

Query  1035  SFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNE  1214
             SFLYH+   +++IG V+ L+Y NP+L+PY EFQ+FKHHPAI+ LLEGG  + YGAR LNE
Sbjct  239   SFLYHLDNNKISIGFVIGLDYKNPYLSPYLEFQRFKHHPAIKKLLEGGRRINYGARALNE  298

Query  1215  GGYQ  1226
             GG Q
Sbjct  299   GGVQ  302


 Score =   262 bits (669),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 154/229 (67%), Gaps = 1/229 (0%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWDNLRSSWIW  1405
              FPGG ++GC AGFLNVPKIKGTH AMKSGM+AA+S F+ +     +  F  +++ SW+W
Sbjct  308   TFPGGMLVGCEAGFLNVPKIKGTHLAMKSGMIAAQSIFENIDKLDEISEFQTDIKQSWLW  367

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
              ELY  RN RP+F+ G +  +  SAI+ YI +G +P T  H   DHE +    +   I+Y
Sbjct  368   NELYKVRNIRPSFKWGFWKAIMYSAIDTYIFRGNAPWTIDHHGTDHENLGNKDNYKEIKY  427

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPD  ISFD LT+V  S TNH+ +QP HL+LKD   P   N   Y  PE+RYCPA VYE
Sbjct  428   PKPDNVISFDRLTNVSFSGTNHEENQPCHLQLKDEDVPINTNFELYDNPETRYCPAGVYE  487

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              + ++N + KL INAQNC+HCK CDIKDPTQNI W  P+GGGGP Y  M
Sbjct  488   IVFNNN-KPKLQINAQNCVHCKTCDIKDPTQNINWVTPQGGGGPNYQGM  535



>ref|WP_038743975.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei]
 gb|KGW30586.1| FAD binding domain protein [Burkholderia pseudomallei MSHR2451]
Length=557

 Score =   380 bits (977),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E LYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAETLYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (688),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>gb|AHI78741.1| FAD binding domain protein [Burkholderia thailandensis E444]
 gb|AIC86531.1| FAD binding domain protein [Burkholderia thailandensis USAMRU 
Malaysia #20]
 gb|AIT21860.1| FAD binding domain protein [Burkholderia thailandensis E254]
Length=557

 Score =   380 bits (975),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EY+VVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYEVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P+DV V+ D+FL L++  AF     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLDVDVTEDRFLFLTEKSAFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILY++   V G+AT +MG+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYHDDGSVKGVATGNMGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   270 bits (690),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMSKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_038780633.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei]
 gb|KGU93216.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4377]
Length=557

 Score =   380 bits (977),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAI+P LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIQPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (688),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_027793424.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
acidipaludis]
Length=557

 Score =   380 bits (976),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 230/308 (75%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGVEMGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L+EL+P W+++  P+DVPV+ DKFL LS+  A     ++LP  F+N GNYVISL+ + RW
Sbjct  73    LNELMPDWKEQGAPLDVPVTEDKFLFLSETGAKAVPNWALPDNFKNHGNYVISLANVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+L+++   V G+AT +MG+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEVLFHDDGSVKGVATGNMGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+  K KL    +   Q Y +GIKE+WEID  KH+PG V+HT GWPL+
Sbjct  193   LFAEGCRGHLGRQLNEKLKLDR--DADPQVYGIGIKELWEIDPAKHQPGLVIHTAGWPLE  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
             + TYGGSFLYH+   QV +G VV L Y NP+L+P+EEFQ++K HPAIR  LEGG  + YG
Sbjct  251   NDTYGGSFLYHIDNNQVMVGFVVGLAYTNPYLSPFEEFQRYKTHPAIRQYLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAMTAGG  318


 Score =   269 bits (688),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 162/232 (70%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSS  1396
             VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AF+ +Q G     +  + +  + S
Sbjct  326   VFPGGALVGDDAGFLNAARIKGSHAAIKTGMLAAEAAFEAVQAGRQGDELTAYPEAFQKS  385

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+++ELY ARN++     GL+ G  +  IE+ +L G+ P T  H   D+E +  A    P
Sbjct  386   WLYEELYKARNFKQWMSKGLYLGTLMVGIEQKLLGGKVPWTLHHQHRDNEMLKPASQCRP  445

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA 
Sbjct  446   IEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEGRFCPAA  505

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++ DD+ E +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  506   VYEFVKDDSNEDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>gb|KGS24093.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR5569]
Length=557

 Score =   382 bits (982),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   267 bits (682),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +V PGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVLPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_003772075.1| electron transfer flavoprotein [Neisseria elongata]
 gb|EFE49703.1| FAD dependent oxidoreductase [Neisseria elongata subsp. glycolytica 
ATCC 29315]
 gb|AJE18074.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Neisseria 
elongata subsp. glycolytica ATCC 29315]
Length=550

 Score =   391 bits (1004),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 187/307 (61%), Positives = 238/307 (78%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE+++YD VIVGAGPAGLSAAIRLKQL  +   ++SVCVVEKG+EVGAHIL+G V +P+A
Sbjct  7     RESMQYDAVIVGAGPAGLSAAIRLKQLAEKDGREISVCVVEKGSEVGAHILAGAVIDPKA  66

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLP-SP-FENKGNYVISLSQLVRWLGQ  665
             L+ELLP WR+   P++ PVS D+ L L++ RAF LP +P F+N GNYVISL  L RWL +
Sbjct  67    LNELLPGWRKNGAPLNCPVSEDRVLFLTQKRAFKLPVTPCFQNHGNYVISLGLLTRWLAE  126

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGFAA+EILY+    V GIAT +MGV KDG   E FQ G+EL  + TL A
Sbjct  127   QAENLGVEIYPGFAAAEILYHADGSVKGIATGNMGVGKDGEATEMFQAGMELHAKQTLFA  186

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL++Q+I +++L +  + Q QTY +GIKE+WEI A K RPG V+H+ GWPLD KT
Sbjct  187   EGCRGSLSKQLIRRFELDK--HSQPQTYGIGIKEIWEIPAEKSRPGLVMHSTGWPLDSKT  244

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGG+FLYH+ + QVA+G VV L+Y NP+L+P+EEFQ+FK HP IR   EGG  + YGAR+
Sbjct  245   YGGAFLYHLNDNQVAVGFVVGLDYQNPYLSPFEEFQRFKTHPEIRKTFEGGRRIAYGARS  304

Query  1206  LNEGGYQ  1226
             L+EGG Q
Sbjct  305   LSEGGLQ  311


 Score =   258 bits (659),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 159/233 (68%), Gaps = 7/233 (3%)
 Frame = +2

Query  1232  PGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML------QGGSNMETFWDNLRS  1393
             PG  +IG +AGFLNVP+IKG HTAMKSGMLAAE+   +L      + G    ++      
Sbjct  319   PGALLIGDAAGFLNVPRIKGIHTAMKSGMLAAEAVLAVLDENDHAESGREAASYQTLFEQ  378

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+++EL+  RN RP+F+ G++P  A + +E+Y+ KGR+P T  H   DH ++ +A    
Sbjct  379   SWLYRELHEVRNVRPSFKWGMWPAFAYTGLEQYLFKGRTPWTISHHGTDHGSLKKAADCT  438

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ +N +H+ +QP HL+L DP+    +NL +YA PE+RYCPA
Sbjct  439   PIDYPKPDGVLTFDRLSSVFLANVSHEENQPVHLQLADPQAAIGINLREYASPETRYCPA  498

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE I  +NG  KL INA NC+HCK CDIKDPTQNI W  PEGG GP Y  M
Sbjct  499   GVYE-IVQENGSPKLQINAANCVHCKTCDIKDPTQNITWVCPEGGSGPNYGAM  550



>ref|WP_012730109.1| dehydrogenase [Burkholderia pseudomallei]
 ref|YP_002896448.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
pseudomallei MSHR346]
 gb|ACQ96640.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
pseudomallei MSHR346]
Length=581

 Score =   380 bits (975),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  37    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  96

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  97    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  156

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  157   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  216

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  K++PG V+HT GWPL 
Sbjct  217   LFCEGARGHLGRQLMDKFKL--NANSDPQAYGIGIKELWEIDPVKNKPGLVIHTAGWPLS  274

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  275   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  334

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  335   ARAITAGG  342


 Score =   269 bits (688),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  349   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  408

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  409   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  468

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  469   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  528

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  529   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWITPEGGGGPNYPNM  581



>gb|EMC84765.1| Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial, 
partial [Columba livia]
Length=608

 Score =   373 bits (958),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 177/311 (57%), Positives = 230/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVV+VGAGPAGLSAAIRLKQL  E N ++ VC+VEK +++GAH LSG   EPRA
Sbjct  55    RFAEEADVVVVGAGPAGLSAAIRLKQLAAEHNKEIRVCLVEKASQIGAHTLSGACLEPRA  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P+  PV+ DKF +L+KN    +P     P  N GNY++ L  LV WL
Sbjct  115   LEELFPDWKERGAPLKTPVTEDKFGILTKNSRIPVPILPGLPMVNHGNYIVRLGHLVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  175   GEQAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWIIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  293   HTYGGSFLYHLNESEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  353   GARALNEGGFQ  363


 Score =   275 bits (704),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  369   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLTNENLQSKTIGLDVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  +IL+G+ P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYAVRNIRPSCHSILGVYGGMIYTGIFYWILRGKEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLAVFDGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>ref|WP_021251410.1| dehydrogenase [Burkholderia pseudomallei]
 gb|EQA89882.1| dehydrogenase [Burkholderia pseudomallei MSHR338]
 gb|AIP09638.1| FAD binding domain protein [Burkholderia pseudomallei]
Length=557

 Score =   380 bits (975),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  K++PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKNKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (687),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWITPEGGGGPNYPNM  557



>ref|XP_006682380.1| hypothetical protein BATDEDRAFT_27979 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76830.1| hypothetical protein BATDEDRAFT_27979 [Batrachochytrium dendrobatidis 
JAM81]
Length=636

 Score =   379 bits (972),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 257/386 (67%), Gaps = 23/386 (6%)
 Frame = +3

Query  75    QINTGTTIQHRFYTHATIVHLSQLKTMLKFILSSAKSKLSTTPINRFSSFPNPCGKASRF  254
             +INT T++    Y         Q +++   I++       +TP  R            + 
Sbjct  19    RINTVTSLVSDSYCLLPTRIQLQSRSIPSRIVNKQDRSYHSTPFTR-----------QQL  67

Query  255   GAESGYSLNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVE  434
               E+   LNG R FS +        DV IVGAGPAGLSAAI++++       D  V VVE
Sbjct  68    DDETKAILNGER-FSEQ-------VDVCIVGAGPAGLSAAIQIRKRALADGKDTRVFVVE  119

Query  435   KGAEVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--F  608
             KGAEVGAHILSG V EPRAL+EL+P W+++  P++ P + D+  L ++  A  +P P   
Sbjct  120   KGAEVGAHILSGAVLEPRALNELIPDWKEKGAPLNTPATKDRMYLFTEKYAVPIPHPPQM  179

Query  609   ENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGS  788
              N GNY++SL+  VRWLG++A+E+GVE+YP FAASEILY+E   V GIATND+G+ KDG 
Sbjct  180   TNSGNYIVSLNNFVRWLGEQADEVGVEIYPSFAASEILYHEDGSVKGIATNDVGIGKDGK  239

Query  789   RKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDAN  968
              K+NF+ G+E+  RVTLLAEGC GSL +++I K+ LR+  + + QTY +GIKEVWE+D +
Sbjct  240   PKDNFERGMEIHARVTLLAEGCHGSLTKKLIQKFDLRK--DSEAQTYGIGIKEVWELDPS  297

Query  969   KHRPGDVLHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHH  1148
             KH PG VLH++GWP+D+KTYGG+F+YH++    A+G V +LNY NP L+PY EFQ++KHH
Sbjct  298   KHDPGLVLHSVGWPMDYKTYGGAFMYHLENNLCAVGFVTSLNYSNPTLSPYREFQRYKHH  357

Query  1149  PAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             P I+  LEGG VL YGAR LNEGG Q
Sbjct  358   PHIKKYLEGGKVLSYGARALNEGGLQ  383


 Score =   270 bits (689),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 172/246 (70%), Gaps = 19/246 (8%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG---GSN----------M  1366
             + PG A+IGC+AGFLNVPKIKGTHTAMKSGMLA ++A++ ++G   GS+          +
Sbjct  389   IVPGAALIGCTAGFLNVPKIKGTHTAMKSGMLAGDAAYEKIEGISAGSDTTEPSTAPLLL  448

Query  1367  ETFWDNLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKH-GKP  1537
               + D L+SSW+WKELY  RN RP+F +  GL+ GL  S ++   LKGR P TF H  + 
Sbjct  449   TNYVDTLKSSWVWKELYEVRNIRPSFHSVLGLWGGLIYSGLDTLFLKGRVPWTFSHPAQK  508

Query  1538  DHEAINEAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELV-NL  1714
             DHE++   KS+ PI YPKPDG ISFD+L SV R+ T+H+ +QP HLRLK   +P+L  N 
Sbjct  509   DHESLTPIKSANPIHYPKPDGVISFDLLESVSRTGTSHEENQPVHLRLKSGPSPQLEHNW  568

Query  1715  PKYAGPESRYCPARVYEYISDDN--GEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGG  1888
               Y GPE ++CPA VYEY+ D+   G+ +  INA NC+HCK CDIKDP+QNI W+VPEGG
Sbjct  569   KVYGGPEQKFCPAGVYEYLDDEANPGKKRFQINASNCIHCKTCDIKDPSQNIDWSVPEGG  628

Query  1889  GGPGYT  1906
             GGP Y 
Sbjct  629   GGPKYV  634



>ref|WP_009891608.1| dehydrogenase [Burkholderia thailandensis]
 ref|YP_443128.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
thailandensis E264]
 gb|ABC38555.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
thailandensis E264]
 gb|AHI74113.1| FAD binding domain protein [Burkholderia thailandensis 2002721723]
 gb|AIP26986.1| FAD binding domain protein [Burkholderia thailandensis E264]
 gb|AIS96673.1| FAD binding domain protein [Burkholderia thailandensis MSMB59]
Length=557

 Score =   379 bits (972),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EY+VVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYEVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P+DV V+ D+FL L++  AF     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLDVDVTEDRFLFLTEKSAFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILY++   V G+AT +MG+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYHDDGSVKGVATGNMGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ ++KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDQFKL--NANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   270 bits (690),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMSKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>emb|CCI45444.1| unnamed protein product [Albugo candida]
Length=568

 Score =   402 bits (1034),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 241/314 (77%), Gaps = 10/314 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA++YDV++VG GPA LSAAIRLKQL  EK  DLSVCV+EKGAE+G+HI+SGNVFE RA
Sbjct  5     REAMDYDVLLVGGGPASLSAAIRLKQLSLEKGTDLSVCVIEKGAEIGSHIVSGNVFETRA  64

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             LDEL+P W+++K P+D PV+ D FL LS+ ++     F LP    N GNYVISLS+L RW
Sbjct  65    LDELIPDWKEKKAPLDTPVTQDSFLFLSEKKSWKLPNFLLPPQQHNLGNYVISLSKLTRW  124

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG++AEELGVE+YPGF+A+++LY E   V GIAT D+G+ KDG  K  F  G+EL+ R T
Sbjct  125   LGEQAEELGVEIYPGFSAAQVLYREDGAVYGIATRDVGIGKDGKPKSTFARGMELRARTT  184

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             LL EGCRGS +E+VI K+KLR + + Q QTY LG+KEVW I  +KH PG V HT+GWPL 
Sbjct  185   LLGEGCRGSCSEEVIRKFKLRGE-DTQPQTYGLGVKEVWRIPKDKHHPGLVQHTLGWPLQ  243

Query  1017  H----KTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTV  1184
             +    KT+GGSF+YHM+E    IGLVV L+Y NP++NPYEEFQ+FK HP+I+ +L+GG  
Sbjct  244   NKLLDKTFGGSFMYHMEEDLAQIGLVVGLDYENPYINPYEEFQRFKTHPSIKEMLDGGEC  303

Query  1185  LQYGARTLNEGGYQ  1226
             L YGAR LNEGGY 
Sbjct  304   LAYGARCLNEGGYH  317


 Score =   246 bits (627),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 159/247 (64%), Gaps = 19/247 (8%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS-------------NM  1366
              FPGGA+IGC+ GFLN  KIKGTHTAMKSGMLAAE+ ++ L   +             ++
Sbjct  323   TFPGGALIGCAPGFLNSVKIKGTHTAMKSGMLAAEAVYNALASTAGESAEIDLTAPPPDI  382

Query  1367  ETFWDNLRSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHE  1546
              ++  ++  SWI +EL   RN   AF  GL PGL  +A   +I +G+ P T  +  PD  
Sbjct  383   SSYESSVEKSWIIEELKPVRNVHAAFHYGLLPGLLHAAFSSFIARGKEPWTIPNKIPDSA  442

Query  1547  AINEAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPK---TPELVNLP  1717
                 AK   PI YPKPDG ISFD+L+++ RS TNH+HDQP HLR+K PK    P  V+ P
Sbjct  443   KTRPAKDFAPIVYPKPDGVISFDLLSNLQRSGTNHNHDQPPHLRIK-PKLASAPTQVSYP  501

Query  1718  KYAGPESRYCPARVYEYI--SDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGG  1891
              YAGPE R+CPA+VYEY   S+ NG  +L INAQNC+HCK C IK P + I WTVPEGGG
Sbjct  502   VYAGPEQRFCPAKVYEYTDGSEANGIPQLVINAQNCVHCKCCSIKTPEEYIDWTVPEGGG  561

Query  1892  GPGYTVM  1912
             GP Y +M
Sbjct  562   GPAYELM  568



>ref|XP_005507908.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Columba livia]
Length=556

 Score =   373 bits (958),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 177/311 (57%), Positives = 230/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVV+VGAGPAGLSAAIRLKQL  E N ++ VC+VEK +++GAH LSG   EPRA
Sbjct  3     RFAEEADVVVVGAGPAGLSAAIRLKQLAAEHNKEIRVCLVEKASQIGAHTLSGACLEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P+  PV+ DKF +L+KN    +P     P  N GNY++ L  LV WL
Sbjct  63    LEELFPDWKERGAPLKTPVTEDKFGILTKNSRIPVPILPGLPMVNHGNYIVRLGHLVSWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  123   GEQAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  183   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWIIDEKKWKPGRVEHTVGWPLDR  240

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  241   HTYGGSFLYHLNESEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  300

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  301   GARALNEGGFQ  311


 Score =   275 bits (704),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  317   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLTNENLQSKTIGLDVQEYEE  376

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  +IL+G+ P T KH  PD   + 
Sbjct  377   NLKKSWVWKELYAVRNIRPSCHSILGVYGGMIYTGIFYWILRGKEPWTLKHPGPDFAQLK  436

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  437   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLAVFDGPE  496

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  497   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  556



>ref|WP_038738208.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
sp. MSHR44]
 gb|KGW15444.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4000]
 gb|KGX07316.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
sp. MSHR44]
Length=557

 Score =   379 bits (973),  Expect(2) = 4e-176, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K H AIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHSAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (687),  Expect(2) = 4e-176, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLHTELYRARNFKQWMGKGLYLGTLMIGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_028217507.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
oxyphila]
Length=557

 Score =   377 bits (968),  Expect(2) = 4e-176, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 229/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGVEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL+P W+++  P++VPV+ D+FL L++N A     ++LP  F+N GNYVISL+ + RW
Sbjct  73    IGELIPDWKEKGAPLNVPVTEDQFLFLTENGAKAVPNWALPDNFKNHGNYVISLANVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+LYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEVLYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EGCRG L  Q+   +KL +  +   Q Y +GIKE+WEID  KH+PG V+HT GWPL+
Sbjct  193   LFCEGCRGHLGRQLSEHFKLGK--DADPQVYGIGIKELWEIDPAKHKPGLVIHTAGWPLE  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYH +  QV +G VV L Y NP+L+P+EEFQ++K HPAIR  LEGG  + YG
Sbjct  251   KDTYGGSFLYHTENNQVMVGFVVGLAYTNPYLSPFEEFQRYKTHPAIRKYLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAMTAGG  318


 Score =   271 bits (693),  Expect(2) = 4e-176, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 163/231 (71%), Gaps = 3/231 (1%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSSW  1399
             FPGGA++G +AGFLN  +IKG+H A+K+GMLAAE+AF+ +Q G     +  + D  ++SW
Sbjct  327   FPGGALVGDNAGFLNAARIKGSHAAIKTGMLAAEAAFEAVQAGRQSDELTAYPDAFKNSW  386

Query  1400  IWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPI  1579
             + +ELY ARN++     GL+ G  +  IE+ +L G+ P T  H   DHE +  A    PI
Sbjct  387   LHEELYKARNFKQWMSKGLYLGTLMVGIEQKLLGGKVPWTLHHQHRDHEMLRPASQCKPI  446

Query  1580  EYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARV  1759
             EYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  +NL  YAGPESR+CPA V
Sbjct  447   EYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDATVPVGINLKTYAGPESRFCPAGV  506

Query  1760  YEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YE++ DD+ E +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  507   YEFVKDDSDEDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_021132414.1| dehydrogenase [Phaeospirillum fulvum]
 gb|EPY01515.1| dehydrogenase [Phaeospirillum fulvum MGU-K5]
Length=536

 Score =   372 bits (954),  Expect(2) = 5e-176, Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 223/304 (73%), Gaps = 8/304 (3%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +E+DVVIVG GPAGL+AAIRLKQ+    + DL+VCV+EKG+E+GAHILSG V EPR L E
Sbjct  1     MEFDVVIVGGGPAGLTAAIRLKQI----DPDLTVCVLEKGSEIGAHILSGAVLEPRTLAE  56

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAE  674
             L P WR+   P+  P S D F  L+++RA  LP+P    N GNY+ISL    RWL  +AE
Sbjct  57    LFPDWRERGAPLHTPASDDSFYYLTESRAIRLPTPPTMNNHGNYIISLGNFARWLATQAE  116

Query  675   ELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGC  854
              LGVE++ GFAA+E+LY+ES  V G+AT DMGV KDG    NF  GVEL  R TL AEGC
Sbjct  117   ALGVEIFAGFAAAEVLYDESGAVRGVATGDMGVGKDGEPGPNFTPGVELLARQTLFAEGC  176

Query  855   RGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGG  1034
             RGSL + +  ++ LR + +   QTY +GIKE+WEID  +H PG ++H++GWP+D KTYGG
Sbjct  177   RGSLTKTLFERFDLRRECD--VQTYGIGIKELWEIDPAQHHPGKIVHSVGWPMDAKTYGG  234

Query  1035  SFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNE  1214
             +FLYH+++ QVA+G VV L+Y NP L+P++EFQ+FK HPAIRP  EGG  + YGAR L+E
Sbjct  235   AFLYHLEDNQVAVGFVVGLDYANPHLSPFDEFQRFKTHPAIRPTFEGGRRISYGARALSE  294

Query  1215  GGYQ  1226
             GG Q
Sbjct  295   GGLQ  298


 Score =   276 bits (705),  Expect(2) = 5e-176, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 167/234 (71%), Gaps = 6/234 (3%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS----NMETFWDNLRS  1393
              FPGGA+IG +AGFLNVPK+KGTHTAMKS M+AAE+    L  G+    ++  +   LR 
Sbjct  304   TFPGGALIGDTAGFLNVPKVKGTHTAMKSAMVAAEAVAKALGSGAAPSGDLSDYPAALRQ  363

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+W ELY ARN RP+F  GL+ GLA SA +  IL+GR+P T KH + DH A+ +A    
Sbjct  364   SWLWDELYRARNVRPSFHWGLWGGLAYSAFDYEILRGRAPWTLKH-RADHLALGKAADYP  422

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
              I YPKPDG +SFD L+SV+ SNTNH+ +QP+HL+L DP  P  VNLP Y  PE RYCPA
Sbjct  423   AIAYPKPDGIVSFDKLSSVFISNTNHEENQPSHLKLTDPAIPVSVNLPLYDAPEQRYCPA  482

Query  1754  RVYEYI-SDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE + + D+   +L INAQNC+HCK CDIKDPTQNI WTVPEGGGGP Y  M
Sbjct  483   GVYEIVAATDSAPPRLQINAQNCVHCKTCDIKDPTQNITWTVPEGGGGPNYPNM  536



>ref|WP_025989846.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
oklahomensis]
 gb|AIO66815.1| FAD binding domain protein [Burkholderia oklahomensis]
Length=557

 Score =   376 bits (966),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 221/308 (72%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL   K  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAGKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+ +  P+ V V+ D+FL L++   F     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKAQGAPLTVDVTEDRFLFLTEKSGFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MG+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLAYTNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (693),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHADHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFVSNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++  D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKSDDGTDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_017450682.1| MULTISPECIES: dehydrogenase [Herbaspirillum]
Length=558

 Score =   375 bits (962),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 176/310 (57%), Positives = 229/310 (74%), Gaps = 7/310 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  ++N +++VCV+EKG+EVGAHILSG V +PRA
Sbjct  14    RESMEYDVVIVGGGPAGLSAAIRLKQLAAQQNREVAVCVLEKGSEVGAHILSGAVMDPRA  73

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFS-----LPSPFENKGNYVISLSQLVRW  656
             L EL+P W+++  P+  PV+ D+FL LS  +A+      LP+ F+N GNYVISLS + RW
Sbjct  74    LSELIPDWKEQGAPLHTPVTEDRFLFLSATKAYKTPNWLLPTCFQNHGNYVISLSNVTRW  133

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+LY+E   V G+AT ++G+ K+G     FQ G+EL  + T
Sbjct  134   LGQQAEALGVEIFPGFPAAEVLYHEDGSVKGVATGNLGINKEGEPTAEFQLGMELHAKYT  193

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
               AEG RG L +Q+I KY+L E  +   QTYA+GIKE+WE+    H+PG V+HT GWPL 
Sbjct  194   FFAEGARGHLGKQLIAKYQLDEGRD--PQTYAIGIKELWEVKPEVHQPGLVVHTAGWPLP  251

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
             H TYGGSFLYH++  QVA+G VV L Y NP+L+P+EEFQ++K HP IR   EGG  L YG
Sbjct  252   HDTYGGSFLYHLENNQVAVGYVVGLAYQNPYLSPFEEFQRYKTHPEIRKFFEGGKRLSYG  311

Query  1197  ARTLNEGGYQ  1226
             AR +  GG Q
Sbjct  312   ARAITAGGVQ  321


 Score =   273 bits (697),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 162/232 (70%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNMETFWDNLRSS  1396
             VFPGGA++GC AGFLN  +IKG+H A+KSGMLAAE+AF  L   + G  +  +     +S
Sbjct  327   VFPGGALLGCDAGFLNASRIKGSHAAIKSGMLAAEAAFQALGENRQGDELAAYPAAFDAS  386

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+ +EL+ ARN++P+   GL  G  L  I++ +  G++P T +H   DHE +  A    P
Sbjct  387   WLKEELHKARNFKPSMSRGLVSGTLLVGIDQVLFGGKAPWTLRHTHADHECLRPASDFAP  446

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I YPKPDG ++FD L+SV+ SNTNH  DQPAHL LKD   P  +NL KYAGPE+RYCPA 
Sbjct  447   IAYPKPDGKLTFDRLSSVFISNTNHGEDQPAHLTLKDKNVPVQINLAKYAGPEARYCPAG  506

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++ +++   +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y+ M
Sbjct  507   VYEFVKNEDHSDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYSGM  558



>ref|WP_038751255.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
pseudomallei]
 gb|KGR97560.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei ABCPW 111]
Length=557

 Score =   375 bits (963),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 221/308 (72%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRW  656
             + EL P W+++  P+ V V+ D+FL L++  AF     +LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKEKGAPLTVDVTEDRFLFLTEKSAFQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG  AE LGVE++PGF A+EILYN    V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGTMAEGLGVEIFPGFPAAEILYNADGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFCEGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLS  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G V+ L Y NP+L+P+EEFQ++K HP+IRP LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVIGLAYSNPYLSPFEEFQRYKTHPSIRPFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   272 bits (696),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 163/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  325   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMSKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVSVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>gb|KFC75758.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Massilia 
sp. LC238]
Length=558

 Score =   376 bits (965),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 230/310 (74%), Gaps = 7/310 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA+EYDVVIVG GPAGLSAAIRLKQL  EK  ++SVCV+EKG E+GAHILSG V +P A
Sbjct  14    REAMEYDVVIVGGGPAGLSAAIRLKQLAAEKGQEVSVCVLEKGGELGAHILSGAVMDPIA  73

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L+EL+P W+++  P++  V+ D+ LLL++ RA     F +P    N GNYVISL+ + RW
Sbjct  74    LNELIPDWKEKGAPLNTAVTEDQVLLLTETRAIKTPNFMVPKMLTNHGNYVISLANVTRW  133

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+LYNE   V G+AT +MGV +DG    +FQ G+EL  + T
Sbjct  134   LGQQAEALGVEIFPGFPAAEVLYNEDGSVKGVATGNMGVKRDGEPGPDFQLGMELHAKYT  193

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEG RG L +Q++ KY L  KG    QTY +GIKE+WEID +KH+PG V+HT GWPLD
Sbjct  194   LFAEGSRGHLGKQLMAKYDLN-KGK-DPQTYGIGIKELWEIDPSKHKPGLVIHTAGWPLD  251

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
             + TYGGSFLYH++  QVA+G VV L Y NP+L+PYEEFQ++K HPAIR   EGG  + YG
Sbjct  252   NDTYGGSFLYHLENNQVAVGFVVGLAYQNPYLSPYEEFQRYKTHPAIRHYFEGGKRISYG  311

Query  1197  ARTLNEGGYQ  1226
             AR +  GG Q
Sbjct  312   ARAITAGGLQ  321


 Score =   271 bits (694),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IGC AGFLN  +IKG+H A+K+GMLAAESAF  L  G     + ++      
Sbjct  326   TVFPGGALIGCDAGFLNTSRIKGSHAAIKTGMLAAESAFAALGEGRQHDELASYPAAFEK  385

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+ +EL+ ARN++P    GL+ G  ++ I++ + +G++P T  H   DHE +  A    
Sbjct  386   SWLHEELHVARNFKPWMSKGLYIGTIMTGIDQMVFRGKAPWTLHHQHADHECLKPASQFK  445

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH  DQP HL LK+   P  VNL KYAGPE RYCPA
Sbjct  446   PIAYPKPDGKLTFDRLSSVFISNTNHAEDQPIHLTLKNAAIPVDVNLAKYAGPEQRYCPA  505

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G+ +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  506   GVYEFVKNDDGQDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  558



>ref|WP_020850794.1| FAD binding domain protein [Burkholderia pseudomallei]
 ref|YP_008340669.1| FAD binding domain protein [Burkholderia pseudomallei MSHR305]
 gb|AGR73135.1| FAD binding domain protein [Burkholderia pseudomallei MSHR305]
 gb|KGS95815.1| pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia 
pseudomallei MSHR7498]
 gb|KGV62541.1| FAD binding domain protein [Burkholderia pseudomallei ABCPW 91]
 gb|KGW04535.1| FAD binding domain protein [Burkholderia pseudomallei MSHR4303]
Length=542

 Score =   378 bits (970),  Expect(2) = 8e-176, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 223/305 (73%), Gaps = 7/305 (2%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA+ E
Sbjct  1     MEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRAITE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAF-----SLPSPFENKGNYVISLSQLVRWLGQ  665
             L P W+++  P++V V+ D+FL L++  +F     +LP  F+N GNYVISL  + RWLGQ
Sbjct  61    LFPDWKEKGAPLNVDVTEDRFLFLTEKSSFQVPNWALPDNFKNHGNYVISLGNVTRWLGQ  120

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + TL  
Sbjct  121   QAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYTLFC  180

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EG RG L  Q++ K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL   T
Sbjct  181   EGARGHLGRQLMDKFKLN--ANSDPQAYGIGIKELWEIDPVKHKPGLVIHTAGWPLSSDT  238

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIRP LEGG  + YGAR 
Sbjct  239   YGGSFLYHMDNNQVVVGFVVGLAYSNPYLSPFEEFQRYKTHPAIRPFLEGGKRVSYGARA  298

Query  1206  LNEGG  1220
             +  GG
Sbjct  299   ITAGG  303


 Score =   269 bits (688),  Expect(2) = 8e-176, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D  ++
Sbjct  310   TVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKT  369

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  370   SWLHTELYRARNFKQWMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQ  429

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI+YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  430   PIDYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  489

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  490   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  542



>ref|NP_001087869.1| electron-transferring-flavoprotein dehydrogenase [Xenopus laevis]
 gb|AAH82397.1| MGC81928 protein [Xenopus laevis]
Length=616

 Score =   374 bits (959),  Expect(2) = 9e-176, Method: Compositional matrix adjust.
 Identities = 190/383 (50%), Positives = 253/383 (66%), Gaps = 24/383 (6%)
 Frame = +3

Query  99    QHRFYTHATIVHLSQLKTML-KFILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYS  275
             +H  + H    + + LK  L  + L    S         ++ +P   G+  R+       
Sbjct  6     KHTLHAHRCFAYFTTLKNCLPSYCLKRWASSSVPRITTHYTIYPR--GQDQRW-------  56

Query  276   LNGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGA  455
                  G + E  R A E DVVIVG GPAGLSAAIRLKQL  E + +L VC+VEKGA++GA
Sbjct  57    ----EGVNME--RFAEEADVVIVGGGPAGLSAAIRLKQLAAECDKELRVCLVEKGAQIGA  110

Query  456   HILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGN  623
             HILSG   EPRAL+EL P W++   P++ PV+ DKF +L+K     +P     P  N GN
Sbjct  111   HILSGACLEPRALEELFPDWKERGAPLNTPVTEDKFGILTKKHRIPVPILPGLPMNNHGN  170

Query  624   YVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENF  803
             Y++ L   V WLG++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDGS K  F
Sbjct  171   YIVRLGHFVSWLGEQAEALGVEIYPGYAAAEVLFHEDGSVKGIATNDVGIHKDGSPKSTF  230

Query  804   QHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPG  983
             + G+EL  +VT+  EGC G LA+Q+  K+ LR+  + + QTYA+G+KE+W ID  K +PG
Sbjct  231   ERGLELHAKVTIFGEGCHGHLAKQLYNKFNLRQ--SCEPQTYAIGLKELWVIDEKKWKPG  288

Query  984   DVLHTIGWPLDHKTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAI  1157
              V HT+GWPLD  TYGGSFLYH+ E +  VAIGLVV L+Y NP++NP+ EFQ++KHHP+I
Sbjct  289   CVEHTVGWPLDRHTYGGSFLYHLNEGEPLVAIGLVVGLDYQNPYVNPFREFQRWKHHPSI  348

Query  1158  RPLLEGGTVLQYGARTLNEGGYQ  1226
              P LEGGT + YGAR LNEGG+Q
Sbjct  349   VPTLEGGTRIAYGARALNEGGFQ  371


 Score =   273 bits (699),  Expect(2) = 9e-176, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 166/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG ++GCS GF+NVPKIKGTHTAMKSGMLAAE+ F  L          G ++  + +
Sbjct  377   TFPGGILVGCSPGFMNVPKIKGTHTAMKSGMLAAETIFKQLTDENIQSKTQGLDVPEYEE  436

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
              L+ SW+WKELY  RN RP+     GL+ G+  + I  ++L+G+ P T KH   D + + 
Sbjct  437   QLKKSWVWKELYSVRNIRPSCHGPLGLYGGMIYTGIFYWLLRGKEPWTLKHKGLDSQQLK  496

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK  +PIEYPKPDG +SFD+L+SV  S TNH+HDQPAHL LKD  TP   NL  + GPE
Sbjct  497   PAKDCIPIEYPKPDGKLSFDLLSSVALSGTNHEHDQPAHLTLKDDSTPVNRNLAIFDGPE  556

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEY+  ++GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  557   QRFCPAGVYEYVPLESGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  616



>ref|WP_011881872.1| dehydrogenase [Burkholderia vietnamiensis]
 ref|YP_001117005.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
vietnamiensis G4]
 gb|ABO57540.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
vietnamiensis G4]
Length=565

 Score =   382 bits (980),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL +EK A++ VCV+EKG+E+GAHILSG V +P A
Sbjct  21    RESMEYDVVIVGGGPAGLSAAIRLKQLAKEKGAEIGVCVLEKGSEIGAHILSGAVMDPGA  80

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL+P W     P+DV V+ D+FL LS+  A     ++LPS F N GNYVISL  + RW
Sbjct  81    ISELIPDWAALGAPLDVEVTEDRFLFLSETDAKAVPSWALPSNFRNHGNYVISLGNVTRW  140

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  141   LGTQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  200

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  201   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  258

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM + QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  259   SDTYGGSFLYHMDKNQVMVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRTFLEGGKRVSYG  318

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  319   ARAITAGG  326


 Score =   265 bits (676),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 159/233 (68%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGG---SNMETFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAAE+AF  +Q G     +  + +  + 
Sbjct  333   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAAEAAFHAVQTGRRGDELSAYPNAFKR  392

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  EL+ ARN++     GL+ G  +  IE+ +L G  P T  H   DHE +  A    
Sbjct  393   SWLHAELHRARNFKQWMAKGLYLGTLMVGIEQKLLGGNVPWTLHHKHADHEMLKPASQCT  452

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  453   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEGRFCPA  512

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  513   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  565



>ref|WP_036245898.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Massilia 
sp. BSC265]
Length=542

 Score =   370 bits (949),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 226/307 (74%), Gaps = 7/307 (2%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVG GPAGLSAAIRLKQL  EK  ++SVCV+EKG E+GAHILSG V +P AL+E
Sbjct  1     MEYDVVIVGGGPAGLSAAIRLKQLAAEKGQEVSVCVLEKGGELGAHILSGAVMDPIALNE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRWLGQ  665
             L+P W+++  P+  PV+ D+ L L++ +A     F +P    N GNYVISL+ +VRWLGQ
Sbjct  61    LIPDWKEKGAPLHTPVTEDQVLFLTEAKAIRTPNFMVPKMLTNHGNYVISLANVVRWLGQ  120

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE++PGF A+E+LYN+   V G+AT +MGV +DG    +FQ G+EL  + TL A
Sbjct  121   QAESLGVEIFPGFPAAEVLYNDDGSVKGVATGNMGVKRDGEPGSDFQLGMELHAKYTLFA  180

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EG RG L  Q++ KY L  KG    QTY +GIKE+WEID +KH+PG V+HT GWPLD+ T
Sbjct  181   EGSRGHLGRQLMAKYDLN-KGK-DPQTYGIGIKELWEIDPSKHKPGLVIHTAGWPLDNST  238

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++  QVA+G VV L Y NP+L+PYEEFQ++K HPAIR   EGG  + YGAR 
Sbjct  239   YGGSFLYHLENNQVAVGFVVGLAYQNPYLSPYEEFQRYKTHPAIRHFFEGGKRISYGARA  298

Query  1206  LNEGGYQ  1226
             +  GG Q
Sbjct  299   ITAGGLQ  305


 Score =   276 bits (707),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 164/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IGC AGFLN  +IKG+H A+K+GMLAAESAF  L  G     + ++      
Sbjct  310   TVFPGGALIGCDAGFLNTSRIKGSHAAIKTGMLAAESAFAALGEGRQHDELVSYPAAFEQ  369

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+ +EL+ ARN++P    GL+ G  ++ I++ + +G++P T  H   DHEA+  A    
Sbjct  370   SWLHEELHVARNFKPWMSKGLYIGTIMTGIDQMVFRGKAPWTLHHKHADHEALRPASQFQ  429

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH  DQP HL LK+P  P  VNL KYAGPE RYCPA
Sbjct  430   PIAYPKPDGKLTFDRLSSVFISNTNHAEDQPIHLTLKNPSIPVDVNLAKYAGPEQRYCPA  489

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYEY+ +D+G+ +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  490   GVYEYVKNDDGKDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  542



>gb|KFH65101.1| electron-transferring-flavoprotein dehydrogenase [Mortierella 
verticillata NRRL 6337]
Length=645

 Score =   367 bits (941),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 225/307 (73%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVG GPAGLSAAI+LKQL      +L V +VEK  E+GAH LSG V EPRA
Sbjct  95    RFADETDVVIVGGGPAGLSAAIKLKQLANADGRELRVVLVEKAGEIGAHTLSGAVLEPRA  154

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL+P W+++  P++ P   D     +KN +  LP P    NKGNY++SLS  V+WLG+
Sbjct  155   LNELIPDWKEKGAPLNQPALHDHMKFFTKNYSIPLPHPPQMNNKGNYIVSLSNYVKWLGE  214

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AEE GVE++PGFAASEILYNE   V GIATND+G+ K+   K+ F+ G+E   +VTL A
Sbjct  215   QAEEAGVEVFPGFAASEILYNEDGSVKGIATNDVGLDKNFRPKDGFERGMEFHAKVTLFA  274

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGC GSL +Q+  K+ LR++ + Q  TY +GIKEVW+ID  K +PG V+H +GWP+D+ T
Sbjct  275   EGCHGSLTKQLFRKFNLRDECDPQ--TYGIGIKEVWKIDPAKSKPGTVIHAMGWPIDNAT  332

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSF+YHM +  +++GLV+ L+Y NP+LNPY+EFQ+FKHHP ++ LLEGG  + YGAR 
Sbjct  333   YGGSFIYHMGDDMLSLGLVIGLDYENPYLNPYKEFQRFKHHPYVKDLLEGGECMTYGARA  392

Query  1206  LNEGGYQ  1226
             +NEGG Q
Sbjct  393   INEGGLQ  399


 Score =   280 bits (715),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 169/238 (71%), Gaps = 12/238 (5%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN-------METFWDNL  1387
             FPGGA+IGC+AGFLN+ KIKGTHTAMKSGMLAAESA++ +   S        +E F   +
Sbjct  406   FPGGALIGCTAGFLNLIKIKGTHTAMKSGMLAAESAYEAITSESYSEEKPVVLEDFEKKV  465

Query  1388  RSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEA  1561
             + SWIWKEL   RN RP+F    G   G+  S I+  +LKGR+P TF +  PDHE +  A
Sbjct  466   KESWIWKELTEIRNCRPSFHTPLGNLGGVIYSGIDTILLKGRTPWTFHNRTPDHERLKVA  525

Query  1562  KSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESR  1741
             K++ PIEYPKPDG ISFD+LTSV R+ TNH  +QP HLRLK+   P   NL  + GPE R
Sbjct  526   KNAQPIEYPKPDGVISFDLLTSVSRTGTNHTENQPVHLRLKNKDIPVERNLKVFDGPEGR  585

Query  1742  YCPARVYEYISDDNGEV---KLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYT  1906
             +CPA VYE++ D++G     +L IN+QNC+HCK CDIKDP+QNI WTVPEGGGGP Y+
Sbjct  586   FCPAGVYEFVDDESGPAGTKRLQINSQNCIHCKTCDIKDPSQNIDWTVPEGGGGPQYS  643



>ref|WP_028232653.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
mimosarum]
Length=559

 Score =   380 bits (976),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 231/308 (75%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  15    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  74

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L+EL+P W+++  P++VPV+ DKFL LS+  A     ++LP  F+N GNYVISL+ + RW
Sbjct  75    LNELIPDWKEQGAPLNVPVTEDKFLFLSETGAKAVPNWALPDNFKNHGNYVISLANVTRW  134

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+A+ LGVE++PGF A+E+LYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  135   LGQQAKALGVEIFPGFPAAEVLYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  194

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EGCRG L  Q+  K+KL +  +   Q Y +GIKE+WEID +KH+PG V+HT GWPL+
Sbjct  195   LFCEGCRGHLGRQLNEKFKLGK--DSDPQVYGIGIKELWEIDPSKHQPGLVIHTAGWPLE  252

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYH+   QV +G VV L Y NP+L+P+EEFQ++K HP IR  LEGG  + YG
Sbjct  253   SDTYGGSFLYHIDNNQVMVGFVVGLAYQNPYLSPFEEFQRYKTHPEIRKYLEGGKRVSYG  312

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  313   ARAITAGG  320


 Score =   266 bits (680),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 159/230 (69%), Gaps = 3/230 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSS  1396
             VFPGGA++G  AGFLN  +IKG+H A+K+GMLAA++AF+ +Q G     +  + +  + S
Sbjct  328   VFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAADAAFEAVQAGRQSDELAAYPEAFKQS  387

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+  ELY ARN++     GL+ G  +  IE+ +L G  P T  H   DHE +  A    P
Sbjct  388   WLHTELYKARNFKQWMSKGLYLGTLMVGIEQKLLGGNVPWTLHHQHRDHEMLKPASQCKP  447

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  +NL  YAGPE+R+CPA 
Sbjct  448   IEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDMTVPVGINLATYAGPEARFCPAG  507

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYT  1906
             VYE++ DD  E +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y+
Sbjct  508   VYEFVKDDQEEDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYS  557



>ref|WP_011285997.1| electron transfer flavoprotein [Dechloromonas aromatica]
 ref|YP_283457.1| FAD-dependent oxidoreductase [Dechloromonas aromatica RCB]
 gb|AAZ44987.1| FAD dependent oxidoreductase:Electron transfer flavoprotein-ubiquinone 
oxidoreductase [Dechloromonas aromatica RCB]
Length=547

 Score =   384 bits (985),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 233/307 (76%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R+A+EYDVVI+G GP+GLSAAIR+KQL  +   ++SVC++EKG+E+GAHILSG V EP A
Sbjct  7     RDAMEYDVVIIGGGPSGLSAAIRIKQLAEQAGKEVSVCLLEKGSEIGAHILSGAVLEPHA  66

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL P W++   P++ P   D+FL L++  +F LP+P    N GNY+ISL  L RWLG+
Sbjct  67    LNELFPDWKERGAPLNTPAGEDRFLFLTEGGSFKLPTPPQMSNHGNYIISLGNLCRWLGE  126

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGFAA+E+LY+E   V G+AT D+G+ KDG    NFQ G+EL  + T+ A
Sbjct  127   QAEALGVEIYPGFAAAEVLYHEDGSVKGVATGDLGIGKDGQPGHNFQPGMELHAKQTIFA  186

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL +++ G++ LR+  +   QTY +GIKE+WEID  KH+PG ++HT+GWP+D  T
Sbjct  187   EGCRGSLTKELFGQFNLRDGVD--PQTYGIGIKELWEIDPAKHQPGLIVHTVGWPVDSAT  244

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++   VA+G VV L+Y NP+L+PYEEFQ++K HPAIR   EGG  + YGAR 
Sbjct  245   YGGSFLYHLENNLVAVGYVVGLDYKNPWLSPYEEFQRYKTHPAIRGFFEGGRRISYGARA  304

Query  1206  LNEGGYQ  1226
             L+EGGYQ
Sbjct  305   LSEGGYQ  311


 Score =   263 bits (671),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 161/231 (70%), Gaps = 4/231 (2%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNMETFWDNLRSSW  1399
             FPGG ++G +AGFLNVPKIKGTH AM+SG++AA++ F+ L     G+ +  + + ++ SW
Sbjct  318   FPGGLLVGDTAGFLNVPKIKGTHMAMESGIVAAKAVFEHLCKDNAGAEVVEYGEQIKQSW  377

Query  1400  IWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPI  1579
             +W ELY  RN RPAF+ GL  GLA  AI+ ++  G++P T +H   DH  + +  +   I
Sbjct  378   LWAELYKVRNIRPAFKWGLLGGLAYGAIDTFLFGGKAPWTMRH-HDDHSQLGDKNAYPKI  436

Query  1580  EYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARV  1759
             +YPKPDG ISFD L+SV+ S TNH+ +Q  HLRLKD      VN  KY  PE+RYCPA V
Sbjct  437   DYPKPDGKISFDRLSSVFLSATNHEENQQTHLRLKDESVAISVNYAKYGAPETRYCPAGV  496

Query  1760  YEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YE + ++ G+ +L IN QNCLHCK CDIKDPTQNI WTVPEGGGGP Y  M
Sbjct  497   YEILGEEEGKPRLQINGQNCLHCKTCDIKDPTQNINWTVPEGGGGPNYPNM  547



>ref|WP_012400959.1| dehydrogenase [Burkholderia phymatum]
 ref|YP_001857795.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
phymatum STM815]
 gb|ACC70749.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
phymatum STM815]
Length=557

 Score =   374 bits (961),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 175/308 (57%), Positives = 228/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQ   EK  ++ VCV+EKG+EVGAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQRAAEKGVEIGVCVLEKGSEVGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L+EL+P W+++  P+DV V+ D+FL L++  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    LNELIPDWKEKGAPLDVEVTEDRFLFLNETGAKSVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGFAA+E+LYN+   V G+AT ++G+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFAAAEVLYNDDGSVKGVATGNLGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q+  +++LR+  +   Q Y +GIKE+WEID  KH+PG V+HT GWPLD
Sbjct  193   LFCEGARGHLGRQLSDRFRLRDGAD--PQVYGIGIKELWEIDPAKHKPGLVIHTAGWPLD  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
              +TYGGSFLYH+   QV +G VV L Y NP+L+P+EEFQ++K HP IR  LEGG  + YG
Sbjct  251   SQTYGGSFLYHIDNNQVMVGFVVGLGYSNPYLSPFEEFQRYKTHPEIRKFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   272 bits (695),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 163/232 (70%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSS  1396
             VFPGGA++G  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + ++ +SS
Sbjct  326   VFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELAAYPESFKSS  385

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+  ELY ARN++     GL+ G  +  IE+ ++ G  P T  H   DHE +  A    P
Sbjct  386   WLHTELYRARNFKQWMSKGLYLGTLMVGIEQKLMGGNVPWTLHHQHWDHEMLKPASQCKP  445

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPESRYCPA 
Sbjct  446   IEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVKVNLQTYAGPESRYCPAA  505

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++++D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  506   VYEFVNNDDGSERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|XP_009099437.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Serinus canaria]
Length=556

 Score =   370 bits (951),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 230/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  3     RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEVRVCLVEKASQIGAHTLSGACVEPRS  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L++     +P     P  N GNY++ L  LV WL
Sbjct  63    LEELFPDWKERGAPLNTPVTEDKFGILTETSRIPVPILPGLPMANHGNYIVRLGHLVSWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  123   GEQAEALGVEIYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LRE  N Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  183   FAEGCHGHLAKQLYKKYNLRE--NCQPQSYGIGLKELWTIDKAKWKPGRVEHTVGWPLDR  240

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ ER+  VA+G VV L+Y NP+LNP+ EFQ++KHHP+I+P LEGGT + Y
Sbjct  241   HTYGGSFLYHLNEREPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSIQPTLEGGTRIAY  300

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG Q
Sbjct  301   GARALNEGGIQ  311


 Score =   276 bits (705),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G LNVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  317   TFPGGLLIGCSPGLLNVPKIKGTHTAMKSGMLASEAIFSRLTNENLQSKTIGLDVQEYEE  376

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  +IL+G  P T KH  PD+  + 
Sbjct  377   NLKKSWVWKELYAVRNIRPSCHSVLGVYGGMIYTGIFYWILRGMEPWTLKHPGPDYAQLK  436

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  437   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  496

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEY+  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  497   QRFCPAGVYEYVPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  556



>ref|WP_014725166.1| dehydrogenase [Burkholderia sp. KJ006]
 ref|YP_006335744.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
sp. KJ006]
 gb|AFJ89013.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
sp. KJ006]
Length=565

 Score =   381 bits (979),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL +EK A++ VCV+EKG+E+GAHILSG V +P A
Sbjct  21    RESMEYDVVIVGGGPAGLSAAIRLKQLAKEKGAEIGVCVLEKGSEIGAHILSGAVMDPGA  80

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL+P W     P+DV V+ D+FL LS+  A     ++LPS F N GNYVISL  + RW
Sbjct  81    ISELIPDWAALGAPLDVEVTEDRFLFLSETDAKAVPSWALPSNFRNHGNYVISLGNVTRW  140

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  141   LGTQAEGLGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  200

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  201   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  258

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM + QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  259   SDTYGGSFLYHMDKNQVMVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRTFLEGGKRVSYG  318

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  319   ARAITAGG  326


 Score =   265 bits (677),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 159/233 (68%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGG---SNMETFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAAE+AF  +Q G     +  + +  + 
Sbjct  333   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAAEAAFHAVQTGRRGDELSAYPNAFKR  392

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  EL+ ARN++     GL+ G  +  IE+ +L G  P T  H   DHE +  A    
Sbjct  393   SWLHAELHRARNFKQWMAKGLYLGTLMVGIEQKLLGGNVPWTLHHKHADHEMLKPASQCT  452

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  453   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEGRFCPA  512

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  513   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  565



>gb|KFZ53447.1| hypothetical protein N338_10557, partial [Podiceps cristatus]
Length=608

 Score =   371 bits (952),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 228/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E N ++ VC+VEK +++GAH LSG   EPR+
Sbjct  55    RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHNKEIRVCLVEKASQIGAHTLSGACLEPRS  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  115   LQELFPDWKERGAPLNTPVTEDKFGILTKKSRIPVPILPGLPMVNHGNYIVRLGHFVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVELYPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  175   GEQAEALGVELYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWNIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  293   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  353   GARALNEGGFQ  363


 Score =   275 bits (704),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  369   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLMNENLQSKTIGLDVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G+ P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYAVRNIRPSCHSILGVYGGMIYTGIFYWLLRGKEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>ref|WP_027797970.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
acidipaludis]
Length=557

 Score =   380 bits (975),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 230/308 (75%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGVEMGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L+EL+P W+++  P+DVPV+ DKFL LS+  A     ++LP  F+N GNYVISL+ + RW
Sbjct  73    LNELMPDWKEQGAPLDVPVTEDKFLFLSETGAKAVPNWALPDNFKNHGNYVISLANVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+L+++   V G+AT +MG+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEVLFHDDGSVKGVATGNMGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+  K KL    +   Q Y +GIKE+WEID  KH+PG V+HT GWPL+
Sbjct  193   LFAEGCRGHLGRQLNEKLKLDR--DADPQVYGIGIKELWEIDPAKHQPGLVIHTAGWPLE  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
             + TYGGSFLYH+   QV +G VV L Y NP+L+P+EEFQ++K HPAIR  LEGG  + YG
Sbjct  251   NDTYGGSFLYHIDNNQVMVGFVVGLAYTNPYLSPFEEFQRYKTHPAIRQYLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAMTAGG  318


 Score =   266 bits (680),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 160/232 (69%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSS  1396
             VFPGGA++G  AGFLN  +IKG+H A+K+GMLAAE+AF+ +Q G     +  + +  + S
Sbjct  326   VFPGGALVGDDAGFLNAARIKGSHAAIKTGMLAAEAAFEAVQAGRQGDELTAYPEAFQKS  385

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+ +ELY ARN++     GL+ G  +  IE+ +  G+ P T  H   D+E +  A    P
Sbjct  386   WLHEELYKARNFKQWMSKGLYLGTLMVGIEQKLFGGKVPWTLHHQHRDNEMLKPASQCRP  445

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA 
Sbjct  446   IEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEGRFCPAA  505

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++ DD+ E +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  506   VYEFVKDDSNEDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>gb|KFU96891.1| hypothetical protein N339_09144, partial [Pterocles gutturalis]
Length=608

 Score =   372 bits (954),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 230/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  55    RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACIEPRS  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  115   LEELFPDWKERGAPLNTPVTEDKFGILTKKYRIPVPILPGLPMVNHGNYIVRLGHFVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E D V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  175   GEQAEALGVEVYPGYAAAEVLFHEDDSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LRE  N Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQLFKKYNLRE--NCQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  293   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  353   GARALNEGGFQ  363


 Score =   274 bits (701),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  369   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  +IL+G  P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYAVRNIRPSCHSALGVYGGMIYTGIFYWILRGMEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>ref|WP_039754279.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Chromobacterium 
sp. C-61]
Length=539

 Score =   372 bits (955),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 228/304 (75%), Gaps = 4/304 (1%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVG GP+GL+AAIRLKQL  E+  ++SVC++EKG+E+GAHILSG V EPR L+E
Sbjct  1     MEYDVVIVGGGPSGLTAAIRLKQLAAEQGREVSVCLLEKGSEIGAHILSGAVIEPRVLNE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAE  674
             L+P W+++  P++    SD+FLLL++  +  LP+P    N GNY++SL    RWLGQ+AE
Sbjct  61    LIPDWKEKGAPLNTEAKSDRFLLLTETESIQLPTPPQMHNHGNYIVSLGNFCRWLGQQAE  120

Query  675   ELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGC  854
             ELGVE+YPGFAA+E+LY+E   V G+AT DMG+ KDG + + +Q G+EL  + T+ AEGC
Sbjct  121   ELGVEIYPGFAAAEVLYHEDGSVKGVATGDMGIGKDGEKTDAWQPGMELWAKQTIFAEGC  180

Query  855   RGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGG  1034
             RGSL + +  +++L +  +   QTY +GIKE+WE+    H+PG + HT+GWP+D  TYGG
Sbjct  181   RGSLTKALFERFRLHDGAD--PQTYGIGIKELWEVKPELHQPGSITHTVGWPVDTATYGG  238

Query  1035  SFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNE  1214
             SF+YH++  QV +G V+ L+Y NP+L+P+EEFQ+FK HPAIR + EGG  L YGAR L E
Sbjct  239   SFMYHLENNQVVVGFVIGLDYQNPYLSPFEEFQRFKTHPAIRKVFEGGRRLSYGARALTE  298

Query  1215  GGYQ  1226
             GG Q
Sbjct  299   GGLQ  302


 Score =   273 bits (699),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 162/232 (70%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNMETFWDNLRSS  1396
              FPGG ++G +AGFLNVPKIKGTHTAM+S MLAAE+ F++L   Q       + +  + S
Sbjct  308   TFPGGLLVGDTAGFLNVPKIKGTHTAMQSAMLAAEAVFELLGQEQPAREATAYSEKFKQS  367

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+ +EL+  RN RP+F  GL+P +  SA++ ++ +G++P T +H + DH+++  A    P
Sbjct  368   WLHEELHRVRNIRPSFRWGLWPAMIYSALDTFLFRGKAPWTLRHHQADHQSLKPADECAP  427

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I YPKPDG ++FD L+SV+ SNTNH  DQP HL+LKD   P   NL KY  PE RYCPA 
Sbjct  428   IAYPKPDGVLTFDRLSSVFISNTNHGEDQPPHLKLKDASVPVAFNLAKYDAPEQRYCPAG  487

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE +  + GE +L INAQNC+HCK CDIKDP+QNI WT PEGGGGP Y  M
Sbjct  488   VYEIVGREEGEPRLQINAQNCVHCKTCDIKDPSQNIVWTTPEGGGGPNYPNM  539



>ref|XP_005299361.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Chrysemys picta bellii]
Length=619

 Score =   369 bits (948),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 247/369 (67%), Gaps = 10/369 (3%)
 Frame = +3

Query  138   SQLKTMLKFILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGARGFSSESCRE  317
             SQ    L+ + S  K  L    I R++S  +     + +   S        G + E  R 
Sbjct  10    SQAHHCLRALKSVKKDCLPPLCIARWASTSSVPRITTHYTIHSRNKDKRWEGVNME--RF  67

Query  318   AIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALD  497
             A E DVVIVGAGPAGLSAAIRLKQL  E   ++ VC+VEK A++GAH LSG   EPRAL+
Sbjct  68    AEEADVVIVGAGPAGLSAAIRLKQLANEYGKEVRVCLVEKAAQIGAHTLSGACLEPRALE  127

Query  498   ELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWLGQ  665
             ELLP W++   P+  PV+ DKF +L+KN    +P     P  N GNY++ L   V WLG+
Sbjct  128   ELLPDWKERGAPLQTPVTEDKFGILTKNSRIPVPILPGLPMTNHGNYIVRLGHFVNWLGE  187

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K NF+ G+EL  +VT  A
Sbjct  188   QAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKTNFERGLELHAKVTFFA  247

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGC G LA+Q+  +Y LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD  T
Sbjct  248   EGCHGHLAKQLYNRYNLREK--CQPQSYGIGLKELWLIDEKKWKPGRVEHTVGWPLDRHT  305

Query  1026  YGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGA  1199
             YGGSFLYH+ E +  VA+G VV L+Y NP+L+P++EFQ++KHHP++ P  EGG  + YGA
Sbjct  306   YGGSFLYHLNEGEPLVALGFVVGLDYQNPYLSPFKEFQRWKHHPSVEPTFEGGKRIAYGA  365

Query  1200  RTLNEGGYQ  1226
             R LNEGG+Q
Sbjct  366   RALNEGGFQ  374


 Score =   276 bits (707),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS GF+NVPKIKGTHTAMKSGMLA+E+ F+ L          G ++  + +
Sbjct  380   TFPGGVLIGCSPGFMNVPKIKGTHTAMKSGMLASEAVFNQLTNENLQSKTIGLDVPEYEE  439

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+     G++ G+  + I  +IL+G  P T KH  PD + + 
Sbjct  440   NLKKSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRGMEPWTLKHPGPDSDQLK  499

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQP HL LKD   P   NL  Y GPE
Sbjct  500   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPPHLTLKDDSVPVNKNLAIYDGPE  559

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEY+  + GE ++L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  560   QRFCPAGVYEYVPLETGEGLRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  619



>ref|XP_006629536.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial-like [Lepisosteus oculatus]
Length=620

 Score =   370 bits (949),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 184/368 (50%), Positives = 252/368 (68%), Gaps = 23/368 (6%)
 Frame = +3

Query  147   KTMLKFILSSAKSKLSTTPINRFSSFPN--PCGKASRFGAESGYSLNGARGFSSESCREA  320
             + ++  +L +++   ST+ + R +S     P  K SR+            G + E  R A
Sbjct  23    RELVSPLLCASRWSSSTSTVPRITSHYTVYPRDKDSRW-----------EGVNME--RFA  69

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
              E DVVIVG GPAGLS AIRLKQL  E++ DL VCVVEK +++GAH LSG   EP AL E
Sbjct  70    DEADVVIVGGGPAGLSTAIRLKQLANEQSKDLRVCVVEKASQIGAHTLSGACLEPSALTE  129

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWLGQK  668
             L P W++   P++ PV+ DKF +L++     +P     P  N GNY++ L  +VRWLG++
Sbjct  130   LFPDWKERGAPLNTPVTEDKFGILTEKHRIPVPILPGLPMNNHGNYIVRLGHIVRWLGEQ  189

Query  669   AEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAE  848
             AE LGVELYPG+AA+E+L++E   V GIATND+G+AKDGS K+NF+ G+EL  +VT+  E
Sbjct  190   AEALGVELYPGYAAAEVLFHEDGSVKGIATNDVGIAKDGSPKDNFERGMELHAKVTVFGE  249

Query  849   GCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTY  1028
             GC G LA+Q+  ++ LRE  N + QTYA+G+KE+W ++    RPG + HT+GWPLD  TY
Sbjct  250   GCHGHLAKQLYKRFNLRE--NCEQQTYAIGLKELWLVNEKNWRPGRIEHTVGWPLDRHTY  307

Query  1029  GGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGAR  1202
             GGSFLYH+ E +  VA+GLVV L+Y NP+LNP+ EFQ++KHHP++   LEGG+ + YGAR
Sbjct  308   GGSFLYHLNEGEPLVALGLVVGLDYQNPYLNPFREFQRWKHHPSVSQTLEGGSRIAYGAR  367

Query  1203  TLNEGGYQ  1226
              LNEGG+Q
Sbjct  368   ALNEGGFQ  375


 Score =   276 bits (705),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 162/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQ--------GGSNMETFWD  1381
              FPGG +IGCS GF+NVPKIKGTHTAMKSGMLAAE  F  L          G ++  + +
Sbjct  381   TFPGGLLIGCSPGFMNVPKIKGTHTAMKSGMLAAEDIFQKLTSENLQSETAGIHVHEYEE  440

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SWIWKELY  RN RP+F N  GL+ G+  + I  +IL+G+ P T KH   D   + 
Sbjct  441   NLKKSWIWKELYAVRNIRPSFHNPLGLYGGMIYTGIFYWILRGKEPWTLKHKGLDSSQLK  500

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQP HL L     P   NL  Y GPE
Sbjct  501   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPPHLTLMSDSVPVEKNLNIYDGPE  560

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEY+  +NGE ++L INAQNC+HCK CDIKDP+QNI W VPEG GGP Y  M
Sbjct  561   QRFCPAGVYEYVPLENGEGMRLQINAQNCVHCKTCDIKDPSQNINWVVPEGSGGPAYNGM  620



>gb|EPB88427.1| electron-transferring-flavoprotein dehydrogenase [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=627

 Score =   357 bits (916),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 223/305 (73%), Gaps = 6/305 (2%)
 Frame = +3

Query  324   EYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDEL  503
             E DVVIVG GP+GL+AAIRLKQL  E+  +  V ++EK  EVGAH LSG V EPRAL+EL
Sbjct  75    ETDVVIVGGGPSGLAAAIRLKQLANEEGRECRVMLIEKAGEVGAHTLSGAVLEPRALNEL  134

Query  504   LPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAEE  677
             +P W+++  P++ PV+SD   L++K+ +  LP P    NKGNY++SLS  V+WLG++AEE
Sbjct  135   IPDWKEKGAPLNTPVTSDSMRLMTKSLSIPLPHPPQMNNKGNYIVSLSNFVKWLGEQAEE  194

Query  678   LGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCR  857
             LGVE+YPGFAASE+LYNE   V G+  ND+G+ K+   K+ ++ G+ +K +VTL AEGC 
Sbjct  195   LGVEIYPGFAASEVLYNEDGSVRGVTLNDVGLDKNFEPKDTYERGMAVKAKVTLFAEGCH  254

Query  858   GSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGS  1037
             GSL + +  K+ LR++     Q Y +GIKEVWE+   KH+PG V HT+GWP+D  TYGGS
Sbjct  255   GSLTKTLAKKFDLRKESGP--QKYGIGIKEVWEVLPEKHKPGSVTHTVGWPVDAHTYGGS  312

Query  1038  FLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLN  1211
             F+YH +     V +G V+ L+Y NP+LNPY+ FQ+FKHHP+++ LLEGG  + YGAR +N
Sbjct  313   FIYHFEPDHHLVTVGYVIGLDYSNPYLNPYKTFQQFKHHPSVKSLLEGGKCISYGARAIN  372

Query  1212  EGGYQ  1226
             EGGYQ
Sbjct  373   EGGYQ  377


 Score =   288 bits (737),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 173/243 (71%), Gaps = 16/243 (7%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN------------ME  1369
             VFPGGA+IGC+AGFLNVPKIKGTHTAMKSGMLAAESA++ L  G              + 
Sbjct  383   VFPGGALIGCTAGFLNVPKIKGTHTAMKSGMLAAESAYEALYNGLEPDQESQVEEPVLLN  442

Query  1370  TFWDNLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDH  1543
             T+ + ++ SW++KELY  RN +P+F    GL+ G+  S I+   LKGR+P TFKH K D 
Sbjct  443   TYEERIKDSWVYKELYEVRNVQPSFHGPLGLWGGMLYSGIDTLFLKGRTPWTFKHKKADW  502

Query  1544  EAINEAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKY  1723
             E +  A  S PI+YPKPDG ISFD+LTSV R+ TNH  +QP HLR++D   P   NL  +
Sbjct  503   ECMKTAGESKPIDYPKPDGVISFDLLTSVSRTGTNHAENQPVHLRIRDKDIPVERNLGVF  562

Query  1724  AGPESRYCPARVYEYISDDN--GEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGP  1897
              GPE+R+CPA VYEY+ D+N  GE +L IN+QNC+HCK CDIKDP+QNI WTVPEGGGGP
Sbjct  563   DGPENRFCPAGVYEYVDDENKPGEKRLQINSQNCIHCKTCDIKDPSQNIDWTVPEGGGGP  622

Query  1898  GYT  1906
              Y 
Sbjct  623   QYV  625



>ref|WP_038712693.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
sp. lig30]
 gb|KDB08212.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
sp. lig30]
Length=566

 Score =   370 bits (951),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 183/317 (58%), Positives = 230/317 (73%), Gaps = 7/317 (2%)
 Frame = +3

Query  285   ARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHIL  464
             AR   +   RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHIL
Sbjct  13    ARWLEAYGPRESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHIL  72

Query  465   SGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYV  629
             SG V +PRA+ EL+P W+++  P+ V V+ D+FL LS+  A     ++LP+ F+N GNYV
Sbjct  73    SGAVMDPRAITELIPDWKEQGAPLTVDVTEDRFLFLSETGAKAVPNWALPANFQNHGNYV  132

Query  630   ISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQH  809
             ISL  + RWLGQ+AE LGVE++PGF A+EILY++   V G+AT +MGV KDG   ENFQ 
Sbjct  133   ISLGNVTRWLGQQAEALGVEIFPGFPAAEILYHDDGSVKGVATGNMGVGKDGEPTENFQL  192

Query  810   GVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDV  989
             G+EL  + TL AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V
Sbjct  193   GMELHAKYTLFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHQPGLV  250

Query  990   LHTIGWPLDHKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLL  1169
             +HT GWPL   TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP IR  L
Sbjct  251   IHTAGWPLKSDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPEIRTFL  310

Query  1170  EGGTVLQYGARTLNEGG  1220
             EGG  + YGAR +  GG
Sbjct  311   EGGKRVSYGARAITAGG  327


 Score =   275 bits (702),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G +   +  + D  R 
Sbjct  334   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRHSDELNAYPDAFRQ  393

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  IE+ +L G  P T  H   DHE +  A    
Sbjct  394   SWLHDELYRARNFKQWMAKGLYFGTLMVGIEQKLLGGNVPWTLHHQHADHEMLKPASQCT  453

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPESR+CPA
Sbjct  454   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPESRFCPA  513

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  514   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  566



>ref|WP_008449442.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Janthinobacterium 
sp. HH01]
 gb|ELX09192.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Janthinobacterium 
sp. HH01]
Length=558

 Score =   374 bits (960),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 179/310 (58%), Positives = 230/310 (74%), Gaps = 7/310 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R+A+EYDVVIVG GPAGLSAAI++KQL  EK  ++SV V+EKG E+GAHILSG V +P+A
Sbjct  14    RDAMEYDVVIVGGGPAGLSAAIKIKQLAAEKGQEVSVVVLEKGGELGAHILSGAVMDPKA  73

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L EL+P W+++  P++  VS D+ L L++ +A     F LP+ FEN GNYVISL  +VRW
Sbjct  74    LTELIPDWKEKGAPLNTAVSEDRVLFLTETKAIKTPNFLLPACFENHGNYVISLGNVVRW  133

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV +DG    +FQ G+EL G+ T
Sbjct  134   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVKRDGEAGSDFQLGMELHGKYT  193

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEG RG L +Q++ KY L  KG    Q+Y +GIKE+WEID  KH+PG V+HT GWPLD
Sbjct  194   LFAEGARGHLGKQLMAKYDLN-KGK-DPQSYGIGIKELWEIDPAKHQPGLVIHTTGWPLD  251

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
              KTYGGSFLYH++  QV +G VV LNY NP+L+PYEEFQ++K HPAI+   EG   + YG
Sbjct  252   SKTYGGSFLYHLENNQVMVGYVVGLNYENPYLSPYEEFQRYKTHPAIKTFFEGAKRISYG  311

Query  1197  ARTLNEGGYQ  1226
             AR +  GG Q
Sbjct  312   ARAITAGGLQ  321


 Score =   271 bits (693),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 159/232 (69%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSS  1396
             VFPGGA+IGC AGFLN+ +IKG+H A+KSGMLAAES F+ L        + +F      S
Sbjct  327   VFPGGALIGCDAGFLNMSRIKGSHAAIKSGMLAAESVFEALGASRQHDELASFPAAFEKS  386

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+  EL+ ARN +P    GL+ G  ++ +++ IL+G++P T  H   DHE +  A    P
Sbjct  387   WLHDELHVARNVKPWLSKGLYLGSVMTYVDQAILRGKAPWTLHHSHADHECLKPASQFAP  446

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I YPKPDG ++FD L+SV+ SNTNH  DQP HL LK+P  P  VNL +YAGPE+RYCPA 
Sbjct  447   ISYPKPDGKLTFDRLSSVFISNTNHAEDQPIHLTLKNPSVPVDVNLAQYAGPEARYCPAG  506

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++  D G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  507   VYEFVKTDEGADRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  558



>ref|WP_002691375.1| electron transfer flavoprotein [Beggiatoa alba]
 gb|EIJ43840.1| flavin-dependent dehydrogenase [Beggiatoa alba B18LD]
Length=543

 Score =   369 bits (948),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 229/308 (74%), Gaps = 5/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R+ +EYDVVIVGAG +GLSAAIRLKQL  EKN +L+VCV+EKG+EVGAHILSG V EP  
Sbjct  3     RDVMEYDVVIVGAGASGLSAAIRLKQLSAEKNHELTVCVIEKGSEVGAHILSGAVLEPHT  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLP-SP--FENKGNYVISLSQLVRWLG  662
             L+EL+P WR++  P++ P + D F+ L++ ++F  P +P    N+GNY+ISL    RWL 
Sbjct  63    LNELIPDWREKNAPLNTPATDDSFIFLTEQKSFKFPITPPQMHNEGNYIISLGNFCRWLA  122

Query  663   QKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLL  842
             Q+AE LGV++ PGFAA+++LY+E   V G+ T DMGV K+G    +F  G E+  + T+ 
Sbjct  123   QEAESLGVDIIPGFAAAQVLYHEDGSVKGVITGDMGVNKEGEPTSHFAAGTEIHAQQTIF  182

Query  843   AEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHK  1022
             AEGCRGSL + +  ++ LR+  + Q  TY +GIKE+WEI+  KH+ G ++HTIGWPLD +
Sbjct  183   AEGCRGSLTKILFERFNLRQGVDPQ--TYGIGIKELWEIEPAKHKAGTIMHTIGWPLDSQ  240

Query  1023  TYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGAR  1202
             TYGGSFLYH++  QVA+G VV L+Y NP+L+PYEEFQ++K HP IR L EGG  + YGAR
Sbjct  241   TYGGSFLYHLENNQVAVGFVVGLDYQNPYLSPYEEFQRYKTHPVIRSLFEGGRRVAYGAR  300

Query  1203  TLNEGGYQ  1226
              L+EGG+Q
Sbjct  301   ALSEGGFQ  308


 Score =   276 bits (706),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 164/232 (71%), Gaps = 5/232 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWD---NLRSS  1396
              F GG +IG +AGFLNVPK+KGTHTAMKSGM+AAE+ F  LQ G   E   D    L  S
Sbjct  314   TFQGGLLIGDTAGFLNVPKVKGTHTAMKSGMIAAEAVFTHLQAGKASEEVADYRQRLEQS  373

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+W ELY  RN RP+F+ GL+ GL  SA++ YIL+GR+P T  H + DH A+ +A     
Sbjct  374   WLWDELYTVRNIRPSFQWGLWGGLFYSALDTYILRGRAPWTLHHHE-DHSALKKAGECRK  432

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ISFD L+SV+ SNTNH+ +QP HL+LKD + P   NL  Y  PE RYCPA 
Sbjct  433   IEYPKPDGKISFDRLSSVFISNTNHEENQPCHLQLKDLRVPIETNLALYDAPEQRYCPAG  492

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE I++ N   +L INAQNC+HCK CDIKDP+QNI WTVPEGGGGP Y  M
Sbjct  493   VYEIIAEGNTP-RLQINAQNCVHCKTCDIKDPSQNINWTVPEGGGGPNYPNM  543



>ref|XP_010074203.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Pterocles gutturalis]
Length=556

 Score =   371 bits (953),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 230/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  3     RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACIEPRS  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  63    LEELFPDWKERGAPLNTPVTEDKFGILTKKYRIPVPILPGLPMVNHGNYIVRLGHFVSWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E D V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  123   GEQAEALGVEVYPGYAAAEVLFHEDDSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LRE  N Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  183   FAEGCHGHLAKQLFKKYNLRE--NCQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  240

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  241   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  300

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  301   GARALNEGGFQ  311


 Score =   274 bits (700),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  317   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  376

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  +IL+G  P T KH  PD   + 
Sbjct  377   NLKKSWVWKELYAVRNIRPSCHSALGVYGGMIYTGIFYWILRGMEPWTLKHPGPDFAQLK  436

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  437   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  496

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  497   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  556



>ref|WP_039370819.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Mumia 
flava]
 gb|KHL08364.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Mumia 
flava]
Length=557

 Score =   374 bits (959),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 228/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             ++EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    INELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N + Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANAEPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (693),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_036496110.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Neisseria 
sp. oral taxon 020]
Length=550

 Score =   378 bits (970),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 184/307 (60%), Positives = 227/307 (74%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R+++ YDV+IVGAGPAGLSAAIRLKQL  E   D+ VC+VEKG+EVGA+ILSG V +P+A
Sbjct  6     RDSMFYDVLIVGAGPAGLSAAIRLKQLAAEHGRDIGVCIVEKGSEVGANILSGAVLDPKA  65

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL+P W++   P+   VS D+ L L++ RAF LP+   F NKGNY+ISL  L RWL +
Sbjct  66    LNELIPDWQERGAPVSRSVSEDRVLFLTEKRAFKLPTAPSFRNKGNYIISLGLLTRWLAE  125

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGFAASEILY+    V GIAT DMGV KDG    NFQ G+EL  R TL A
Sbjct  126   QAEALGVEIYPGFAASEILYHPDGSVKGIATGDMGVGKDGQPTGNFQSGMELYARQTLFA  185

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL +Q+I ++ L +  N Q  TY LGIKE+WEI A   RPG V+H+ GWPLD KT
Sbjct  186   EGCRGSLTKQLIRRFNLDQ--NSQPPTYGLGIKEIWEIQAENARPGLVVHSTGWPLDSKT  243

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+   +VA+G VV L+Y NP+L+P+EEFQ+FK  PAI P   GG  + YGAR 
Sbjct  244   YGGSFLYHLDGNKVAVGFVVGLDYQNPYLSPFEEFQRFKTPPAIAPPFAGGRRIAYGARA  303

Query  1206  LNEGGYQ  1226
             L+EGG Q
Sbjct  304   LSEGGLQ  310


 Score =   267 bits (682),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 165/234 (71%), Gaps = 8/234 (3%)
 Frame = +2

Query  1232  PGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML-------QGGSNMETFWDNLR  1390
             PG A++G +AGFLNVP+IKG H A+KS MLAAE+ F +L       Q G     + D   
Sbjct  318   PGAAIVGDAAGFLNVPRIKGIHCAIKSAMLAAEAVFPLLDNEGENAQNGKEAAAYQDLFE  377

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
              SW+++ELY ARN RP+F+ G++P    + +E+YILKGR+P T KH   DH ++ +A + 
Sbjct  378   QSWLYRELYAARNIRPSFKWGMWPAFVYTGLEQYILKGRAPWTLKHHGTDHGSLKKAAAC  437

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI YPKPDG ++FD L+SV+ +N +H+ DQP+HL L+DP+T   VN  +YA PE+RYCP
Sbjct  438   RPIAYPKPDGVLTFDRLSSVFLANVSHEEDQPSHLLLRDPQTMINVNYKEYASPETRYCP  497

Query  1751  ARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE I ++NG  +L+INA NC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  498   AGVYE-IHEENGSPRLHINAANCIHCKTCDIKDPTQNITWICPEGGGGPNYGDM  550



>ref|WP_011660670.1| dehydrogenase [Burkholderia ambifaria]
 ref|YP_777653.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
ambifaria AMMD]
 gb|ABI91319.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
ambifaria AMMD]
Length=557

 Score =   374 bits (959),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+N A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVAVTEDRFLFLSENSAVTTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGAQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (693),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASEYT  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGGDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>emb|CCA85261.1| ELECTRON TRANSFER FLAVOPROTEIN-UBIQUINONE OXIDOREDUCTASE [Ralstonia 
syzygii R24]
Length=557

 Score =   373 bits (958),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLK L  E  ++++VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKLLATEIGSEIAVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + ELLP W++   P+ V V+ D FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    ITELLPDWKERGAPLTVGVTEDCFLFLSEKGAKQVPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   E+FQ G+EL  + T
Sbjct  133   LGQQAEALGVEVFPGFPAAEILYNDDGSVKGVATANMGVGKDGEPTESFQPGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K++L    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLIDKFRL--NANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYH+   QVA+G VV L+Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   PDTYGGSFLYHLDNNQVAVGFVVGLSYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (693),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G     +  + D    
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRQGDELTAYPDAFEQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  IE+ ++ G  P T +H + DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGIEQKLMGGNVPWTLRHHRSDHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFVSNTNHEENQPAHLTLKDASVPVSVNLHTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE+  +++G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   GVYEFAKNEDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_015468218.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Micavibrio 
aeruginosavorus]
 ref|YP_007643311.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Micavibrio 
aeruginosavorus EPB]
 gb|AGH98691.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Micavibrio 
aeruginosavorus EPB]
Length=547

 Score =   393 bits (1010),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 239/307 (78%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVGAGP+GLS AIRLKQL  E+  D+SVCV+EKG+EVGAH++SG VFEPRA
Sbjct  8     RESMEYDVVIVGAGPSGLSCAIRLKQLAAERGTDISVCVIEKGSEVGAHLMSGAVFEPRA  67

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL+P W+++  P+ V   +D+FL L+KN++F LP+P    N GNY+ISLS L RWL  
Sbjct  68    LNELIPDWKEKGAPLHVQAKTDRFLFLTKNKSFRLPTPPQMHNHGNYIISLSMLGRWLAT  127

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AEELGVE+Y GFAA+E+LYN++  V+G+AT DMG+ KDG++ ++F+ GVEL  + T+ A
Sbjct  128   QAEELGVEIYAGFAAAEVLYNDAGAVMGVATGDMGLDKDGNKTDHFEPGVELHAKQTVFA  187

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGC GSL + +I  Y LR+  N   QTY LGIKE+WEI A+KH  G ++HT+GWP+D KT
Sbjct  188   EGCHGSLTKTLIAHYDLRK--NSDPQTYGLGIKEIWEIPADKHSEGLIIHTVGWPMDSKT  245

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGS++YH+   QV++G V+ L+Y NP+L+P+ E Q+FK HP +R  LEGG  + YGAR+
Sbjct  246   YGGSWMYHLDNNQVSVGFVIGLDYQNPYLSPFSEMQRFKTHPDVRKYLEGGRRIAYGARS  305

Query  1206  LNEGGYQ  1226
             L EGG+Q
Sbjct  306   LVEGGFQ  312


 Score =   251 bits (641),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 159/236 (67%), Gaps = 13/236 (6%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGG----SNMETFWDNLRS  1393
              FPGG +IG +AGFLNVPKIKG HTAMKSGM+AAES +D+L  G    +    +   +++
Sbjct  318   TFPGGILIGDTAGFLNVPKIKGNHTAMKSGMVAAESLYDLLTAGDATSAECTAYTAAIKA  377

Query  1394  SWIWKELYHARNYRPAFENGLFPGL---ALSAIERYILKGRSPLTFKHGKPDHEAINEAK  1564
             SWIW EL   RN RP F  GL+ G+   A   +  ++L    P T K+   D+ A+  A 
Sbjct  378   SWIWPELKKVRNIRPGFNFGLWVGMIHAAFQTVGGWLL----PYTMKN-HADYAALKPAT  432

Query  1565  SSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRY  1744
               L I+YPKPD  ++FD LTSV  SNT H+  QP+HL+LKDP  P  VNLP+YA P  RY
Sbjct  433   DDLKIDYPKPDNVLTFDRLTSVRLSNTMHEDGQPSHLKLKDPSIPVAVNLPRYAEPAQRY  492

Query  1745  CPARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             CPA VYE + D NG  K  INAQNC+HCK CDIKDP+QNI+WTVP+GGGGP Y+ M
Sbjct  493   CPAAVYEVVEDANGP-KFVINAQNCVHCKTCDIKDPSQNIEWTVPQGGGGPNYSNM  547



>ref|WP_014087161.1| electron transfer flavoprotein [Pseudogulbenkiania sp. NH8B]
 ref|YP_004847243.1| electron-transferring-flavoprotein dehydrogenase [Pseudogulbenkiania 
sp. NH8B]
 dbj|BAK76829.1| electron-transferring-flavoprotein dehydrogenase [Pseudogulbenkiania 
sp. NH8B]
Length=545

 Score =   369 bits (948),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 229/309 (74%), Gaps = 6/309 (2%)
 Frame = +3

Query  306   SCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEP  485
             S R+ +EYDVVIVG GP+GLSAAIRLKQL  +K  D+SVC++EKG+E+GAHILSG V EP
Sbjct  2     STRDYMEYDVVIVGGGPSGLSAAIRLKQLAADKGQDISVCLLEKGSEIGAHILSGAVLEP  61

Query  486   RALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWL  659
             R L+EL+P W+ +  P++ P   D+FLLL++  +  LP+P    N+GNY+ISL    RWL
Sbjct  62    RTLNELIPDWKDKGAPLNTPAQKDQFLLLTETESIPLPTPPQMHNEGNYIISLGNFCRWL  121

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             GQ+AEELGVE+YPGFAA+E+LY+ +  V G+AT ++G  K+G   ++ + G+EL  R T+
Sbjct  122   GQQAEELGVEIYPGFAAAEVLYHPNGSVKGVATGNVGTGKNGD--QDGEPGIELWARQTV  179

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGCRGSL + +  ++KLR   +   QTY +GIKE+WE+    H+PG + HT GWP+D 
Sbjct  180   FAEGCRGSLTKTLFERFKLRNGAD--PQTYGIGIKELWEVKPELHQPGKITHTAGWPMDT  237

Query  1020  KTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGA  1199
              TYGGSFLYH++  QV +G VV L+Y NP+L+PYEEFQ+FK HPAIR + EGG  L YGA
Sbjct  238   ATYGGSFLYHLENNQVVVGFVVGLDYQNPYLSPYEEFQRFKTHPAIRGVFEGGRRLSYGA  297

Query  1200  RTLNEGGYQ  1226
             R ++EGG Q
Sbjct  298   RAISEGGLQ  306


 Score =   275 bits (703),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 160/234 (68%), Gaps = 5/234 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNME--TFWDNLR  1390
              FPGG +IG +AGFLNVPKIKGTHTAMKS MLAAE+  + L   Q G  +E  T+    +
Sbjct  312   TFPGGVLIGDTAGFLNVPKIKGTHTAMKSAMLAAEAIVEALASAQEGQPLEATTYTATFK  371

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
              SW++ EL+  RN RPAF  GL+P +  SA++ Y+ +G++P T  H   DHE +      
Sbjct  372   QSWLYDELHRVRNIRPAFRWGLWPAMLYSALDTYLFRGKAPWTLHHKHADHECLKPKDEC  431

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI YPKPDG ++FD L+SV+ SNTNH  DQPAHL+LKDP  P  +NL +Y  PE+RYCP
Sbjct  432   TPIAYPKPDGVLTFDRLSSVFISNTNHSEDQPAHLKLKDPSVPIKINLAQYDAPETRYCP  491

Query  1751  ARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE +  D G  +L INAQNC+HCK CDIKDPTQNI W  PEG GGP Y  M
Sbjct  492   AGVYEIVGRDEGTPRLQINAQNCVHCKTCDIKDPTQNINWVTPEGSGGPNYPNM  545



>gb|KDR21248.1| Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial 
[Zootermopsis nevadensis]
Length=599

 Score =   373 bits (958),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 233/311 (75%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R   E DV+IVG GPAG+SAAIRLKQL  + + +L VC+VEK AE+G HILSG   +P A
Sbjct  47    RYVDETDVLIVGGGPAGMSAAIRLKQLAEQNSKELRVCLVEKSAEIGGHILSGACIDPVA  106

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL+P W+ +  P++ PV++D+F  L++     +P     P +N GNYV+ L  +VRWL
Sbjct  107   LNELIPDWKDKGAPLNTPVTTDRFGFLTETSRIPVPILPGFPLQNHGNYVVRLGHVVRWL  166

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AAS++LY+E   V G+ATND+G+AKDGS K NF+ G+EL  + T+
Sbjct  167   GEQAEALGVEMYPGYAASDVLYHEDGSVKGVATNDVGIAKDGSPKGNFERGMELHAKCTI  226

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  ++KLREK   + QTY +G+KEVWE+D++KH+PG V HT+GWPLD 
Sbjct  227   FAEGCHGHLAKQLFQRFKLREK--CEPQTYGIGLKEVWEVDSSKHKPGTVEHTVGWPLDR  284

Query  1020  KTYGGSFLYHMKE--RQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
             +TYGGSFLYH+ E    VA+G  + L+Y NP+++P+ EFQ+FKHHP+++P+ EGG  + Y
Sbjct  285   RTYGGSFLYHLNEPTPMVAVGFAIGLDYSNPYISPFREFQRFKHHPSVKPVFEGGKRIAY  344

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG Q
Sbjct  345   GARALNEGGLQ  355


 Score =   271 bits (693),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 164/240 (68%), Gaps = 12/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNM--------ETFWD  1381
              FPGG +IGCSAGFLNVPK+KGTH AMKSGMLAAESAF+ +   S+         +T+ D
Sbjct  361   TFPGGCIIGCSAGFLNVPKVKGTHNAMKSGMLAAESAFEAVTDDSSKSETTAPEPKTYED  420

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
              +R+SWIW EL   RN RP+F N  GL+ GL  S I   +++GR P T  HG PD++ + 
Sbjct  421   KIRNSWIWSELKSVRNVRPSFHNPLGLYGGLLYSGIS-MLIRGREPWTLSHGDPDYKRLK  479

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              A    PI YPKPDG ISFD+L SV  + TNH+ DQP HL LKD   P   NL  + GPE
Sbjct  480   PASECSPINYPKPDGVISFDLLNSVALTGTNHEGDQPPHLTLKDDAVPVKRNLALFDGPE  539

Query  1736  SRYCPARVYEYI-SDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             +R+CPA VYE++  +D+   +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  540   ARFCPAGVYEFVPHEDSSGQRLQINAQNCIHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  599



>ref|WP_014897245.1| dehydrogenase [Burkholderia cepacia]
 ref|YP_006616078.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
cepacia GG4]
 gb|AFQ48384.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
cepacia GG4]
Length=557

 Score =   373 bits (958),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             ++EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    INELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (693),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYSELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDANVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>gb|KDO29821.1| hypothetical protein SPRG_04927 [Saprolegnia parasitica CBS 223.65]
Length=602

 Score =   412 bits (1058),  Expect(2) = 5e-175, Method: Compositional matrix adjust.
 Identities = 202/330 (61%), Positives = 250/330 (76%), Gaps = 18/330 (5%)
 Frame = +3

Query  285   ARGFSSESC-------REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGA  443
             +RGF++ S        RE ++YDVV+VGAGPA LSAAIRLKQL  EK  DLSVCVVEKGA
Sbjct  19    SRGFAAGSYDEILNAEREGMDYDVVLVGAGPASLSAAIRLKQLSLEKGTDLSVCVVEKGA  78

Query  444   EVGAHILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPF  608
             EVG+HI+SGNVFEP AL+EL+P W+++  P+D PV++D FL++SK ++     F LP   
Sbjct  79    EVGSHIVSGNVFEPHALNELIPDWKEKGAPLDTPVTTDSFLIISKEKSIQLPNFLLPPQV  138

Query  609   ENKGNYVISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGS  788
              N+GNYVISL +L RWLG +AEELGVE+YPGF+ASE+LY E   V GIAT D+G+ KDG+
Sbjct  139   HNEGNYVISLGKLTRWLGTQAEELGVEIYPGFSASEVLYREDGSVRGIATRDVGLEKDGT  198

Query  789   RKENFQHGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDAN  968
              KE F  G+EL+GRVTL  EGCRGS +E+V+ K++LR+  + Q QTY LGIKEVW I  +
Sbjct  199   PKETFARGMELRGRVTLFGEGCRGSCSEEVMKKFELRK--DAQPQTYGLGIKEVWRIPKD  256

Query  969   KHRPGDVLHTIGWPLD----HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQK  1136
             KH PG V HT+GWPL      KT+GGSFLYHM+E  V IG+VV L+Y NP+LNPYEEFQ+
Sbjct  257   KHTPGLVQHTLGWPLQSSLMDKTFGGSFLYHMEEDLVQIGMVVGLDYENPYLNPYEEFQR  316

Query  1137  FKHHPAIRPLLEGGTVLQYGARTLNEGGYQ  1226
             FK HPA+R  LEGG  + YGAR LNEGGY 
Sbjct  317   FKTHPAVRSHLEGGECVAYGARVLNEGGYH  346


 Score =   232 bits (592),  Expect(2) = 5e-175, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 155/255 (61%), Gaps = 32/255 (13%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGM-----------------LAAESAFDMLQGG  1357
             FPGGA+IGCSAGFLN  KIKGTHTAMKSGM                 +A     D  +G 
Sbjct  353   FPGGALIGCSAGFLNSIKIKGTHTAMKSGMLAAEAAYEALTKDGAEPVATTGEIDATEGA  412

Query  1358  SNMETFWDNLRSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKP  1537
             +++ ++   + SSWI  EL   RN   AF  G  PGL  S +  +IL G+ P T      
Sbjct  413   ADLSSYEGAVESSWIADELKKVRNCHQAFHWGTLPGLIYSGLSTFILNGKEPWTIPTTTV  472

Query  1538  DHEAINEAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLP  1717
             D      AK   PIEYPKPDG ++FD+L+++ RS TNH  DQPAHLR+K    PEL ++P
Sbjct  473   DSAKTKPAKECTPIEYPKPDGVLTFDLLSNLQRSGTNH-ADQPAHLRIK----PELKDVP  527

Query  1718  K------YAGPESRYCPARVYEYI--SDD--NGEVKLNINAQNCLHCKACDIKDPTQNIK  1867
                    YAGPE R+CPA+VYEY   S+D  NG+ +L INAQNC+HCK C IK P + I 
Sbjct  528   ANESFPVYAGPEQRFCPAKVYEYTDGSEDGANGKPQLVINAQNCIHCKCCSIKMPKEYIN  587

Query  1868  WTVPEGGGGPGYTVM  1912
             WTVPEGGGGP Y V+
Sbjct  588   WTVPEGGGGPAYEVL  602



>ref|WP_034350157.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Herbaspirillum 
sp. GW103]
Length=558

 Score =   372 bits (956),  Expect(2) = 6e-175, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 230/310 (74%), Gaps = 7/310 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  ++N ++SVCV+EKG+EVGAHILSG V +PRA
Sbjct  14    RESMEYDVVIVGGGPAGLSAAIRLKQLAAQQNREVSVCVLEKGSEVGAHILSGAVMDPRA  73

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFS-----LPSPFENKGNYVISLSQLVRW  656
             L EL+P W+++  P++ PVS D+FL LS+ +A+      LP+ F+N GNYVISLS + RW
Sbjct  74    LTELIPDWKEQGAPLNTPVSEDRFLFLSETKAYKTPNWLLPTCFQNHGNYVISLSNVTRW  133

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+LY+E   V G+AT +MG+ K+G    +FQ G+EL  + T
Sbjct  134   LGQQAEALGVEIFPGFPAAEVLYHEDGSVKGVATGNMGINKEGEPTGDFQLGMELHAKYT  193

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
               AEG RG L +Q+I +YKL        QTYA+GIKE+WE+    ++PG V+HT GWPL 
Sbjct  194   FFAEGARGHLGKQLIARYKL--DAGRDPQTYAIGIKELWEVKPEVYQPGLVVHTAGWPLA  251

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
             + TYGGSFLYH++  QVA+G VV L Y NP+L+P+EEFQ++K HP IR   EGG  + YG
Sbjct  252   NDTYGGSFLYHLENNQVAVGYVVGLAYQNPYLSPFEEFQRYKTHPEIRKFFEGGKRISYG  311

Query  1197  ARTLNEGGYQ  1226
             AR +  GG Q
Sbjct  312   ARAITAGGVQ  321


 Score =   271 bits (694),  Expect(2) = 6e-175, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 161/232 (69%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNMETFWDNLRSS  1396
             VFPGGA++GC AGFLN  +IKG+H A+KSGMLAA++AF  L   +    +  +     +S
Sbjct  327   VFPGGALLGCDAGFLNASRIKGSHAAIKSGMLAADAAFTALGENRQSDELAAYPAAFETS  386

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+ +EL+ ARN++P+   GL  G  L  I++ +  G++P T +H   DHE +  A    P
Sbjct  387   WLKEELHKARNFKPSMSKGLITGTLLVGIDQVLFGGKAPWTLRHTHADHECLRPASDFAP  446

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I YPKPDG ++FD L+SV+ SNTNH  DQPAHL LKD   P  VNL KYAGPESRYCPA 
Sbjct  447   IAYPKPDGKLTFDRLSSVFISNTNHGEDQPAHLTLKDKNVPVQVNLAKYAGPESRYCPAG  506

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++ +++   +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y+ M
Sbjct  507   VYEFVKNEDNSDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYSGM  558



>ref|NP_001005631.1| electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial 
[Xenopus (Silurana) tropicalis]
 gb|AAH74616.1| electron-transferring-flavoprotein dehydrogenase [Xenopus (Silurana) 
tropicalis]
Length=616

 Score =   372 bits (956),  Expect(2) = 6e-175, Method: Compositional matrix adjust.
 Identities = 188/382 (49%), Positives = 252/382 (66%), Gaps = 22/382 (6%)
 Frame = +3

Query  99    QHRFYTHATIVHLSQLKTMLKFILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSL  278
             +H  + H    + + LK  L    SS   + +++ + R ++    C +      E     
Sbjct  6     KHTLHAHHCFAYFTALKNCLP---SSCLKRWASSSVPRITTHYTICPRDQDKRWE-----  57

Query  279   NGARGFSSESCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAH  458
                 G + E  R A E DVVIVG GPAGLSAAIRLKQL  E + +L VC+VEKGA++GAH
Sbjct  58    ----GMNME--RFAEEADVVIVGGGPAGLSAAIRLKQLAAECDKELRVCLVEKGAQIGAH  111

Query  459   ILSGNVFEPRALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNY  626
              LSG   EPRAL+EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY
Sbjct  112   TLSGACLEPRALEELFPDWKERGAPLNTPVTEDKFGILTKKHRIPVPILPGLPMNNHGNY  171

Query  627   VISLSQLVRWLGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQ  806
             ++ L   V WLG++AE LGVE+YPG+AASE+L++E   V GIATND+G+ KDGS K  F+
Sbjct  172   IVRLGHFVSWLGEQAEALGVEIYPGYAASEVLFHEDGSVKGIATNDVGIHKDGSPKSTFE  231

Query  807   HGVELKGRVTLLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGD  986
              G+EL  +VT+  EGC G LA+Q+  K+ LR+  N + QTYA+G+KE+W ID  K +PG 
Sbjct  232   RGLELHAKVTIFGEGCHGHLAKQLYNKFNLRQ--NCEPQTYAIGLKELWVIDEKKWKPGC  289

Query  987   VLHTIGWPLDHKTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIR  1160
             V HT+GWPLD  TYGGSFLYH+ E +  VA+GLVV L+Y NPF+NP+ E Q++KHHP++ 
Sbjct  290   VEHTVGWPLDRHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPFINPFRELQRWKHHPSVV  349

Query  1161  PLLEGGTVLQYGARTLNEGGYQ  1226
             P LEGG  + YGAR LNEGG+Q
Sbjct  350   PTLEGGNRIAYGARALNEGGFQ  371


 Score =   271 bits (694),  Expect(2) = 6e-175, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG ++GCS GF+NVPKIKGTHTAMKSGMLAAE+ F  L          G ++  + +
Sbjct  377   TFPGGILVGCSPGFMNVPKIKGTHTAMKSGMLAAENIFKKLTDESIQSKTQGLDVPEYEE  436

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             +L+ SWIWKELY  RN RP+     GL+ G+  + I  ++L+G+ P T KH   D   + 
Sbjct  437   SLKKSWIWKELYSVRNIRPSCHGPLGLYGGMVYTGIFYWMLRGKEPWTLKHKGLDSNQLK  496

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK  +PIEYPKPDG +SFD+L+SV  S TNHDHDQPAHL LKD   P   NL  Y GPE
Sbjct  497   PAKDCVPIEYPKPDGKLSFDLLSSVALSGTNHDHDQPAHLTLKDDSLPVNKNLAIYDGPE  556

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYE++  ++GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  557   QRFCPAGVYEFVPLESGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  616



>ref|WP_027792375.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
cepacia]
 gb|AIO26925.1| FAD binding domain protein [Burkholderia cepacia ATCC 25416]
Length=557

 Score =   373 bits (958),  Expect(2) = 6e-175, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVEVTEDRFLFLSEKSAITTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLIAKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (692),  Expect(2) = 6e-175, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDANVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_039335584.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
multivorans]
 gb|KHS09758.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
multivorans]
Length=557

 Score =   371 bits (952),  Expect(2) = 7e-175, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L EL P W++   P++V V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    LTELFPDWKERGAPLNVEVTEDRFLFLSEKSAVQTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLIAKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   273 bits (698),  Expect(2) = 7e-175, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  R 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFRQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  IE+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGIEQKLMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VNL  YAGPE R+CPA
Sbjct  445   PIVYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDPSVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|XP_009994219.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Chaetura pelagica]
Length=556

 Score =   370 bits (951),  Expect(2) = 7e-175, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 228/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  3     RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACLEPRS  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L EL P W++   P++ PV+ DKF +L+KN    +P     P  N GNY++ L   V WL
Sbjct  63    LQELFPDWKERGAPLNTPVTEDKFGILTKNSRIPVPIIPGLPMVNHGNYIVRLGHFVSWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVELYPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  123   GEQAEALGVELYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  183   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  240

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP ++P LEGGT + Y
Sbjct  241   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPTVQPTLEGGTRIAY  300

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  301   GARALNEGGFQ  311


 Score =   273 bits (698),  Expect(2) = 7e-175, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  317   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  376

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  377   NLKKSWVWKELYAVRNIRPSCHSVLGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  436

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  437   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  496

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  497   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  556



>gb|KFU88339.1| hypothetical protein M959_02820, partial [Chaetura pelagica]
Length=608

 Score =   370 bits (951),  Expect(2) = 7e-175, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 228/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  55    RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACLEPRS  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L EL P W++   P++ PV+ DKF +L+KN    +P     P  N GNY++ L   V WL
Sbjct  115   LQELFPDWKERGAPLNTPVTEDKFGILTKNSRIPVPIIPGLPMVNHGNYIVRLGHFVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVELYPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  175   GEQAEALGVELYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP ++P LEGGT + Y
Sbjct  293   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPTVQPTLEGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  353   GARALNEGGFQ  363


 Score =   273 bits (698),  Expect(2) = 7e-175, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  369   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYAVRNIRPSCHSVLGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>ref|WP_028445286.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Chitinimonas 
koreensis]
Length=551

 Score =   367 bits (943),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 174/310 (56%), Positives = 233/310 (75%), Gaps = 7/310 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE +EYDVVIVGAGPAGLSAAIRLKQL  EK +++SVCV+EKG+EVGAHILSG V +P A
Sbjct  3     REFMEYDVVIVGAGPAGLSAAIRLKQLAAEKGSEVSVCVLEKGSEVGAHILSGAVIDPIA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             ++EL P W++   P++VPVS D+FL+L ++ +     F LP    N GNYV+SL  + RW
Sbjct  63    MNELFPDWKERGAPLNVPVSEDRFLVLEEDESYRIPNFLLPPLMNNHGNYVVSLGNVCRW  122

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             L  +AEELGVE+YPGFAA+E+LY++   V G+AT DMG+AKDGS K  +  G+EL  + T
Sbjct  123   LASQAEELGVEIYPGFAAAEVLYHDDGSVKGVATGDMGIAKDGSHKPEYARGMELHAKYT  182

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L+AEG RGSLA+++  ++ LR+  +   Q + +GIKE+W++D ++H+PG V+H+ GWPL 
Sbjct  183   LIAEGVRGSLAKELQARFDLRDGVD--PQKFGIGIKELWKVDPSRHQPGLVMHSQGWPLG  240

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               T GGSFLYH+ + QV +G VV LNY NP L+P++EFQ+FK HPAIR + EGG  + YG
Sbjct  241   SATGGGSFLYHLDDNQVVVGFVVHLNYENPHLSPFDEFQRFKTHPAIRGVFEGGKRIAYG  300

Query  1197  ARTLNEGGYQ  1226
             AR +NEGG Q
Sbjct  301   ARAINEGGLQ  310


 Score =   276 bits (706),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 164/236 (69%), Gaps = 7/236 (3%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS----NMETFWDNLRS  1393
             VFPGGA+IGCSAGF+NVP+IKG+H AMKSGMLAAE+ FD L GG+     +  +   LRS
Sbjct  316   VFPGGALIGCSAGFVNVPRIKGSHNAMKSGMLAAEATFDALAGGAAGHDELVAYPQKLRS  375

Query  1394  SWIWKELYHARNYRPAFEN-GLFPGLALSAIERYI--LKGRSPLTFKHGKPDHEAINEAK  1564
             SW+W +L   RN +PA    GL+ G      + +   L  R P TF+HGK DH ++  A 
Sbjct  376   SWVWDDLDKVRNVKPALSKFGLWGGTIYGGFDMWCHSLGIRLPWTFRHGKTDHASLKPAA  435

Query  1565  SSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRY  1744
                PI+YPKPDG ISFD L+SV+ SNTNH+ DQP+HLRLKD   P  VN   YAGPE R+
Sbjct  436   DCPPIDYPKPDGKISFDKLSSVFISNTNHEEDQPSHLRLKDASVPVAVNWNVYAGPEQRF  495

Query  1745  CPARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             CPA VYE++  +  + +L INAQNC+HCK CDIKDPTQNI W VPEGGGGP Y  M
Sbjct  496   CPAGVYEFVGVEENQPRLQINAQNCVHCKTCDIKDPTQNINWVVPEGGGGPNYPNM  551



>ref|WP_038709235.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
sp. lig30]
 gb|KDB10313.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
sp. lig30]
Length=557

 Score =   368 bits (945),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL+P W+++  P+ V V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    ITELIPDWKEQGAPLTVDVTEDRFLFLSETGAKAVPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILY++   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYHDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I ++KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISRFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPEIRKFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   275 bits (704),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAAE+AFD +Q G +   +  + D  R 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAAEAAFDAVQAGRHSDELNAYPDAFRQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+  ELY ARN++     GL+ G  +  IE+ +L G  P T  H   DHE +  A    
Sbjct  385   SWLHDELYRARNFKQWMAKGLYLGTLMVGIEQKLLGGNVPWTLHHQHADHEMLKPASQCT  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPESR+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPESRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_027816459.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
bannensis]
Length=557

 Score =   376 bits (966),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 229/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L+EL P W+++  P++VPV+ DKFL LS+  A     ++LP  F+N GNYVISL+ + RW
Sbjct  73    LNELFPDWKEQGAPLNVPVTEDKFLFLSETGAKSVPNWALPDNFKNHGNYVISLANVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+LYN+   V G+AT +MG+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEVLYNDDGSVKGVATGNMGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q+  K+KL +  +   Q Y +GIKE+WEID  +H+PG V+HT GWPL+
Sbjct  193   LFCEGARGHLGRQLNEKFKLGK--DADPQVYGIGIKELWEIDPARHKPGLVIHTAGWPLE  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
             + TYGGSFLYH+   QV +G VV L Y NP+L+P+EEFQ++K HP IR  LEGG  + YG
Sbjct  251   NDTYGGSFLYHIDNNQVMVGFVVGLAYTNPYLSPFEEFQRYKTHPEIRKYLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   267 bits (683),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 161/232 (69%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSS  1396
             VFPGGA++G  AGFLN  +IKG+H A+K+GMLAA++AF+ +Q G     +  + +  + S
Sbjct  326   VFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAADAAFEAVQAGRQGDELAAYPEGFKQS  385

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+ +ELY ARN++     GL+ G  +  IE+ +L G  P T  H   D+E +  A    P
Sbjct  386   WLHEELYKARNFKQWMSKGLYLGTLMVGIEQKLLGGNVPWTLHHQHRDNEMLKPASQCKP  445

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  +NL KYAGPE+R+CPA 
Sbjct  446   IEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDATVPVGINLTKYAGPEARFCPAG  505

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++ DD+   +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  506   VYEFVKDDSNADRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYATM  557



>ref|WP_012213489.1| dehydrogenase [Burkholderia multivorans]
 ref|YP_001579973.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
multivorans ATCC 17616]
 ref|YP_001945920.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
multivorans ATCC 17616]
 gb|ABX15476.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
multivorans ATCC 17616]
 dbj|BAG43384.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
multivorans ATCC 17616]
 gb|KHS14394.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
multivorans]
Length=557

 Score =   371 bits (952),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L EL P W++   P++V V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    LTELFPDWKERGAPLNVEVTEDRFLFLSEKSAVQTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLIAKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   273 bits (697),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  R 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFRQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  IE+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGIEQKLMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VNL  YAGPE R+CPA
Sbjct  445   PIVYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDPSVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_014746187.1| electron transfer flavoprotein [Tistrella mobilis]
 ref|YP_006372094.1| dehydrogenase [Tistrella mobilis KA081020-065]
 gb|AFK54510.1| Dehydrogenase [Tistrella mobilis KA081020-065]
Length=542

 Score =   380 bits (976),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 229/307 (75%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE +E+DVVIVGAGPAGLSAAIRLKQL  E + ++SVCV+EKG+EVGAHIL+G  FEPRA
Sbjct  3     REVMEFDVVIVGAGPAGLSAAIRLKQLAAENDHEVSVCVIEKGSEVGAHILAGACFEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL+P W+++  P++ P   D+FLLL+++    LP+P    N GNYVISL  L RWL +
Sbjct  63    LNELIPDWKEKGAPLNQPADEDRFLLLTESNHIRLPTPPQMNNHGNYVISLGNLARWLAE  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE L VE+YPGFAA+E+LY+E   V G+AT D+G+ +DG +K  +  GVEL  + TL A
Sbjct  123   QAEALEVEVYPGFAAAEVLYDEQGRVKGVATGDLGIGRDGEQKSGYTPGVELHAKYTLFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EG RGSL   +  K+ LR+  N   QTY +GIKE+WEID  KH+PG V+HTIGWPLD KT
Sbjct  183   EGARGSLTRMLTDKFGLRD--NCDPQTYGIGIKELWEIDPAKHKPGLVIHTIGWPLDTKT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             Y GSFLYHM+  QVA+GLV+ L+Y NP ++P++EFQ+ K HPA+R   EG   + YGAR 
Sbjct  241   YSGSFLYHMENNQVAVGLVIGLDYQNPHISPFDEFQRLKQHPALRDYFEGAKRIAYGARA  300

Query  1206  LNEGGYQ  1226
             L EGG+Q
Sbjct  301   LTEGGFQ  307


 Score =   263 bits (673),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 166/231 (72%), Gaps = 5/231 (2%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSSW  1399
             FPGG +IGC+AGF+NVPK+KG+HTAMK+GMLAAE+AF+ L+ G     ++ +      SW
Sbjct  314   FPGGVLIGCTAGFMNVPKVKGSHTAMKTGMLAAEAAFEALKDGRANDVLDAYPALYEQSW  373

Query  1400  IWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPI  1579
             + +EL   RN RP+F  GL  GLA SA++ Y+ +G +P TF H + DH+++  A +   I
Sbjct  374   VHQELKKVRNIRPSFNRGLLAGLAYSALDTYLFRGNAPWTFHHHE-DHKSLKPASACKKI  432

Query  1580  EYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARV  1759
              YPKPDG ISFD L+SV+ SNTNH+ DQP HLRLKDP  P  VNLP Y  PE RYCPA V
Sbjct  433   VYPKPDGKISFDKLSSVFLSNTNHEEDQPIHLRLKDPSVPVTVNLPTYDAPEQRYCPAGV  492

Query  1760  YEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YE + +D G  +L INAQNC+HCK CDIKDPTQNI WTVPEG GGP Y  M
Sbjct  493   YEIVQEDAGP-RLQINAQNCVHCKTCDIKDPTQNIVWTVPEGAGGPNYPNM  542



>ref|WP_007585449.1| MULTISPECIES: dehydrogenase [Burkholderia]
 gb|EIM98429.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
terrae BS001]
 gb|EUC17800.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
sp. BT03]
Length=557

 Score =   370 bits (950),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 175/308 (57%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQ   EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQRAAEKGVEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L+EL+  W+++  P+DV V+ D+FL LS+  A     ++LP  F+N GNYVISL+ + RW
Sbjct  73    LNELILDWKEKGAPLDVEVTEDRFLFLSETGAKSVPNWALPDNFKNHGNYVISLANVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE  GVE++PGFAA+E+LYNE   V G+AT ++G+ KDG   ENFQ G+EL  + T
Sbjct  133   LGTQAEAAGVEIFPGFAAAEVLYNEDGSVKGVATGNLGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q+  K+KLR+  +   Q Y +GIKE+WEID  KH+PG V+HT GWPLD
Sbjct  193   LFCEGARGHLGRQLSDKFKLRDGAD--PQVYGIGIKELWEIDPAKHKPGLVIHTAGWPLD  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
              +TYGGSFLYH+   QV +G VV L Y NP+L+P+EEFQ++K HP IR  LEGG  + YG
Sbjct  251   TQTYGGSFLYHIDNNQVMVGFVVGLGYSNPYLSPFEEFQRYKTHPEIRKFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   273 bits (699),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 163/231 (71%), Gaps = 3/231 (1%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSSW  1399
             FPGGA++G  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G +   +  + ++ ++SW
Sbjct  327   FPGGALVGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRHSDELTAYPESFKTSW  386

Query  1400  IWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPI  1579
             +  ELY ARN++     GL+ G  +  IE+ +L G  P T  H   DHE +  A    PI
Sbjct  387   LHTELYRARNFKQWMSKGLYLGTLMVGIEQKLLGGNVPWTLHHQHWDHEMLKPASQCTPI  446

Query  1580  EYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARV  1759
             EYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VNL  YAGPESRYCPA V
Sbjct  447   EYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDPTVPVKVNLQTYAGPESRYCPAAV  506

Query  1760  YEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             YE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  507   YEFVKNDDGSERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_026687107.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Azovibrio 
restrictus]
Length=545

 Score =   361 bits (927),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 231/307 (75%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE +EYDVV+VGAGPAGL+AAIRLKQL  E+  +LSVCV+EKG+EVGAHILSG  FEPRA
Sbjct  5     REFMEYDVVVVGAGPAGLAAAIRLKQLAAEQGRELSVCVLEKGSEVGAHILSGACFEPRA  64

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             LDELLP W+    P+  P + D+FL L++  A  LP+P    N GNY+ISL  L RWL +
Sbjct  65    LDELLPDWKALGAPLHTPATDDQFLFLTETGAHQLPTPPQMHNHGNYIISLGNLCRWLAE  124

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGFAA+E+LY+E   V G+AT DMGV KDG    N+Q G+EL  R T+ +
Sbjct  125   QAEGLGVEIYPGFAAAEVLYHEDGSVKGVATGDMGVGKDGQPTGNYQPGMELHARQTIFS  184

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL + +  +++LR+  + Q QTY +GIKE+WE+D  +H+PG ++H+IGWPL   T
Sbjct  185   EGCRGSLTQDLFERFELRK--DAQPQTYGIGIKELWEVDPARHQPGKIVHSIGWPLSTDT  242

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++  QV +G V+ L+Y NP+L+P+EEFQ+FK HP++R    GG  + YGAR 
Sbjct  243   YGGSFLYHLENNQVVVGFVIGLDYKNPWLSPFEEFQRFKTHPSVRDTFAGGRRIAYGARA  302

Query  1206  LNEGGYQ  1226
             L+EGG+Q
Sbjct  303   LSEGGFQ  309


 Score =   282 bits (721),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 170/232 (73%), Gaps = 4/232 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQ---GGSNMETFWDNLRSS  1396
              FPGG ++G +AGFLNVPKIKG+HTAMKSGMLAAE+ F+ L     G+ +  + + L++S
Sbjct  315   TFPGGLLVGDTAGFLNVPKIKGSHTAMKSGMLAAEAVFEHLGREGAGTEVSAYPEKLKAS  374

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+W+EL+  RN RP F+ GL+PGLAL+A++ Y+ +G++P T  H   DH A+ E     P
Sbjct  375   WLWQELHAVRNIRPGFKWGLWPGLALAAVDTYLFRGKAPWTLSH-HADHAALEEKSRHAP  433

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I YPKPDG ++FD L+SV+ S+TNH+ +Q  HL+L+D   P  VNL +Y  PE RYCPA 
Sbjct  434   IAYPKPDGVLTFDRLSSVFLSSTNHEENQRCHLQLRDEAVPIRVNLARYGAPEIRYCPAG  493

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE + ++ G+ +L INAQNCLHCK CDIKDPTQNI WTVPEGGGGP Y  M
Sbjct  494   VYEILGEEEGQPRLQINAQNCLHCKTCDIKDPTQNIHWTVPEGGGGPNYPNM  545



>ref|WP_038455600.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
cenocepacia]
 gb|AIO30905.1| FAD binding domain protein [Burkholderia cenocepacia]
Length=557

 Score =   374 bits (959),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  +H+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLIAKFKL--DANADPQAYGIGIKELWEIDPARHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   270 bits (689),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  IE+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGIEQKVMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIVYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_014087257.1| electron transfer flavoprotein [Pseudogulbenkiania sp. NH8B]
 ref|YP_004847397.1| electron-transferring-flavoprotein dehydrogenase [Pseudogulbenkiania 
sp. NH8B]
 dbj|BAK76983.1| electron-transferring-flavoprotein dehydrogenase [Pseudogulbenkiania 
sp. NH8B]
Length=545

 Score =   367 bits (941),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 229/309 (74%), Gaps = 6/309 (2%)
 Frame = +3

Query  306   SCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEP  485
             + RE++EYDVVIVG GP+GLSAAIRLKQL  +K  ++SVC++EKG+E+GAHILSG V EP
Sbjct  2     NARESMEYDVVIVGGGPSGLSAAIRLKQLAADKGQEISVCLLEKGSEIGAHILSGAVLEP  61

Query  486   RALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWL  659
             R L+EL+P W+ +  P++ P   D+FLLL++  +  LP+P    N+GNY+ISL    RWL
Sbjct  62    RTLNELIPDWKDKGAPLNTPAQKDQFLLLTETESIQLPTPPQMHNEGNYIISLGNFCRWL  121

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             GQ+AEELGVE+YPGFAA+E+LY+    V G+AT ++G  K+G   ++ + G+EL  R T+
Sbjct  122   GQQAEELGVEIYPGFAAAEVLYHPDGSVKGVATGNVGTGKNGD--QDGEPGIELWARQTV  179

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGCRGSL + +  ++ LR+  +   QTY +GIKE+WE+    H+PG + HT GWP+D 
Sbjct  180   FAEGCRGSLTKTLFERFDLRKGSD--PQTYGIGIKELWEVKPELHQPGKITHTAGWPMDT  237

Query  1020  KTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGA  1199
              TYGGSFLYH++  QV +G VV L+Y NP+L+PYEEFQ+FK HPAIR + EGG  L YGA
Sbjct  238   ATYGGSFLYHLENNQVVVGFVVGLDYQNPYLSPYEEFQRFKTHPAIRGVFEGGRRLSYGA  297

Query  1200  RTLNEGGYQ  1226
             R ++EGG Q
Sbjct  298   RAISEGGLQ  306


 Score =   276 bits (707),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 162/234 (69%), Gaps = 5/234 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNME--TFWDNLR  1390
              FPGG +IG +AGFLNVPKIKGTHTAMKS MLAAE+  + L   Q G  +E  T+    +
Sbjct  312   TFPGGVLIGDTAGFLNVPKIKGTHTAMKSAMLAAEAIVEALASAQEGQPLEATTYTATFK  371

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
              SW++ EL+  RN RPAF  GL+P +  SA++ Y+ +G++P T  H   DHE +      
Sbjct  372   QSWLYDELHRVRNIRPAFRWGLWPAMLYSALDTYLFRGKAPWTLHHKHADHECLKPKDEC  431

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI YPKPDG ++FD L+SV+ SNTNH  DQPAHL+LKDP  P  +NL +Y  PE+RYCP
Sbjct  432   TPIAYPKPDGVLTFDRLSSVFISNTNHSEDQPAHLKLKDPSVPIKINLAQYDAPETRYCP  491

Query  1751  ARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE +  + GE +L INAQNC+HCK CDIKDP+QNI W  PEGGGGP Y  M
Sbjct  492   AGVYEIVGREEGEPRLQINAQNCVHCKTCDIKDPSQNINWVTPEGGGGPNYPNM  545



>gb|EAY62113.1| Dehydrogenase [Burkholderia cenocepacia PC184]
Length=583

 Score =   372 bits (956),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  39    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  98

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  99    ITELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPDNFKNHGNYVISLGNVTRW  158

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  159   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  218

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  219   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  276

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  277   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  336

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  337   ARAITAGG  344


 Score =   271 bits (692),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  351   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  410

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  411   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHRHADHEMLKPASQCE  470

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  471   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  530

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  531   AVYEFVKNDDGGERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  583



>ref|XP_007436536.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Python bivittatus]
Length=619

 Score =   373 bits (958),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 179/311 (58%), Positives = 230/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E   ++ VC+VEK A++GAHILSG   EPRA
Sbjct  66    RFAEEADVVIVGAGPAGLSAAIRLKQLASEHGKEIRVCLVEKAAQIGAHILSGACLEPRA  125

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P+   V+ D+F +L+KN    +P     P  N GNY++ L   V WL
Sbjct  126   LEELFPDWKERGAPLHTTVTEDRFGILTKNYRIPVPILPGLPMVNHGNYIVRLGHFVSWL  185

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+EIL+N+   V GIATND+G+ KDG+ K NF+ G+EL  ++T+
Sbjct  186   GEQAEALGVEVYPGYAAAEILFNDDGSVKGIATNDVGIQKDGAPKGNFERGLELHAKITV  245

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LRE  N Q QTY +G+KE+W ID NK +PG V HT+GWPLD 
Sbjct  246   FAEGCHGHLAKQLYNKYNLRE--NCQPQTYGIGLKELWLIDENKWKPGRVEHTVGWPLDK  303

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NPFL+P++EFQ++KHHP+++P LEGG  + Y
Sbjct  304   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPFLSPFKEFQRWKHHPSVQPTLEGGKRIAY  363

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGGYQ
Sbjct  364   GARALNEGGYQ  374


 Score =   270 bits (690),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 165/239 (69%), Gaps = 11/239 (5%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWDN  1384
             FPGG +IGCS GF+NVPKIKGTHTAMKSGMLA+E+ F+ L          G ++  + +N
Sbjct  381   FPGGVLIGCSPGFMNVPKIKGTHTAMKSGMLASEAIFNQLINENLQSKTIGLHVTEYEEN  440

Query  1385  LRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINE  1558
             L+ SW+WKELY  RN RP+     G++ G+  + I  ++L+G  P T KH   D + +  
Sbjct  441   LKKSWVWKELYGVRNIRPSCHGLMGVYGGMIYTGIFYWLLRGFEPWTLKHPGTDAKQLKP  500

Query  1559  AKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPES  1738
             AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQP HL LKD   P   NL  Y GPE 
Sbjct  501   AKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPPHLTLKDDSIPVSHNLAIYDGPEQ  560

Query  1739  RYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             R+CPA VYEY+  ++GE ++L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  561   RFCPAGVYEYVPVESGEGLRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  619



>ref|WP_035546943.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
sp. 9120]
Length=557

 Score =   380 bits (976),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 231/308 (75%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK+ +L VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKSVELGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL+P W+++  P+DV VS DKFL LS+  +     ++LP  F+N GNYV+SL+ + RW
Sbjct  73    ITELIPDWKEKGAPLDVAVSEDKFLFLSETGSKNVPVWALPDNFKNHGNYVVSLANVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT ++G+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNLGIGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q+  ++KLRE  +   Q Y +GIKE+WEID  KH+PG V+HT GWPL+
Sbjct  193   LFCEGARGHLGRQLNDRFKLREGVD--PQVYGIGIKELWEIDPGKHKPGLVMHTAGWPLE  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
             + TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HPAIR +LEGG  + YG
Sbjct  251   NDTYGGSFLYHMDNNQVMVGFVVGLGYTNPYLSPFEEFQRYKTHPAIRAILEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   263 bits (672),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 160/232 (69%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGG---SNMETFWDNLRSS  1396
             VFPGGA++G  AGFLN  +IKG+H A+K+GMLAA++AF+ +Q G     +  + +  ++S
Sbjct  326   VFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAADAAFEAVQAGRTSDELTAYPEAFKTS  385

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+  EL+ ARN++     GL+ G  +  +E+ +L G  P T  H   DHE +  A    P
Sbjct  386   WLHTELHRARNFKQWMSKGLYLGTLMVGLEQKVLGGNVPWTLHHQHSDHEMLKPASQCKP  445

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VN   YAGPE+RYCPA 
Sbjct  446   IIYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDPSVPVNVNWQTYAGPEARYCPAA  505

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  506   VYEFVKNDDGGERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_006498524.1| dehydrogenase [Burkholderia cenocepacia]
 emb|CCE52603.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
cenocepacia H111]
Length=557

 Score =   374 bits (959),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   270 bits (689),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELTAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHQHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIAYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_006413264.1| dehydrogenase [Burkholderia multivorans]
 gb|EJO60533.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
multivorans CF2]
 gb|KGC07270.1| FAD binding domain protein [Burkholderia multivorans]
Length=557

 Score =   370 bits (951),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L EL P W++   P++V V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    LTELFPDWKERGAPLNVEVTEDRFLFLSEKSAVQTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLIAKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   PDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   273 bits (697),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  R 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFRQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  IE+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGIEQKLMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VNL  YAGPE R+CPA
Sbjct  445   PIVYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDPSVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|XP_005517648.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Pseudopodoces humilis]
Length=619

 Score =   370 bits (950),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 230/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  66    RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEVRVCLVEKASQIGAHTLSGACLEPRS  125

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L++     +P     P  N GNY++ L  LV WL
Sbjct  126   LEELFPDWKERGAPLNTPVTEDKFGILTETSRIPVPILPGLPMVNHGNYIVRLGHLVSWL  185

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  186   GEQAEALGVEIYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  245

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LRE  N Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  246   FAEGCHGHLAKQLYKKYNLRE--NCQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  303

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ ER+  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  304   HTYGGSFLYHLNEREPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  363

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG Q
Sbjct  364   GARALNEGGIQ  374


 Score =   273 bits (697),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  380   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  439

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  440   NLKKSWVWKELYAVRNIRPSCHSVLGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  499

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  500   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSVPVSRNLALFDGPE  559

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEY+  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  560   QRFCPAGVYEYVPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  619



>ref|XP_007071342.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Chelonia mydas]
Length=619

 Score =   367 bits (941),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 186/369 (50%), Positives = 247/369 (67%), Gaps = 10/369 (3%)
 Frame = +3

Query  138   SQLKTMLKFILSSAKSKLSTTPINRFSSFPNPCGKASRFGAESGYSLNGARGFSSESCRE  317
             SQ    L+ + S  K  L    I R++S  +     + +   S        G + E  R 
Sbjct  10    SQAHHCLRALKSVKKDILPPLCIARWASTSSVPRITTHYTIHSRNKDKRWEGVNME--RF  67

Query  318   AIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALD  497
             A E DVVIVGAGPAGLSAAIRLKQL  E   ++ VC+VEK A++GAH LSG   EPRAL+
Sbjct  68    AEEADVVIVGAGPAGLSAAIRLKQLANEYGKEVRVCLVEKAAQIGAHTLSGACLEPRALE  127

Query  498   ELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWLGQ  665
             ELLP W++   P+  PV+ DKF +L+KN    +P     P  N GNY++ L   V WLG+
Sbjct  128   ELLPDWKERGAPLQTPVTEDKFGILTKNSRIPVPVLPGLPMTNHGNYIVRLGHFVNWLGE  187

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT  A
Sbjct  188   QAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKAIFERGLELHAKVTFFA  247

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGC G LA+Q+  +Y LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD  T
Sbjct  248   EGCHGHLAKQLYNRYNLREK--CQPQSYGIGLKELWLIDEKKWKPGRVEHTVGWPLDRHT  305

Query  1026  YGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGA  1199
             YGGSFLYH+ E +  VA+G VV L+Y NP+L+P++EFQ++KHHP+++P  EGG  + YGA
Sbjct  306   YGGSFLYHLNEGEPLVALGFVVGLDYQNPYLSPFKEFQRWKHHPSVQPTFEGGKRIAYGA  365

Query  1200  RTLNEGGYQ  1226
             R LNEGG+Q
Sbjct  366   RALNEGGFQ  374


 Score =   276 bits (707),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS GF+NVPKIKGTHTAMKSGMLA+E+ F+ L          G ++  + +
Sbjct  380   TFPGGVLIGCSPGFMNVPKIKGTHTAMKSGMLASEAVFNQLTNENLQSKTIGLDVPEYEE  439

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+     G++ G+  + I  +IL+G  P T KH  PD + + 
Sbjct  440   NLKKSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWILRGMEPWTLKHPGPDSDQLK  499

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQP HL LKD   P   NL  Y GPE
Sbjct  500   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPPHLTLKDDSVPVNKNLAIYDGPE  559

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEY+  + GE ++L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  560   QRFCPAGVYEYVPLETGEGLRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  619



>ref|WP_014103512.1| electron transfer flavoprotein [Micavibrio aeruginosavorus]
 ref|YP_004866291.1| electron transfer flavo-ubiquinone oxidoreductase family protein 
[Micavibrio aeruginosavorus ARL-13]
 gb|AEP10289.1| electron transfer flavo-ubiquinone oxidoreductase family protein 
[Micavibrio aeruginosavorus ARL-13]
Length=537

 Score =   387 bits (994),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 235/304 (77%), Gaps = 4/304 (1%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVGAGP+GLS AIRLKQL  E+  D+SVCV+EKG+EVGAH++SG VFEPRAL+E
Sbjct  1     MEYDVVIVGAGPSGLSCAIRLKQLAAERGTDISVCVIEKGSEVGAHLMSGAVFEPRALNE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAE  674
             L+P W+ +  P+ V   +D+FL L+KN++F LP+P    N GNY+ISLS L RWL  +AE
Sbjct  61    LIPDWKDKGAPLHVQAKTDRFLFLTKNKSFRLPTPPQMYNHGNYIISLSMLGRWLATQAE  120

Query  675   ELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGC  854
             ELGVE+Y GFAA+E+LYN++  V+G+AT DMG+ KDG++ ++F+ GVEL  + T+ AEGC
Sbjct  121   ELGVEIYAGFAAAEVLYNDAGAVMGVATGDMGLDKDGNKTDHFEPGVELHAKQTVFAEGC  180

Query  855   RGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGG  1034
              GSL + +I  Y LR+  N   QTY LGIKE+WEI A+KH  G ++HT+GWP+D KTYGG
Sbjct  181   HGSLTKTLIAHYDLRK--NSDPQTYGLGIKEIWEIPADKHSEGLIIHTVGWPMDSKTYGG  238

Query  1035  SFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNE  1214
             S++YH+   QV+IG V+ L+Y NP+L+P+ E Q+FK HP +R  LEGG  + YGAR+L E
Sbjct  239   SWMYHLDNNQVSIGFVIGLDYQNPYLSPFAEMQRFKTHPDVRKYLEGGRRIAYGARSLVE  298

Query  1215  GGYQ  1226
             GG+Q
Sbjct  299   GGFQ  302


 Score =   256 bits (653),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 160/236 (68%), Gaps = 13/236 (6%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGG----SNMETFWDNLRS  1393
              FPGG +IG +AGFLNVPKIKG HTAMKSGM+AAES +D+L  G    +    + DN+++
Sbjct  308   TFPGGILIGDTAGFLNVPKIKGNHTAMKSGMVAAESLYDLLTTGDATSAECTAYTDNIKA  367

Query  1394  SWIWKELYHARNYRPAFENGLFPGL---ALSAIERYILKGRSPLTFKHGKPDHEAINEAK  1564
             SWIW EL   RN RP F  G + G+   A   +  ++L    P T K+   DH ++  A 
Sbjct  368   SWIWPELKKVRNIRPGFNFGFWIGMIHAAFQTVGGWLL----PYTLKN-HADHSSLKPAT  422

Query  1565  SSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRY  1744
               L I+YPKPD  ++FD LTSV  SNT H+  QP+HL+LKDP  P  VNLP+YA P  RY
Sbjct  423   DDLKIDYPKPDNVLTFDRLTSVRLSNTMHEDGQPSHLKLKDPSIPVSVNLPRYAEPAQRY  482

Query  1745  CPARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             CPA VYE + D NG  K  INAQNC+HCK CDIKDP+QNI+WTVP+GGGGP Y+ M
Sbjct  483   CPAAVYEVVEDANGP-KFVINAQNCVHCKTCDIKDPSQNIEWTVPQGGGGPNYSNM  537



>ref|WP_006488512.1| MULTISPECIES: dehydrogenase [Burkholderia cepacia complex]
 ref|YP_002230599.1| putative electron transport protein [Burkholderia cenocepacia 
J2315]
 emb|CAR51767.1| putative electron transport protein [Burkholderia cenocepacia 
J2315]
 gb|EPZ87034.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
cenocepacia K56-2Valvano]
 gb|ERI25726.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
cenocepacia BC7]
 gb|AIO49218.1| FAD binding domain protein [Burkholderia cepacia]
 gb|KGB96066.1| FAD binding domain protein [Burkholderia cepacia]
Length=557

 Score =   374 bits (959),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (688),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHQHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIAYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|XP_005232538.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Falco peregrinus]
 ref|XP_005232539.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X2 [Falco peregrinus]
 ref|XP_005438696.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X1 [Falco cherrug]
 ref|XP_005438697.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial isoform X2 [Falco cherrug]
Length=556

 Score =   369 bits (947),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 228/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVG GPAGLSAAIRLKQL  E N ++ VC+VEK +++GAH LSG   EPR+
Sbjct  3     RFAEEADVVIVGGGPAGLSAAIRLKQLAAEHNKEIRVCLVEKASQIGAHTLSGACLEPRS  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  63    LEELFPDWKERGAPLNTPVTEDKFGILTKKSRIPVPILPGLPMVNHGNYIVRLGHFVTWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVELYPG+AA+E+L++E   V G+ATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  123   GEQAEALGVELYPGYAAAEVLFHEDGSVKGVATNDVGIRKDGAPKATFERGLELHAKVTV  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  183   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  240

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  241   HTYGGSFLYHLNESEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  300

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  301   GARALNEGGFQ  311


 Score =   274 bits (700),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  317   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  376

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  +IL+G  P T KH  PD   + 
Sbjct  377   NLKKSWVWKELYAVRNIRPSCHSILGVYGGMIYTGIFYWILRGMEPWTLKHPGPDFAQLK  436

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  437   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  496

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  497   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  556



>ref|WP_006402093.1| dehydrogenase [Burkholderia multivorans]
 gb|EED97618.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
multivorans CGD1]
 gb|EEE08005.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
multivorans CGD2]
 gb|EEE14057.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
multivorans CGD2M]
 gb|EJO59321.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
multivorans CF2]
 gb|AIO76150.1| FAD binding domain protein [Burkholderia multivorans]
Length=557

 Score =   370 bits (951),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L EL P W++   P++V V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    LTELFPDWKERGAPLNVEVTEDRFLFLSEKSAVQTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLIAKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   PDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   272 bits (696),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  R 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFRQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  IE+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGIEQKLMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VNL  YAGPE R+CPA
Sbjct  445   PIVYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDPSVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>gb|KFQ46672.1| hypothetical protein N333_03372, partial [Nestor notabilis]
Length=608

 Score =   369 bits (946),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 227/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVG GPAGLSAAIRLKQL  E N ++ VC+VEK +++GAH LSG   EPR+
Sbjct  55    RFAEEADVVIVGGGPAGLSAAIRLKQLAAEHNKEIRVCLVEKASQIGAHTLSGACLEPRS  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L++     +P     P  N GNY++ L   V WL
Sbjct  115   LEELFPDWKERGAPLNTPVTEDKFGILTEKSRIPVPIIPGLPMVNHGNYIVRLGHFVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL G+VT+
Sbjct  175   GEQAEALGVEIYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHGKVTV  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LRE  N Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQMYKKYNLRE--NCQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP ++P LEGGT + Y
Sbjct  293   HTYGGSFLYHLNESEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPTVQPTLEGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG Q
Sbjct  353   GARALNEGGLQ  363


 Score =   274 bits (701),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML--------QGGSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F+ L          G +++ + +
Sbjct  369   TFPGGVLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFNQLINENLQSKTKGLHVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYSVRNIRPSCHSILGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKECTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>gb|AIO31185.1| FAD binding domain protein [Burkholderia cenocepacia]
Length=557

 Score =   374 bits (959),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (687),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 160/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  IE+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGIEQKVMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  445   PIVYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>gb|KDV26560.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
cepacia JBK9]
Length=557

 Score =   372 bits (955),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 181/308 (59%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             ++EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    INELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGAQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N + Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANAEPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (692),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDANVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_012371926.1| dehydrogenase [Burkholderia ambifaria]
 ref|YP_001815528.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
ambifaria MC40-6]
 gb|ACB67975.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
ambifaria MC40-6]
Length=557

 Score =   371 bits (953),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 181/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             ++EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    INELFPDWKERGAPLDVAVTEDRFLFLSETGAVTTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGAQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (693),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCT  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDANVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGGDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|XP_010009141.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Nestor notabilis]
Length=556

 Score =   368 bits (945),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 227/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVG GPAGLSAAIRLKQL  E N ++ VC+VEK +++GAH LSG   EPR+
Sbjct  3     RFAEEADVVIVGGGPAGLSAAIRLKQLAAEHNKEIRVCLVEKASQIGAHTLSGACLEPRS  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L++     +P     P  N GNY++ L   V WL
Sbjct  63    LEELFPDWKERGAPLNTPVTEDKFGILTEKSRIPVPIIPGLPMVNHGNYIVRLGHFVSWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL G+VT+
Sbjct  123   GEQAEALGVEIYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHGKVTV  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LRE  N Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  183   FAEGCHGHLAKQMYKKYNLRE--NCQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  240

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP ++P LEGGT + Y
Sbjct  241   HTYGGSFLYHLNESEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPTVQPTLEGGTRIAY  300

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG Q
Sbjct  301   GARALNEGGLQ  311


 Score =   274 bits (701),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML--------QGGSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F+ L          G +++ + +
Sbjct  317   TFPGGVLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFNQLINENLQSKTKGLHVQEYEE  376

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  377   NLKKSWVWKELYSVRNIRPSCHSILGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  436

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  437   PAKECTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  496

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  497   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  556



>ref|WP_034203734.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
cepacia]
 gb|AIO43586.1| FAD binding domain protein [Burkholderia cepacia]
 gb|KGC05220.1| FAD binding domain protein [Burkholderia cepacia]
Length=557

 Score =   374 bits (959),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (687),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELTAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHQHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIAYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGGERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_034174160.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
cenocepacia]
Length=557

 Score =   372 bits (955),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   270 bits (691),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHRHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGGERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_035950271.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
multivorans]
 gb|KGC03154.1| FAD binding domain protein [Burkholderia multivorans]
Length=557

 Score =   370 bits (950),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             L EL P W++   P++V V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    LTELFPDWKERGAPLNVEVTEDRFLFLSEKSAVQTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLIAKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   PDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   272 bits (696),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  R 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFRQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  IE+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGIEQKLMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VNL  YAGPE R+CPA
Sbjct  445   PIVYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDPSVPVNVNLHTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_034175548.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
cenocepacia]
Length=557

 Score =   372 bits (955),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   270 bits (691),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHRHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGGDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_006489716.1| dehydrogenase [Burkholderia cenocepacia]
 ref|YP_002153991.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia cenocepacia J2315]
 emb|CAR57541.1| putative electron transfer flavoprotein-ubiquinone oxidoreductase 
[Burkholderia cenocepacia J2315]
 gb|EPZ85181.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
cenocepacia K56-2Valvano]
 gb|ERI24604.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
cenocepacia BC7]
Length=557

 Score =   374 bits (959),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP  F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVEVTEDRFLFLSEKSAVTTPNWALPDNFKNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   269 bits (687),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHQHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIAYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGGERLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_012384737.1| electron transfer flavoprotein [Beijerinckia indica]
 ref|YP_001832869.1| electron-transferring-flavoprotein dehydrogenase [Beijerinckia 
indica subsp. indica ATCC 9039]
 gb|ACB95380.1| Electron-transferring-flavoprotein dehydrogenase [Beijerinckia 
indica subsp. indica ATCC 9039]
Length=533

 Score =   381 bits (978),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 231/307 (75%), Gaps = 8/307 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE +E+D+V+VG+GPAGLSAAI +KQL    N DLSVCV+EKG+EVGAHILSG VFEP A
Sbjct  3     REVMEFDIVVVGSGPAGLSAAIHVKQL----NKDLSVCVLEKGSEVGAHILSGAVFEPVA  58

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             LDEL+P WR    P+    + D+FL L++ RA  LP+P    N GNY+ISL  L RWL Q
Sbjct  59    LDELIPDWRHRGAPLHTEATEDRFLFLTETRAVRLPTPPLMRNHGNYIISLGNLCRWLAQ  118

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE+LGVE+YPGFAA+E+L+++   V+G+AT D+G+ KDG   EN+  GVEL+ R T+ A
Sbjct  119   QAEQLGVEIYPGFAAAEVLFDQEGAVVGVATGDLGIGKDGQPTENYTAGVELRARQTIFA  178

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL   +  +++LRE  +   QTY LG+KE+WE++  +HRPG ++HTIGWPLD+KT
Sbjct  179   EGCRGSLTRTLFERFRLREGCD--PQTYGLGLKELWEVNPERHRPGLIVHTIGWPLDNKT  236

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++  QVA+G VV L Y NP+L+P+ EFQ++K HPA+R   +GG  L YGAR 
Sbjct  237   YGGSFLYHLENNQVAVGFVVGLGYTNPYLSPFNEFQRYKTHPAVRDTFQGGRRLAYGARA  296

Query  1206  LNEGGYQ  1226
             ++ GG Q
Sbjct  297   ISAGGLQ  303


 Score =   261 bits (667),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 158/229 (69%), Gaps = 6/229 (3%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG-GSNMETFWDNLRSSWIW  1405
             FPGG ++G +AGFLNVPKIKG+HTAMKSG+ AA+S   +LQG G     +   L+ +W+W
Sbjct  310   FPGGVLVGDTAGFLNVPKIKGSHTAMKSGITAAKSVVALLQGYGRVAVGYRPALQKTWLW  369

Query  1406  KELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLPIEY  1585
             KEL   RN +PAF+ GL+P +A SA + Y+L+G +P T  H KPDH ++  A     I Y
Sbjct  370   KELSDVRNIKPAFKWGLWPAMAYSAFDTYVLRGNAPWTLHH-KPDHTSLKRASQCRQISY  428

Query  1586  PKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPARVYE  1765
             PKPD  +SFD L+SV+ +NTNH+ +QP+HLRLKD   P  VNL  Y  PE RYCPA VYE
Sbjct  429   PKPDNVLSFDRLSSVFITNTNHEENQPSHLRLKDDSVPIDVNLALYDAPEQRYCPAAVYE  488

Query  1766  YISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              +        L INAQNC+HCK CDIKDP QNI WTVPEGGGGP Y  M
Sbjct  489   IVEGP----ALRINAQNCIHCKTCDIKDPKQNIVWTVPEGGGGPNYPNM  533



>gb|KER71661.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
cepacia]
Length=557

 Score =   371 bits (953),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 181/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             ++EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    INELFPDWKERGAPLDVEVTEDRFLFLSEKSAVQTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGAQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (693),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDANVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_034199546.1| electron transfer flavoprotein-ubiquinone oxidoreductase, partial 
[Burkholderia sp. MSh2]
 gb|KEZ02729.1| electron transfer flavoprotein-ubiquinone oxidoreductase, partial 
[Burkholderia sp. MSh2]
Length=549

 Score =   374 bits (960),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK A++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  5     RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGAEIGVCVLEKGSEIGAHILSGAVMDPRA  64

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS++ A     ++LP  F+N GNYVISL  + RW
Sbjct  65    ITELFPDWKERGAPLDVEVTEDRFLFLSESSAVTTPNWALPDNFKNHGNYVISLGNVTRW  124

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  125   LGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  184

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  185   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  242

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  243   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  302

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  303   ARAITAGG  310


 Score =   268 bits (686),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  317   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  376

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  IE+ ++ G  P T +H   DHE +  A    
Sbjct  377   SWLYTELYRARNFKQWMAKGLYIGTPMVFIEQKLMGGNVPWTLRHKHADHEMLKPASQCE  436

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  437   PIVYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDANVPVNVNLHTYAGPEGRFCPA  496

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  497   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  549



>emb|CDI00877.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Candidatus 
Competibacter denitrificans Run_A_D11]
Length=544

 Score =   384 bits (986),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 230/307 (75%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE +EYDVVIVGAGP+GLSAAI+LKQL  E   D++VCV+EKG+EVGAHILSG V EPRA
Sbjct  3     RETMEYDVVIVGAGPSGLSAAIQLKQLAAEHEQDVTVCVIEKGSEVGAHILSGAVIEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             LDEL+P W++   P++ P + D+FLLL++  ++ LP+P    N GNY+ISL  L RWL  
Sbjct  63    LDELIPDWKERGAPLNTPATEDRFLLLTREISYRLPTPPQMNNHGNYIISLGNLCRWLAT  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE+YPGFAA+E+LYN+   V+G+AT DMG+ ++G   + F  G+EL+ R TL A
Sbjct  123   QAEALGVEIYPGFAAAEVLYNDEGAVVGVATGDMGIDREGHPTDQFTPGMELRARYTLFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL + +  ++ LRE  +   QTY +GIKE+WE+D  KH+ G ++HT+GWPLD  T
Sbjct  183   EGCRGSLTKTLCERFNLREGVD--PQTYGIGIKELWEVDPAKHQAGKIVHTVGWPLDPST  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYHM+  QVA+G V+ L Y NP L+P++EFQ+FK HP IRP  EGG  + YGAR 
Sbjct  241   YGGSFLYHMENNQVAVGFVIGLGYANPHLSPFDEFQRFKTHPDIRPTFEGGRRIAYGARA  300

Query  1206  LNEGGYQ  1226
             ++ GG Q
Sbjct  301   ISAGGIQ  307


 Score =   258 bits (659),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 161/233 (69%), Gaps = 5/233 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSNMETFWD---NLRSS  1396
              FPGG +IG +AGFLN+PKIKGTHTAMKSG++AA++ F  +      +   D    LR S
Sbjct  313   TFPGGLLIGDTAGFLNMPKIKGTHTAMKSGIVAADAVFAAVTADRKADEVTDYPEQLRRS  372

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+W+ELY  RN +P+F  GL+  +  SA++ Y+ +G++P TF H KPDH  + +A     
Sbjct  373   WLWRELYEVRNIKPSFSWGLWAAIGYSALDTYVFRGKAPWTFHH-KPDHTKLKKASECAK  431

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I+YPKPDG ISFD L+SV+ S+TNH+ DQP HL LKDP  P  +NL  Y  PE RYCPA 
Sbjct  432   IDYPKPDGVISFDKLSSVFISSTNHEEDQPCHLTLKDPTVPIRINLALYDAPEQRYCPAG  491

Query  1757  VYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE + D +G   +L INAQNC+HCK CDIKDPTQNI W  P+GGGGP Y  M
Sbjct  492   VYEIVRDGDGSNPRLQINAQNCVHCKTCDIKDPTQNINWVTPQGGGGPNYPNM  544



>gb|KFQ73185.1| hypothetical protein N337_04341, partial [Phoenicopterus ruber 
ruber]
Length=608

 Score =   369 bits (947),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 228/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E N ++ VC+VEK +++GAH LSG   EPR+
Sbjct  55    RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHNKEIRVCLVEKASQIGAHTLSGACLEPRS  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  115   LQELFPDWKERGAPLNTPVTEDKFGILTKKSRIPVPILPGLPMVNHGNYIVRLGHFVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  175   GEQAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  293   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  353   GARALNEGGFQ  363


 Score =   273 bits (699),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  369   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G+ P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYAVRNIRPSCHSILGVYGGMIYTGIFYWLLRGKEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLAVFDGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>gb|KFW96184.1| hypothetical protein N336_10049, partial [Phalacrocorax carbo]
Length=608

 Score =   369 bits (948),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 228/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPRA
Sbjct  55    RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACLEPRA  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L EL P W++   P+  PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  115   LQELFPDWKERGAPLKTPVTEDKFGILTKKYRIPVPILPGLPMVNHGNYIVRLGHFVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E D V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  175   GEQAEALGVEVYPGYAAAEVLFHEDDSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWSIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P L+GGT + Y
Sbjct  293   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLDGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  353   GARALNEGGFQ  363


 Score =   273 bits (698),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  369   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYAVRNIRPSCHSVLGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>ref|XP_002198937.2| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Taeniopygia guttata]
Length=650

 Score =   371 bits (953),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 231/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVV+VGAGPAGLSAAIRLKQL  E + +L VC+VEK +++GAH LSG   EPR+
Sbjct  97    RFAEEADVVVVGAGPAGLSAAIRLKQLAAEHSKELRVCLVEKASQIGAHTLSGACIEPRS  156

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L++     +P     P  N GNY++ L  LV WL
Sbjct  157   LEELFPDWKERGAPLNTPVTEDKFGILTETSRIPVPILPGLPMVNHGNYIVRLGHLVSWL  216

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  217   GEQAEALGVEIYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  276

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LRE  N Q Q+Y +G+KE+W ID +K +PG V HT+GWPLD 
Sbjct  277   FAEGCHGHLAKQLYKKYNLRE--NCQPQSYGIGLKELWTIDKSKWKPGRVEHTVGWPLDR  334

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ ER+  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  335   HTYGGSFLYHLNEREPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  394

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG Q
Sbjct  395   GARALNEGGIQ  405


 Score =   271 bits (692),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G LNVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  411   TFPGGLLIGCSPGLLNVPKIKGTHTAMKSGMLASEAIFSRLINENLQSKTIGLDVQEYEE  470

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL++SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  471   NLKNSWVWKELYAVRNIRPSCHSILGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  530

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQP HL LKD   P   NL  + GPE
Sbjct  531   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPPHLTLKDDSIPVSRNLAVFDGPE  590

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEY+  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  591   QRFCPAGVYEYVPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  650



>ref|XP_009499703.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Phalacrocorax carbo]
Length=556

 Score =   369 bits (948),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 228/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPRA
Sbjct  3     RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACLEPRA  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L EL P W++   P+  PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  63    LQELFPDWKERGAPLKTPVTEDKFGILTKKYRIPVPILPGLPMVNHGNYIVRLGHFVSWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E D V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  123   GEQAEALGVEVYPGYAAAEVLFHEDDSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  183   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWSIDEKKWKPGRVEHTVGWPLDR  240

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P L+GGT + Y
Sbjct  241   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLDGGTRIAY  300

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  301   GARALNEGGFQ  311


 Score =   273 bits (697),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  317   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  376

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  377   NLKKSWVWKELYAVRNIRPSCHSVLGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  436

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  437   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  496

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  497   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  556



>gb|EIE80316.1| hypothetical protein RO3G_05021 [Rhizopus delemar RA 99-880]
Length=612

 Score =   350 bits (899),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 220/305 (72%), Gaps = 6/305 (2%)
 Frame = +3

Query  324   EYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDEL  503
             E DVVIVG GPAGLSAAIR KQL  E+  +  V VVEK  E+GAH LSG V E RALDEL
Sbjct  70    ETDVVIVGGGPAGLSAAIRFKQLANEQGKECRVMVVEKAGEIGAHTLSGAVLETRALDEL  129

Query  504   LPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAEE  677
             +P W+++  P++ PV  D    L+K  +  LP P    NKGNY++SL+  V+WLG++AEE
Sbjct  130   IPDWKEKGAPLNTPVVHDSMRYLTKTLSIPLPHPPQMNNKGNYIVSLNNFVKWLGEQAEE  189

Query  678   LGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGCR  857
             LGVE+YPGFAAS++LY++   V G+A ND+G+ K+   K+ ++ G+++  ++T  AEGC 
Sbjct  190   LGVEIYPGFAASDVLYDDRGNVRGVALNDVGLDKNFEPKDTYERGMQVAAKMTFFAEGCH  249

Query  858   GSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGGS  1037
             GSL + ++ K+ LR++     Q Y +G+KEVWE+   KH+PG V+H++GWP+D  TYGGS
Sbjct  250   GSLTKSIVKKFDLRKESGP--QKYGIGLKEVWEVSPEKHKPGHVIHSVGWPVDMNTYGGS  307

Query  1038  FLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLN  1211
             F+YH +  +  VA+G VV L+Y NP+LNPY+ FQ FKHHP+++ LLEGG  + YGAR +N
Sbjct  308   FIYHFEADRHLVAVGYVVGLDYENPYLNPYKTFQMFKHHPSVKSLLEGGKCISYGARAIN  367

Query  1212  EGGYQ  1226
             EGGYQ
Sbjct  368   EGGYQ  372


 Score =   291 bits (746),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 173/232 (75%), Gaps = 6/232 (3%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML--QGGSNMETFWDNLRSSWI  1402
             FPGGA+IGC+AGFLNVPKIKGTHTAMKSGMLAAESAFD L  +    ++ + D +++SW+
Sbjct  379   FPGGALIGCTAGFLNVPKIKGTHTAMKSGMLAAESAFDRLFEEEVIVLDNYEDKIKNSWV  438

Query  1403  WKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             + ELY  RN  P+F    GL+ GLA S ++  +LKGR P TFKH K D E +  A  S P
Sbjct  439   YDELYQVRNVIPSFHGPLGLYGGLAYSGLDTLLLKGRVPWTFKHKKADWECMKTAAESKP  498

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I+YPKPDG ISFD+LT+V R+ TNH  +QP HLR++D K P   NL  + GPE+R+CPA 
Sbjct  499   IDYPKPDGVISFDLLTNVSRTGTNHAENQPVHLRIRDTKKPVERNLAIFDGPENRFCPAG  558

Query  1757  VYEYISDDN--GEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYT  1906
             VYEY+ D+N  GE +L IN+QNC+HCK CDIKDP+QNI WTVPEGGGGP Y 
Sbjct  559   VYEYVDDENKPGEKRLQINSQNCIHCKTCDIKDPSQNIDWTVPEGGGGPQYV  610



>ref|WP_008952700.1| electron transfer flavoprotein [Pseudogulbenkiania ferrooxidans]
 gb|EEG09664.1| Electron-transferring-flavoprotein dehydrogenase [Pseudogulbenkiania 
ferrooxidans 2002]
Length=545

 Score =   367 bits (941),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 229/309 (74%), Gaps = 6/309 (2%)
 Frame = +3

Query  306   SCREAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEP  485
             S RE+++YDVVIVG GP+GL+AAIRLKQL  +K  ++SVC++EKG+E+GAHILSG V EP
Sbjct  2     SVRESMKYDVVIVGGGPSGLTAAIRLKQLAADKGQEISVCLLEKGSEIGAHILSGAVLEP  61

Query  486   RALDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWL  659
             R L+EL+P W+ +  P++ P   D+FLLL++  +  LP+P    N+GNY+ISL    RWL
Sbjct  62    RTLNELIPDWKDKGAPLNTPAQKDQFLLLTETESIPLPTPPQMHNEGNYIISLGNFCRWL  121

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             GQ+AEELGVE+YPGFAA+E+LY+    V G+AT ++G  K+G   ++ + G+EL  R T+
Sbjct  122   GQQAEELGVEIYPGFAAAEVLYHPDGSVKGVATGNVGTGKNGD--QDGEPGIELWARQTV  179

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGCRGSL + +  ++KLR   +   QTY +GIKE+WE+    H+PG + HT GWP+D 
Sbjct  180   FAEGCRGSLTKTLFERFKLRNGAD--PQTYGIGIKELWEVKPELHQPGKITHTAGWPMDT  237

Query  1020  KTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGA  1199
              TYGGSFLYH++  QV +G VV L+Y NP+L+PYEEFQ+FK HPAIR + EGG  L YGA
Sbjct  238   ATYGGSFLYHLENNQVVVGFVVGLDYQNPYLSPYEEFQRFKTHPAIRGVFEGGRRLSYGA  297

Query  1200  RTLNEGGYQ  1226
             R ++EGG Q
Sbjct  298   RAISEGGLQ  306


 Score =   275 bits (704),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 159/234 (68%), Gaps = 5/234 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNMET--FWDNLR  1390
              FPGG +IG +AGFLNVPKIKGTHTAMKS MLAAE+  + L   Q G  +E   +    +
Sbjct  312   TFPGGVLIGDTAGFLNVPKIKGTHTAMKSAMLAAEAIVEALATAQEGQAVEASAYTARFK  371

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
              SW++ ELY  RN RPAF  GL+P +  SA++ Y+ +G++P T  H   DHE +      
Sbjct  372   QSWLYDELYRVRNIRPAFRWGLWPAMLYSALDTYLFRGKAPWTLHHKHADHECLKPKDEC  431

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI YPKPDG ++FD L+SV+ SNTNH  DQPAHL+LKDP  P  +NL +Y  PE RYCP
Sbjct  432   TPIAYPKPDGVLTFDRLSSVFISNTNHSEDQPAHLKLKDPSVPIKINLAQYDAPEQRYCP  491

Query  1751  ARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE +  + G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  492   AGVYEIVGREEGAPRLQINAQNCVHCKTCDIKDPTQNINWVTPEGGGGPNYPNM  545



>emb|CCI45445.1| unnamed protein product [Albugo candida]
Length=561

 Score =   396 bits (1018),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 238/311 (77%), Gaps = 10/311 (3%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             ++YDV++VG GPA LSAAIRLKQL  EK  DLSVCV+EKGAE+G+HI+SGNVFE RALDE
Sbjct  1     MDYDVLLVGGGPASLSAAIRLKQLSLEKGTDLSVCVIEKGAEIGSHIVSGNVFETRALDE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRWLGQ  665
             L+P W+++K P+D PV+ D FL LS+ ++     F LP    N GNYVISLS+L RWLG+
Sbjct  61    LIPDWKEKKAPLDTPVTQDSFLFLSEKKSWKLPNFLLPPQQHNLGNYVISLSKLTRWLGE  120

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AEELGVE+YPGF+A+++LY E   V GIAT D+G+ KDG  K  F  G+EL+ R TLL 
Sbjct  121   QAEELGVEIYPGFSAAQVLYREDGAVYGIATRDVGIGKDGKPKSTFARGMELRARTTLLG  180

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH--  1019
             EGCRGS +E+VI K+KLR + + Q QTY LG+KEVW I  +KH PG V HT+GWPL +  
Sbjct  181   EGCRGSCSEEVIRKFKLRGE-DTQPQTYGLGVKEVWRIPKDKHHPGLVQHTLGWPLQNKL  239

Query  1020  --KTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
               KT+GGSF+YHM+E    IGLVV L+Y NP++NPYEEFQ+FK HP+I+ +L+GG  L Y
Sbjct  240   LDKTFGGSFMYHMEEDLAQIGLVVGLDYENPYINPYEEFQRFKTHPSIKEMLDGGECLAY  299

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGGY 
Sbjct  300   GARCLNEGGYH  310


 Score =   246 bits (627),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 159/247 (64%), Gaps = 19/247 (8%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS-------------NM  1366
              FPGGA+IGC+ GFLN  KIKGTHTAMKSGMLAAE+ ++ L   +             ++
Sbjct  316   TFPGGALIGCAPGFLNSVKIKGTHTAMKSGMLAAEAVYNALASTAGESAEIDLTAPPPDI  375

Query  1367  ETFWDNLRSSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHE  1546
              ++  ++  SWI +EL   RN   AF  GL PGL  +A   +I +G+ P T  +  PD  
Sbjct  376   SSYESSVEKSWIIEELKPVRNVHAAFHYGLLPGLLHAAFSSFIARGKEPWTIPNKIPDSA  435

Query  1547  AINEAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPK---TPELVNLP  1717
                 AK   PI YPKPDG ISFD+L+++ RS TNH+HDQP HLR+K PK    P  V+ P
Sbjct  436   KTRPAKDFAPIVYPKPDGVISFDLLSNLQRSGTNHNHDQPPHLRIK-PKLASAPTQVSYP  494

Query  1718  KYAGPESRYCPARVYEYI--SDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGG  1891
              YAGPE R+CPA+VYEY   S+ NG  +L INAQNC+HCK C IK P + I WTVPEGGG
Sbjct  495   VYAGPEQRFCPAKVYEYTDGSEANGIPQLVINAQNCVHCKCCSIKTPEEYIDWTVPEGGG  554

Query  1892  GPGYTVM  1912
             GP Y +M
Sbjct  555   GPAYELM  561



>gb|KFR08684.1| hypothetical protein Y956_01058, partial [Nipponia nippon]
Length=608

 Score =   368 bits (945),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 229/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  55    RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACLEPRS  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  115   LEELFPDWKERGAPLNTPVTEDKFGILTKKFRIPVPILPGLPMVNHGNYIVRLGHFVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVELYPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  175   GEQAEALGVELYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  293   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  353   GARALNEGGFQ  363


 Score =   274 bits (700),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  369   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  +IL+G  P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYAVRNIRPSCHSVLGVYGGMIYTGIFYWILRGMEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>ref|WP_008955617.1| electron transfer flavoprotein [Pseudogulbenkiania ferrooxidans]
 gb|EEG07015.1| Electron-transferring-flavoprotein dehydrogenase [Pseudogulbenkiania 
ferrooxidans 2002]
Length=539

 Score =   363 bits (933),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 225/304 (74%), Gaps = 6/304 (2%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVG GP+GL+AAIRLKQL  EK  ++SVC++EKG+E+GAHILSG V EPR L+E
Sbjct  1     MEYDVVIVGGGPSGLTAAIRLKQLAAEKGQEISVCLLEKGSEIGAHILSGAVLEPRTLNE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAE  674
             L+P W+ +  P++ P   D+FLLL++  +  LP+P    N+GNY+ISL    RWLGQ+AE
Sbjct  61    LIPDWKDKGAPLNTPAQKDQFLLLTETESIQLPTPPQMHNEGNYIISLGNFCRWLGQQAE  120

Query  675   ELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGC  854
             ELGVE+YPGFAA+E+LY+    V G+AT ++G  K+G   ++ + G+EL  R T+ AEGC
Sbjct  121   ELGVEIYPGFAAAEVLYHPDGSVKGVATGNVGTGKNGD--QDGEPGIELWARQTVFAEGC  178

Query  855   RGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGG  1034
             RGSL + +  ++KLR   +   QTY +GIKE+WE+    H+PG + HT GWP+D  TYGG
Sbjct  179   RGSLTKTLFERFKLRNGAD--PQTYGIGIKELWEVKPELHQPGKITHTAGWPMDTATYGG  236

Query  1035  SFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNE  1214
             SFLYH++  QV +G VV L+Y NP+L+PYEEFQ+FK HPAIR + EGG  L YGAR ++E
Sbjct  237   SFLYHLENNQVVVGFVVGLDYQNPYLSPYEEFQRFKTHPAIRGVFEGGRRLSYGARAISE  296

Query  1215  GGYQ  1226
             GG Q
Sbjct  297   GGLQ  300


 Score =   278 bits (711),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 161/234 (69%), Gaps = 5/234 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNMET--FWDNLR  1390
              FPGG +IG +AGFLNVPKIKGTHTAMKS MLAAE+  + L   Q G  +E   +    +
Sbjct  306   TFPGGVLIGDTAGFLNVPKIKGTHTAMKSAMLAAEAIVEALATAQEGQAVEASAYTARFK  365

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
              SW++ ELY  RN RPAF  GL+P +  SA++ Y+ +G++P T  H   DHE +      
Sbjct  366   QSWLYDELYRVRNIRPAFRWGLWPAMLYSALDTYLFRGKAPWTLHHKHADHECLKPKDEC  425

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI YPKPDG ++FD L+SV+ SNTNH  DQPAHL+LKDP  P  +NL +Y  PE+RYCP
Sbjct  426   TPIAYPKPDGVLTFDRLSSVFISNTNHSEDQPAHLKLKDPSVPIKINLAQYDAPETRYCP  485

Query  1751  ARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE +  + GE +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  486   AGVYEIVGREEGEPRLQINAQNCVHCKTCDIKDPTQNINWVTPEGGGGPNYPNM  539



>ref|WP_026122040.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
kururiensis]
Length=557

 Score =   372 bits (956),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQ   EK  +L VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQRAAEKGVELGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             ++EL+P W+++  P+DVPV+ D+FL L++  A     ++LP  F+N+GNYV+SL+ + RW
Sbjct  73    INELIPDWKEKGAPLDVPVTEDRFLFLTETGARTVPHWALPENFKNEGNYVVSLANVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE  GVE++PGF A+E+LYNE   V G+AT +MG+ KDG   ENFQ G+EL  + T
Sbjct  133   LGQQAEAAGVEIFPGFPAAEVLYNEDGSVKGVATGNMGIGKDGQPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L  EG RG L  Q+  K+KL    +   Q Y +GIKE+WEID  KH+PG V+H+ GWPLD
Sbjct  193   LFCEGARGHLGRQLNEKFKLNR--DSDPQVYGIGIKELWEIDPAKHQPGLVIHSAGWPLD  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
              +TYGGSFLYH+   QV +G VV L Y NP+L+P+EEFQ++K HP IR  LEGG  + YG
Sbjct  251   PQTYGGSFLYHIDNNQVMVGFVVGLGYSNPYLSPFEEFQRYKTHPEIRKFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   270 bits (689),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 162/232 (70%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGG---SNMETFWDNLRSS  1396
             VFPGGA++G  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + ++ ++S
Sbjct  326   VFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRTADELTAYPESFKTS  385

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W++ EL+ ARN++     GL+ G  +  IE+ +  G  P T  H   DHE +  A    P
Sbjct  386   WLYTELHRARNFKQWMSKGLYLGTLMVGIEQKLFGGNVPWTLHHQHWDHEMLKPASQCKP  445

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             IEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKDP  P  VNL  YAGPE RYCPA 
Sbjct  446   IEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDPSVPVNVNLRTYAGPEGRYCPAA  505

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  506   VYEFVKNDDGNDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_014085823.1| electron transfer flavoprotein [Pseudogulbenkiania sp. NH8B]
 ref|YP_004845710.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Pseudogulbenkiania 
sp. NH8B]
 dbj|BAK75296.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Pseudogulbenkiania 
sp. NH8B]
Length=544

 Score =   365 bits (937),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 227/307 (74%), Gaps = 6/307 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE +EYDVVIVG GP+GLSAAIRLKQL  +K  ++SVC++EKG+E+GAHILSG V EPR 
Sbjct  3     REYMEYDVVIVGGGPSGLSAAIRLKQLAADKGQEISVCLLEKGSEIGAHILSGAVLEPRT  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             L+EL+P W+ +  P++ P   D+FLLL++  +  LP+P    N+GNY+ISL    RWLGQ
Sbjct  63    LNELIPDWKDKGAPLNTPAQKDQFLLLTETESIQLPTPPQMHNEGNYIISLGNFCRWLGQ  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AEELGVE+YPGFAA+E+LY+    V G+AT ++G  K+G   ++ + G+EL  R T+ A
Sbjct  123   QAEELGVEIYPGFAAAEVLYHPDGSVKGVATGNVGTGKNGD--QDGEPGIELWARQTVFA  180

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRGSL + +  ++ LR+  +   QTY +GIKE+WE+    H+PG + HT GWP+D  T
Sbjct  181   EGCRGSLTKTLFERFDLRKGSD--PQTYGIGIKELWEVKPELHQPGKITHTAGWPMDTAT  238

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++  QV +G VV L+Y NP+L+PYEEFQ+FK HPAIR + EGG  L YGAR 
Sbjct  239   YGGSFLYHLENNQVVVGFVVGLDYQNPYLSPYEEFQRFKTHPAIRGVFEGGRRLSYGARA  298

Query  1206  LNEGGYQ  1226
             ++EGG Q
Sbjct  299   ISEGGLQ  305


 Score =   276 bits (707),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 161/234 (69%), Gaps = 5/234 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDML---QGGSNME--TFWDNLR  1390
              FPGG +IG +AGFLNVPKIKGTHTAMKS MLAAE+  + L   Q G  +E  T+    +
Sbjct  311   TFPGGVLIGDTAGFLNVPKIKGTHTAMKSAMLAAEAIVEALASAQEGQPLEATTYTATFK  370

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
              SW++ EL+  RN RPAF  GL+P +  SA++ Y+ +G++P T  H   DHE +      
Sbjct  371   QSWLYDELHRVRNIRPAFRWGLWPAMLYSALDTYLFRGKAPWTLHHKHADHECLKPKDEC  430

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI YPKPDG ++FD L+SV+ SNTNH  DQPAHL+LKDP  P  +NL KY  PE+RYCP
Sbjct  431   TPIAYPKPDGVLTFDRLSSVFISNTNHSEDQPAHLKLKDPTVPIRINLEKYDAPETRYCP  490

Query  1751  ARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE +  + G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  491   AGVYEIVGREEGAPRLQINAQNCVHCKTCDIKDPTQNINWVTPEGGGGPNYPNM  544



>ref|XP_009473036.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Nipponia nippon]
Length=556

 Score =   368 bits (944),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 229/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  3     RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACLEPRS  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  63    LEELFPDWKERGAPLNTPVTEDKFGILTKKFRIPVPILPGLPMVNHGNYIVRLGHFVSWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVELYPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  123   GEQAEALGVELYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  183   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  240

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  241   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  300

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  301   GARALNEGGFQ  311


 Score =   274 bits (700),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  317   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  376

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  +IL+G  P T KH  PD   + 
Sbjct  377   NLKKSWVWKELYAVRNIRPSCHSVLGVYGGMIYTGIFYWILRGMEPWTLKHPGPDFAQLK  436

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  437   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  496

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  497   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  556



>gb|KFO74349.1| hypothetical protein N303_14232, partial [Cuculus canorus]
Length=608

 Score =   369 bits (947),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 229/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  55    RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACLEPRS  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  115   LEELFPDWKERGAPLNTPVTEDKFGILTKKYRIPVPILPGLPMVNHGNYIVRLGHFVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  175   GEQAEALGVEIYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQLFKKYNLREK--CQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  293   HTYGGSFLYHLNEAEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  353   GARALNEGGFQ  363


 Score =   273 bits (698),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 163/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  369   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLVNENLQSKTIGLDVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+     G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYAVRNIRPSCHTILGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>gb|KER69162.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia 
cepacia]
Length=557

 Score =   370 bits (951),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 181/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             ++EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    INELFPDWKERGAPLDVEVTEDRFLFLSEKGAVQTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGAQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (693),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCQ  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_029770445.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Pseudogulbenkiania 
sp. MAI-1]
Length=539

 Score =   365 bits (936),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 226/304 (74%), Gaps = 6/304 (2%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVG GP+GL+AAIRLKQL  EK  D+SVC++EKG+E+GAHILSG V EPR L+E
Sbjct  1     MEYDVVIVGGGPSGLTAAIRLKQLAAEKGQDISVCLLEKGSEIGAHILSGAVIEPRTLNE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQKAE  674
             L+P W+++  P++ P   D+FLLL++  +  LP+P    N+GNY+ISL    RWLGQ+AE
Sbjct  61    LIPDWKEKGAPLNTPAKKDQFLLLTETESIQLPTPPQMHNEGNYIISLGNFCRWLGQQAE  120

Query  675   ELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLAEGC  854
             ELGVE+YPGFAA+E+LY+    V G+AT ++G  K+G  +   + G+EL  + T+ AEGC
Sbjct  121   ELGVEIYPGFAAAEVLYHPDGSVKGVATGNVGTGKNGDLEG--EPGIELWAKQTIFAEGC  178

Query  855   RGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKTYGG  1034
             RGSL + +  ++KLR+  +   QTY +GIKE+WE+   KH PG + HT GWP+D  TYGG
Sbjct  179   RGSLTKTLFERFKLRDGAD--PQTYGIGIKELWEVQPEKHEPGKITHTAGWPMDTATYGG  236

Query  1035  SFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGARTLNE  1214
             SFLYH++  QV +G VV L+Y NP+L+PYEEFQ+FK HPAI+ + EGG  L YGAR ++E
Sbjct  237   SFLYHLENNQVVVGFVVGLDYQNPYLSPYEEFQRFKTHPAIKGVFEGGRRLSYGARAISE  296

Query  1215  GGYQ  1226
             GG Q
Sbjct  297   GGLQ  300


 Score =   277 bits (708),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 159/234 (68%), Gaps = 5/234 (2%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG---GSNMET--FWDNLR  1390
              FPGG +IG +AGFLNVPKIKGTHTAMKSGMLAAE+  + L     G  +E   +    R
Sbjct  306   TFPGGVLIGDTAGFLNVPKIKGTHTAMKSGMLAAEAIVEALSSAVEGQPIEATAYTAKFR  365

Query  1391  SSWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSS  1570
              SW++ EL+  RN RP+F  GL+P +  SAI+ Y+ +GR+P T  H   DHE +      
Sbjct  366   QSWLYDELHRVRNIRPSFRWGLWPAMLYSAIDTYLFRGRAPWTLHHKHADHECLKTKDEC  425

Query  1571  LPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCP  1750
              PI YPKPDG ++FD L+SV+ SNTNH  DQPAHL+LKDP  P  +NL KY  PE RYCP
Sbjct  426   EPIAYPKPDGVLTFDRLSSVFISNTNHSEDQPAHLKLKDPTVPIRINLEKYDAPEQRYCP  485

Query  1751  ARVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             A VYE +  + G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  486   AGVYEIVGREEGAPRLQINAQNCVHCKTCDIKDPTQNINWVTPEGGGGPNYPNM  539



>gb|KFV95243.1| hypothetical protein N326_11102, partial [Eurypyga helias]
Length=608

 Score =   369 bits (947),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 228/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  55    RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACLEPRS  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  115   LQELFPDWKERGAPLNTPVTEDKFGILTKKSRIPVPILPGLPMVNHGNYIVRLGHFVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  175   GEQAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LRE  N Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQLYKKYNLRE--NCQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+I+P LEGGT + Y
Sbjct  293   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSIQPTLEGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  353   GARALNEGGFQ  363


 Score =   273 bits (697),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 164/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  369   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYAVRNIRPSCHSILGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLAVFNGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>ref|XP_009556752.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Cuculus canorus]
Length=556

 Score =   369 bits (946),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 229/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  3     RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACLEPRS  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  63    LEELFPDWKERGAPLNTPVTEDKFGILTKKYRIPVPILPGLPMVNHGNYIVRLGHFVSWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  123   GEQAEALGVEIYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  183   FAEGCHGHLAKQLFKKYNLREK--CQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  240

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  241   HTYGGSFLYHLNEAEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  300

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  301   GARALNEGGFQ  311


 Score =   273 bits (698),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 163/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  317   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLVNENLQSKTIGLDVQEYEE  376

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+     G++ G+  + I  ++L+G  P T KH  PD   + 
Sbjct  377   NLKKSWVWKELYAVRNIRPSCHTILGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLK  436

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  437   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  496

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  497   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  556



>gb|KFP45177.1| hypothetical protein N324_10181, partial [Chlamydotis macqueenii]
Length=608

 Score =   367 bits (943),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 228/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  55    RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACLEPRS  114

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L EL P W++   P++ PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  115   LQELFPDWKERGAPLNTPVTEDKFGILTKKYRIPVPILPGLPMVNHGNYIVRLGHFVSWL  174

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  175   GEQAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTI  234

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  235   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  292

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  293   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  352

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  353   GARALNEGGFQ  363


 Score =   274 bits (701),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  369   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  428

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G+ P T KH  PD   + 
Sbjct  429   NLKKSWVWKELYAVRNIRPSCHSLLGVYGGMIYTGIFYWLLRGKEPWTLKHPGPDFAQLK  488

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  489   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  548

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  549   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  608



>gb|EMP24943.1| Electron transfer flavoprotein-ubiquinone oxidoreductase, partial 
[Chelonia mydas]
Length=605

 Score =   365 bits (936),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 227/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E   ++ VC+VEK A++GAH LSG   EPRA
Sbjct  52    RFAEEADVVIVGAGPAGLSAAIRLKQLANEYGKEVRVCLVEKAAQIGAHTLSGACLEPRA  111

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+ELLP W++   P+  PV+ DKF +L+KN    +P     P  N GNY++ L   V WL
Sbjct  112   LEELLPDWKERGAPLQTPVTEDKFGILTKNSRIPVPVLPGLPMTNHGNYIVRLGHFVNWL  171

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT 
Sbjct  172   GEQAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKAIFERGLELHAKVTF  231

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  +Y LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  232   FAEGCHGHLAKQLYNRYNLREK--CQPQSYGIGLKELWLIDEKKWKPGRVEHTVGWPLDR  289

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+L+P++EFQ++KHHP+++P  EGG  + Y
Sbjct  290   HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLSPFKEFQRWKHHPSVQPTFEGGKRIAY  349

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  350   GARALNEGGFQ  360


 Score =   277 bits (708),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 165/240 (69%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS GF+NVPKIKGTHTAMKSGMLA+E+ F+ L          G ++  + +
Sbjct  366   TFPGGVLIGCSPGFMNVPKIKGTHTAMKSGMLASEAVFNQLTNENLQSKTIGLDVPEYEE  425

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+     G++ G+  + I  +IL+G  P T KH  PD + + 
Sbjct  426   NLKKSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWILRGMEPWTLKHPGPDSDQLK  485

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQP HL LKD   P   NL  Y GPE
Sbjct  486   PAKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPPHLTLKDDSVPVNKNLAIYDGPE  545

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEY+  + GE ++L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  546   QRFCPAGVYEYVPLETGEGLRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  605



>ref|WP_011351769.1| dehydrogenase [Burkholderia lata]
 ref|YP_368846.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
lata]
 gb|ABB08202.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
lata]
Length=557

 Score =   371 bits (952),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 181/308 (59%), Positives = 227/308 (74%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             ++EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    INELFPDWKERGAPLDVEVTEDRFLFLSEKGAVTTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGAQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N + Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANAEPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   270 bits (691),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDANVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_036168071.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Massilia 
sp. 9096]
Length=558

 Score =   374 bits (960),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 179/310 (58%), Positives = 229/310 (74%), Gaps = 7/310 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             REA+EYDVVIVG GPAGLSAAIRLKQL  E+  ++SVCV+EKG E+GAHILSG V +PRA
Sbjct  14    REAMEYDVVIVGGGPAGLSAAIRLKQLAGEQGKEVSVCVLEKGGELGAHILSGAVMDPRA  73

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFS-----LPSPFENKGNYVISLSQLVRW  656
             L+EL P W++   P++ PVS D+ L L++ ++++     +PS   N GN+V+SL  +VRW
Sbjct  74    LNELFPNWKELGAPLNTPVSEDRVLFLTETKSYATPHAMVPSALNNTGNFVVSLGNVVRW  133

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LGQ+AE LGVE++PGF A+E+LYNE   V G+AT +MGV + G   ENFQ G+EL  + T
Sbjct  134   LGQQAEALGVEIFPGFPAAEVLYNEDGSVKGVATGNMGVNRHGQPTENFQLGMELHAKYT  193

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEG RG L +Q+I  Y L +KG    QTY +GIKE+WEI+  KH+PG V+HT GWPLD
Sbjct  194   LFAEGSRGHLGKQLIANYAL-DKGK-DPQTYGIGIKELWEINPAKHQPGLVIHTAGWPLD  251

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYH++  QVA+G VV L Y NP+L+PYEEFQ++K HPAIR   EGG  + YG
Sbjct  252   ADTYGGSFLYHLENNQVAVGFVVGLAYQNPYLSPYEEFQRYKTHPAIRGFFEGGKRISYG  311

Query  1197  ARTLNEGGYQ  1226
             AR +  GG Q
Sbjct  312   ARAITAGGLQ  321


 Score =   268 bits (684),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IGC AGFLNV +IKG+H A+K+GMLAA++AF  LQ G     + ++      
Sbjct  326   TVFPGGALIGCDAGFLNVSRIKGSHGAVKTGMLAADAAFAALQEGRQYDELSSYPAAFEQ  385

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+ +ELY ARN++P    GL  G  ++ I++ + KGR+P T  H   DHE +  A    
Sbjct  386   SWLREELYVARNFKPWMGKGLKLGTVMTGIDQIVFKGRAPWTLHHQHADHECLRPAADYK  445

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH  DQP HL LK+P  P  +NLPK+AGPE RYCPA
Sbjct  446   PIVYPKPDGKLTFDRLSSVFISNTNHAEDQPVHLLLKNPAVPVEINLPKFAGPEQRYCPA  505

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYEY+  D G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  506   GVYEYVKTDEGNDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  558



>emb|CCQ75325.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Magnetospira 
sp. QH-2]
Length=545

 Score =   365 bits (936),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 180/307 (59%), Positives = 230/307 (75%), Gaps = 4/307 (1%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++E+DVVIVGAGPAGL+AAIRL QL  E   + +VCVVEKG+EVGAHILSG V E R+
Sbjct  3     RESMEFDVVIVGAGPAGLAAAIRLMQLASEAGREQTVCVVEKGSEVGAHILSGAVIETRS  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPSP--FENKGNYVISLSQLVRWLGQ  665
             LDELLP W++   P+   V+ DKF+ LS   A  L +P    N+GNY++SL  L RWLG+
Sbjct  63    LDELLPDWKEMGAPMTTLVTDDKFMYLSSGAATKLVTPPQMHNEGNYIVSLGNLCRWLGE  122

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE++PGFAA+E+L ++   VIG+ T DMG  +DGS   NF+ GV+LK + T  A
Sbjct  123   QAEALGVEIFPGFAAAEVLVDDDGAVIGVGTGDMGRLRDGSEGPNFEPGVDLKAKYTFFA  182

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EGCRG L  Q++ K+ LR   +   QTY LGIKE+WE+D+  H+PG VLHT+GWPLD KT
Sbjct  183   EGCRGHLGRQLMDKFDLR--ADCDVQTYGLGIKELWEVDSKDHKPGTVLHTVGWPLDTKT  240

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH+ + QVA+G V+ L+Y NP+L+PY+EFQ+FK HPAI PL EGG  + YGAR 
Sbjct  241   YGGSFLYHLDDNQVAVGFVIGLDYPNPYLSPYDEFQRFKTHPAIAPLFEGGRRIAYGARA  300

Query  1206  LNEGGYQ  1226
             LNEGG+Q
Sbjct  301   LNEGGFQ  307


 Score =   277 bits (708),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 164/234 (70%), Gaps = 6/234 (3%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGS---NMETFWDNLRSS  1396
              FPGG +IGC AGFLNVPKIKGTHTAMK+GMLAAESAF  L G      + T+ D +++S
Sbjct  313   TFPGGVLIGCDAGFLNVPKIKGTHTAMKTGMLAAESAFAALDGEDGPKELTTYADAVKAS  372

Query  1397  WIWKELYHARNYRPAFEN-GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             W+W ELY ARN RP+F   GL+ G+A SA + Y+ KG++  TF H   D EA+  A    
Sbjct  373   WVWDELYRARNIRPSFAKWGLWGGIAYSATDTYVFKGKASWTFNH-HSDREALKPAAGQK  431

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD LT+V  S+TNH+ DQP HLRL D   P  VN+  YAGPE R+CPA
Sbjct  432   PIAYPKPDGKLTFDKLTNVAFSSTNHEEDQPCHLRLADEAIPLAVNMATYAGPEVRFCPA  491

Query  1754  RVYEYISDDN-GEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ D+  G  +L INAQNC+HCK CDIKDP+ NI W  PEGGGGP Y  M
Sbjct  492   GVYEFLDDEEGGGQRLQINAQNCVHCKTCDIKDPSGNITWVAPEGGGGPNYPNM  545



>ref|WP_012363721.1| dehydrogenase [Burkholderia ambifaria]
 ref|YP_001808090.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
ambifaria MC40-6]
 gb|ACB63874.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
ambifaria MC40-6]
Length=557

 Score =   370 bits (950),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 181/308 (59%), Positives = 225/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             + EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    ITELFPDWKERGAPLDVAVTEDRFLFLSETGAVTTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGAQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (693),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCT  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE+R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGGDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|XP_009981915.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Tauraco erythrolophus]
Length=556

 Score =   367 bits (942),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 227/311 (73%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVVIVGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  3     RFAEEADVVIVGAGPAGLSAAIRLKQLAAEHSKEIRVCLVEKASQIGAHTLSGACIEPRS  62

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L EL P W++   P+  PV+ DKF +L+K     +P     P  N GNY++ L   V WL
Sbjct  63    LQELFPDWKERGAPLKTPVTEDKFGILTKKSRIPVPILPGLPMVNHGNYIVRLGHFVSWL  122

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  123   GEQAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  182

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LREK   Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  183   FAEGCHGHLAKQLYKKYNLREK--CQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  240

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  241   HTYGGSFLYHLNEDEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  300

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG+Q
Sbjct  301   GARALNEGGFQ  311


 Score =   275 bits (702),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 163/240 (68%), Gaps = 11/240 (5%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWD  1381
              FPGG +IGCS G +NVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +
Sbjct  317   TFPGGLLIGCSPGLMNVPKIKGTHTAMKSGMLASEAIFSQLINENLQSKTIGLDVQEYEE  376

Query  1382  NLRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAIN  1555
             NL+ SW+WKELY  RN RP+     G++ G+  + I  +IL+G  P T KH  PD   + 
Sbjct  377   NLKKSWVWKELYAVRNIRPSCHTVLGVYGGMIYTGIFYWILRGMEPWTLKHPGPDFAQLK  436

Query  1556  EAKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPE  1735
              AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE
Sbjct  437   PAKECTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVSRNLAVFDGPE  496

Query  1736  SRYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              R+CPA VYEYI  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  497   QRFCPAGVYEYIPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  556



>ref|XP_005045087.1| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, 
mitochondrial [Ficedula albicollis]
Length=628

 Score =   368 bits (945),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 173/311 (56%), Positives = 229/311 (74%), Gaps = 8/311 (3%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             R A E DVV+VGAGPAGLSAAIRLKQL  E + ++ VC+VEK +++GAH LSG   EPR+
Sbjct  75    RFAEEADVVVVGAGPAGLSAAIRLKQLAAEHSKEVRVCLVEKASQIGAHTLSGACIEPRS  134

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRAFSLPS----PFENKGNYVISLSQLVRWL  659
             L+EL P W++   P++ PV+ DKF +L++     +P     P  N GNY++ L  LV WL
Sbjct  135   LEELFPDWKERGAPLNTPVTEDKFGILTETSRIPVPILPGLPMANHGNYIVRLGHLVSWL  194

Query  660   GQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTL  839
             G++AE LGVE+YPG+AA+E+L++E   V GIATND+G+ KDG+ K  F+ G+EL  +VT+
Sbjct  195   GEQAEALGVEIYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTV  254

Query  840   LAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDH  1019
              AEGC G LA+Q+  KY LRE  N Q Q+Y +G+KE+W ID  K +PG V HT+GWPLD 
Sbjct  255   FAEGCHGHLAKQLYKKYNLRE--NCQPQSYGIGLKELWTIDEKKWKPGRVEHTVGWPLDR  312

Query  1020  KTYGGSFLYHMKERQ--VAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQY  1193
              TYGGSFLYH+ E +  VA+G VV L+Y NP+LNP+ EFQ++KHHP+++P LEGGT + Y
Sbjct  313   HTYGGSFLYHLNEHEPLVALGFVVGLDYQNPYLNPFREFQRWKHHPSVQPTLEGGTRIAY  372

Query  1194  GARTLNEGGYQ  1226
             GAR LNEGG Q
Sbjct  373   GARALNEGGIQ  383


 Score =   273 bits (698),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 164/239 (69%), Gaps = 11/239 (5%)
 Frame = +2

Query  1229  FPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQG--------GSNMETFWDN  1384
             FPGG +IGCS G LNVPKIKGTHTAMKSGMLA+E+ F  L          G +++ + +N
Sbjct  390   FPGGLLIGCSPGLLNVPKIKGTHTAMKSGMLASEAIFPQLINENLQSKTIGLDVQEYEEN  449

Query  1385  LRSSWIWKELYHARNYRPAFEN--GLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINE  1558
             L+ SW+WKELY  RN RP+  +  G++ G+  + I  ++L+G  P T KH  PD   +  
Sbjct  450   LKKSWVWKELYAVRNIRPSCHSVLGVYGGMIYTGIFYWLLRGMEPWTLKHPGPDFAQLKP  509

Query  1559  AKSSLPIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPES  1738
             AK   PIEYPKPDG ISFD+L+SV  S TNH+HDQPAHL LKD   P   NL  + GPE 
Sbjct  510   AKDCTPIEYPKPDGKISFDLLSSVALSGTNHEHDQPAHLTLKDDSVPVSRNLAVFDGPEQ  569

Query  1739  RYCPARVYEYISDDNGE-VKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             R+CPA VYEY+  + GE  +L INAQNC+HCK CDIKDP+QNI W VPEGGGGP Y  M
Sbjct  570   RFCPAGVYEYVPLETGEGSRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  628



>ref|WP_020702680.1| dehydrogenase [Oxalobacteraceae bacterium AB_14]
Length=542

 Score =   371 bits (952),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 229/307 (75%), Gaps = 7/307 (2%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVG GPAGLSAAI++KQL  EK  ++SV V+EKG E+GAHILSG V +P+AL E
Sbjct  1     MEYDVVIVGGGPAGLSAAIKIKQLAAEKGQEVSVVVLEKGGELGAHILSGAVMDPKALTE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRWLGQ  665
             L+P W+++  P++  V+ D+ L L++ +A     F LP+ FEN GNYVISL  +VRWLGQ
Sbjct  61    LIPDWKEKGAPLNTAVTEDRVLFLTETKAIKTPNFLLPACFENHGNYVISLGNVVRWLGQ  120

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE++PGF A+EILYN++  V G+AT +MGV +DG    +FQ G+EL G+ TL A
Sbjct  121   QAEALGVEIFPGFPAAEILYNDNGSVKGVATGNMGVKRDGEAGSDFQLGMELHGKYTLFA  180

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EG RG L +Q++ KY L  KG    Q+Y +GIKE+WEID  KH+PG V+HT GWPLD KT
Sbjct  181   EGARGHLGKQLMAKYDLN-KGK-DPQSYGIGIKELWEIDPAKHQPGLVVHTTGWPLDSKT  238

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++  QV +G VV LNY NP+L+PYEEFQ++K HPAI+   EGG  + YGAR 
Sbjct  239   YGGSFLYHLENNQVMVGYVVGLNYENPYLSPYEEFQRYKTHPAIKTFFEGGKRISYGARA  298

Query  1206  LNEGGYQ  1226
             +  GG Q
Sbjct  299   ITAGGLQ  305


 Score =   270 bits (691),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 160/232 (69%), Gaps = 3/232 (1%)
 Frame = +2

Query  1226  VFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRSS  1396
             VFPGGA+IGC AGFLN+ +IKG+H A+KSGMLAA SAF+ L  G     + +F      S
Sbjct  311   VFPGGALIGCDAGFLNMSRIKGSHAAIKSGMLAAASAFEALGAGRQHDELASFPAAFEQS  370

Query  1397  WIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSLP  1576
             W+ +EL  ARN +P    GL+ G  ++ +++ IL+G++P T  H   DHE +  A    P
Sbjct  371   WLHEELQVARNVKPWLSKGLYLGSVMTYVDQAILRGKAPWTLHHSHADHECLKPAAQFTP  430

Query  1577  IEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPAR  1756
             I YPK DG ++FD L+SV+ SNTNH  DQP HL LK+P  P  VNL +YAGPE+RYCPA 
Sbjct  431   ISYPKADGKLTFDRLSSVFISNTNHAEDQPIHLTLKNPSVPVDVNLAQYAGPEARYCPAG  490

Query  1757  VYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
             VYE++  D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  491   VYEFVKTDDGADRLQINAQNCVHCKTCDIKDPTQNIVWITPEGGGGPNYPNM  542



>ref|WP_011349563.1| dehydrogenase [Burkholderia lata]
 ref|YP_366563.1| electron-transferring-flavoprotein dehydrogenase [Burkholderia 
lata]
 gb|ABB05919.1| Electron-transferring-flavoprotein dehydrogenase [Burkholderia 
lata]
Length=557

 Score =   370 bits (951),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 181/308 (59%), Positives = 226/308 (73%), Gaps = 7/308 (2%)
 Frame = +3

Query  312   REAIEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRA  491
             RE++EYDVVIVG GPAGLSAAIRLKQL  EK  ++ VCV+EKG+E+GAHILSG V +PRA
Sbjct  13    RESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGAHILSGAVMDPRA  72

Query  492   LDELLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRW  656
             ++EL P W++   P+DV V+ D+FL LS+  A     ++LP+ F+N GNYVISL  + RW
Sbjct  73    INELFPDWKERGAPLDVEVTEDRFLFLSEKGAVTTPNWALPANFQNHGNYVISLGNVTRW  132

Query  657   LGQKAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVT  836
             LG +AE LGVE++PGF A+EILYN+   V G+AT +MGV KDG   ENFQ G+EL  + T
Sbjct  133   LGAQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTENFQLGMELHAKYT  192

Query  837   LLAEGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLD  1016
             L AEGCRG L  Q+I K+KL    N   Q Y +GIKE+WEID  KH+PG V+HT GWPL 
Sbjct  193   LFAEGCRGHLGRQLISKFKL--DANADPQAYGIGIKELWEIDPAKHKPGLVIHTAGWPLK  250

Query  1017  HKTYGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYG  1196
               TYGGSFLYHM   QV +G VV L Y NP+L+P+EEFQ++K HP+IR  LEGG  + YG
Sbjct  251   SDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAFLEGGKRVSYG  310

Query  1197  ARTLNEGG  1220
             AR +  GG
Sbjct  311   ARAITAGG  318


 Score =   271 bits (692),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IG  AGFLN  +IKG+H A+K+GMLAA++AFD +Q G     +  + D  + 
Sbjct  325   TVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNVYPDAFKQ  384

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW++ ELY ARN++     GL+ G  +  +E+ ++ G  P T  H   DHE +  A    
Sbjct  385   SWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMGGNVPWTLHHKHADHEMLKPASQCE  444

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PIEYPKPDG ++FD L+SV+ SNTNH+ +QPAHL LKD   P  VNL  YAGPE R+CPA
Sbjct  445   PIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTLKDANVPVNVNLRTYAGPEGRFCPA  504

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G  +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  505   AVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  557



>ref|WP_036206833.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Massilia 
sp. LC238]
Length=542

 Score =   370 bits (949),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 227/307 (74%), Gaps = 7/307 (2%)
 Frame = +3

Query  321   IEYDVVIVGAGPAGLSAAIRLKQLCREKNADLSVCVVEKGAEVGAHILSGNVFEPRALDE  500
             +EYDVVIVG GPAGLSAAIRLKQL  EK  ++SVCV+EKG E+GAHILSG V +P AL+E
Sbjct  1     MEYDVVIVGGGPAGLSAAIRLKQLAAEKGQEVSVCVLEKGGELGAHILSGAVMDPIALNE  60

Query  501   LLPQWRQEKTPIDVPVSSDKFLLLSKNRA-----FSLPSPFENKGNYVISLSQLVRWLGQ  665
             L+P W+++  P++  V+ D+ LLL++ RA     F +P    N GNYVISL+ + RWLGQ
Sbjct  61    LIPDWKEKGAPLNTAVTEDQVLLLTETRAIKTPNFMVPKMLTNHGNYVISLANVTRWLGQ  120

Query  666   KAEELGVELYPGFAASEILYNESDEVIGIATNDMGVAKDGSRKENFQHGVELKGRVTLLA  845
             +AE LGVE++PGF A+E+LYNE   V G+AT +MGV +DG    +FQ G+EL  + TL A
Sbjct  121   QAEALGVEIFPGFPAAEVLYNEDGSVKGVATGNMGVKRDGEPGPDFQLGMELHAKYTLFA  180

Query  846   EGCRGSLAEQVIGKYKLREKGNGQHQTYALGIKEVWEIDANKHRPGDVLHTIGWPLDHKT  1025
             EG RG L +Q++ KY L  KG    QTY +GIKE+WEID +KH+PG V+HT GWPLD+ T
Sbjct  181   EGSRGHLGKQLMAKYDLN-KGK-DPQTYGIGIKELWEIDPSKHKPGLVIHTAGWPLDNDT  238

Query  1026  YGGSFLYHMKERQVAIGLVVALNYHNPFLNPYEEFQKFKHHPAIRPLLEGGTVLQYGART  1205
             YGGSFLYH++  QVA+G VV L Y NP+L+PYEEFQ++K HPAIR   EGG  + YGAR 
Sbjct  239   YGGSFLYHLENNQVAVGFVVGLAYQNPYLSPYEEFQRYKTHPAIRHYFEGGKRISYGARA  298

Query  1206  LNEGGYQ  1226
             +  GG Q
Sbjct  299   ITAGGLQ  305


 Score =   271 bits (694),  Expect(2) = 4e-174, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 162/233 (70%), Gaps = 3/233 (1%)
 Frame = +2

Query  1223  SVFPGGAVIGCSAGFLNVPKIKGTHTAMKSGMLAAESAFDMLQGGSN---METFWDNLRS  1393
             +VFPGGA+IGC AGFLN  +IKG+H A+K+GMLAAESAF  L  G     + ++      
Sbjct  310   TVFPGGALIGCDAGFLNTSRIKGSHAAIKTGMLAAESAFAALGEGRQHDELASYPAAFEK  369

Query  1394  SWIWKELYHARNYRPAFENGLFPGLALSAIERYILKGRSPLTFKHGKPDHEAINEAKSSL  1573
             SW+ +EL+ ARN++P    GL+ G  ++ I++ + +G++P T  H   DHE +  A    
Sbjct  370   SWLHEELHVARNFKPWMSKGLYIGTIMTGIDQMVFRGKAPWTLHHQHADHECLKPASQFK  429

Query  1574  PIEYPKPDGAISFDILTSVYRSNTNHDHDQPAHLRLKDPKTPELVNLPKYAGPESRYCPA  1753
             PI YPKPDG ++FD L+SV+ SNTNH  DQP HL LK+   P  VNL KYAGPE RYCPA
Sbjct  430   PIAYPKPDGKLTFDRLSSVFISNTNHAEDQPIHLTLKNAAIPVDVNLAKYAGPEQRYCPA  489

Query  1754  RVYEYISDDNGEVKLNINAQNCLHCKACDIKDPTQNIKWTVPEGGGGPGYTVM  1912
              VYE++ +D+G+ +L INAQNC+HCK CDIKDPTQNI W  PEGGGGP Y  M
Sbjct  490   GVYEFVKNDDGQDRLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM  542



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6469852911870