BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25118_g1_i2 len=1706 path=[1:0-400 402:401-469 471:470-586
588:587-719 721:720-746 748:747-796 798:797-874 876:875-917
919:918-941 943:942-1071 1073:1072-1096 1098:1097-1146
1148:1147-1150 1152:1151-1179 1181:1180-1267 1269:1268-1318
1320:1319-1321 1323:1322-1357 1359:1358-1437 1439:1438-1560
1562:1561-1598 1600:1599-1624 1626:1625-1630 1632:1631-1705]

Length=1706
                                                                      Score     E

ref|XP_009619039.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    638   0.0      
ref|XP_009766247.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    637   0.0      
ref|XP_006363138.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    613   0.0      
emb|CDP02807.1|  unnamed protein product                                611   0.0      
ref|XP_004233715.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    605   0.0      
ref|XP_011097210.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    570   0.0      
ref|XP_009622863.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    548   0.0      
gb|EYU28575.1|  hypothetical protein MIMGU_mgv1a005593mg                546   0.0      
ref|XP_009608461.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    546   0.0      
ref|XP_009759972.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    539   0.0      
ref|XP_009623100.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    535   0.0      
ref|XP_009768026.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    535   0.0      
ref|XP_009758472.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    523   3e-177   
emb|CDP02806.1|  unnamed protein product                                520   1e-176   
ref|XP_004233506.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    515   1e-174   
gb|AIL51397.1|  glycosyltransferase                                     506   4e-171   
gb|AIE12490.1|  UGT2                                                    501   6e-170   
gb|KCW58588.1|  hypothetical protein EUGRSUZ_H01247                     496   6e-167   
ref|XP_010070032.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    495   8e-167   
ref|XP_002264323.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    494   2e-166   Vitis vinifera
ref|XP_009349753.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    491   4e-165   
gb|KHN24740.1|  Anthocyanidin 3-O-glucosyltransferase 5                 489   1e-164   
ref|XP_002269179.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    489   2e-164   Vitis vinifera
ref|XP_011025718.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    488   4e-164   
ref|XP_002310202.1|  UTP-glucose glucosyltransferase family protein     488   6e-164   Populus trichocarpa [western balsam poplar]
ref|XP_003527240.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    488   7e-164   
sp|Q40287.1|UFOG5_MANES  RecName: Full=Anthocyanidin 3-O-glucosyl...    488   9e-164   Manihot esculenta [manioc]
ref|XP_010070031.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    487   2e-163   
ref|XP_004300603.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    486   3e-163   
ref|XP_010070027.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    485   1e-162   
ref|XP_009349754.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    484   1e-162   
ref|XP_010649186.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    483   2e-162   
ref|XP_007203879.1|  hypothetical protein PRUPE_ppa005112mg             483   4e-162   
ref|XP_007047010.1|  UDP-glucosyl transferase 72E1, putative            483   5e-162   
ref|XP_002268983.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    484   5e-162   Vitis vinifera
ref|XP_006425733.1|  hypothetical protein CICLE_v10025490mg             483   5e-162   
ref|XP_007157762.1|  hypothetical protein PHAVU_002G096500g             483   6e-162   
ref|XP_008393333.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    483   7e-162   
ref|XP_010649185.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    484   7e-162   
gb|KDO79471.1|  hypothetical protein CISIN_1g043859mg                   481   2e-161   
ref|XP_010070028.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    479   2e-160   
ref|XP_006346992.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    477   4e-160   
ref|XP_010070029.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    478   8e-160   
ref|XP_008393335.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    477   9e-160   
ref|XP_009349752.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    477   1e-159   
ref|XP_010070030.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    477   2e-159   
ref|XP_008338776.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    475   6e-159   
gb|KDP31803.1|  hypothetical protein JCGZ_12264                         474   1e-158   
ref|XP_009374237.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    473   4e-158   
ref|XP_010026160.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    471   4e-157   
ref|XP_003629205.1|  Anthocyanidin 3-O-glucosyltransferase              471   5e-157   
gb|EPS66787.1|  hypothetical protein M569_07987                         470   7e-157   
gb|AGU14106.1|  UDP-glycosyltransferase                                 469   1e-156   
ref|XP_002310203.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    469   1e-156   Populus trichocarpa [western balsam poplar]
emb|CBI25658.3|  unnamed protein product                                467   4e-156   
gb|ADL67595.1|  glycosyltransferase 1                                   468   6e-156   
ref|XP_006425732.1|  hypothetical protein CICLE_v10027249mg             466   1e-155   
gb|KHN45581.1|  Anthocyanidin 3-O-glucosyltransferase 5                 464   7e-155   
ref|XP_002273356.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    465   1e-154   Vitis vinifera
ref|XP_007047012.1|  Anthocyanidin 3-O-glucosyltransferase 5            463   2e-154   
ref|XP_007047009.1|  UDP-glucosyl transferase 72E1, putative            462   1e-153   
emb|CBI24504.3|  unnamed protein product                                461   1e-153   
gb|KDO79472.1|  hypothetical protein CISIN_1g011608mg                   460   5e-153   
emb|CAN77173.1|  hypothetical protein VITISV_035786                     461   6e-153   Vitis vinifera
ref|XP_002310204.2|  hypothetical protein POPTR_0007s12410g             459   2e-152   Populus trichocarpa [western balsam poplar]
ref|XP_011025719.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    456   2e-151   
gb|ADL67596.1|  glycosyltransferase 2                                   453   2e-150   
ref|XP_008241631.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    451   4e-150   
ref|XP_011025720.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    452   4e-150   
ref|XP_008453746.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    449   1e-148   
ref|XP_003526037.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    449   1e-148   
ref|XP_010026164.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       448   2e-148   
ref|XP_010040922.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       447   3e-148   
ref|XP_007203198.1|  hypothetical protein PRUPE_ppa025290mg             447   7e-148   
gb|KCW58591.1|  hypothetical protein EUGRSUZ_H01251                     446   1e-147   
gb|KDP31802.1|  hypothetical protein JCGZ_12263                         445   2e-147   
ref|XP_008241632.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    445   4e-147   
ref|XP_007047008.1|  Anthocyanidin 3-O-glucosyltransferase 5, put...    444   5e-147   
emb|CBI17565.3|  unnamed protein product                                446   6e-147   
ref|XP_010026163.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       444   8e-147   
ref|XP_007047011.1|  UDP-glucosyl transferase 72E1, putative            442   4e-146   
ref|XP_004301883.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    442   7e-146   
ref|XP_010040924.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       440   2e-145   
gb|ADL67597.1|  glycosyltransferase 3                                   439   3e-145   
ref|XP_010070034.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       438   2e-144   
ref|XP_006404007.1|  hypothetical protein EUTSA_v10010324mg             438   2e-144   
ref|XP_010099823.1|  Anthocyanidin 3-O-glucosyltransferase 5            436   7e-144   
ref|XP_010558128.1|  PREDICTED: UDP-glycosyltransferase 72E1            436   1e-143   
ref|XP_004165853.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    435   2e-143   
ref|XP_004149165.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    435   2e-143   
gb|KDO79473.1|  hypothetical protein CISIN_1g011099mg                   436   2e-143   
ref|XP_010070033.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       435   3e-143   
ref|XP_002281768.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    435   3e-143   Vitis vinifera
ref|XP_010667699.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    435   3e-143   
gb|AFJ52924.1|  UDP-glycosyltransferase 1                               435   5e-143   
ref|XP_006425731.1|  hypothetical protein CICLE_v10025462mg             434   6e-143   
ref|NP_566938.1|  UDP-glucosyl transferase 72E1                         434   6e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877765.1|  UDP-glucosyl transferase 72E1                      434   1e-142   
ref|XP_004238231.1|  PREDICTED: hydroquinone glucosyltransferase        430   2e-141   
emb|CAB42903.1|  UTP-glucose glucosyltransferase like protein           430   3e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006475483.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       430   5e-141   
gb|AFJ52925.1|  UDP-glycosyltransferase 1                               430   6e-141   
ref|XP_006451504.1|  hypothetical protein CICLE_v10008085mg             429   9e-141   
ref|XP_007156903.1|  hypothetical protein PHAVU_002G026900g             428   1e-140   
ref|XP_010507375.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       428   2e-140   
ref|XP_010431232.1|  PREDICTED: UDP-glycosyltransferase 72E1            427   4e-140   
ref|XP_006293138.1|  hypothetical protein CARUB_v10019444mg             425   2e-139   
ref|XP_009136555.1|  PREDICTED: UDP-glycosyltransferase 72E1            424   4e-139   
gb|KFK28349.1|  hypothetical protein AALP_AA8G504500                    424   5e-139   
ref|XP_006393862.1|  hypothetical protein EUTSA_v10005518mg             424   6e-139   
ref|XP_006367304.1|  PREDICTED: hydroquinone glucosyltransferase-...    423   1e-138   
gb|KFK34320.1|  hypothetical protein AALP_AA5G129700                    423   1e-138   
ref|XP_010040925.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    422   3e-138   
ref|XP_009349755.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    422   5e-138   
ref|XP_006404008.1|  hypothetical protein EUTSA_v10010327mg             421   6e-138   
ref|XP_006375073.1|  hypothetical protein POPTR_0014s04130g             421   8e-138   
ref|XP_009136554.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       421   8e-138   
gb|KFK24026.1|  hypothetical protein AALP_AAs56878U000200               421   1e-137   
emb|CDP07557.1|  unnamed protein product                                420   2e-137   
gb|KCW44779.1|  hypothetical protein EUGRSUZ_L01660                     421   2e-137   
gb|AFJ52922.1|  UDP-glycosyltransferase 1                               419   5e-137   
gb|AFJ52921.1|  UDP-glycosyltransferase 1                               419   5e-137   
ref|XP_004301886.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    417   4e-136   
ref|XP_007047015.1|  Anthocyanidin 3-O-glucosyltransferase 5            416   5e-136   
ref|XP_006387833.1|  hypothetical protein POPTR_0535s00230g             415   8e-136   
ref|XP_011031500.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    415   1e-135   
gb|ADV71360.1|  glycosyltransferase GT01K01                             415   2e-135   
ref|XP_002866746.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    415   2e-135   
gb|KCW58582.1|  hypothetical protein EUGRSUZ_H01240                     409   1e-134   
ref|NP_201470.1|  UDP-glycosyltransferase 72E2                          412   2e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004301887.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    411   5e-134   
ref|NP_198003.1|  UDP-glycosyltransferase 72E3                          410   8e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004301885.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    410   9e-134   
ref|XP_008338753.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    409   2e-133   
ref|XP_009782200.1|  PREDICTED: hydroquinone glucosyltransferase-...    410   2e-133   
ref|XP_003611938.1|  UDP-glucuronosyltransferase 1-6                    410   3e-133   
ref|XP_004293221.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    408   9e-133   
ref|XP_006495100.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    407   1e-132   
ref|XP_006433446.1|  hypothetical protein CICLE_v10001013mg             407   2e-132   
ref|XP_009112325.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    406   6e-132   
gb|KGN48805.1|  hypothetical protein Csa_6G501940                       405   1e-131   
ref|XP_010465049.1|  PREDICTED: UDP-glycosyltransferase 72E3 isof...    405   2e-131   
ref|XP_006573595.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       405   3e-131   
ref|XP_004160164.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       404   3e-131   
ref|XP_006280388.1|  hypothetical protein CARUB_v10026316mg             403   7e-131   
gb|AAM62659.1|  UTP-glucose glucosyltransferase                         403   8e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153279.1|  hypothetical protein PHAVU_003G021900g             402   1e-130   
ref|XP_006434938.1|  hypothetical protein CICLE_v10001016mg             400   6e-130   
ref|XP_009103497.1|  PREDICTED: UDP-glycosyltransferase 72E3            401   6e-130   
gb|KHN24742.1|  Anthocyanidin 3-O-glucosyltransferase 5                 397   1e-129   
gb|KDO40224.1|  hypothetical protein CISIN_1g046326mg                   399   2e-129   
ref|NP_849978.2|  UDP-glycosyltransferase 72D1                          397   7e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409132.1|  hypothetical protein EUTSA_v10022671mg             397   2e-128   
ref|XP_010534239.1|  PREDICTED: UDP-glycosyltransferase 72E2-like       397   3e-128   
ref|XP_009149425.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       396   4e-128   
ref|XP_006473463.1|  PREDICTED: hydroquinone glucosyltransferase-...    396   4e-128   
ref|XP_010649181.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    394   1e-127   
ref|XP_007046303.1|  UDP-Glycosyltransferase superfamily protein        394   3e-127   
ref|XP_008441118.1|  PREDICTED: UDP-glycosyltransferase 72E1            393   4e-127   
gb|KFK40251.1|  hypothetical protein AALP_AA3G349900                    393   6e-127   
emb|CCO13612.1|  anthocyanidin 3-O-glucosyltransferase like protein     392   6e-127   
ref|XP_004143577.1|  PREDICTED: UDP-glycosyltransferase 72E2-like       391   2e-126   
ref|XP_002884142.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    389   2e-125   
ref|XP_010029834.1|  PREDICTED: UDP-glycosyltransferase 72E1            389   4e-125   
ref|XP_010030882.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       388   9e-125   
ref|XP_011031512.1|  PREDICTED: hydroquinone glucosyltransferase-...    387   1e-124   
ref|XP_010446296.1|  PREDICTED: UDP-glycosyltransferase 72E3-like       387   1e-124   
gb|KCW58587.1|  hypothetical protein EUGRSUZ_H01245                     384   3e-124   
ref|XP_003538841.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       386   5e-124   
gb|ADL67598.1|  glycosyltransferase 4                                   381   7e-124   
ref|XP_010060922.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    386   8e-124   
ref|XP_006297598.1|  hypothetical protein CARUB_v10013620mg             384   9e-124   
ref|XP_002884141.1|  hypothetical protein ARALYDRAFT_319804             384   9e-124   
ref|XP_004168405.1|  PREDICTED: hydroquinone glucosyltransferase-...    384   2e-123   
ref|XP_010489562.1|  PREDICTED: UDP-glycosyltransferase 72D1-like...    383   3e-123   
ref|XP_003524274.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    384   4e-123   
ref|XP_004133821.1|  PREDICTED: hydroquinone glucosyltransferase-...    380   4e-122   
ref|XP_009114698.1|  PREDICTED: UDP-glycosyltransferase 72D1            379   2e-121   
ref|XP_008437921.1|  PREDICTED: hydroquinone glucosyltransferase-...    378   4e-121   
gb|AAD12211.1|  putative flavonol 3-O-glucosyltransferase               376   7e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150723.1|  PREDICTED: UDP-glycosyltransferase 72D1-like       376   2e-120   
ref|XP_008338748.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    376   2e-120   
emb|CDY72102.1|  BnaA07g37370D                                          374   2e-120   
ref|XP_010468740.1|  PREDICTED: UDP-glycosyltransferase 72D1            375   5e-120   
gb|KEH27552.1|  UDP-glucosyltransferase family protein                  376   6e-120   
ref|XP_010490444.1|  PREDICTED: UDP-glycosyltransferase 72D1-like       374   9e-120   
ref|XP_008220762.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       374   2e-119   
ref|XP_010667692.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    372   5e-119   
emb|CDY13025.1|  BnaC07g03240D                                          372   5e-119   
gb|AFJ52917.1|  UDP-glycosyltransferase 1                               370   5e-118   
emb|CDY43896.1|  BnaA07g01730D                                          369   8e-118   
ref|XP_007224074.1|  hypothetical protein PRUPE_ppa015442mg             367   4e-117   
gb|AGU14069.1|  UDP-glycosyltransferase                                 364   2e-116   
ref|XP_011037856.1|  PREDICTED: hydroquinone glucosyltransferase-...    366   6e-116   
gb|EYU32802.1|  hypothetical protein MIMGU_mgv1a005797mg                364   7e-116   
ref|XP_002320190.1|  hydroquinone glucosyltransferase family protein    363   1e-115   Populus trichocarpa [western balsam poplar]
ref|XP_007051600.1|  UDP-Glycosyltransferase superfamily protein        363   2e-115   
gb|AFJ52923.1|  UDP-glycosyltransferase 1                               363   2e-115   
ref|XP_008376064.1|  PREDICTED: hydroquinone glucosyltransferase-...    362   5e-115   
ref|XP_004133820.1|  PREDICTED: hydroquinone glucosyltransferase-...    362   5e-115   
ref|XP_008350138.1|  PREDICTED: hydroquinone glucosyltransferase        360   3e-114   
emb|CDY30762.1|  BnaC07g16620D                                          359   4e-114   
dbj|BAF75896.1|  glucosyltransferase                                    358   2e-113   Cyclamen persicum
ref|XP_010095793.1|  Hydroquinone glucosyltransferase                   358   3e-113   
ref|XP_011023207.1|  PREDICTED: hydroquinone glucosyltransferase-...    358   4e-113   
ref|XP_008233208.1|  PREDICTED: hydroquinone glucosyltransferase-...    357   5e-113   
ref|XP_009350467.1|  PREDICTED: hydroquinone glucosyltransferase-...    356   1e-112   
ref|XP_009377276.1|  PREDICTED: hydroquinone glucosyltransferase-...    356   1e-112   
gb|KDP28511.1|  hypothetical protein JCGZ_14282                         355   2e-112   
ref|XP_008437917.1|  PREDICTED: hydroquinone glucosyltransferase-...    355   3e-112   
emb|CBI34463.3|  unnamed protein product                                354   4e-112   
ref|XP_010053796.1|  PREDICTED: hydroquinone glucosyltransferase-...    354   5e-112   
gb|KEH18691.1|  UDP-glucosyltransferase family protein                  353   1e-111   
gb|ACD87062.1|  UDP-glucosyltransferase                                 353   2e-111   Rhodiola sachalinensis
ref|XP_009788732.1|  PREDICTED: hydroquinone glucosyltransferase-...    353   2e-111   
gb|AFJ52916.1|  UDP-glycosyltransferase 1                               352   2e-111   
emb|CDX81377.1|  BnaC09g07880D                                          351   2e-111   
ref|XP_002301402.2|  hypothetical protein POPTR_0002s17000g             353   3e-111   Populus trichocarpa [western balsam poplar]
gb|KCW78150.1|  hypothetical protein EUGRSUZ_D02351                     354   3e-111   
gb|KDO84452.1|  hypothetical protein CISIN_1g047445mg                   351   4e-111   
dbj|BAI65909.1|  UDP-sugar:glycosyltransferase                          352   5e-111   Forsythia x intermedia [cultivated forsythia]
ref|XP_004516402.1|  PREDICTED: hydroquinone glucosyltransferase-...    352   6e-111   
gb|ABL85472.1|  glycosyltransferase UGT72B9                             351   1e-110   Maclura pomifera
dbj|BAF49302.1|  putative glycosyltransferase                           351   1e-110   Clitoria ternatea
gb|AIE12483.1|  UGT6                                                    350   3e-110   
ref|XP_006847344.1|  hypothetical protein AMTR_s00015p00251000          350   3e-110   
gb|AFJ52928.1|  UDP-glycosyltransferase 1                               350   3e-110   
ref|NP_179446.2|  UDP-glycosyltransferase family protein                346   4e-110   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43482.2|  putative flavonol 3-O-glucosyltransferase              346   5e-110   Arabidopsis thaliana [mouse-ear cress]
gb|AIZ00426.1|  UDP-glycosyltransferase                                 348   7e-110   
ref|XP_004231207.1|  PREDICTED: hydroquinone glucosyltransferase        349   7e-110   
gb|KEH18690.1|  UDP-glucosyltransferase family protein                  349   7e-110   
ref|XP_010053798.1|  PREDICTED: hydroquinone glucosyltransferase-...    349   8e-110   
gb|AGU14071.1|  UDP-glycosyltransferase                                 348   8e-110   
ref|XP_004494807.1|  PREDICTED: hydroquinone glucosyltransferase-...    348   9e-110   
ref|XP_010097012.1|  Hydroquinone glucosyltransferase                   347   3e-109   
ref|XP_011005719.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    341   4e-109   
gb|AFJ52927.1|  UDP-glycosyltransferase 1                               347   5e-109   
ref|XP_010531180.1|  PREDICTED: UDP-glycosyltransferase 72D1            346   5e-109   
gb|AEM43001.1|  UDP-glucosyltransferase                                 346   1e-108   
ref|XP_011093530.1|  PREDICTED: hydroquinone glucosyltransferase        345   1e-108   
ref|XP_010053797.1|  PREDICTED: hydroquinone glucosyltransferase-...    345   1e-108   
ref|XP_010266460.1|  PREDICTED: hydroquinone glucosyltransferase-...    345   2e-108   
ref|XP_009365904.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       344   3e-108   
emb|CDP08704.1|  unnamed protein product                                342   2e-107   
sp|Q9AR73.1|HQGT_RAUSE  RecName: Full=Hydroquinone glucosyltransf...    342   2e-107   Rauvolfia serpentina [devilpepper]
ref|XP_006847343.1|  hypothetical protein AMTR_s00015p00249680          342   2e-107   
ref|XP_004306692.1|  PREDICTED: hydroquinone glucosyltransferase-...    341   5e-107   
dbj|BAG80556.1|  UDP-glucose:glucosyltransferase                        341   6e-107   Lycium barbarum [goji berry]
gb|KDO53104.1|  hypothetical protein CISIN_1g011396mg                   342   6e-107   
ref|XP_006428663.1|  hypothetical protein CICLE_v10011598mg             342   7e-107   
ref|XP_011022526.1|  PREDICTED: hydroquinone glucosyltransferase-...    341   8e-107   
ref|XP_006418419.1|  hypothetical protein EUTSA_v10010005mg             340   2e-106   
ref|XP_006480475.1|  PREDICTED: hydroquinone glucosyltransferase-...    341   3e-106   
ref|XP_002303638.2|  hypothetical protein POPTR_0003s13800g             340   5e-106   Populus trichocarpa [western balsam poplar]
ref|XP_006346931.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    332   5e-106   
ref|XP_002280923.1|  PREDICTED: hydroquinone glucosyltransferase        338   5e-106   Vitis vinifera
ref|XP_010414446.1|  PREDICTED: UDP-glycosyltransferase 72D1            335   6e-106   
ref|XP_010925982.1|  PREDICTED: hydroquinone glucosyltransferase-...    339   7e-106   
ref|XP_010484601.1|  PREDICTED: UDP-glycosyltransferase 72E3-like       335   9e-106   
ref|XP_007147290.1|  hypothetical protein PHAVU_006G111400g             338   1e-105   
dbj|BAF75897.1|  glucosyltransferase                                    338   1e-105   Cyclamen persicum
ref|XP_009785688.1|  PREDICTED: hydroquinone glucosyltransferase-...    337   2e-105   
ref|XP_008776769.1|  PREDICTED: hydroquinone glucosyltransferase-...    337   2e-105   
ref|XP_008338741.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    334   2e-105   
gb|AHZ08761.1|  UDP-glucose:glucosyltransferase                         337   2e-105   
ref|NP_001235053.1|  glucosyltransferase                                337   4e-105   
gb|AEM43000.1|  UDP-glucosyltransferase                                 337   4e-105   
ref|XP_002273653.1|  PREDICTED: hydroquinone glucosyltransferase        336   6e-105   Vitis vinifera
gb|KCW58585.1|  hypothetical protein EUGRSUZ_H01243                     330   7e-105   
ref|XP_002872912.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    335   2e-104   
gb|AGV54472.1|  hydroquinone glucosyltransferase-like protein           335   2e-104   
ref|XP_002270960.3|  PREDICTED: hydroquinone glucosyltransferase        343   3e-104   Vitis vinifera
ref|XP_010669265.1|  PREDICTED: hydroquinone glucosyltransferase-...    334   3e-104   
dbj|BAO45895.1|  UDP-glycosyltransferase, putative                      334   3e-104   
ref|XP_009628747.1|  PREDICTED: hydroquinone glucosyltransferase-...    334   3e-104   
ref|XP_003521983.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    334   4e-104   
ref|NP_192016.1|  UDP-glycosyltransferase 72B1                          334   5e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336576.1|  PREDICTED: UDP-glycosyltransferase 72E1-like       333   7e-104   
gb|EYU32219.1|  hypothetical protein MIMGU_mgv1a005645mg                333   7e-104   
gb|KHN34494.1|  Hydroquinone glucosyltransferase                        333   1e-103   
ref|XP_006584234.1|  PREDICTED: hydroquinone glucosyltransferase-...    332   1e-103   
ref|XP_010913987.1|  PREDICTED: hydroquinone glucosyltransferase-...    332   2e-103   
gb|EYU38906.1|  hypothetical protein MIMGU_mgv1a005604mg                332   2e-103   
gb|KFK30683.1|  hypothetical protein AALP_AA6G014400                    332   2e-103   
ref|XP_006444877.1|  hypothetical protein CICLE_v10019927mg             332   3e-103   
ref|XP_010099247.1|  Hydroquinone glucosyltransferase                   332   3e-103   
ref|XP_006491243.1|  PREDICTED: hydroquinone glucosyltransferase-...    331   5e-103   
ref|XP_007134739.1|  hypothetical protein PHAVU_010G071900g             331   7e-103   
gb|KDP25320.1|  hypothetical protein JCGZ_20476                         330   8e-103   
ref|XP_003532193.1|  PREDICTED: hydroquinone glucosyltransferase-...    330   1e-102   
gb|KFK30296.1|  hypothetical protein AALP_AA7G243300                    329   1e-102   
gb|KHN01825.1|  Hydroquinone glucosyltransferase                        330   2e-102   
ref|XP_002320189.1|  putative flavonol 3-o-glucosyltransferase fa...    329   2e-102   
gb|ADV71364.1|  glycosyltransferase GT04F14                             329   2e-102   
ref|NP_001239949.1|  uncharacterized protein LOC100810554               330   2e-102   
ref|XP_006411963.1|  hypothetical protein EUTSA_v10025160mg             328   3e-102   
ref|XP_010097013.1|  Hydroquinone glucosyltransferase                   329   4e-102   
ref|XP_009385373.1|  PREDICTED: hydroquinone glucosyltransferase-...    329   4e-102   
ref|XP_003553781.1|  PREDICTED: hydroquinone glucosyltransferase-...    329   4e-102   
ref|XP_006428662.1|  hypothetical protein CICLE_v10011601mg             329   4e-102   
ref|XP_003522032.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    329   5e-102   
ref|XP_009119690.1|  PREDICTED: UDP-glycosyltransferase 72B3            329   5e-102   
ref|XP_010556587.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       328   5e-102   
ref|XP_006366559.1|  PREDICTED: hydroquinone glucosyltransferase-...    328   6e-102   
emb|CDX90030.1|  BnaA10g00520D                                          328   8e-102   
ref|XP_011037843.1|  PREDICTED: hydroquinone glucosyltransferase-...    327   1e-101   
gb|AFX67020.1|  glycosyltransferase                                     327   1e-101   
emb|CDP12136.1|  unnamed protein product                                327   1e-101   
ref|XP_009421247.1|  PREDICTED: hydroquinone glucosyltransferase        327   2e-101   
ref|XP_003626556.1|  Hydroquinone glucosyltransferase                   327   2e-101   
ref|XP_010278886.1|  PREDICTED: hydroquinone glucosyltransferase-...    327   2e-101   
ref|XP_009404467.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       327   2e-101   
gb|KDO53101.1|  hypothetical protein CISIN_1g011381mg                   327   3e-101   
ref|XP_006428661.1|  hypothetical protein CICLE_v10011599mg             327   3e-101   
ref|XP_006396305.1|  hypothetical protein EUTSA_v10028623mg             327   3e-101   
gb|KHN24645.1|  Anthocyanidin 3-O-glucosyltransferase 5                 327   3e-101   
gb|ACB56923.1|  glycosyltransferase UGT72B11                            326   4e-101   
ref|XP_009390686.1|  PREDICTED: hydroquinone glucosyltransferase-...    326   4e-101   
ref|XP_007219620.1|  hypothetical protein PRUPE_ppa024809mg             326   5e-101   
ref|XP_006480472.1|  PREDICTED: hydroquinone glucosyltransferase-...    326   5e-101   
ref|XP_010548356.1|  PREDICTED: UDP-glycosyltransferase 72C1            325   6e-101   
ref|XP_006446970.1|  hypothetical protein CICLE_v10015042mg             326   7e-101   
gb|EPS59751.1|  hypothetical protein M569_15052                         325   8e-101   
ref|XP_010054859.1|  PREDICTED: hydroquinone glucosyltransferase-...    325   9e-101   
ref|XP_010916760.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       325   9e-101   
ref|XP_010556588.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       325   1e-100   
ref|XP_006468867.1|  PREDICTED: hydroquinone glucosyltransferase-...    326   1e-100   
dbj|BAJ34074.1|  unnamed protein product                                325   1e-100   
ref|XP_010661895.1|  PREDICTED: hydroquinone glucosyltransferase-...    326   2e-100   
gb|KHN24647.1|  Anthocyanidin 3-O-glucosyltransferase 5                 325   2e-100   
ref|XP_010544428.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       324   3e-100   
gb|ACJ85806.1|  unknown                                                 323   4e-100   
ref|XP_009128506.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       323   5e-100   
ref|XP_004300861.1|  PREDICTED: hydroquinone glucosyltransferase-...    323   5e-100   
ref|XP_008233421.1|  PREDICTED: hydroquinone glucosyltransferase-...    323   5e-100   
ref|XP_009134508.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       323   9e-100   
ref|XP_004298887.1|  PREDICTED: hydroquinone glucosyltransferase-...    322   1e-99    
ref|XP_003530818.1|  PREDICTED: hydroquinone glucosyltransferase-...    322   2e-99    
gb|EYU26904.1|  hypothetical protein MIMGU_mgv1a019456mg                322   2e-99    
ref|XP_009385281.1|  PREDICTED: hydroquinone glucosyltransferase-...    322   2e-99    
ref|XP_004248451.1|  PREDICTED: hydroquinone glucosyltransferase-...    321   3e-99    
ref|XP_006290216.1|  hypothetical protein CARUB_v10003907mg             321   3e-99    
ref|XP_003556942.1|  PREDICTED: hydroquinone glucosyltransferase-...    320   4e-99    
dbj|BAJ90124.1|  predicted protein                                      321   4e-99    
ref|XP_007208773.1|  hypothetical protein PRUPE_ppa023599mg             321   6e-99    
emb|CAM31954.1|  glucosyltransferase                                    320   6e-99    
emb|CDY15179.1|  BnaC05g00580D                                          320   7e-99    
ref|XP_008239055.1|  PREDICTED: hydroquinone glucosyltransferase-...    320   8e-99    
ref|XP_006282774.1|  hypothetical protein CARUB_v10006214mg             319   1e-98    
ref|XP_007140774.1|  hypothetical protein PHAVU_008G140800g             319   2e-98    
emb|CDY29242.1|  BnaA06g25150D                                          317   2e-98    
ref|XP_008239054.1|  PREDICTED: hydroquinone glucosyltransferase        328   3e-98    
ref|XP_006491242.1|  PREDICTED: hydroquinone glucosyltransferase-...    318   3e-98    
ref|XP_010451029.1|  PREDICTED: UDP-glycosyltransferase 72C1            318   4e-98    
gb|AAB61023.1|  Similar to UTP-Glucose Glucosyltransferase; coded...    318   4e-98    
ref|XP_006444878.1|  hypothetical protein CICLE_v10020010mg             318   5e-98    
ref|XP_008791324.1|  PREDICTED: LOW QUALITY PROTEIN: hydroquinone...    318   5e-98    
ref|XP_010556589.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       318   8e-98    
ref|XP_002533911.1|  UDP-glucosyltransferase, putative                  315   1e-97    
ref|NP_171649.1|  UDP-glucosyltransferase 72B3                          317   1e-97    
ref|XP_007140773.1|  hypothetical protein PHAVU_008G140700g             316   2e-97    
ref|XP_004510128.1|  PREDICTED: hydroquinone glucosyltransferase-...    315   7e-97    
ref|XP_009616889.1|  PREDICTED: hydroquinone glucosyltransferase-...    315   8e-97    
ref|XP_004308317.1|  PREDICTED: hydroquinone glucosyltransferase-...    315   1e-96    
emb|CDY36488.1|  BnaC03g48470D                                          312   2e-96    
gb|KCW78154.1|  hypothetical protein EUGRSUZ_D02357                     313   2e-96    
ref|XP_007221237.1|  hypothetical protein PRUPE_ppa005039mg             314   2e-96    
ref|XP_010109861.1|  Hydroquinone glucosyltransferase                   313   3e-96    
ref|XP_007040472.1|  UDP-Glycosyltransferase superfamily protein        314   3e-96    
ref|XP_010109870.1|  Hydroquinone glucosyltransferase                   314   3e-96    
ref|XP_009128501.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       313   3e-96    
emb|CDX75597.1|  BnaA01g01050D                                          312   5e-96    
ref|XP_010232036.1|  PREDICTED: hydroquinone glucosyltransferase-...    313   5e-96    
ref|XP_009352389.1|  PREDICTED: hydroquinone glucosyltransferase-...    313   5e-96    
ref|XP_010456210.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       313   6e-96    
emb|CDX69245.1|  BnaC01g02080D                                          311   9e-96    
ref|XP_010089285.1|  Hydroquinone glucosyltransferase                   312   1e-95    
dbj|BAD43267.1|  putative flavonol 3-o-glucosyltransferase              312   1e-95    
ref|XP_010444943.1|  PREDICTED: UDP-glycosyltransferase 72C1-like       311   1e-95    
ref|XP_007047016.1|  Anthocyanidin 3-O-glucosyltransferase 5            307   2e-95    
ref|XP_006838970.1|  hypothetical protein AMTR_s00002p00271210          311   2e-95    
ref|XP_011093048.1|  PREDICTED: hydroquinone glucosyltransferase-...    311   2e-95    
ref|XP_008392435.1|  PREDICTED: hydroquinone glucosyltransferase-...    311   3e-95    
ref|XP_011091686.1|  PREDICTED: hydroquinone glucosyltransferase-...    311   3e-95    
ref|XP_007210088.1|  hypothetical protein PRUPE_ppa020191mg             309   3e-95    
gb|KHN24643.1|  Anthocyanidin 3-O-glucosyltransferase 5                 315   5e-95    
ref|XP_010915685.1|  PREDICTED: LOW QUALITY PROTEIN: hydroquinone...    310   5e-95    
ref|XP_010427832.1|  PREDICTED: UDP-glycosyltransferase 72B1            311   6e-95    
ref|XP_009142135.1|  PREDICTED: UDP-glycosyltransferase 72C1            309   8e-95    
ref|XP_007137358.1|  hypothetical protein PHAVU_009G120600g             310   8e-95    
emb|CDY01952.1|  BnaC02g27750D                                          309   9e-95    
ref|XP_003532191.1|  PREDICTED: hydroquinone glucosyltransferase-...    309   9e-95    
ref|XP_003618190.1|  UDP-glucuronosyltransferase 1-6                    309   2e-94    
ref|XP_009419775.1|  PREDICTED: hydroquinone glucosyltransferase-...    308   2e-94    
gb|ADV71365.1|  glycosyltransferase GT07O02                             308   2e-94    
ref|XP_010669272.1|  PREDICTED: hydroquinone glucosyltransferase-...    308   2e-94    
ref|XP_009352454.1|  PREDICTED: hydroquinone glucosyltransferase-...    309   2e-94    
gb|KEH16439.1|  UDP-glucosyltransferase family protein                  308   3e-94    
ref|XP_010432139.1|  PREDICTED: UDP-glycosyltransferase 72C1-like       307   5e-94    
gb|AET01260.2|  UDP-glucosyltransferase family protein                  307   5e-94    
gb|KFK42529.1|  hypothetical protein AALP_AA1G006300                    307   6e-94    
ref|XP_010232034.1|  PREDICTED: hydroquinone glucosyltransferase-...    307   9e-94    
dbj|BAG71125.1|  glucosyltransferase                                    306   9e-94    
ref|XP_009379192.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    301   1e-93    
gb|KHN01826.1|  Hydroquinone glucosyltransferase                        306   2e-93    
ref|XP_003532192.2|  PREDICTED: hydroquinone glucosyltransferase-...    305   5e-93    
emb|CDX97236.1|  BnaA02g20270D                                          304   7e-93    
ref|XP_006480473.1|  PREDICTED: hydroquinone glucosyltransferase-...    305   7e-93    
ref|XP_002866993.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    304   8e-93    
ref|XP_002462236.1|  hypothetical protein SORBIDRAFT_02g022260          304   1e-92    
ref|XP_003532190.1|  PREDICTED: hydroquinone glucosyltransferase-...    303   2e-92    
dbj|BAP90371.1|  UDP-glycose: glycosyltransferase UGT72B19              303   2e-92    
ref|NP_195395.4|  UDP-glycosyltransferase 72C1                          302   3e-92    
gb|KHN01832.1|  Hydroquinone glucosyltransferase                        302   4e-92    
gb|KEH17821.1|  UDP-glucosyltransferase family protein                  302   4e-92    
ref|XP_004300858.1|  PREDICTED: hydroquinone glucosyltransferase-...    303   5e-92    
gb|AGN33444.1|  UFGT2                                                   302   6e-92    
emb|CBI75538.1|  hydroquinone glucosyltransferase, putative, expr...    303   6e-92    
ref|XP_002889371.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    302   6e-92    
ref|XP_010089286.1|  Hydroquinone glucosyltransferase                   301   7e-92    
ref|XP_003530820.1|  PREDICTED: hydroquinone glucosyltransferase-...    302   7e-92    
gb|EAY75001.1|  hypothetical protein OsI_02900                          303   7e-92    
ref|XP_004969191.1|  PREDICTED: hydroquinone glucosyltransferase-...    303   7e-92    
gb|KEH17972.1|  UDP-glucosyltransferase family protein                  301   7e-92    
ref|XP_010104975.1|  Hydroquinone glucosyltransferase                   301   2e-91    
ref|NP_001043600.1|  Os01g0620800                                       302   2e-91    
ref|XP_009111416.1|  PREDICTED: UDP-glycosyltransferase 72B1            300   4e-91    
emb|CDY02077.1|  BnaA03g40900D                                          294   4e-91    
ref|NP_001147461.1|  hydroquinone glucosyltransferase                   300   4e-91    
gb|AFJ52926.1|  UDP-glycosyltransferase 1                               300   5e-91    
gb|EAY81508.1|  hypothetical protein OsI_36677                          300   6e-91    
gb|KHN01827.1|  Hydroquinone glucosyltransferase                        299   6e-91    
ref|NP_001176639.1|  Os11g0599200                                       300   8e-91    
ref|XP_006583507.1|  PREDICTED: hydroquinone glucosyltransferase-...    299   8e-91    
ref|XP_004492196.1|  PREDICTED: hydroquinone glucosyltransferase-...    298   2e-90    
ref|XP_004954716.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       298   2e-90    
dbj|BAJ96725.1|  predicted protein                                      298   2e-90    
dbj|BAJ85873.1|  predicted protein                                      298   3e-90    
dbj|BAJ88919.1|  predicted protein                                      298   3e-90    
ref|XP_003521002.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       298   3e-90    
emb|CDM80806.1|  unnamed protein product                                298   3e-90    
gb|KEH17968.1|  UDP-glucosyltransferase family protein                  296   7e-90    
gb|AGU14145.1|  UDP-glycosyltransferase                                 296   8e-90    
ref|XP_003626784.1|  UDP-glycosyltransferase                            308   8e-90    
ref|XP_010925766.1|  PREDICTED: hydroquinone glucosyltransferase-...    296   9e-90    
ref|XP_003626779.1|  UDP-glycosyltransferase                            296   9e-90    
ref|XP_003622642.1|  Hydroquinone glucosyltransferase                   296   1e-89    
ref|XP_007134372.1|  hypothetical protein PHAVU_010G042200g             295   2e-89    
gb|KEH18133.1|  UDP-glucosyltransferase family protein                  295   3e-89    
ref|XP_010673995.1|  PREDICTED: hydroquinone glucosyltransferase-...    295   4e-89    
ref|XP_010436782.1|  PREDICTED: UDP-glycosyltransferase 72E3-like       291   4e-89    
emb|CAN70910.1|  hypothetical protein VITISV_012544                     294   4e-89    
gb|AFW60457.1|  hydroquinone glucosyltransferase                        295   6e-89    
ref|XP_003629448.1|  Glucosyltransferase-6                              294   6e-89    
ref|NP_001147512.1|  LOC100281121                                       295   7e-89    
ref|XP_008392434.1|  PREDICTED: hydroquinone glucosyltransferase-...    294   9e-89    
ref|XP_003521044.1|  PREDICTED: hydroquinone glucosyltransferase-...    294   1e-88    
ref|XP_009776112.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    285   1e-88    
ref|XP_003577390.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       294   1e-88    
gb|KEH25442.1|  UDP-glucosyltransferase family protein                  293   1e-88    
gb|KEH17824.1|  UDP-glucosyltransferase family protein                  293   2e-88    
dbj|BAP90368.1|  UDP-glycose: glycosyltransferase UGT72AC1              293   2e-88    
ref|NP_171646.1|  UDP-glycosyltransferase 72B2                          293   2e-88    
emb|CDY23001.1|  BnaC07g31860D                                          286   3e-88    
ref|XP_010457132.1|  PREDICTED: UDP-glycosyltransferase 72B2            293   3e-88    
gb|EAY74998.1|  hypothetical protein OsI_02897                          292   4e-88    
ref|XP_004300860.1|  PREDICTED: hydroquinone glucosyltransferase-...    293   4e-88    
gb|EMT22342.1|  Putative hydroquinone glucosyltransferase               296   4e-88    
ref|XP_007140772.1|  hypothetical protein PHAVU_008G140600g             292   7e-88    
ref|XP_004979487.1|  PREDICTED: UDP-glycosyltransferase 72B3-like       291   7e-88    
ref|XP_004969192.1|  PREDICTED: hydroquinone glucosyltransferase-...    291   1e-87    
ref|XP_010512977.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       290   1e-87    
gb|KEH16873.1|  UDP-glucosyltransferase family protein                  291   1e-87    
ref|XP_002449704.1|  hypothetical protein SORBIDRAFT_05g021870          290   2e-87    
ref|XP_003622636.1|  Hydroquinone glucosyltransferase                   290   2e-87    
ref|XP_004979486.1|  PREDICTED: UDP-glycosyltransferase 72B1-like       290   3e-87    
gb|EYU39338.1|  hypothetical protein MIMGU_mgv1a020359mg                286   3e-87    
ref|XP_007040473.1|  Hydroquinone glucosyltransferase, putative         298   5e-87    
ref|XP_002453595.1|  hypothetical protein SORBIDRAFT_04g008700          301   6e-87    
ref|XP_002451052.1|  hypothetical protein SORBIDRAFT_05g023240          290   7e-87    
emb|CBI17569.3|  unnamed protein product                                284   9e-87    
gb|KHN04234.1|  Hydroquinone glucosyltransferase                        288   1e-86    
ref|NP_001046408.2|  Os02g0242100                                       288   1e-86    
ref|XP_003571160.1|  PREDICTED: hydroquinone glucosyltransferase-...    288   3e-86    
ref|XP_002438627.1|  hypothetical protein SORBIDRAFT_10g023110          288   3e-86    
ref|XP_011092044.1|  PREDICTED: hydroquinone glucosyltransferase-...    287   3e-86    
gb|AGU14155.1|  UDP-glycosyltransferase                                 288   3e-86    
gb|EYU26902.1|  hypothetical protein MIMGU_mgv1a024118mg                286   4e-86    
gb|AFW65951.1|  hydroquinone glucosyltransferase                        287   4e-86    
ref|XP_003626719.1|  UDP-glucuronosyltransferase 1-1                    286   5e-86    
gb|AAF97324.1|AC023628_5  Putative UTP-glucose glucosyltransferase      286   6e-86    
ref|XP_010676324.1|  PREDICTED: hydroquinone glucosyltransferase-...    287   6e-86    
gb|ABK25443.1|  unknown                                                 286   6e-86    
ref|XP_002889369.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    286   7e-86    
ref|XP_006586162.1|  PREDICTED: hydroquinone glucosyltransferase-...    286   8e-86    
ref|XP_006576742.1|  PREDICTED: hydroquinone glucosyltransferase-...    286   9e-86    
ref|XP_003626786.1|  UDP-glucuronosyltransferase 3A1                    301   9e-86    
ref|XP_010669296.1|  PREDICTED: hydroquinone glucosyltransferase-...    286   1e-85    
ref|NP_001148283.1|  hydroquinone glucosyltransferase                   286   1e-85    



>ref|XP_009619039.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/470 (65%), Positives = 381/470 (81%), Gaps = 2/470 (0%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             LH+GILSSPG+GHIIP ++L + LA  HNV +TVFVIT+  S  E++LL+S++ +  ++ 
Sbjct  7     LHVGILSSPGLGHIIPVIVLGSHLATHHNVSVTVFVITSGSSLAEKELLKSANKSKLIDT  66

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             V IP VDIS L+DANTK V QLC+LVR +LP V++ +  +   LDAL+VD FCTEALP+A
Sbjct  67    VEIPAVDISNLIDANTKMVTQLCVLVRESLPVVKSVIFAKKHILDALIVDLFCTEALPIA  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E  LP ++Y+PTNA FTA TVYC VLD+EI GQYV+Q++ L+IPGCKPVRPEDVVDPML
Sbjct  127   KEFGLPNYIYIPTNAWFTASTVYCQVLDKEIEGQYVDQDEPLKIPGCKPVRPEDVVDPML  186

Query  708   DRNDVQYREYLR-LGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             +RND QY EYLR LG+GF ++DGILMNTWED +P +LKALRENE L  +V   VY IGPL
Sbjct  187   ERNDQQYSEYLRVLGIGFCLSDGILMNTWEDAEPGSLKALRENETLKAIVKSTVYPIGPL  246

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
             +R I + + DD   I++WL +Q  ESVLYVSFGSGGTLS++Q+TELA+GLELS+Q+F+W+
Sbjct  247   SRQIIDGN-DDRNFILKWLDEQTPESVLYVSFGSGGTLSSKQLTELAFGLELSQQKFVWI  305

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VRPPS  G+D +FFTTG+  D TP YLPEGF TRTQ+ GLVV MWA+Q  IL HPS GGF
Sbjct  306   VRPPSEVGADKSFFTTGKEGDDTPEYLPEGFLTRTQDFGLVVQMWADQVRILSHPSVGGF  365

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             LSHCG NS++ESI N VP+IAWPLY+EQRQNAT+LTEE+GVA+RP  LPTK +V REE++
Sbjct  366   LSHCGWNSSIESITNNVPMIAWPLYAEQRQNATILTEELGVAVRPKVLPTKKVVEREEIE  425

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
              LV+ ++Q K+GKE+RE V KLKMS+EKA S+GGSSYNSMCEVL  IEKR
Sbjct  426   KLVRTVMQYKEGKELRENVKKLKMSAEKAPSVGGSSYNSMCEVLKDIEKR  475



>ref|XP_009766247.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Nicotiana 
sylvestris]
Length=488

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/472 (64%), Positives = 381/472 (81%), Gaps = 3/472 (1%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             LH+GILSSPG+GHIIP ++L N LA  HNV +TVFVIT+  S  E++LL+S++ +  ++ 
Sbjct  7     LHVGILSSPGLGHIIPVIVLGNHLATHHNVSVTVFVITSGSSLAEKELLKSANKSKLIDI  66

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             V IP VDIS L+DANTK V QLC+LVR +LP V++ +  +   LDAL+VD FCTEALP+A
Sbjct  67    VEIPAVDISNLIDANTKMVTQLCVLVRESLPLVKSVIFAKKHILDALIVDLFCTEALPIA  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E  LP +VY+PTNA FTALTVYC +LD+EI GQYV+Q++ L+IPGCKPVRPEDVVDPML
Sbjct  127   KEFGLPNYVYIPTNAWFTALTVYCQILDKEIEGQYVDQDEPLKIPGCKPVRPEDVVDPML  186

Query  708   DRNDVQYREYLR-LGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             DRND QY EY+R LG+GF ++DGILMNTWED +P +LKALRENE L  +V   +Y IGPL
Sbjct  187   DRNDQQYSEYMRVLGLGFCLSDGILMNTWEDAEPGSLKALRENETLKAIVKSTIYPIGPL  246

Query  885   TRNIEER-DG-DDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
              R  E+  DG DD   +++WL +Q  ESVLYVSFGSGGTLS++Q+TE+A+G+ELS+Q+FI
Sbjct  247   CRRDEQIIDGSDDRNFVLKWLDEQTSESVLYVSFGSGGTLSSKQLTEIAFGMELSQQKFI  306

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             W+VRPPS  G+D +FFTTG+  D  P YLPEGF TRTQ+ GLVV MWA+Q  IL HPS G
Sbjct  307   WIVRPPSEVGADKSFFTTGKEGDDAPKYLPEGFLTRTQDYGLVVEMWADQGRILSHPSVG  366

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NS +ESI NGVP+IAWPLY+EQRQNAT+LTEE+GVA+RP  LPTK +V REE
Sbjct  367   GFLTHCGWNSNIESITNGVPMIAWPLYAEQRQNATILTEELGVAVRPKVLPTKKVVEREE  426

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             ++ LV+ ++  K+GKE+RE V KLKMS+EKA+S+GGSS+NSMCEVL  IEKR
Sbjct  427   IEKLVRTVMHYKEGKELRENVKKLKMSAEKALSVGGSSHNSMCEVLKDIEKR  478



>ref|XP_006363138.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Solanum 
tuberosum]
Length=493

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/476 (62%), Positives = 375/476 (79%), Gaps = 7/476 (1%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             LHIGILSSPG+GHIIP + LANRLA  HNV +TVFVIT+  S  E ++L+S++ +  ++ 
Sbjct  8     LHIGILSSPGLGHIIPVVTLANRLATFHNVSVTVFVITSGSSLAETEILKSANKSKMIDV  67

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             V IP VDIS L+D+NTK V QLC+L+R  L  V++ ++     LDAL+VD F TEALP+A
Sbjct  68    VEIPGVDISNLIDSNTKIVTQLCILIRETLHVVKSVISAMKHLLDALIVDIFTTEALPIA  127

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E  LP +VY+PTNA FTA+TVYCP LD+EI GQYV+Q++ L+IPGCKPVRPEDV DPML
Sbjct  128   KEFELPNYVYIPTNAWFTAMTVYCPFLDKEIEGQYVDQKEPLKIPGCKPVRPEDVNDPML  187

Query  708   DRNDVQYREYLRL-GVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             DRN+  YREYL++ G+GF ++DGILMNTWED +  +LKALREN+ L  +V  PVY +GPL
Sbjct  188   DRNEQDYREYLKVHGIGFCLSDGILMNTWEDAETGSLKALRENDILKAIVKSPVYPVGPL  247

Query  885   TRN----IEERDGDD--GTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSE  1046
              R+    I+ R GDD     ++ WL KQ   SVLY+SFGSGGTLS++Q+TELA+GLELS 
Sbjct  248   IRHDQQIIDGRSGDDDGNNSVLNWLDKQIPNSVLYISFGSGGTLSSKQLTELAFGLELSH  307

Query  1047  QRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRH  1226
             Q+FIWVVRPPS  G+D +FFTTG   D TP YLPEGF TRT++ GLV+ MW +Q  IL H
Sbjct  308   QKFIWVVRPPSEVGADKSFFTTGNRGDNTPEYLPEGFLTRTKDFGLVIQMWTDQTRILSH  367

Query  1227  PSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIV  1406
             PS GGFL+HCG NS++ESI NG+P+IAWPLY+EQRQNAT+LTEE+ VA+RP  LPTK +V
Sbjct  368   PSVGGFLTHCGWNSSIESITNGLPMIAWPLYAEQRQNATMLTEELRVAVRPKVLPTKKVV  427

Query  1407  TREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
              REE++ LV++++Q K GKE++E V KLKMS+EKA+S+GGSS++SMC+VL  IEKR
Sbjct  428   EREEIEQLVRMVMQYKDGKELKENVKKLKMSAEKALSVGGSSHDSMCQVLKDIEKR  483



>emb|CDP02807.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/469 (61%), Positives = 366/469 (78%), Gaps = 2/469 (0%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             LH+ IL+SPG+GH+IP L+L NRLA  H VK+T  V+TT+ SP E QLL+       ++ 
Sbjct  6     LHVAILASPGLGHLIPVLVLGNRLATHHAVKVTALVLTTSTSPAESQLLKPPAGPKVVDT  65

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             + IPPVDIS L+DANT+ V QLC++VR +LPGVR+A+     R + L+ D FCTEA P+A
Sbjct  66    INIPPVDISHLIDANTRVVTQLCIMVRESLPGVRSAIAGMKHRPNVLIADLFCTEAFPIA  125

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E N+PK++Y+P+ A FTALT YCPVL  +I GQYV+Q + L+IPGCKPVRPEDVVDPML
Sbjct  126   TEFNIPKYLYIPSTAWFTALTSYCPVLHEQIDGQYVDQSEPLQIPGCKPVRPEDVVDPML  185

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DRND QYREYLR  + F + DGILMNTWE+I+PV+L+ALR NE L  VV  PVY IGPLT
Sbjct  186   DRNDQQYREYLRQAMEFQLGDGILMNTWEEIEPVSLEALRRNESLRAVVKPPVYPIGPLT  245

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R IE       + +++WL KQP ESV++VSFGSGGTLSA+ ITELAWGLELS+QRFIWVV
Sbjct  246   RPIEL--AGPKSEVIEWLDKQPHESVIFVSFGSGGTLSAQHITELAWGLELSQQRFIWVV  303

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP+  G+D++FFT+G  +DGTP+YLPEGF  RT+  G VVP+WA+Q  IL HPS GGFL
Sbjct  304   RPPAENGADESFFTSGSASDGTPDYLPEGFLRRTKKTGWVVPLWAQQPEILNHPSVGGFL  363

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NS LE IK+GVP+IAWPLY+EQR NAT+LTEE+G+A+RP  LP K +V REE++ 
Sbjct  364   SHCGWNSALECIKSGVPMIAWPLYAEQRLNATMLTEELGIAVRPEILPAKKVVDREEIEK  423

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             LV+ +++ K+GK MR++V KLK S+E A++ GGSSY++MC +L  ++ R
Sbjct  424   LVRTVMEYKEGKVMRDKVKKLKNSAENALNKGGSSYDTMCNLLRDVQMR  472



>ref|XP_004233715.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5 [Solanum lycopersicum]
Length=490

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/478 (61%), Positives = 373/478 (78%), Gaps = 4/478 (1%)
 Frame = +3

Query  153   NNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLT  332
             +++ +LHIG+LSSPG+GHIIP L L NRLA VHNV +TVFVIT+  S  E ++L+S+  +
Sbjct  3     SSKQLLHIGVLSSPGLGHIIPVLNLGNRLATVHNVSVTVFVITSGSSLAETEILKSAHKS  62

Query  333   SRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTE  512
               ++ V IP VDIS L+D+NTK V QLC+LVR  L  V++ +      LDAL+VD F TE
Sbjct  63    KMIDVVEIPAVDISKLIDSNTKTVTQLCMLVRETLCVVKSVIFAMKHLLDALIVDIFTTE  122

Query  513   ALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDV  692
             AL +A E +LP +VY+PTNA FTALTVYCPVLD+EI GQYV+ ++ L+IPGCKPVRPEDV
Sbjct  123   ALSIAKEFDLPNYVYIPTNAWFTALTVYCPVLDKEIEGQYVDHKEPLKIPGCKPVRPEDV  182

Query  693   VDPMLDRNDVQYREYLR-LGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVY  869
              DPMLDRN+  Y EYL+ LG+GF ++DGILMNTWED +  +LKALRENE L  +V  PVY
Sbjct  183   SDPMLDRNNQDYCEYLKVLGIGFCLSDGILMNTWEDAEAGSLKALRENEILKAIVKSPVY  242

Query  870   AIGPLTRNIEER-DGDD--GTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLEL  1040
              +GPL R  ++  DGDD     ++ WL KQ   SVLY+SFGSGGTLS++Q+TELA+GLEL
Sbjct  243   PVGPLIRQEQQIIDGDDDGNNSVLNWLDKQMPNSVLYISFGSGGTLSSKQLTELAFGLEL  302

Query  1041  SEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             S Q+FIWVVRPPS  G+D ++FTTG     TP YLPEGF TRT++ GLV+ MW +Q  IL
Sbjct  303   SHQKFIWVVRPPSEDGADKSYFTTGDQGKNTPEYLPEGFQTRTKDFGLVIQMWTDQTRIL  362

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
              HPS GGFL+HCG NS++ESI NG+P+IAWPLY+EQRQNAT+LTEE+ VA+ P  LPTK 
Sbjct  363   SHPSVGGFLTHCGWNSSIESITNGLPMIAWPLYAEQRQNATMLTEELRVAVGPKVLPTKE  422

Query  1401  IVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             +V REE++ LV++++Q K+G E++E V KLKMS+EKA+SIGGSS++SMC+VL  IEKR
Sbjct  423   VVEREEIEQLVRMVMQYKEGNELKENVKKLKMSAEKALSIGGSSHDSMCQVLRDIEKR  480



>ref|XP_011097210.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Sesamum 
indicum]
Length=472

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/472 (58%), Positives = 356/472 (75%), Gaps = 2/472 (0%)
 Frame = +3

Query  150   NNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDL  329
             +++ S LH+ ILSSPG+GH+IP ++LANRLA  HNV++TV  +TTA +P E +LL     
Sbjct  2     DSSFSNLHVAILSSPGMGHLIPVVVLANRLAAHHNVRVTVLQVTTAVAPPESKLLNLHVH  61

Query  330   TSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCT  509
                +  + +PPVDIS L+  +T+ V QLCL+VR ALP +R+A+    RR DAL VD F T
Sbjct  62    KELVQIIQLPPVDISHLVGPSTQVVTQLCLMVREALPVIRSAIDAMDRRPDALFVDHFGT  121

Query  510   EALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPED  689
             +ALP+A ELN+ K+VYVP+ A FTALTVYCPVLD+EI G+YV+Q + L IPGCKP+RPED
Sbjct  122   DALPIAAELNIAKYVYVPSTAWFTALTVYCPVLDQEIEGEYVDQLEDLRIPGCKPIRPED  181

Query  690   VVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVY  869
             VV+PMLDRND QY EY+R+G    ++DGIL N+WED++P T++ALREN+ L  +V  PVY
Sbjct  182   VVEPMLDRNDQQYDEYVRMGKQIPLSDGILFNSWEDLEPKTIQALRENQTLRSIVNIPVY  241

Query  870   AIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQ  1049
              IGPL R IE       + ++ WL +QP ESVL+VSFGSGG LS EQ+TELAWGLELS Q
Sbjct  242   PIGPLRRPIEP--AGPTSELISWLDRQPNESVLFVSFGSGGMLSTEQMTELAWGLELSCQ  299

Query  1050  RFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             RFIWVVRPP+    DDA+ +    +D TP YLPEGF+TRT++ GL+VP WA Q  IL HP
Sbjct  300   RFIWVVRPPTRGRMDDAYLSIHNTSDDTPTYLPEGFSTRTRDVGLLVPTWAPQVEILSHP  359

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVT  1409
             + GGFLSHCG +STLESI NGVP+IAWPLY+EQR NAT L EEVGVA+RP  LPTK +V 
Sbjct  360   AVGGFLSHCGWSSTLESITNGVPMIAWPLYAEQRMNATFLVEEVGVAVRPGVLPTKQVVG  419

Query  1410  REEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAI  1565
             REE++ L + +++ K+G+ MRE+  +LK+S   ++  GGSSY SMCE+L+ I
Sbjct  420   REEIERLARSLIEHKEGQRMREKAKQLKLSGMDSLGHGGSSYKSMCEILSKI  471



>ref|XP_009622863.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/480 (55%), Positives = 358/480 (75%), Gaps = 10/480 (2%)
 Frame = +3

Query  156   NQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTS  335
             ++S LHIGILSSPG+GH+IP L+L NRLA  HN+K+T+  ITT+ S +E + L+ S LT 
Sbjct  2     DRSQLHIGILSSPGMGHLIPVLVLGNRLATYHNIKITILAITTSSSSSETEFLKKSTLTD  61

Query  336   R---LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFC  506
                 +  + IP VDIS L++++TK   QL LLVR ALP + + +     R DAL+VD FC
Sbjct  62    EKKTIEIIPIPSVDISHLINSSTKVFTQLRLLVREALPKIHSTIASMTHRPDALIVDIFC  121

Query  507   TEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPE  686
             T+ LP+A+E N+PK+ Y PT A    L +YC + D+EI G+YV+ ++ L+IPG K +RP+
Sbjct  122   TQILPIAEEFNIPKYAYHPTTAWTLTLAIYCQIFDKEIEGEYVDLKEPLKIPGSKELRPD  181

Query  687   DVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPV  866
             DVVDP+LDR+D QY EYL+LG+ +   DGIL+NTWED++P T+KALR NE L  ++  PV
Sbjct  182   DVVDPLLDRSDQQYEEYLKLGMEYAAFDGILINTWEDLEPETIKALRNNEKLRSILKVPV  241

Query  867   ---YAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLE  1037
                Y +GPL R +E  + D+   +++WL KQ  ESVL+VSFGSGGTLS +Q+TELAWGLE
Sbjct  242   FPIYPVGPLRRTVETNEPDE---VIEWLDKQNNESVLFVSFGSGGTLSTQQMTELAWGLE  298

Query  1038  LSEQRFIWVVRPPSMRGSDDAFF-TTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQAL  1214
             LS+Q+F+W VRPPS   +D A+  + G+   G P YLPEGF TRT++ GLVVPMWA+Q  
Sbjct  299   LSQQKFVWTVRPPSDGDADSAYLNSAGKETRGMPKYLPEGFLTRTKDIGLVVPMWAKQVE  358

Query  1215  ILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT  1394
             IL H S GGFL+HCG NST+ES+ NGVP+IAWPLY+EQ+ NA LLTEE+GVAIRP  LPT
Sbjct  359   ILGHSSVGGFLTHCGWNSTVESLTNGVPMIAWPLYAEQKMNAALLTEELGVAIRPAVLPT  418

Query  1395  KGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             K +V REE+K +V++++ +K+GK +RE+  KLKMS+E A+S+GGSSYNS+CE++  I  R
Sbjct  419   KKLVKREEIKGMVRMLMYTKEGKTIREKAQKLKMSAENALSVGGSSYNSICELVKDIRSR  478



>gb|EYU28575.1| hypothetical protein MIMGU_mgv1a005593mg [Erythranthe guttata]
Length=478

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/473 (57%), Positives = 347/473 (73%), Gaps = 2/473 (0%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             L I ++SSPG+GH+IP L+LANRLA  HNV +TV  +TTA SP E  LL      + +  
Sbjct  8     LQITMVSSPGMGHLIPMLVLANRLAADHNVTVTVLQVTTAVSPPESNLLHLPVDDNLVQI  67

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             + +PPVDIS L+D +TK V QLCL+VR ALP VR+A+    RR DAL+VD F TE LP+A
Sbjct  68    IQLPPVDISHLIDPSTKVVTQLCLMVRQALPSVRSAIAAMDRRPDALIVDHFGTELLPIA  127

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E NLPK+VY P+ A F AL +Y PVLDREI GQYV+Q + L IPGCKPVRPEDVVDPML
Sbjct  128   AEFNLPKYVYAPSTAWFAALLIYSPVLDREINGQYVDQTEPLRIPGCKPVRPEDVVDPML  187

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DRND QY EY+R+G    + DG+L N+W +++P TL++ + NE +  V+  PVY IGP++
Sbjct  188   DRNDQQYDEYIRMGQEITLFDGVLCNSWPNLEPKTLESFKRNEHMRSVMRNPVYPIGPMS  247

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R ++     + T ++ WL +QP ESV++VSFGSGG LSAEQ TELAWGLELS QRFIWVV
Sbjct  248   RPVQPIT--EKTELISWLDRQPDESVIFVSFGSGGMLSAEQTTELAWGLELSRQRFIWVV  305

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP+    DDAFF    G+D  P+Y PEGF+TRT + GL+VPMWA+Q  IL HPS GGFL
Sbjct  306   RPPTAGRVDDAFFNITNGSDSAPDYFPEGFSTRTGDIGLLVPMWAQQVEILNHPSIGGFL  365

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NST+ESI +GVP+IAWPLY+EQR NA  L EE  VA+RP  LPTK +V R E++ 
Sbjct  366   SHCGWNSTMESITSGVPMIAWPLYAEQRMNAAFLAEEAEVAVRPGVLPTKAVVGRGEIER  425

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKRRDLK  1586
             +V+ +++ ++G +MRE V +LKMS E+++ IGGSSYN + E+L  I  ++  K
Sbjct  426   MVRRVMEEREGVKMRENVKRLKMSGEESLRIGGSSYNFIYEILKVIASKKSHK  478



>ref|XP_009608461.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Nicotiana 
tomentosiformis]
Length=478

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/480 (55%), Positives = 353/480 (74%), Gaps = 10/480 (2%)
 Frame = +3

Query  156   NQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTS  335
             ++S LHI ILSSPG+GH+IP L+L NRLA  +N+K+T+  ITT+ S  E + L+ S LT+
Sbjct  2     DRSQLHIAILSSPGMGHLIPVLVLGNRLAAHYNIKITILAITTSSSSAETEFLKKSTLTN  61

Query  336   R---LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFC  506
                 +  + IP VDIS L++++TK   QL L+VR ALP + + +       DAL+VD FC
Sbjct  62    EKKTIEIIPIPSVDISHLINSSTKVFTQLRLMVREALPKIHSTIASMTHCPDALIVDIFC  121

Query  507   TEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPE  686
             T+ LP+A+E  + K+ Y PT A   AL +YC V D+EI G+YV+ +  L+IPGCK +RP+
Sbjct  122   TQILPIAEEFKISKYAYHPTTAWTLALAIYCQVFDKEIEGEYVDLKDPLKIPGCKALRPD  181

Query  687   DVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPV  866
             DVVDP+LDR+D QY EY++LG+ +   DGIL+NTWED++P T+KALR NE L  ++  PV
Sbjct  182   DVVDPLLDRSDQQYEEYVKLGMEYAAFDGILINTWEDLEPETIKALRINEKLRSILKVPV  241

Query  867   ---YAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLE  1037
                Y +GPL R +E  + D+   ++QWL KQ  ESVL+VSFGSGGTLS +QITELAWGLE
Sbjct  242   FPIYPVGPLRRTVETNEPDE---VIQWLDKQNNESVLFVSFGSGGTLSTKQITELAWGLE  298

Query  1038  LSEQRFIWVVRPPSMRGSDDAFF-TTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQAL  1214
             LS+Q+F+WVVRPPS   +D A+  +TG+   G   YLPEGF TRT++ GLVVPMWA Q  
Sbjct  299   LSQQKFVWVVRPPSDGDADSAYLNSTGKETRGMSGYLPEGFLTRTKDMGLVVPMWANQVE  358

Query  1215  ILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT  1394
             IL H S GGFL+HCG NST+ES+ NGVP+IAWPLY+EQ+ NA +LTEE+GVAIRP  LPT
Sbjct  359   ILGHSSVGGFLTHCGWNSTVESLTNGVPMIAWPLYAEQKMNAAMLTEELGVAIRPAILPT  418

Query  1395  KGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             K +V REE++ +V+I++Q+K+GK ++E   KLK S+E A+S GGSSYNS+CE++  I  R
Sbjct  419   KKLVKREEIQGMVRILMQTKEGKRIKEMAKKLKKSAENALSEGGSSYNSICELVKDIRSR  478



>ref|XP_009759972.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Nicotiana 
sylvestris]
Length=479

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/480 (55%), Positives = 352/480 (73%), Gaps = 11/480 (2%)
 Frame = +3

Query  156   NQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTS  335
             ++S LHI ILSSPG+GH+IP L+L NRLA  HN+K+T+  ITT+ S  E + L+ S LT+
Sbjct  2     DRSQLHIAILSSPGMGHLIPVLVLGNRLATHHNIKITILAITTSSSSAETEFLKKSTLTN  61

Query  336   R---LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFC  506
                 +  + IP VDIS L++++ K   QL LLVR ALP +   +     R DAL+VD FC
Sbjct  62    EKKTIEIIPIPSVDISHLINSSIKVFTQLRLLVREALPKIHCTIASMTHRPDALIVDIFC  121

Query  507   TEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPE  686
             T+ LP+A+E N+ K+ Y PT A   AL +YC V D+EI G+YV+ ++ L+IPGCK +RP+
Sbjct  122   TQILPIAEEFNIFKYAYHPTTAWTLALALYCQVFDKEIEGEYVDLKEPLKIPGCKALRPD  181

Query  687   DVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPV  866
             DVVDP+LDR+D QY EY++LG+ +   DGIL+NTWED++P T+KALR NE L  V+  PV
Sbjct  182   DVVDPLLDRSDQQYEEYVKLGLEYAAFDGILINTWEDLEPETIKALRNNEKLRSVLKVPV  241

Query  867   YAI---GPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLE  1037
             + I   GPL R +E  + D+   +++WL KQ   SVLYVSFGSGGTLS +Q+TELAWGLE
Sbjct  242   FPIFPVGPLRRTVETTERDE---VIKWLDKQNHGSVLYVSFGSGGTLSTKQMTELAWGLE  298

Query  1038  LSEQRFIWVVRPPSMRGSDDAFF-TTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQAL  1214
             LS+Q+F+WVVRPPS   +D A+  +TG+   G P YLPEGF TRT   GLVVPMWA+Q  
Sbjct  299   LSQQKFVWVVRPPSDGDADSAYLNSTGKETRGMPGYLPEGFLTRTNEMGLVVPMWAKQVE  358

Query  1215  ILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT  1394
             IL H S GGFL+HCG NST+ES+ NGVP+IAWPLY+EQ+ NA +LTEE+GVAIRP  LPT
Sbjct  359   ILGHSSVGGFLTHCGWNSTVESLTNGVPMIAWPLYAEQKMNAAMLTEELGVAIRPEVLPT  418

Query  1395  KGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             K +V REE++ +V++++ +K+GK +RE+  KLK S+E A+S GGSSYNS+ E++  I  R
Sbjct  419   K-VVKREEIEGMVRMLMYTKEGKTIREKAKKLKKSAENALSDGGSSYNSIYELVKDIRSR  477



>ref|XP_009623100.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/480 (54%), Positives = 350/480 (73%), Gaps = 11/480 (2%)
 Frame = +3

Query  156   NQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTS  335
             ++S LHI ILSSPG+GH+IP L+L NRLA  +N+K+T+  ITT+ S  E + L+ S LT+
Sbjct  2     DRSQLHIAILSSPGMGHLIPVLVLGNRLAAHYNIKITILAITTSSSSAETEFLKKSTLTN  61

Query  336   RLNNVGI---PPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFC  506
                 + I   P VDIS L++++TK   QL L+VR ALP + + +    RR DAL+VD FC
Sbjct  62    EKKTIEIIPIPSVDISHLINSSTKVFTQLRLMVREALPKIHSTIASMTRRPDALIVDIFC  121

Query  507   TEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPE  686
             T+ LP+A+E  + K+ Y PT A   AL +YC V D+EI G+YV+ +  L+IPGCK +RP+
Sbjct  122   TQILPIAEEFKISKYAYHPTTAWTLALAIYCQVFDKEIEGEYVDLKDPLKIPGCKALRPD  181

Query  687   DVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPV  866
             DVVDP+LDR+D QY EY++LG+ +   DGIL+NTWED++P T+KALR NE L  V+  PV
Sbjct  182   DVVDPLLDRSDQQYEEYVKLGMEYAAFDGILINTWEDLEPETIKALRNNEKLRSVLKMPV  241

Query  867   ---YAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLE  1037
                + +GPL R +E  + D+   ++QWL KQ   SVLYVSFGSGGTLS +Q+TELA GLE
Sbjct  242   LPIFPVGPLRRTVETTERDE---VIQWLDKQNHGSVLYVSFGSGGTLSTQQMTELALGLE  298

Query  1038  LSEQRFIWVVRPPSMRGSDDAFF-TTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQAL  1214
             LS+Q+F+WVVRPP    +D A+  +TG+   G   YLPEGF TRT   GLVV +WA+Q  
Sbjct  299   LSQQKFVWVVRPPFDGDADSAYMNSTGKETRGMSGYLPEGFLTRTNGMGLVVSLWAKQVE  358

Query  1215  ILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT  1394
             IL H S GGFL+HCG NST+ES+ NGVP+IAWPLY+EQ+ NA +LTEE+GVAIRP  LPT
Sbjct  359   ILGHSSVGGFLTHCGWNSTVESLTNGVPMIAWPLYAEQKMNAAMLTEELGVAIRPAVLPT  418

Query  1395  KGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             K +V REE++ +V++++ +K+GK +RE+  KLKMS++ A+S GGSSYNS+CE++  I  R
Sbjct  419   K-VVKREEIEGMVRMLMHTKEGKTIREKAKKLKMSAQNALSDGGSSYNSICELVKDIRSR  477



>ref|XP_009768026.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Nicotiana 
sylvestris]
Length=475

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/477 (53%), Positives = 352/477 (74%), Gaps = 7/477 (1%)
 Frame = +3

Query  156   NQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTS  335
             + S LH+ I+SSPG+GH+IP L+L N+LA  HN+K+T+  ITT+ S  E + L+ S LT+
Sbjct  2     DSSQLHVAIVSSPGMGHLIPVLVLGNQLATYHNIKITMLAITTSSSSAETEFLKKSTLTN  61

Query  336   RLNNVGIPPV---DISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFC  506
                 + I PV   DIS L++++TK   +L LLVR  LP +R+A+     R DAL+VD F 
Sbjct  62    EKKTIEIIPVPSNDISHLINSSTKVFTKLRLLVRETLPKIRSAIASMTHRPDALIVDIFG  121

Query  507   TEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPE  686
             T+ LP+A+E N+PK+ Y  T A   AL +YC VL++EI G+YV+ ++ L+IPGCK +RP+
Sbjct  122   TQILPIAEEFNIPKYAYHLTTAWTLALAIYCQVLEKEIEGEYVDLKEPLKIPGCKALRPD  181

Query  687   DVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPV  866
             +V+D +LDR+D QY EY++LG+ +   DGIL+NTWED++P T+ AL+ NE L  ++  PV
Sbjct  182   NVLDQLLDRSDQQYEEYVKLGMEYTDFDGILINTWEDLEPETINALKYNEKLRLLLKVPV  241

Query  867   YAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSE  1046
             + IGPL R +E    D+   ++QWL KQ  ESVL+ SFGSGGTLS +Q+TELAWGLELS+
Sbjct  242   FPIGPLRRKVETTSNDE---VIQWLDKQNNESVLFASFGSGGTLSTKQMTELAWGLELSQ  298

Query  1047  QRFIWVVRPPSMRGSDDAFF-TTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILR  1223
             Q+F+WVVRPPS   +D A+  +TG+   G   YLPEGF TRT++  LVVPMWA Q  IL 
Sbjct  299   QKFVWVVRPPSDGDADSAYLNSTGKETRGMSEYLPEGFLTRTKDMDLVVPMWANQVEILG  358

Query  1224  HPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGI  1403
             H S GGFL+HCG NST+ES+ NGVP+IAWPL++EQ+ NA +LTEE+GVAIRP  LPTK +
Sbjct  359   HSSLGGFLTHCGWNSTMESLTNGVPMIAWPLHAEQKMNAAMLTEELGVAIRPAVLPTKKL  418

Query  1404  VTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             V REE++ +V+I++Q+K+GK + E+  KLKMS+E A+S GGSSYNS+CE++  I+ R
Sbjct  419   VKREEIQGMVRILMQTKEGKPIEEKAKKLKMSAENALSEGGSSYNSICELVKDIQSR  475



>ref|XP_009758472.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Nicotiana 
sylvestris]
Length=504

 Score =   523 bits (1346),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 264/501 (53%), Positives = 358/501 (71%), Gaps = 37/501 (7%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRL-N  344
             LH+GI++SPG GH+IP L+L NRLA  HN+K T+ +IT+ +SP + QLL++ ++  +L +
Sbjct  6     LHVGIVASPGKGHLIPVLVLGNRLAVFHNIKATIIIITSKNSPPDTQLLKTFNVPRKLID  65

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
              V IPPVDIS L+D + K V Q+C++VR ALP +R A++    + DAL+VD   TE + +
Sbjct  66    VVQIPPVDISNLIDTDAKVVTQICVMVRQALPEIRIAIS--TIKPDALIVDLLSTEVMTL  123

Query  525   AD-ELNLPKFVYVPTNARFTALTVY-CPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
                E N+PK+V+VPTNA FTAL +Y   VLD+EI GQYV+    L IPGCKPVRP+DVVD
Sbjct  124   VSREFNMPKYVFVPTNAWFTALAIYSAKVLDKEIEGQYVDHGNILMIPGCKPVRPDDVVD  183

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIG  878
              MLDRND QY E++RLG+ + ++DGIL+NTWE+ +  TLK L ENE L  VV   +Y IG
Sbjct  184   AMLDRNDEQYNEHVRLGIEYTLSDGILINTWEEAECDTLKGLTENERLKSVVKVQIYPIG  243

Query  879   PLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             PL RN+E+++ ++   I++WL KQP ESVLYVSFGSGGTLS++Q+ ELAWGL+LS+QRF+
Sbjct  244   PLRRNVEDKNMEN--WILKWLDKQPSESVLYVSFGSGGTLSSKQMIELAWGLKLSQQRFV  301

Query  1059  WVVRPPSMRGSDDAFFTTGQG-----------------------------ADGTPNYLPE  1151
             WVVRPP   G+D +FF++GQ                               DGT +YLPE
Sbjct  302   WVVRPPCDGGADGSFFSSGQNPEQTAVDKSEKEEDNVKSSCSLCPAQHLPCDGTLDYLPE  361

Query  1152  GFNTRTQNQGLVVPMWAEQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQR  1331
             GF TRT+++GLVV  WA+Q  IL H S  GFLSHCG NST+ES+ NG+P+IAW LY+EQR
Sbjct  362   GFLTRTRDKGLVVQTWAQQVEILSH-SAVGFLSHCGWNSTIESLTNGIPMIAWQLYAEQR  420

Query  1332  QNATLLTEEVGVAIRPMKLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKA  1511
              NAT+LT+E+ VA+RP  LPTK +V REE++ +V+ ++Q  +GK +R +  +L +S+E A
Sbjct  421   LNATMLTKELRVAVRPEFLPTKKVVGREEIEKMVRTIMQYPEGKGIRNKAKQLLISAENA  480

Query  1512  ISIGGSSYNSMCEVLNAIEKR  1574
             +  GGSSYNSMC+VL  IE +
Sbjct  481   LRKGGSSYNSMCKVLKDIENK  501



>emb|CDP02806.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   520 bits (1339),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 260/477 (55%), Positives = 345/477 (72%), Gaps = 19/477 (4%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             MDN   + LH+ I+SSPG+GH+IP L+L NRLA VH V++T+ VITT++S  ER+ L++ 
Sbjct  1     MDN---AKLHVAIVSSPGMGHVIPVLVLGNRLATVHGVRVTILVITTSNSDEERRFLKTL  57

Query  324   DLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFF  503
              L++ +  + +PPVDISA +   T  V QLC+ VR ALP +R+++       DAL++D F
Sbjct  58    TLSTLVRVIALPPVDISAKITPATAAVTQLCMSVREALPIIRSSIASMNCGPDALILDLF  117

Query  504   CTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRP  683
             C  A+P+A E +LP +VY PTNA  T L +Y  VLD+EI G+YVEQ++ L IPGCK VRP
Sbjct  118   CPSAIPIAREFSLPVYVYAPTNAWSTTLFMYIQVLDKEIEGRYVEQKEPLRIPGCKSVRP  177

Query  684   EDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP  863
             EDVVDPMLDRND QY +Y+ LG+G   +DGIL+NTW D++P TLKALRENE L   V   
Sbjct  178   EDVVDPMLDRNDQQYHDYIELGIGLTRSDGILVNTWADLEPTTLKALRENETLKPAVKVS  237

Query  864   VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELS  1043
             VY +GPLTR +E       + +++WL +QP +SV+YVSFGSGG LSA+QI ELA+GLELS
Sbjct  238   VYPVGPLTRPVEPSSLK--SKVLEWLDEQPVDSVIYVSFGSGGVLSADQIKELAFGLELS  295

Query  1044  EQRFIWVVRPP---SMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQAL  1214
             +QRFIWVVR P    +  SDD             +YLP GF  RT+N G VVP+WA+Q  
Sbjct  296   QQRFIWVVRLPLDGGLSKSDDPL-----------DYLPGGFLNRTKNVGFVVPLWAQQVE  344

Query  1215  ILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT  1394
             IL HPS GGFLSHCG NSTLESI  GVP+IAWPLY+EQ+ NA +LTE++GVA+RP  LPT
Sbjct  345   ILGHPSVGGFLSHCGWNSTLESISAGVPMIAWPLYAEQKLNAAMLTEDLGVAVRPEVLPT  404

Query  1395  KGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAI  1565
             K +V REEV+ +V++++Q K+G+EMR+++ +LK S++  +S  GSS+ SM  VL+ I
Sbjct  405   KKMVEREEVEKMVRMVMQQKEGQEMRQKMKQLKSSADDGLSNRGSSFISMYNVLDEI  461



>ref|XP_004233506.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Solanum 
lycopersicum]
Length=471

 Score =   515 bits (1326),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 256/476 (54%), Positives = 348/476 (73%), Gaps = 9/476 (2%)
 Frame = +3

Query  156   NQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTS  335
             + + LH+ I SSPG+GH+IP L+L N+LA  HN+K+T+  ITT  S  E + L+      
Sbjct  2     DSTQLHVAIFSSPGMGHLIPVLVLGNQLATHHNIKITILTITTNSSSPEIEFLKKK---K  58

Query  336   RLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEA  515
              +  + +P VDIS L+D+NTK + QL L+VR ALPG+R+ +     RLDAL+VD F T+ 
Sbjct  59    NIEIIHVPSVDISHLIDSNTKVLTQLRLMVREALPGIRSVIASMNHRLDALIVDIFGTQI  118

Query  516   LPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVV  695
             LP+A E N+ K+V+  T+A   AL +Y  VLD++  G+YV+ ++ LEIPGCK +RP+DVV
Sbjct  119   LPIAQEFNIAKYVFHTTSAWALALFIYLQVLDQKTEGEYVDLKQPLEIPGCKALRPDDVV  178

Query  696   DPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSK--VVGKPVY  869
             DPM+DR+D QY EYL+L + +   DGIL+NTWED++  T+KALR NE L +   V  P+Y
Sbjct  179   DPMMDRSDQQYHEYLKLTIEYTCFDGILINTWEDLEGETIKALRSNEKLQQGLKVPLPIY  238

Query  870   AIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQ  1049
              IGPL R +E  + D+   ++QWL KQ  ES+L+VSFGSGG LS++Q+ ELAWGLELS+Q
Sbjct  239   PIGPLRRTVEITERDE---VIQWLDKQNYESILFVSFGSGGALSSQQMIELAWGLELSQQ  295

Query  1050  RFIWVVRPPSMRGSDDAFF-TTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRH  1226
             +F+WVVRPPS    D+A+  + G    GT  YLPEGF TRT++ GLVVPMWA Q  IL H
Sbjct  296   KFVWVVRPPSDGDPDNAYLKSNGSDTRGTFEYLPEGFLTRTKDMGLVVPMWANQVEILSH  355

Query  1227  PSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIV  1406
              S GGF+SHCG NST+ES+ NGVP+IAWPL++EQ+ NA +LTEE+GVAIRP  LPTK +V
Sbjct  356   SSVGGFMSHCGWNSTVESLTNGVPMIAWPLHAEQKMNAAMLTEELGVAIRPAVLPTKKMV  415

Query  1407  TREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
              REE++ +V+I++ +K+GK +RE+  KLK+S+E A+S GGSSYNSMCE++  I  R
Sbjct  416   KREEIQGMVRILMDTKEGKSIREKAKKLKISAENALSEGGSSYNSMCELVKDIRTR  471



>gb|AIL51397.1| glycosyltransferase [Actinidia deliciosa]
Length=478

 Score =   506 bits (1303),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 255/467 (55%), Positives = 335/467 (72%), Gaps = 12/467 (3%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITT-ADSPTERQLLESSDLTSRLN  344
             LH  +L SPG GH+IP L L  RL   H + +T+ V+TT A S     LL+++  +++ N
Sbjct  6     LHAAMLCSPGTGHLIPVLELGKRLLTNHFLHVTILVVTTPASSGQAHLLLQTNTGSTQPN  65

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
              + +PPVDIS L+   TK V QL +++R A P +R+AL+    +    V D F TE+  +
Sbjct  66    IIELPPVDISCLITTTTKVVTQLSIIMREARPAIRSALSNMDPQPTIFVADLFGTESFEI  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A+EL +PK+ YVP+ A FTALT YCPVLD+EI GQYV++ + L IPGC+PVRPE+VVDPM
Sbjct  126   AEELRIPKYTYVPSTAWFTALTSYCPVLDKEIAGQYVDRTEPLRIPGCRPVRPEEVVDPM  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR D QY EYLR+GV   + DGIL+NTWED++  +L+ALR +E    ++  PVYAIGPL
Sbjct  186   LDRTDQQYYEYLRMGVELSLFDGILLNTWEDLERKSLEALRGDE----ILKPPVYAIGPL  241

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
             T+ +E    +  T +++WL  QP ESV++VSFGSGGTLSAEQITELAWGLELS+QRFIWV
Sbjct  242   TKPVEPDSLN--TKLLEWLEDQPGESVIFVSFGSGGTLSAEQITELAWGLELSQQRFIWV  299

Query  1065  VRPPSMRGSDDAFFTTGQGADGT---PNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             VRPP    +D AFF +  G D T    N+LP+GF  RT   G+VVPMW+ Q  IL HPS 
Sbjct  300   VRPPIDGHADAAFFKSSDGPDDTNQESNFLPDGFLARTHKVGMVVPMWSPQMRILSHPSV  359

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFLSHCG NSTLES+ NGVPI+AWPLY+EQR NA +LTEE+GVA+R   LPTK +V R 
Sbjct  360   GGFLSHCGWNSTLESLTNGVPIVAWPLYAEQRMNAVVLTEELGVALRTEVLPTKKVVGRR  419

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
             EV+ LV+ +++  +GK MRER  +++ S + A+  GGSSY S+CE++
Sbjct  420   EVEKLVRSVME--EGKGMRERAKEVRESGKNALRKGGSSYKSLCELI  464



>gb|AIE12490.1| UGT2 [Panax ginseng]
Length=420

 Score =   501 bits (1290),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 239/410 (58%), Positives = 304/410 (74%), Gaps = 2/410 (0%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             LH+ I++SPG+GH+ P LLL NRLA  HN+ +TV V+TT  SP E Q+L ++     LN 
Sbjct  6     LHVAIVASPGLGHLTPVLLLGNRLATHHNIHVTVIVVTTQQSPAESQILHTTTAPKLLNI  65

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             V +P VDIS L+DANTK   QL +++R   P +R+A++    + DAL+VD F +E LP+A
Sbjct  66    VQVPHVDISGLIDANTKVATQLSIMMRETRPRIRSAISAMNHQPDALIVDLFGSELLPIA  125

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             +E  +P++++V + A F ALT YC VLD+EI G+YV+Q++ L+IPGC+PV PEDVVDPML
Sbjct  126   EEFCMPRYIFVTSTAWFVALTTYCQVLDKEIQGEYVDQKEPLKIPGCRPVHPEDVVDPML  185

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR+D QYREY+R GV + M DGILMNTWED++P T++ALR +E L  VV  PVY IGPL+
Sbjct  186   DRSDQQYREYIRHGVEYSMFDGILMNTWEDLEPTTIQALRNDEILQTVVKVPVYPIGPLS  245

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
               +  +     + +++WL  QP +SV+YVSFGSGGTL+AEQ+ ELAWGLE S+QRFIWVV
Sbjct  246   TPV--KPVSQKSELIEWLDTQPSDSVMYVSFGSGGTLAAEQVNELAWGLEQSQQRFIWVV  303

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +D  FFT G G DGTP YLPE F TRTQ  G VVP+WA Q  IL HPS G FL
Sbjct  304   RPPIEGHADGTFFTAGNGPDGTPAYLPERFLTRTQKLGKVVPLWAPQMEILSHPSVGVFL  363

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTK  1397
             SHCG NS LESI NGVP++AWPLY+EQR NATLLTE++GVA RP  LP K
Sbjct  364   SHCGWNSALESISNGVPMVAWPLYAEQRLNATLLTEDLGVAWRPTVLPGK  413



>gb|KCW58588.1| hypothetical protein EUGRSUZ_H01247 [Eucalyptus grandis]
Length=495

 Score =   496 bits (1277),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 247/473 (52%), Positives = 330/473 (70%), Gaps = 10/473 (2%)
 Frame = +3

Query  150   NNNQSM-----LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLL  314
             ++N SM     LH  +LSSPG+GH+IP + L   L   H  ++T+FV+ +  S  E +++
Sbjct  7     SSNSSMEKPKKLHAALLSSPGMGHLIPIMELGKCLVADHGFEVTIFVVPSQASRAEAEII  66

Query  315   ESSDLTSRLNNVGIPPVDISAL-LDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALV  491
             +S+     L+ V +P  D++A  L  N   V +L +++R A    R+AL       D L+
Sbjct  67    DSAMTPKLLDIVELPAPDLTAAGLGPNASMVERLAVMMREARSAFRSALKAMEAPPDVLI  126

Query  492   VDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCK  671
             VD F TE L M DEL +PK+VYVP+NA F AL ++ PVLD+E+ G+YV+Q + L+IPGCK
Sbjct  127   VDLFGTEHLCMGDELRIPKYVYVPSNAWFLALLLHSPVLDKEVKGEYVDQTELLKIPGCK  186

Query  672   PVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKV  851
             PVRPEDVVDPMLDR++ QY EYLR+     M DGIL+N WED+   TL ALR  E L + 
Sbjct  187   PVRPEDVVDPMLDRSNQQYHEYLRIAGEIAMGDGILLNVWEDLQAETLAALRNEEFLGRA  246

Query  852   VGKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWG  1031
             V  PVY +GPL R +  R    G  +++WL KQPRESVL VSFGSGGT+SAEQ+ ELAWG
Sbjct  247   VNGPVYTVGPLIRPV--RPAGLGKELLEWLDKQPRESVLLVSFGSGGTMSAEQLAELAWG  304

Query  1032  LELSEQRFIWVVRPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAE  1205
             LELS QRFIW++R P +   D +FF  G+G   D   ++LP+GF  RT++ GL++P+W  
Sbjct  305   LELSRQRFIWILRKPIVESLDGSFFDVGKGGGDDELSSFLPDGFAVRTRDVGLIIPLWGP  364

Query  1206  QALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMK  1385
             Q  IL HPS GGFLSHCG NSTLESI NGVP+IAWPLY+EQRQNATLL EE+GV IRP +
Sbjct  365   QLDILSHPSVGGFLSHCGWNSTLESIVNGVPMIAWPLYAEQRQNATLLAEEIGVVIRPKE  424

Query  1386  LPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             LP+K IV REE++ L ++++  K+G +MR RV +LK ++EKA++ GG+SY S+
Sbjct  425   LPSKKIVGREEIEKLARMIIAKKEGHQMRARVKELKSTAEKAVTKGGTSYESL  477



>ref|XP_010070032.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Eucalyptus 
grandis]
Length=484

 Score =   495 bits (1275),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 244/462 (53%), Positives = 325/462 (70%), Gaps = 5/462 (1%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             LH  +LSSPG+GH+IP + L   L   H  ++T+FV+ +  S  E ++++S+     L+ 
Sbjct  7     LHAALLSSPGMGHLIPIMELGKCLVADHGFEVTIFVVPSQASRAEAEIIDSAMTPKLLDI  66

Query  348   VGIPPVDISAL-LDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +P  D++A  L  N   V +L +++R A    R+AL       D L+VD F TE L M
Sbjct  67    VELPAPDLTAAGLGPNASMVERLAVMMREARSAFRSALKAMEAPPDVLIVDLFGTEHLCM  126

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+VYVP+NA F AL ++ PVLD+E+ G+YV+Q + L+IPGCKPVRPEDVVDPM
Sbjct  127   GDELRIPKYVYVPSNAWFLALLLHSPVLDKEVKGEYVDQTELLKIPGCKPVRPEDVVDPM  186

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR++ QY EYLR+     M DGIL+N WED+   TL ALR  E L + V  PVY +GPL
Sbjct  187   LDRSNQQYHEYLRIAGEIAMGDGILLNVWEDLQAETLAALRNEEFLGRAVNGPVYTVGPL  246

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R +  R    G  +++WL KQPRESVL VSFGSGGT+SAEQ+ ELAWGLELS QRFIW+
Sbjct  247   IRPV--RPAGLGKELLEWLDKQPRESVLLVSFGSGGTMSAEQLAELAWGLELSRQRFIWI  304

Query  1065  VRPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             +R P +   D +FF  G+G   D   ++LP+GF  RT++ GL++P+W  Q  IL HPS G
Sbjct  305   LRKPIVESLDGSFFDVGKGGGDDELSSFLPDGFAVRTRDVGLIIPLWGPQLDILSHPSVG  364

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFLSHCG NSTLESI NGVP+IAWPLY+EQRQNATLL EE+GV IRP +LP+K IV REE
Sbjct  365   GFLSHCGWNSTLESIVNGVPMIAWPLYAEQRQNATLLAEEIGVVIRPKELPSKKIVGREE  424

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             ++ L ++++  K+G +MR RV +LK ++EKA++ GG+SY S+
Sbjct  425   IEKLARMIIAKKEGHQMRARVKELKSTAEKAVTKGGTSYESL  466



>ref|XP_002264323.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Vitis 
vinifera]
Length=480

 Score =   494 bits (1272),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/479 (50%), Positives = 337/479 (70%), Gaps = 11/479 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L LA RL   H   +TVF I  + SP E QLL S+  +  L+ V
Sbjct  7     HAVLLASPGLGHLIPVLELAKRLVTHHAFHVTVFAIAASASPAETQLLRSATSSKLLHVV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPV+IS L+DA+     ++ +++R  +P  RAA+          +VD F  EAL +A 
Sbjct  67    ELPPVNISGLVDADAAVFTRIAVMMREVIPNFRAAMFAMRVPPSLFIVDLFGFEALEIA-  125

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++PK+ +VPT A   ALT+Y P LD E+ G+YV++ + L +PGCK VRPEDV+DPM++
Sbjct  126   EFDMPKYTFVPTAACALALTLYVPTLDVEVKGEYVDRAEPLRLPGCKSVRPEDVIDPMME  185

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R + QY EY+R+ +G   ADGIL+NTWED++P TL+ALR+++ +++    P+Y IGPL R
Sbjct  186   RRNQQYLEYIRMAIGIPKADGILLNTWEDLEPTTLRALRDHKAMAQFAKVPIYPIGPLIR  245

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
             ++ + +    T ++ WL  QP +SV+YVSFGSGGT S+EQ+ ELAWGLELS+QRFIWVVR
Sbjct  246   SVGQEEVR--TELLDWLDLQPIDSVIYVSFGSGGTYSSEQLAELAWGLELSQQRFIWVVR  303

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP       +FFTTG+G +   +YLPEGF TRT+N G+VVP+WA Q  IL HPS GGFLS
Sbjct  304   PPIENDHSGSFFTTGKGGEHPSDYLPEGFLTRTKNVGMVVPLWAPQVEILSHPSVGGFLS  363

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG  STL+SI NGVP++AWPLY+EQR NAT+LTEE+G+A+RP  LPTK +V +EE++ +
Sbjct  364   HCGWGSTLDSILNGVPMVAWPLYAEQRLNATMLTEELGIAVRPEVLPTKRVVRKEEIEKM  423

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAI-----EKRRDLKIC  1592
             V+ +++    KE+RERV ++  + E+A+  GGSSYNS+ +V +A      E R  +K C
Sbjct  424   VRDVIEE---KELRERVKEVMKTGERALRKGGSSYNSLSQVASAATSFHKEYRSPVKHC  479



>ref|XP_009349753.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like isoform 
X1 [Pyrus x bretschneideri]
Length=479

 Score =   491 bits (1264),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 241/474 (51%), Positives = 327/474 (69%), Gaps = 7/474 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  IL SPG+GH+IPSL LA RL    N  +T+F I +  S TE +LL+++      + +
Sbjct  6     HAAILCSPGLGHLIPSLELAKRLVTHRNFTVTIFAIPSPTSKTESELLKAAATPKFFDII  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAAL--TKQCRRLDALVVDFFCTEALPM  524
              +PP DIS  +  N      L +++R   P  R+A+   +   R   L+VD F TE+L +
Sbjct  66    ELPPPDISGCVGPNVAVATLLAVMMREVRPAFRSAILGMEYSLRPTVLIVDLFSTESLSI  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+VYV + A   ALTVY PV DRE+ G+YV+Q + L IPGCKPV+P+DVVDPM
Sbjct  126   GDELGIPKYVYVASTAWLVALTVYVPVFDREVEGEYVDQTEPLRIPGCKPVQPDDVVDPM  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR D QY EY+R+G  F  +DGILMNTWED++  T+ ALR+   L +V   P+Y IGPL
Sbjct  186   LDRTDQQYLEYVRIGTNFPKSDGILMNTWEDLEHKTIDALRDEGLLGRVAKVPIYPIGPL  245

Query  885   TRNIEERDGDDGTM----IMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             TR+++        +    +  WL KQP ESV++VS GSGGT+S EQ+TE+AWGLELS+QR
Sbjct  246   TRSVQSAGSTSTGLREEGLFNWLDKQPCESVIFVSLGSGGTVSFEQMTEMAWGLELSKQR  305

Query  1053  FIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             FIWVVRPP+ + +D AFFT+G   D    YLP+GF TRT + GL V +WA Q  IL HPS
Sbjct  306   FIWVVRPPA-KSADAAFFTSGNRDDDPSTYLPKGFLTRTHDVGLAVHLWAPQVDILSHPS  364

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
              GGF SHCG NS+LESI NGVP+I WPL++EQR NAT+LTEE+GVA+R   LP+K +V R
Sbjct  365   IGGFWSHCGWNSSLESITNGVPMIVWPLHAEQRMNATMLTEELGVAVRSKVLPSKKVVDR  424

Query  1413  EEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             EE+K +V+ ++  K G+ +R RV +LK+S+ KA S+GGSSYN++ ++ +  +++
Sbjct  425   EEIKEMVRKIMVDKDGQAIRGRVKELKLSAAKAWSVGGSSYNAISQISSGNQRK  478



>gb|KHN24740.1| Anthocyanidin 3-O-glucosyltransferase 5 [Glycine soja]
Length=480

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 330/476 (69%), Gaps = 6/476 (1%)
 Frame = +3

Query  159   QSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSR  338
             Q   H+ +LSSPG+GH+IP++ L  R    HN K+TV  +T+  S  E Q+L S+   S 
Sbjct  4     QKPTHVALLSSPGLGHLIPTIELGKRFVLNHNFKVTVLAVTSQTSRAETQILNSALTPSL  63

Query  339   LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEAL  518
              N + IP  D++ L+  N + + +LC+++R ALP +++ L++   R  AL+VD F TEA+
Sbjct  64    CNVINIPSPDLTGLIHQNDRMLTRLCVMMRQALPTIKSILSEITPRPSALIVDIFGTEAI  123

Query  519   PMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
             P+  +LN+P +VYV + A F +L VY P+LD +I G+YV+Q++ L+IPGC PVRPEDVVD
Sbjct  124   PIGRKLNIPNYVYVASQAWFLSLLVYSPILDEKIEGEYVDQKEALKIPGCNPVRPEDVVD  183

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGK--PVYA  872
              MLDRND +Y+EYL +G G   +DGIL+NTWE++    L+ALRE   LS+ +    PVYA
Sbjct  184   QMLDRNDREYKEYLGVGKGIPQSDGILVNTWEELQRKDLEALREGGLLSEALNMNIPVYA  243

Query  873   IGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             +GPL R  E         ++ WL +QP ESV+YVSFGSGGT+S EQ+TELAWGLELSE R
Sbjct  244   VGPLVREPELETSSVTKSLLTWLDEQPSESVVYVSFGSGGTMSYEQMTELAWGLELSEWR  303

Query  1053  FIWVVRPPSMRGSDDAFFTTGQ-GADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             F+WVVR P    +D AFFTTG  G D    YLPEGF +RT+  GL+VP WA+Q  IL+H 
Sbjct  304   FVWVVRAPMEGTADAAFFTTGSDGVDEVAKYLPEGFVSRTRKVGLLVPEWAQQVTILKHR  363

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVT  1409
             S GGFLSHCG  STLES+ NG+P+IAWPLY+EQR NATLL EE+G+A+R   LPTK +V 
Sbjct  364   SIGGFLSHCGWGSTLESVTNGIPLIAWPLYAEQRMNATLLAEELGLAVRTTVLPTKKVVR  423

Query  1410  REEVKTLVKIMLQSK---KGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             REE+  +V+ +LQ     K  ++RERV +++ S+  A+S GGSSY ++  V   I+
Sbjct  424   REEIARMVREVLQGDENVKSNDIRERVKEVQRSAVNALSEGGSSYVALSHVAKTIQ  479



>ref|XP_002269179.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Vitis 
vinifera]
Length=476

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 238/461 (52%), Positives = 330/461 (72%), Gaps = 7/461 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L LA RL   H  ++TVF I  + SP E Q L S+  +  L+ V
Sbjct  7     HAILLASPGLGHLIPVLELAKRLVTHHGFRVTVFAIAASASPAESQSLGSAASSKLLHVV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PP DIS+L+DA+     ++ +++R  +P  RAA++        ++VDFF  EAL +  
Sbjct  67    ELPPADISSLVDADAAVFTRIVVMMRETIPSFRAAISAMKFPPSLMIVDFFGFEALEIP-  125

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++PK+ +VP+NA   ALT+Y   LD E+ G+YV++ + L++PGCKPVRPEDVVDPMLD
Sbjct  126   EFDMPKYTFVPSNACLLALTLYVATLDVEVKGEYVDRAEPLQLPGCKPVRPEDVVDPMLD  185

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R + QY EY+R+GVG   ADGIL+NTWED++P TLKALR+++ +++    P+Y +GPLTR
Sbjct  186   RRNQQYLEYMRMGVGITKADGILLNTWEDLEPTTLKALRDHKVMAQFAKVPIYPVGPLTR  245

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              + + +    + ++ WL  QP +SV+YVSFGSGGT S+EQ+ ELAWGLELS+QRFIWVVR
Sbjct  246   PVGKEEAR--SELLDWLDLQPADSVIYVSFGSGGTHSSEQLAELAWGLELSQQRFIWVVR  303

Query  1071  PPSMRGSDDAFFTTGQGADGTP-NYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             PP       +FFTTG+G    P +YLPEGF TRT+N G+VVP+WA Q  IL HPS  GFL
Sbjct  304   PPIENDPSGSFFTTGKGRGEHPSDYLPEGFLTRTKNVGVVVPLWAPQVEILSHPSVRGFL  363

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG  STLESI +GVP++AWPLY+EQR NAT+LTEE+G+A+RP  LPTK +V +EE++ 
Sbjct  364   SHCGWGSTLESILSGVPMVAWPLYAEQRLNATMLTEELGIAVRPEVLPTKRVVRKEEIEK  423

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             +V+ +++       RERV ++  S E+A+  GGSSYNS+ +
Sbjct  424   MVRKVMEENHS---RERVKEVMNSGERALRKGGSSYNSLSQ  461



>ref|XP_011025718.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Populus 
euphratica]
Length=486

 Score =   488 bits (1257),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 242/476 (51%), Positives = 326/476 (68%), Gaps = 2/476 (0%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             M+N   S  H+ +L+S GIGH+IP L L  RL   HN  +T+FV+ +  S  E Q+L+S+
Sbjct  1     MENTTDSKPHLVLLASLGIGHLIPILELGKRLFTHHNFDITIFVVVSHSSAAESQVLQSA  60

Query  324   DLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFF  503
                     V +PPVDIS L+  +   V ++C+ +R   P +R+A++    R  AL+VD F
Sbjct  61    MTPKLCEIVELPPVDISRLVSPDAAVVTRICVTMREIKPALRSAISALSFRPAALIVDLF  120

Query  504   CTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRP  683
              ++A+ +ADE  + K+VY+P+NA F ALT+Y P+LD  + G+Y++Q++ L+IPGCK V+P
Sbjct  121   GSQAMMVADEFEMLKYVYIPSNAWFLALTIYMPILDEVVQGEYLDQKEPLKIPGCKAVQP  180

Query  684   EDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP  863
             EDVVDPMLDR D QY EY+R+ +     DGIL+N WED++P TL+ALR+ E L ++   P
Sbjct  181   EDVVDPMLDRTDQQYLEYVRMAMEIPTCDGILLNIWEDLEPKTLEALRDEELLGQLCKAP  240

Query  864   VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELS  1043
             VY +GPLTR  +  D   G + + WL KQP ESV+YVSFGSGGTLS EQ  ELAWGLELS
Sbjct  241   VYPVGPLTRPPKPLDSRSGELFI-WLDKQPGESVIYVSFGSGGTLSLEQTVELAWGLELS  299

Query  1044  EQRFIWVVRPPSMRGSDDAFFTTGQG-ADGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             +QRFIWVVR PS +  D +FF+ G G A    +  PEGF  R Q  GLV+  WA Q  IL
Sbjct  300   QQRFIWVVRSPSRKKGDGSFFSAGSGEASSMASCFPEGFLDRIQEVGLVIQDWAPQVDIL  359

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
              HPS GGF+SHCG NSTLESI NGVP+IAWPLYSEQR NA LLTEE+GVA+RP  L ++G
Sbjct  360   NHPSVGGFISHCGWNSTLESITNGVPMIAWPLYSEQRMNAALLTEELGVAVRPSILASEG  419

Query  1401  IVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             +V REE++ +++ +   K+   ++ RV KLK S+ + IS GGSS+N++  V    E
Sbjct  420   MVGREEIEMMIRKITVDKEATNIKNRVKKLKYSAAETISKGGSSHNALSLVAKQCE  475



>ref|XP_002310202.1| UTP-glucose glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE90652.1| UTP-glucose glucosyltransferase family protein [Populus trichocarpa]
Length=486

 Score =   488 bits (1257),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 241/476 (51%), Positives = 325/476 (68%), Gaps = 2/476 (0%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             M+N   S  H+ +L+S GIGH+IP L L  RL   HN  +T+FV+ +  S  E Q+L+S+
Sbjct  1     MENTTDSKPHLVLLASLGIGHLIPILELGKRLFTHHNFDITIFVVVSHSSAAESQVLQSA  60

Query  324   DLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFF  503
                     V +PPV+IS L+  +     Q+C+ +R   P +R+A++    R  AL+VD F
Sbjct  61    MTPKLCEIVELPPVNISRLVSPDAAVATQICVTMREIKPALRSAISALSFRPAALIVDLF  120

Query  504   CTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRP  683
              ++A+ +ADE  +PK+VY+P+NA F ALT+Y P+LD  + G+Y++Q++ L+IPGCK V+P
Sbjct  121   GSQAMMVADEFEMPKYVYIPSNAWFLALTIYMPILDEVVQGEYLDQKEPLKIPGCKAVQP  180

Query  684   EDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP  863
             EDVVDPMLDR D QY EY+R+G+     DGIL+N WED++P TL+ALR+ E L ++   P
Sbjct  181   EDVVDPMLDRTDQQYLEYVRMGMEIPKCDGILLNIWEDLEPKTLEALRDEELLGQLCKVP  240

Query  864   VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELS  1043
             VY +GPLTR ++  D   G + + WL KQP ESV+YVSFGSGGTLS EQ+ ELAWGLELS
Sbjct  241   VYPVGPLTRPLKPLDSRSGELFL-WLDKQPSESVIYVSFGSGGTLSLEQMVELAWGLELS  299

Query  1044  EQRFIWVVRPPSMRGSDDAFFTTGQG-ADGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             +QRFIWV R PS +  D +FFT G   A+   +  PEGF  R Q  GLV+  WA Q  IL
Sbjct  300   QQRFIWVGRSPSRKTGDGSFFTAGSCEANSMASCFPEGFLDRIQEVGLVIQDWAPQVDIL  359

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
              HPS GGF+SHCG NSTLESI NGVP+IAWPLYSEQR NA LLTEE+GVA+RP  L + G
Sbjct  360   NHPSVGGFISHCGWNSTLESITNGVPMIAWPLYSEQRMNAALLTEELGVAVRPNILASDG  419

Query  1401  IVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             +V REE++ +++ +   K+   +R RV KLK  + + +  GGSSYN++  V    E
Sbjct  420   MVGREEIEMMIRKITVDKEATNIRNRVKKLKYRAAETLRKGGSSYNALSLVAKECE  475



>ref|XP_003527240.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Glycine 
max]
Length=480

 Score =   488 bits (1255),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 329/476 (69%), Gaps = 6/476 (1%)
 Frame = +3

Query  159   QSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSR  338
             Q   H+ +LSSPG+GH+IP++ L  R    HN K+TV  +T+  S  E Q+L S+   S 
Sbjct  4     QKPTHVALLSSPGLGHLIPTIELGKRFVLNHNFKVTVLAVTSQTSRAETQILNSALTPSL  63

Query  339   LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEAL  518
              N + IP  D++ L+  N + + +LC+++R ALP +++ L++   R  AL+VD F TEA+
Sbjct  64    CNVINIPSPDLTGLIHQNDRMLTRLCVMMRQALPTIKSILSEITPRPSALIVDIFGTEAI  123

Query  519   PMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
             P+  +LN+P +VYV + A F +L VY P+LD +I G+YV+Q++ L+IPGC PVRPEDVVD
Sbjct  124   PIGRKLNIPNYVYVASQAWFLSLLVYSPILDEKIEGEYVDQKEALKIPGCNPVRPEDVVD  183

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGK--PVYA  872
              MLDRND +Y+EYL +G G   +DGIL+NTWE++    L+ALRE   LS+ +    PVYA
Sbjct  184   QMLDRNDREYKEYLGVGKGIPQSDGILVNTWEELQRKDLEALREGGLLSEALNMNIPVYA  243

Query  873   IGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             +GPL R  E         ++ WL +QP ESV+YVSFGSGGT+S EQ+TELAWGLELSE R
Sbjct  244   VGPLVREPELETSSVTKSLLTWLDEQPSESVVYVSFGSGGTMSYEQMTELAWGLELSEWR  303

Query  1053  FIWVVRPPSMRGSDDAFFTTGQ-GADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             F+WVVR P    +D AFFTTG  G D    YLPEGF +RT+  GL+VP WA+Q  IL+H 
Sbjct  304   FVWVVRAPMEGTADAAFFTTGSDGVDEVAKYLPEGFVSRTRKVGLLVPEWAQQVTILKHR  363

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVT  1409
             S GGFLSHCG  STLES+ NG+P+IAWPLY+EQR NATLL EE+G+A+R   LPTK +V 
Sbjct  364   SIGGFLSHCGWGSTLESVTNGIPLIAWPLYAEQRMNATLLAEELGLAVRTTVLPTKKVVR  423

Query  1410  REEVKTLVKIMLQSK---KGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             REE+  +V+ +LQ     K   +RERV +++ S+  A+S GGSSY ++  V   I+
Sbjct  424   REEIARMVREVLQGDENVKSNGIRERVKEVQRSAVNALSEGGSSYVALSHVAKTIQ  479



>sp|Q40287.1|UFOG5_MANES RecName: Full=Anthocyanidin 3-O-glucosyltransferase 5; AltName: 
Full=Flavonol 3-O-glucosyltransferase 5; AltName: Full=UDP-glucose 
flavonoid 3-O-glucosyltransferase 5 [Manihot esculenta]
 emb|CAA54612.1| UTP-glucose glucosyltransferase [Manihot esculenta]
Length=487

 Score =   488 bits (1255),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 243/469 (52%), Positives = 327/469 (70%), Gaps = 6/469 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +LSSPG+GH+IP L L  R+  + N  +T+F++ +  S  E Q+L S+        +
Sbjct  11    HIVLLSSPGLGHLIPVLELGKRIVTLCNFDVTIFMVGSDTSAAEPQVLRSAMTPKLCEII  70

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PP +IS L+D       +L +L+R   P  RAA++    R  A++VD F TE+L +A 
Sbjct  71    QLPPPNISCLIDPEATVCTRLFVLMREIRPAFRAAVSALKFRPAAIIVDLFGTESLEVAK  130

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             EL + K+VY+ +NA F ALT+Y P+LD+E+ G++V Q++ ++IPGC+PVR E+VVDPMLD
Sbjct  131   ELGIAKYVYIASNAWFLALTIYVPILDKEVEGEFVLQKEPMKIPGCRPVRTEEVVDPMLD  190

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R + QY EY RLG+    ADGILMNTWE ++P T  ALR+ + L +V   PV+ IGPL R
Sbjct  191   RTNQQYSEYFRLGIEIPTADGILMNTWEALEPTTFGALRDVKFLGRVAKVPVFPIGPLRR  250

Query  891   NIEERDGDDGT--MIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
                 + G  G+   ++ WL +QP+ESV+YVSFGSGGTLS EQ+ ELAWGLE S+QRFIWV
Sbjct  251   ----QAGPCGSNCELLDWLDQQPKESVVYVSFGSGGTLSLEQMIELAWGLERSQQRFIWV  306

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VR P+++  D AFFT G GAD    Y PEGF TR QN GLVVP W+ Q  I+ HPS G F
Sbjct  307   VRQPTVKTGDAAFFTQGDGADDMSGYFPEGFLTRIQNVGLVVPQWSPQIHIMSHPSVGVF  366

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             LSHCG NS LESI  GVPIIAWP+Y+EQR NATLLTEE+GVA+RP  LP K +V REE++
Sbjct  367   LSHCGWNSVLESITAGVPIIAWPIYAEQRMNATLLTEELGVAVRPKNLPAKEVVKREEIE  426

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEK  1571
              +++ ++  ++G E+R+RV +LK S EKA++ GGSS+N M  + N  EK
Sbjct  427   RMIRRIMVDEEGSEIRKRVRELKDSGEKALNEGGSSFNYMSALGNEWEK  475



>ref|XP_010070031.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Eucalyptus 
grandis]
Length=494

 Score =   487 bits (1254),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 243/462 (53%), Positives = 324/462 (70%), Gaps = 5/462 (1%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             LH  +LSS G+GH++P + L  RL   H  ++TVFV+ +  S  E +++ES+     L+ 
Sbjct  17    LHAALLSSLGMGHLVPIIELGKRLVADHGFEVTVFVLRSQTSRAEAEIIESAMTPKLLDI  76

Query  348   VGIPPVDISAL-LDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +PP D++A  L  +    A+L  ++R A    R+AL     R D L+VD F TE L +
Sbjct  77    VELPPPDLAATGLSPDESVFARLAAMMREARHVFRSALLAMEARPDVLIVDLFGTEHLCI  136

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+VYV T+A F AL ++ P LD+E+ G+Y ++ + LEIPGCKPVRPEDV DPM
Sbjct  137   GDELGIPKYVYVATSAWFLALLLHSPTLDKEVKGEYADRTEPLEIPGCKPVRPEDVSDPM  196

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+ +QYR+++R+     M DGIL+N WED+   TL ALR  E L +VV  PVY +GPL
Sbjct  197   LDRSQLQYRDFVRIAEEIPMGDGILLNVWEDLQAGTLAALRNEEFLGRVVNSPVYTVGPL  256

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R +  R       + +WL KQPRESVL+VSFGSGGTLSAEQ+ ELAWGLELS QRFIW+
Sbjct  257   IRPV--RTAGLEKELQEWLDKQPRESVLFVSFGSGGTLSAEQLVELAWGLELSRQRFIWI  314

Query  1065  VRPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             +R P  +  D +FF  G+G   D   ++LP+GF  RT+  GL++P+W  Q  IL HPS G
Sbjct  315   LRKPIAKSLDGSFFDVGKGGSDDELLSFLPDGFVARTREVGLILPLWGPQVDILSHPSVG  374

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFLSHCG NSTLESI NGVP+IAWPLY+EQRQNATLL EE+GVAIRP +LP+K IV REE
Sbjct  375   GFLSHCGWNSTLESILNGVPMIAWPLYAEQRQNATLLAEEIGVAIRPKELPSKKIVGREE  434

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             ++ LV+++L  K+G +MR RV +LK ++EKA++ GG+SY S+
Sbjct  435   IEKLVRMILVEKEGYKMRARVKELKSTAEKAVTKGGTSYESL  476



>ref|XP_004300603.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   486 bits (1251),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 249/486 (51%), Positives = 331/486 (68%), Gaps = 8/486 (2%)
 Frame = +3

Query  153   NNQSMLHIGILSSPGIGHIIPSLLLANRL-AGVHNVKLTVFVITTADSPTERQLLESSDL  329
              + S LH  IL+SPG+GHIIP + L  RL A   NV +T+F +++  S  E Q ++ +  
Sbjct  2     GSNSTLHAAILTSPGLGHIIPVIELGKRLIAANRNVTVTIFAMSST-SQAEYQTIKEATS  60

Query  330   TSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCT  509
             T++LN V +PPVDIS L+      V  L + +R   P  R+AL         L+VDFF T
Sbjct  61    TAKLNVVELPPVDISGLVHPKAAVVTCLAVWMREIRPVFRSALQDMASPPTMLIVDFFGT  120

Query  510   EALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPED  689
             E+LP+ADEL +PKFVYVP NA F AL  Y P LD+E+ G+YV++ + L+IPGC+PVRPE+
Sbjct  121   ESLPIADELGIPKFVYVPCNAWFLALMTYSPTLDKEVEGEYVDRTEPLKIPGCRPVRPEE  180

Query  690   VVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGK-PV  866
             V DPMLDR + QY EY+R      + DGI +NTWE++ P TL + R+ + L  V+   PV
Sbjct  181   VADPMLDRTNQQYSEYIRFCGEIPLCDGIFLNTWEELQPTTLASFRDEKLLGGVIKMVPV  240

Query  867   YAIGPLTRNIEERDGDD--GTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLEL  1040
             Y IGPLTR +  R G       + +WL KQP ESVL+VS GSGGTLS EQ+TE+AWGLEL
Sbjct  241   YPIGPLTRAVRSRSGHPRVDQDLFEWLDKQPSESVLFVSLGSGGTLSYEQMTEMAWGLEL  300

Query  1041  SEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             S+QRFIWVVRPP+ + SD AFFT+G G      Y PEGF TRT   GLVVP+WA Q  IL
Sbjct  301   SQQRFIWVVRPPTTK-SDAAFFTSGNGDGDLSTYFPEGFLTRTSGIGLVVPLWAPQVDIL  359

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
              HPS GGF++HCG NS LES+ NGV +IAWPLY+EQR NAT LTEE+GVA+R    P K 
Sbjct  360   GHPSVGGFITHCGWNSALESVTNGVQMIAWPLYAEQRLNATSLTEELGVAVRSEVPPWKK  419

Query  1401  IVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKRRD  1580
             +V REE++ +V+ ++  K G +++ RV +LK S EKA+  GGSSYN++ ++++  +  +D
Sbjct  420   VVGREEIERMVRKIIVEKDGFKIKSRVKELKQSGEKALREGGSSYNALSQMVS--KAMQD  477

Query  1581  LKICTQ  1598
             L++  Q
Sbjct  478   LQMKDQ  483



>ref|XP_010070027.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Eucalyptus 
grandis]
 gb|KCW58583.1| hypothetical protein EUGRSUZ_H01241 [Eucalyptus grandis]
Length=484

 Score =   485 bits (1248),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 243/472 (51%), Positives = 324/472 (69%), Gaps = 5/472 (1%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             L + +LSSPG+GH+IP + L   L   H  + TVFV+    S  E ++++S+     L+ 
Sbjct  7     LRVALLSSPGLGHLIPVIELGKCLVADHGFEATVFVLPLQASRAEAEIIKSAMTPKLLDI  66

Query  348   VGIPPVDISAL-LDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +PP D+SA  L  +     +L +++R A P  R+AL     R D L+VD F  E L +
Sbjct  67    VELPPPDLSASGLSPDATMTMRLVVMMREARPAFRSALEAMEDRPDLLIVDMFGAEYLCI  126

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+V+VP+NA F AL +Y P LD+E+ G+YV++ + LEIPGCKP+RPEDVVD M
Sbjct  127   GDELGIPKYVFVPSNAWFLALFIYSPALDKEVKGEYVDRTEPLEIPGCKPLRPEDVVDSM  186

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+D QY EY++   G    DGIL+N WED+   TL ALR  E L +VV  PVY  GPL
Sbjct  187   LDRSDQQYHEYVQRAGGIPTGDGILLNVWEDLQAETLTALRNEEFLGRVVNGPVYTAGPL  246

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
             TR +  R    G  +++WL KQP ESV++VSFGSGGT+SAEQ  ELAWGLELS+QRFIWV
Sbjct  247   TRPV--RPAGLGKELLEWLDKQPSESVMFVSFGSGGTMSAEQQVELAWGLELSQQRFIWV  304

Query  1065  VRPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             +R P+++  D +FF  G+G   D   ++LP GF   T+  G ++P WA Q  IL HPS G
Sbjct  305   LRRPTVKALDGSFFDVGKGDADDEVLSFLPSGFTAHTRGIGFILPSWASQVEILSHPSVG  364

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFLSHCG NSTLESI NGVP+IAWPLY+EQR NATLLTEE+GVA+RP  LP+K IV REE
Sbjct  365   GFLSHCGWNSTLESIVNGVPMIAWPLYAEQRLNATLLTEEIGVAVRPKVLPSKKIVGREE  424

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             ++ LV+ ++  K+G  +R+RV  LK S++KA++ GGSSY S+C++    + R
Sbjct  425   IEKLVRTIMVEKEGHTLRDRVRDLKSSAQKAMARGGSSYESLCKMKEDCQMR  476



>ref|XP_009349754.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like isoform 
X2 [Pyrus x bretschneideri]
Length=476

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 240/474 (51%), Positives = 326/474 (69%), Gaps = 10/474 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  IL SPG+GH+IPSL LA RL    N  +T+F I +  S TE +LL+++      + +
Sbjct  6     HAAILCSPGLGHLIPSLELAKRLVTHRNFTVTIFAIPSPTSKTESELLKAAATPKFFDII  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAAL--TKQCRRLDALVVDFFCTEALPM  524
              +PP DIS  +  N      L +++R   P  R+A+   +   R   L+VD F TE+L +
Sbjct  66    ELPPPDISGCVGPNVAVATLLAVMMREVRPAFRSAILGMEYSLRPTVLIVDLFSTESLSI  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+VYV + A   ALTVY PV DRE+ G+YV+Q + L IPGCKPV+P+DVVDPM
Sbjct  126   GDELGIPKYVYVASTAWLVALTVYVPVFDREVEGEYVDQTEPLRIPGCKPVQPDDVVDPM  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR D QY EY+R+G  F  +DGILMNTWED++  T+ ALR+   L +V   P+Y IGPL
Sbjct  186   LDRTDQQYLEYVRIGTNFPKSDGILMNTWEDLEHKTIDALRDEGLLGRVAKVPIYPIGPL  245

Query  885   TRNIEERDGDDGTM----IMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             TR+++        +    +  WL KQP ESV++VS GSGGT+S EQ+TE+AWGLELS+QR
Sbjct  246   TRSVQSAGSTSTGLREEGLFNWLDKQPCESVIFVSLGSGGTVSFEQMTEMAWGLELSKQR  305

Query  1053  FIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             FIWVVRPP+ + +D AFFT+    D    YLP+GF TRT + GL V +WA Q  IL HPS
Sbjct  306   FIWVVRPPA-KSADAAFFTSD---DDPSTYLPKGFLTRTHDVGLAVHLWAPQVDILSHPS  361

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
              GGF SHCG NS+LESI NGVP+I WPL++EQR NAT+LTEE+GVA+R   LP+K +V R
Sbjct  362   IGGFWSHCGWNSSLESITNGVPMIVWPLHAEQRMNATMLTEELGVAVRSKVLPSKKVVDR  421

Query  1413  EEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             EE+K +V+ ++  K G+ +R RV +LK+S+ KA S+GGSSYN++ ++ +  +++
Sbjct  422   EEIKEMVRKIMVDKDGQAIRGRVKELKLSAAKAWSVGGSSYNAISQISSGNQRK  475



>ref|XP_010649186.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like isoform 
X3 [Vitis vinifera]
 ref|XP_010649187.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like isoform 
X3 [Vitis vinifera]
 ref|XP_010649188.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like isoform 
X3 [Vitis vinifera]
Length=463

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 239/461 (52%), Positives = 320/461 (69%), Gaps = 13/461 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +LSSPG+GH+IP L L  RL   H   +TVF I+ + SP E QLL+S      LN V
Sbjct  7     HAALLSSPGLGHLIPMLELGKRLVTHHGFDVTVFTISASTSPAESQLLQSIASPQLLNMV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S L+DA+ K V ++  ++R  +P  R A++    R   L++DFF  EAL +  
Sbjct  67    ELPPVDMSNLVDADAKLVTRIAAIMREIIPRFRTAISGMKVRPTVLILDFFGFEALHIL-  125

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++PK++Y P  A F +L+VY P+LD E+ G+YV++ + L +PGCKPVRPEDVVDPMLD
Sbjct  126   EFDMPKYIYFPGTAWFLSLSVYAPILDMEVEGEYVDRTEPLSLPGCKPVRPEDVVDPMLD  185

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R + +Y +Y+R+G G    DGIL+N WED++P TL+ALR+ E ++  V  P+Y IGPLTR
Sbjct  186   RTNQEYLQYVRMGAGLSKCDGILLNMWEDLEPTTLRALRDEEAMAPFVKVPIYPIGPLTR  245

Query  891   ---NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
                 +  R+      ++ WL  QP ESV+YVSFGSGGT++ EQ+TELAWGLELS+ RFIW
Sbjct  246   CPGGVAPRE------LLDWLDLQPTESVIYVSFGSGGTITIEQLTELAWGLELSQHRFIW  299

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVRPP       ++FT G G D    YLP GF  RT+  G+V+P WA Q  ILRHPS GG
Sbjct  300   VVRPPIQNNLYGSYFTLGNGGDDPIRYLPVGFLGRTKTIGIVIPNWAPQVDILRHPSVGG  359

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FLSHCG +STLESI N VP+IAWPL++EQR NAT++TE++G+A+RP  LPTK +V REE+
Sbjct  360   FLSHCGWSSTLESIVNAVPMIAWPLFAEQRLNATIVTEDLGIAVRPEVLPTKRVVRREEI  419

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             + +V+ ++     KEMR RV +LK S E A+S G SSYNS+
Sbjct  420   EKMVRRVMVD---KEMRNRVKELKKSGESALSKGASSYNSL  457



>ref|XP_007203879.1| hypothetical protein PRUPE_ppa005112mg [Prunus persica]
 gb|EMJ05078.1| hypothetical protein PRUPE_ppa005112mg [Prunus persica]
Length=477

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 243/468 (52%), Positives = 324/468 (69%), Gaps = 11/468 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  IL SPG+GH+IP + LA RL   HNV +T+F + +  S  E +LL+++      + +
Sbjct  9     HAAILCSPGMGHLIPVIELAKRLVNHHNVMVTIFAVQSNTSEAESELLKAATSPKFCDII  68

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAA-LTKQCRRLDALVVDFFCTEALPMA  527
              +P  DIS LLD +   V +L +++R   P  R+A L +   R   L+VD F TE+LP+ 
Sbjct  69    ELPLPDISGLLDPDAGIVTKLRVMMREIRPAFRSAILAEDSPRPSILIVDLFGTESLPIG  128

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             DEL +PK+VYV  NA F ALTVY P+LD+E+ G+YV+Q + L IPGC  V+PE+V DPML
Sbjct  129   DELGVPKYVYVACNAWFLALTVYVPILDKEVEGEYVDQTEPLRIPGCSLVQPEEVCDPML  188

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
              R D QY EY+R+G     +DGIL+N W+D+ P TL A ++   L  VV  PVY IGPL 
Sbjct  189   KRADQQYLEYVRMGFEIPRSDGILLNIWKDLQPKTLDAFKDESLLGGVVKVPVYPIGPLM  248

Query  888   RNIEE------RDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQ  1049
             R+ +       RD D    +  WL KQP ESV++VS GSGGTL+ EQ+TE+AWGLELS+Q
Sbjct  249   RSAQSAGPTGLRDRD----LFNWLDKQPSESVIFVSLGSGGTLTYEQMTEMAWGLELSQQ  304

Query  1050  RFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             RFIWVVRPP+ + +D AFFT+G+G D   +YLPEGF TRT+  GLVVP+WA Q  IL HP
Sbjct  305   RFIWVVRPPTSKRADAAFFTSGKGDDDPSSYLPEGFLTRTREIGLVVPIWAPQVDILSHP  364

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVT  1409
             S GGF SHCG NSTLESI NGVP+I WPLY+EQR NATLL++E+GVA+R    P KG+V 
Sbjct  365   SIGGFFSHCGWNSTLESIINGVPMIVWPLYAEQRMNATLLSDELGVAVRSKVPPWKGVVE  424

Query  1410  REEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             REE+K +V+ ++  + G  +R +V +LK+S+ KA+S G SSYN++ +V
Sbjct  425   REEIKRMVRKIMVEEDGIAIRGKVNELKLSAVKALSQGDSSYNALSQV  472



>ref|XP_007047010.1| UDP-glucosyl transferase 72E1, putative [Theobroma cacao]
 gb|EOX91167.1| UDP-glucosyl transferase 72E1, putative [Theobroma cacao]
Length=479

 Score =   483 bits (1243),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 234/473 (49%), Positives = 335/473 (71%), Gaps = 3/473 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ +L+SPG+GH+IP L L  RL   HN ++T+FV+ +  S  + QLLESS++   LN V
Sbjct  7     HVALLASPGLGHLIPVLELGKRLVTHHNFRITIFVLASEASTAQNQLLESSNM-DVLNIV  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  +IS  +D     V ++ +++R +LPG+R+A+     R  AL+VD F TEALP+AD
Sbjct  66    SLPSAEISTKVDPGAHIVTKIVVIMRESLPGLRSAIAAMKSRPSALIVDLFGTEALPVAD  125

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E  + K+V++ +NA F  +TVY P +++ +  ++V+Q+K L+IPGCK VR ED ++  L+
Sbjct  126   EFKMLKYVFIASNAWFLGITVYAPTVEKIVDEEHVKQQKPLKIPGCKSVRFEDTLEAYLN  185

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             RND  Y EY R+G+    ADGIL+NT+ED++P TL++L + E L +V   PVY IGP+ R
Sbjct  186   RNDQLYGEYARVGLEIPEADGILVNTFEDLEPATLRSLTDAELLGRVAKVPVYPIGPVVR  245

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +      D   ++ WL KQP +SV+YVSFGSGGTLSA+Q+TE+AWGLE S+QRFIWVVR
Sbjct  246   TLGPLVLADP--VLDWLDKQPSQSVIYVSFGSGGTLSAKQMTEIAWGLEQSQQRFIWVVR  303

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    +   FFT G  +DGTP+YLP+GF TRT+++GLV+PMWA Q  IL HPS GGF+S
Sbjct  304   PPVENDASGTFFTVGNDSDGTPDYLPDGFLTRTRDRGLVLPMWAPQTDILAHPSVGGFVS  363

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NST+ES+ NGVP+IAWPLY+EQ+ NAT+LTEE+G+A+RP    +  IV R+E++ +
Sbjct  364   HCGWNSTMESLLNGVPLIAWPLYAEQKMNATMLTEELGLAVRPKMSTSSRIVERKELEMV  423

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKRRDLKI  1589
             V+ ++  K G+E+R+R  +LK  ++KA+S GGSS  S+ +V   IE     K+
Sbjct  424   VRKIMVDKDGQEIRDRAKELKHIAQKALSKGGSSCTSLSQVAKEIEMSLKAKV  476



>ref|XP_002268983.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like isoform 
X2 [Vitis vinifera]
Length=513

 Score =   484 bits (1246),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 239/462 (52%), Positives = 320/462 (69%), Gaps = 13/462 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +LSSPG+GH+IP L L  RL   H   +TVF I+ + SP E QLL+S      LN V
Sbjct  57    HAALLSSPGLGHLIPMLELGKRLVTHHGFDVTVFTISASTSPAESQLLQSIASPQLLNMV  116

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S L+DA+ K V ++  ++R  +P  R A++    R   L++DFF  EAL +  
Sbjct  117   ELPPVDMSNLVDADAKLVTRIAAIMREIIPRFRTAISGMKVRPTVLILDFFGFEALHIL-  175

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++PK++Y P  A F +L+VY P+LD E+ G+YV++ + L +PGCKPVRPEDVVDPMLD
Sbjct  176   EFDMPKYIYFPGTAWFLSLSVYAPILDMEVEGEYVDRTEPLSLPGCKPVRPEDVVDPMLD  235

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R + +Y +Y+R+G G    DGIL+N WED++P TL+ALR+ E ++  V  P+Y IGPLTR
Sbjct  236   RTNQEYLQYVRMGAGLSKCDGILLNMWEDLEPTTLRALRDEEAMAPFVKVPIYPIGPLTR  295

Query  891   ---NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
                 +  R+      ++ WL  QP ESV+YVSFGSGGT++ EQ+TELAWGLELS+ RFIW
Sbjct  296   CPGGVAPRE------LLDWLDLQPTESVIYVSFGSGGTITIEQLTELAWGLELSQHRFIW  349

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVRPP       ++FT G G D    YLP GF  RT+  G+V+P WA Q  ILRHPS GG
Sbjct  350   VVRPPIQNNLYGSYFTLGNGGDDPIRYLPVGFLGRTKTIGIVIPNWAPQVDILRHPSVGG  409

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FLSHCG +STLESI N VP+IAWPL++EQR NAT++TE++G+A+RP  LPTK +V REE+
Sbjct  410   FLSHCGWSSTLESIVNAVPMIAWPLFAEQRLNATIVTEDLGIAVRPEVLPTKRVVRREEI  469

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMC  1547
             + +V+ ++     KEMR RV +LK S E A+S G SSYNS+ 
Sbjct  470   EKMVRRVMVD---KEMRNRVKELKKSGESALSKGASSYNSLS  508



>ref|XP_006425733.1| hypothetical protein CICLE_v10025490mg [Citrus clementina]
 ref|XP_006466729.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Citrus 
sinensis]
 gb|ESR38973.1| hypothetical protein CICLE_v10025490mg [Citrus clementina]
Length=484

 Score =   483 bits (1243),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 243/472 (51%), Positives = 329/472 (70%), Gaps = 9/472 (2%)
 Frame = +3

Query  153   NNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLT  332
             ++ S  H  +L+SPG+GH+IP L L  RL  ++N  +T+FV+ +  S  E ++L+S+  +
Sbjct  3     SSSSKPHAVLLASPGVGHVIPVLELGKRLVTLYNFDVTIFVVASQTSAAESKILQSAMSS  62

Query  333   SRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTE  512
                + + IP  DIS L+D +   V  + +++R   P  R+A++       AL+VD F TE
Sbjct  63    KLCHVIEIPAPDISGLVDPDAAVVTIISVIMREIKPAFRSAISALKTTPTALIVDLFGTE  122

Query  513   ALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDV  692
             +L +A+EL +PK+VYV TNA   AL VY P LD+ + GQYV Q +   IPGC+P+RPEDV
Sbjct  123   SLAIAEELQIPKYVYVGTNAWCVALFVYAPTLDKTVQGQYVVQNESFNIPGCRPLRPEDV  182

Query  693   VDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYA  872
             VDPMLDR + QY EY+R+G    ++DGIL+NTWED+ P  L ALR+++ L ++   P+Y 
Sbjct  183   VDPMLDRTNQQYFEYVRIGEEIPLSDGILVNTWEDLQPTALTALRDDKSLGRITKVPIYT  242

Query  873   IGPLTRNIEERDGDDGTM--IMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSE  1046
             +GP+ R    R G  G+   +  WL KQP ESVLYVSFGSGGTL+ EQITELAWGLELS+
Sbjct  243   VGPIIR----RLGPAGSWNELFDWLDKQPSESVLYVSFGSGGTLTYEQITELAWGLELSQ  298

Query  1047  QRFIWVVRPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             QRFIWVVR P+    D +FFT G GA  D   + LP+GF +RT + G+VVP WA Q  IL
Sbjct  299   QRFIWVVRLPTETTGDGSFFTAGSGAGDDDLSSLLPDGFLSRTLDIGVVVPQWAPQIDIL  358

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
              HPS GGFLSHCG NSTLESI NGVP+I WPLYSEQR NAT+LTEE+GVAIR   LP+KG
Sbjct  359   THPSVGGFLSHCGWNSTLESITNGVPMIVWPLYSEQRMNATILTEELGVAIRSKVLPSKG  418

Query  1401  IVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEV  1553
             +V REE+KT+V+ +L  ++G E+R +V +L+ S++KA +   GSSY+S+  +
Sbjct  419   VVGREEIKTMVRRILVDEEGYEIRAKVKELQRSAQKAWTRESGSSYSSLARL  470



>ref|XP_007157762.1| hypothetical protein PHAVU_002G096500g [Phaseolus vulgaris]
 gb|ESW29756.1| hypothetical protein PHAVU_002G096500g [Phaseolus vulgaris]
Length=474

 Score =   483 bits (1242),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 238/468 (51%), Positives = 326/468 (70%), Gaps = 6/468 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ ++S PG+GH+IP + LA R    HN K+T+  +T+  S  E Q+L S+  +S  + +
Sbjct  8     HVVLVSCPGLGHLIPVIELAKRFVLHHNFKVTILAVTSQTSRAETQILNSALTSSLFHFI  67

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              IP  DI+AL+  N     +LC+++R A   +R+ L++   R  AL+VD F TEA+P+A 
Sbjct  68    DIPSPDITALVAQNDTVFTRLCVVMREAKIAIRSILSEITPRPSALIVDIFSTEAIPIAR  127

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             ELN+  +V+V ++A   AL +Y PVLD  + GQYV+Q++ L+IPGCKPV+PEDV++PMLD
Sbjct  128   ELNIISYVFVASHAWMLALVIYSPVLDELVEGQYVDQKEPLKIPGCKPVQPEDVIEPMLD  187

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGK--PVYAIGPL  884
             RND QY+EYL +G GF  +DG+L+NTWE++    L+ALRE   LS+ +    PVYA+GPL
Sbjct  188   RNDRQYKEYLAIGNGFLQSDGVLVNTWEELQREELEALREGGLLSEALNMKIPVYAVGPL  247

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R  E         +++WL +QP +SV+YVSFGSGGTLS+EQ+ ELAWGLELSEQRF+WV
Sbjct  248   VRQPELETNSSSESLVKWLDEQPSQSVVYVSFGSGGTLSSEQMRELAWGLELSEQRFLWV  307

Query  1065  VRPPSMRGSDDAFFTTG-QGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VR P  + +D AFFTTG  G D    YLPEGF +RT   GL+VP WA+Q  IL H + GG
Sbjct  308   VRAPIEKNADAAFFTTGSSGIDEVAKYLPEGFVSRTNEVGLLVPEWAQQVTILGHRAIGG  367

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG  STLES+ NGVP+IAWPLY+EQR NA LL EE+GVA+R   LP K +V REE+
Sbjct  368   FLTHCGWGSTLESVTNGVPLIAWPLYAEQRMNAALLAEELGVAVRHRVLPIKKVVRREEI  427

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAI  1565
               +VK   +S K   +RER+ +++ S  KA+S GGSSY ++ ++ N I
Sbjct  428   AEMVK---ESVKSNRVRERMKEVQQSGMKALSEGGSSYVALSKIANTI  472



>ref|XP_008393333.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like isoform 
X1 [Malus domestica]
Length=477

 Score =   483 bits (1242),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 319/465 (69%), Gaps = 5/465 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  IL SPG+GH+IP L LA RL    N  +T+F I +  S  E +LL+++      + V
Sbjct  6     HAAILCSPGLGHLIPVLELAKRLVTHRNFTVTIFAIPSPTSKAESELLKAATTPKFCDIV  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAAL--TKQCRRLDALVVDFFCTEALPM  524
              +PP DIS  +  +   V  L +++R   P  R+A+   K   R   L+VD F TE+L +
Sbjct  66    ELPPPDISGCVGPDAAVVTLLAVMMREVRPAFRSAILGIKPPLRPTVLIVDLFSTESLSI  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+V++  NA F ALTVY  VLD+E+ G+YV+Q + L IPGCKPVRPEDVVDPM
Sbjct  126   GDELGIPKYVFIACNAWFLALTVYVRVLDKEVEGEYVDQTEPLRIPGCKPVRPEDVVDPM  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR D QY EY+R+G  F  +DGIL+NTWED+   TL A R+   L  V   PVY IGPL
Sbjct  186   LDRTDQQYLEYVRIGSNFPKSDGILINTWEDLQHETLDAFRDERLLGGVAKVPVYPIGPL  245

Query  885   TRNIEE--RDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             TR ++     G     +  WL KQP ESV++VS GSGGT+S EQ+TE+AWGLELS+QRFI
Sbjct  246   TRPVQSGGSAGPKEEGLFNWLDKQPSESVIFVSLGSGGTVSFEQMTEMAWGLELSQQRFI  305

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVRPPS    D AFFT+G G +    YLP+GF TRT++ GLVVP+W  Q  +L HPS G
Sbjct  306   WVVRPPS-NSPDAAFFTSGDGDNDASTYLPKGFLTRTRDVGLVVPLWVPQVDMLSHPSIG  364

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GF SHCG NST+ESI  GVP+I WPLY+EQR NATLLTEE+GVA+R   LP K +V REE
Sbjct  365   GFWSHCGWNSTIESITYGVPMIVWPLYAEQRLNATLLTEELGVAVRSKVLPLKKVVGREE  424

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             ++ +V+ ++  + G+ +R+RV +LK+S+ KA+S+ GSSYN++ ++
Sbjct  425   IEGMVRKIMVDRDGQAIRDRVKELKLSAAKALSVAGSSYNALSQI  469



>ref|XP_010649185.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like isoform 
X1 [Vitis vinifera]
Length=515

 Score =   484 bits (1245),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 239/461 (52%), Positives = 320/461 (69%), Gaps = 13/461 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +LSSPG+GH+IP L L  RL   H   +TVF I+ + SP E QLL+S      LN V
Sbjct  59    HAALLSSPGLGHLIPMLELGKRLVTHHGFDVTVFTISASTSPAESQLLQSIASPQLLNMV  118

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S L+DA+ K V ++  ++R  +P  R A++    R   L++DFF  EAL +  
Sbjct  119   ELPPVDMSNLVDADAKLVTRIAAIMREIIPRFRTAISGMKVRPTVLILDFFGFEALHIL-  177

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++PK++Y P  A F +L+VY P+LD E+ G+YV++ + L +PGCKPVRPEDVVDPMLD
Sbjct  178   EFDMPKYIYFPGTAWFLSLSVYAPILDMEVEGEYVDRTEPLSLPGCKPVRPEDVVDPMLD  237

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R + +Y +Y+R+G G    DGIL+N WED++P TL+ALR+ E ++  V  P+Y IGPLTR
Sbjct  238   RTNQEYLQYVRMGAGLSKCDGILLNMWEDLEPTTLRALRDEEAMAPFVKVPIYPIGPLTR  297

Query  891   ---NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
                 +  R+      ++ WL  QP ESV+YVSFGSGGT++ EQ+TELAWGLELS+ RFIW
Sbjct  298   CPGGVAPRE------LLDWLDLQPTESVIYVSFGSGGTITIEQLTELAWGLELSQHRFIW  351

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVRPP       ++FT G G D    YLP GF  RT+  G+V+P WA Q  ILRHPS GG
Sbjct  352   VVRPPIQNNLYGSYFTLGNGGDDPIRYLPVGFLGRTKTIGIVIPNWAPQVDILRHPSVGG  411

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FLSHCG +STLESI N VP+IAWPL++EQR NAT++TE++G+A+RP  LPTK +V REE+
Sbjct  412   FLSHCGWSSTLESIVNAVPMIAWPLFAEQRLNATIVTEDLGIAVRPEVLPTKRVVRREEI  471

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             + +V+ ++     KEMR RV +LK S E A+S G SSYNS+
Sbjct  472   EKMVRRVMVD---KEMRNRVKELKKSGESALSKGASSYNSL  509



>gb|KDO79471.1| hypothetical protein CISIN_1g043859mg [Citrus sinensis]
Length=484

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 242/472 (51%), Positives = 329/472 (70%), Gaps = 9/472 (2%)
 Frame = +3

Query  153   NNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLT  332
             ++ S  H  +L+SPG+GH+IP L L  RL  ++N ++T+FV+ +  S  E ++L+S+  +
Sbjct  3     SSSSKPHAVLLASPGVGHVIPVLELGKRLVTLYNFQVTIFVVASQTSAAESKILQSAMSS  62

Query  333   SRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTE  512
                + + IP  DIS L+D +   V  + +++R   P  R+A++       AL+VD F TE
Sbjct  63    KLCHVIEIPAPDISGLVDPDAAVVTIISVIMREIKPAFRSAISALKTTPTALIVDLFGTE  122

Query  513   ALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDV  692
             +L +A+EL +PK+VYV TNA   AL VY P LD+ + GQYV Q +   IPGC+P+RPEDV
Sbjct  123   SLAIAEELQIPKYVYVGTNAWCVALFVYAPTLDKTVQGQYVVQNESFNIPGCRPLRPEDV  182

Query  693   VDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYA  872
             VDPMLDR + QY EY+ +G    ++DGIL+NTWED+ P  L ALR+++ L ++   P+Y 
Sbjct  183   VDPMLDRTNQQYFEYVHIGEEIPLSDGILVNTWEDLQPTALTALRDDKSLGRITKVPIYT  242

Query  873   IGPLTRNIEERDGDDGTM--IMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSE  1046
             +GP+ R    R G  G+   +  WL KQP ESVLYVSFGSGGTL+ EQITELAWGLELS+
Sbjct  243   VGPIIR----RLGPAGSWNELFDWLDKQPSESVLYVSFGSGGTLTYEQITELAWGLELSQ  298

Query  1047  QRFIWVVRPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             QRFIWVVR P+    D +FFT G GA  D   + LP+GF +RT + G+VVP WA Q  IL
Sbjct  299   QRFIWVVRLPNETTGDGSFFTAGSGAGDDDLSSLLPDGFLSRTLDIGVVVPQWAPQIDIL  358

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
              HPS GGFLSHCG NSTLESI NGVP+I WPLYSEQR NAT+LTEE+GVAIR   LP+KG
Sbjct  359   SHPSVGGFLSHCGWNSTLESITNGVPMIVWPLYSEQRMNATILTEELGVAIRSKVLPSKG  418

Query  1401  IVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEV  1553
             +V REE+KT+V+ +L  ++G E+R +V +L+ S++KA +   GSSY+S+  +
Sbjct  419   VVGREEIKTMVRRILVDEEGYEIRAKVKELQRSAQKAWTRESGSSYSSLARL  470



>ref|XP_010070028.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Eucalyptus 
grandis]
 gb|KCW58584.1| hypothetical protein EUGRSUZ_H01242 [Eucalyptus grandis]
Length=484

 Score =   479 bits (1233),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 241/472 (51%), Positives = 322/472 (68%), Gaps = 5/472 (1%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             L + +LSSPG+GH+IP + L   L   H  + TVFV+    S  E ++++S+     L+ 
Sbjct  7     LRVALLSSPGLGHLIPVIELGKCLVADHGFEATVFVLPLQASRAEAEIIKSAMTPKLLDI  66

Query  348   VGIPPVDISAL-LDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +PP D+SA  L  +     +L +++R A P  R+AL       D L+VD F  E L +
Sbjct  67    VELPPPDLSASGLCQDAAMTMRLVVMMREARPAFRSALEAMEAWPDVLIVDMFGAEYLCI  126

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+V+VP+NA F AL +Y P LD+E+ G+YV++ + LEIPGCKP+RPEDVVD M
Sbjct  127   GDELGIPKYVFVPSNAWFLALFIYSPALDKEVKGEYVDRTEPLEIPGCKPLRPEDVVDAM  186

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+D QY EY++        DGIL+N WED+   TL ALR  E L +VV  PVY  GPL
Sbjct  187   LDRSDQQYHEYVQGAGKILTGDGILLNAWEDLQAETLSALRNEEFLGRVVNGPVYTAGPL  246

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
             TR +  R    G  +++WL KQP ESV++VSFGSGGT+SAEQ  ELAWGLELS+QRFIWV
Sbjct  247   TRPV--RPAGLGKELLEWLDKQPSESVMFVSFGSGGTMSAEQQVELAWGLELSQQRFIWV  304

Query  1065  VRPPSMRGSDDAFFTTGQG--ADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             +R P+++  D +FF  G+G   D   ++LP GF   T+  G ++P WA Q  IL HPS G
Sbjct  305   LRQPTVKALDGSFFDVGKGDAGDEVLSFLPSGFTAHTRGIGFILPSWASQVEILSHPSVG  364

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFLSHCG NSTLESI NGVP+IAWPLY+EQR NATLLTEE+GVA+RP  LP+K IV REE
Sbjct  365   GFLSHCGWNSTLESIVNGVPMIAWPLYAEQRLNATLLTEEIGVAVRPKVLPSKKIVGREE  424

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             ++ LV+ ++  K+G  +R+RV  LK S++KA++ GGSSY S+C++    + R
Sbjct  425   IEKLVRTIMVEKEGHTLRDRVRDLKSSAQKAMARGGSSYESLCKMKEDCQMR  476



>ref|XP_006346992.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Solanum 
tuberosum]
Length=454

 Score =   477 bits (1228),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 240/449 (53%), Positives = 329/449 (73%), Gaps = 9/449 (2%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             MDN   + LH+ I+SSPG+GH+IP L+L NRLA  HN+K+T+  ITT  S +E + L+ S
Sbjct  1     MDN---TQLHVAIVSSPGMGHLIPVLVLGNRLATHHNIKITILTITTTSSSSEIEFLKKS  57

Query  324   DLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFF  503
             +    +  + IP VDIS L+D+ TK + Q+ LLVR ALPG+R+ +     R DAL+VD F
Sbjct  58    NGKKTIEIISIPSVDISHLIDSTTKVITQIRLLVREALPGIRSVIASMNHRPDALIVDIF  117

Query  504   CTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRP  683
              T+ L +A+E N+PK+V+  + A    L +Y  VLD+EI G+YV+ ++ LEIPGCK ++P
Sbjct  118   GTQILSIAEEFNIPKYVFHTSTAWLLTLFIYLQVLDQEIEGEYVDLKQPLEIPGCKALQP  177

Query  684   EDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKV--VG  857
             +DVVDPM+DR+D QY EYL+L + +   DGIL+NTWED++  T+KA+R NE L  V  V 
Sbjct  178   DDVVDPMMDRSDQQYHEYLKLTMEYTCFDGILINTWEDLEGETIKAIRSNEKLQSVLKVP  237

Query  858   KPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLE  1037
              P+Y IGPL R  E  + D+   ++QWL KQ  ES+L+VSFGSGG LS++Q+ ELAWGLE
Sbjct  238   LPIYPIGPLRRTTEIIERDE---VIQWLDKQNYESILFVSFGSGGALSSQQMIELAWGLE  294

Query  1038  LSEQRFIWVVRPPSMRGSDDAFF-TTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQAL  1214
             LS+Q+F+WVVRPPS   +D A+  + G    GT  YLPEGF TRT++ GLVVPMWA+QA 
Sbjct  295   LSQQKFVWVVRPPSDGDADRAYLNSNGSHTHGTFEYLPEGFLTRTKDMGLVVPMWAKQAE  354

Query  1215  ILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT  1394
             IL H S GGF+SHCG N T+ES+ NGVP+IAWPL++EQ+ NAT+LTEE+GVAIRP  LPT
Sbjct  355   ILSHSSVGGFMSHCGWNLTIESLTNGVPMIAWPLHAEQKMNATMLTEELGVAIRPAVLPT  414

Query  1395  KGIVTREEVKTLVKIMLQSKKGKEMRERV  1481
             K +  REE++ +V+I++ +K+GK +RE++
Sbjct  415   KKLAKREEIQGMVRILMDTKEGKSIREKL  443



>ref|XP_010070029.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Eucalyptus 
grandis]
 gb|KCW58586.1| hypothetical protein EUGRSUZ_H01244 [Eucalyptus grandis]
Length=495

 Score =   478 bits (1230),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 242/462 (52%), Positives = 319/462 (69%), Gaps = 5/462 (1%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             L   +LSSPG+GH+IP + L   L   H  ++TVFVI +  S  E ++++S+     L+ 
Sbjct  18    LRAALLSSPGMGHLIPVIELGKCLVANHGFEVTVFVIPSQASRAEAEIIDSAVTPKLLDI  77

Query  348   VGIPPVDISAL-LDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +P  D++A  L  N   + +L  ++R   P  R+AL       D L+VD F TE L M
Sbjct  78    VELPAPDLTAADLGPNASMITRLAAMMREVRPAFRSALAAMEATPDVLIVDLFGTEHLCM  137

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+VYVP+NA F AL ++ P LD+E+ G+YV+Q + LEIPGCKPVRPEDVVDPM
Sbjct  138   GDELRIPKYVYVPSNAWFLALLLHSPALDKEVKGEYVDQTEPLEIPGCKPVRPEDVVDPM  197

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR++ QYR Y+R      M DGIL+N WE++   TL ALR  E L +VV  PVY IGPL
Sbjct  198   LDRSNQQYRGYIRQAGEIPMGDGILLNVWEELQAETLAALRNEEFLGRVVNGPVYTIGPL  257

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R +  R       +++WL KQP ESV++VSFGSGGT+SAEQ+ ELAWGLELS+QRFIWV
Sbjct  258   IRPV--RPAGLAKELLEWLDKQPNESVMFVSFGSGGTMSAEQLVELAWGLELSQQRFIWV  315

Query  1065  VRPPSMRGSDDAFFTTGQGADGTP--NYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             +R P  +  D +FF  G+G  G    ++LP+GF   T++ GL+VP WA Q  IL HPS G
Sbjct  316   LRKPIAKSLDGSFFDMGKGCGGDELLSFLPDGFMECTRDVGLIVPSWAPQVDILSHPSVG  375

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFLSHCG NSTLESI NGVP+IAWPLY+EQR NATLL EE+GVAIRP +LP+K IV REE
Sbjct  376   GFLSHCGWNSTLESIVNGVPMIAWPLYAEQRLNATLLAEEIGVAIRPKELPSKKIVRREE  435

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             ++ LV+ ++   +G  +R RV +LK S++KA++ GG+SY S+
Sbjct  436   IEKLVRTIMVENEGHMIRARVKELKSSAKKAMTKGGTSYESL  477



>ref|XP_008393335.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like isoform 
X2 [Malus domestica]
Length=476

 Score =   477 bits (1228),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 241/465 (52%), Positives = 317/465 (68%), Gaps = 6/465 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  IL SPG+GH+IP L LA RL    N  +T+F I +  S  E +LL+++      + V
Sbjct  6     HAAILCSPGLGHLIPVLELAKRLVTHRNFTVTIFAIPSPTSKAESELLKAATTPKFCDIV  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAAL--TKQCRRLDALVVDFFCTEALPM  524
              +PP DIS  +  +   V  L +++R   P  R+A+   K   R   L+VD F TE+L +
Sbjct  66    ELPPPDISGCVGPDAAVVTLLAVMMREVRPAFRSAILGIKPPLRPTVLIVDLFSTESLSI  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+V++  NA F ALTVY  VLD+E+ G+YV+Q + L IPGCKPVRPEDVVDPM
Sbjct  126   GDELGIPKYVFIACNAWFLALTVYVRVLDKEVEGEYVDQTEPLRIPGCKPVRPEDVVDPM  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR D QY EY+R+G  F  +DGIL+NTWED+   TL A R+   L  V   PVY IGPL
Sbjct  186   LDRTDQQYLEYVRIGSNFPKSDGILINTWEDLQHETLDAFRDERLLGGVAKVPVYPIGPL  245

Query  885   TRNIEE--RDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             TR ++     G     +  WL KQP ESV++VS GSGGT+S EQ+TE+AWGLELS+QRFI
Sbjct  246   TRPVQSGGSAGPKEEGLFNWLDKQPSESVIFVSLGSGGTVSFEQMTEMAWGLELSQQRFI  305

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVRPPS   S DA F T  G +    YLP+GF TRT++ GLVVP+W  Q  +L HPS G
Sbjct  306   WVVRPPS--NSPDAAFFTSDGDNDASTYLPKGFLTRTRDVGLVVPLWVPQVDMLSHPSIG  363

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GF SHCG NST+ESI  GVP+I WPLY+EQR NATLLTEE+GVA+R   LP K +V REE
Sbjct  364   GFWSHCGWNSTIESITYGVPMIVWPLYAEQRLNATLLTEELGVAVRSKVLPLKKVVGREE  423

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             ++ +V+ ++  + G+ +R+RV +LK+S+ KA+S+ GSSYN++ ++
Sbjct  424   IEGMVRKIMVDRDGQAIRDRVKELKLSAAKALSVAGSSYNALSQI  468



>ref|XP_009349752.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Pyrus 
x bretschneideri]
Length=471

 Score =   477 bits (1227),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 238/471 (51%), Positives = 319/471 (68%), Gaps = 7/471 (1%)
 Frame = +3

Query  159   QSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSR  338
              S  H  IL SPG+GH+IP L LA RL    N  +T+F I +  S TE +LL+++     
Sbjct  2     SSQPHAAILCSPGLGHLIPVLELAKRLVTHRNFTVTIFAIPSPASKTESELLKAAATPKF  61

Query  339   LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAAL--TKQCRRLDALVVDFFCTE  512
              + + +PP DIS  +  +      L +++R   P  R+A+   +   R   L+VD F TE
Sbjct  62    FDIIELPPPDISGCVGPDATVATVLAVMMREVRPAFRSAILGMESSLRPTVLIVDLFSTE  121

Query  513   ALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDV  692
              L + DEL +PK+VY+ + A F ALTVY PV D+E  G+YV+Q + L IPGCKPV+PEDV
Sbjct  122   TLSIGDELGIPKYVYIASTAWFVALTVYVPVFDKEAEGKYVDQTEPLRIPGCKPVQPEDV  181

Query  693   VDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYA  872
             VDPMLDR D QY +Y++       +DGILMNTWED++  T+ ALR+   L +V   PVY 
Sbjct  182   VDPMLDRTDQQYLDYVKSCTNLLKSDGILMNTWEDLERKTIDALRDEGLLGRVAKVPVYP  241

Query  873   IGPLTRNIEERDGDDGTM----IMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLEL  1040
             IGPLTR ++        +    +  WL KQP ESV++VS GSGGT+S EQ+TE+AWGLEL
Sbjct  242   IGPLTRPVQSAGSTSTGLREEGLFNWLDKQPCESVIFVSLGSGGTVSFEQMTEMAWGLEL  301

Query  1041  SEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             S+QRFIWVVR P+ + +D AFFT+G   D    YLP+GF TRT + GLVVP+WA Q  IL
Sbjct  302   SKQRFIWVVRSPA-KSADAAFFTSGNREDDPSTYLPKGFLTRTHDVGLVVPLWAPQVDIL  360

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
              HPS GGF SHCG NS+LESI NGVP+I WPL++EQR NAT+LTEE+GVA+R   LP+K 
Sbjct  361   SHPSIGGFWSHCGWNSSLESITNGVPMIVWPLHAEQRMNATMLTEELGVAVRLKVLPSKK  420

Query  1401  IVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             +V REE+K +V+ ++  K G+ +R RV +LK+S+ KA S+GGSSYN++ ++
Sbjct  421   VVDREEIKEMVRKIMVDKDGQAIRGRVKELKLSAAKAWSVGGSSYNAISQI  471



>ref|XP_010070030.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Eucalyptus 
grandis]
Length=484

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 318/470 (68%), Gaps = 5/470 (1%)
 Frame = +3

Query  153   NNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLT  332
               Q  L + +LSSPG+GH+IP + L   L   H  + TVF++    S  E +++ES+   
Sbjct  2     ETQKKLRVVLLSSPGLGHLIPVIELGKCLVADHGFEATVFILPLQASRAEAEIIESAMTP  61

Query  333   SRLNNVGIPPVDISAL-LDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCT  509
               L+ V +PP D+SA  LD N     +L +++R A    R+ L     R D L+VD    
Sbjct  62    KLLDIVELPPPDLSAAGLDPNAATATRLVVMMREARAAFRSVLAAMEARPDVLIVDLLGA  121

Query  510   EALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPED  689
             E L +ADEL +P++V+VP+NA F AL +  P LD+E  G+YV++ + LEIPGCKP+RPED
Sbjct  122   EYLCLADELGIPRYVFVPSNAWFLALLLQSPTLDKETKGEYVDRTEPLEIPGCKPLRPED  181

Query  690   VVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVY  869
             VVD MLDR+D QY EY++        DGIL+N WED+   TL AL   E L +VV  PVY
Sbjct  182   VVDAMLDRSDQQYHEYVQGAGKIPTGDGILLNVWEDLQAETLAALGNEEFLGRVVNGPVY  241

Query  870   AIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQ  1049
              +GPLTR +  R    G  +++WL KQP ESV++VSFGSGGT+SAEQ+ ELAWGLELS+Q
Sbjct  242   TVGPLTRPV--RPTGLGKELLEWLDKQPSESVMFVSFGSGGTVSAEQLVELAWGLELSQQ  299

Query  1050  RFIWVVRPPSMRGSDDAFFTTGQG--ADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILR  1223
             RFIWV+R P ++  D +FF  G+G   D   ++LP GF  RT   G ++P WA Q  IL 
Sbjct  300   RFIWVLRQPIVKSLDGSFFDVGKGDAGDEVLSFLPSGFTARTHGIGFILPSWASQVEILS  359

Query  1224  HPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGI  1403
             HPS GGFLSHCG NSTLESI NGVP+IAWPLY+EQR NATLLTEE+GVA+RP  LP+K I
Sbjct  360   HPSVGGFLSHCGWNSTLESIVNGVPMIAWPLYAEQRLNATLLTEEIGVAVRPKVLPSKKI  419

Query  1404  VTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             V REE++ LV+ ++  K+G  +R RV  LK S++KA++ GGSSY S+C++
Sbjct  420   VGREEIEKLVRTVMVEKEGHTLRVRVGDLKSSAQKAVARGGSSYESLCKM  469



>ref|XP_008338776.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Malus 
domestica]
Length=479

 Score =   475 bits (1222),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 239/478 (50%), Positives = 318/478 (67%), Gaps = 9/478 (2%)
 Frame = +3

Query  162   SMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRL  341
             S  H  IL SPG+GH+I +  LA RL    N  + +F I +  S TE +LL+++      
Sbjct  3     SQPHAAILCSPGLGHLIXAFELAKRLVTHRNFTVXIFAIPSPTSKTESELLKAAATPKFF  62

Query  342   NNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAAL--TKQCRRLDALVVDFFCTEA  515
             + + +PP DIS  +  +      L +++R A P  R+A+   +   R   L+VD F TE+
Sbjct  63    DIIELPPPDISGCVGPDAAVTTLLAVMMREARPAFRSAILGMESSLRPTVLIVDLFSTES  122

Query  516   LPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVV  695
             L + DEL +PK+VY+ + A F ALTVY PV D+E+ G+YV+Q + L IPGCKPV+PEDVV
Sbjct  123   LSIGDELGIPKYVYIASTAWFVALTVYVPVFDKEVEGEYVDQTEPLRIPGCKPVQPEDVV  182

Query  696   DPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAI  875
             DPMLDR D QY EY+R+   F  +DGILMN WED++  T+ ALR+   L +V   PVY I
Sbjct  183   DPMLDRIDQQYLEYVRIXTNFPKSDGILMNXWEDLEHKTIDALRDEGLLGRVXKVPVYPI  242

Query  876   GPLTRNIEERDGDDGTMI-----MQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLEL  1040
             GPLTR ++   G   T I       WL KQP E V++VS GSGGT+S EQ+TE+AWGLEL
Sbjct  243   GPLTRQVQSA-GSTSTXIRDEGLFNWLDKQPCEXVIFVSLGSGGTVSLEQMTEMAWGLEL  301

Query  1041  SEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             S+QRFIWVVRPP+ R +D  FFT+G   D    YLP+GF TRT + GLVVP+W  Q  IL
Sbjct  302   SQQRFIWVVRPPA-RSADAXFFTSGNQDDDPSTYLPKGFLTRTHDVGLVVPLWVSQVDIL  360

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
               PS GGF SHCG NS+LES  NGVP++ WPLY EQR NAT LTEE+GVA+R   LP+K 
Sbjct  361   SXPSIGGFWSHCGWNSSLESXTNGVPMMVWPLYXEQRMNATXLTEELGVAVRSKVLPSKK  420

Query  1401  IVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
              V REE+K +V+ ++  K G+ +R RV  LK+S+ KA S+GGSSYN++ ++ +  E++
Sbjct  421   XVGREEIKEMVRKIMVDKDGQAIRGRVXGLKLSAAKAWSVGGSSYNALSQISSGNERK  478



>gb|KDP31803.1| hypothetical protein JCGZ_12264 [Jatropha curcas]
Length=481

 Score =   474 bits (1221),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 235/469 (50%), Positives = 323/469 (69%), Gaps = 2/469 (0%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+  LSSPG+GH+IP L L NRL  + N ++T+F + +  S TE QLL+S+        +
Sbjct  9     HLVFLSSPGLGHLIPVLELGNRLVTLCNFEVTIFTVLSNTSQTETQLLQSAMTAKICEII  68

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
               PPVDIS+L+      V Q+ +++R   P  R+AL+       A+++D   TE+L +  
Sbjct  69    QPPPVDISSLIQPEAAIVTQISVMMREIRPAFRSALSALNFGPAAIIIDLSGTESLEIPK  128

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             EL +PK+VY+P NA F ALT+Y P LD+ + G++V+Q++ LEIPGC+PVRPEDVVDPMLD
Sbjct  129   ELGIPKYVYMPNNAWFLALTIYLPFLDQVVEGEFVDQKENLEIPGCRPVRPEDVVDPMLD  188

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R++ QY EY+R+G     ADGIL+NTWE ++P TL ALR+   L K +  PV+ IGP+ R
Sbjct  189   RSNQQYFEYVRVGNEIPKADGILVNTWEALEPTTLAALRDENLLYKTIKIPVFPIGPVRR  248

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              + +        ++ WL  QP+ESV+YVSFGSGGTLS EQ+ E+A+GLE+S QRFIWVVR
Sbjct  249   AVGKVQVGSKCELLNWLDNQPKESVVYVSFGSGGTLSFEQMQEIAYGLEMSHQRFIWVVR  308

Query  1071  PPSMRGSDDAFFTTGQ-GADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
              P++   D +FFTTG  G D    YLP+GF TRT+N G V+P W  Q  I+ HPSTG F 
Sbjct  309   RPTIETGDSSFFTTGNVGDDDISRYLPDGFLTRTKNIGRVIPGWGPQVQIIGHPSTGAFF  368

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NS LES+ NGVPII WPLY+EQR NATLL EEVGVA++P  LP+ G+V REE+  
Sbjct  369   SHCGWNSILESLTNGVPIIGWPLYAEQRLNATLLAEEVGVAVKPKILPSNGVVKREEIVM  428

Query  1428  LV-KIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEK  1571
             ++ KIM   ++G ++R+RV ++K +SE+A++ GGSS N++       +K
Sbjct  429   MIRKIMADEEEGDKIRKRVKEVKENSERALNEGGSSCNALSSFAGECKK  477



>ref|XP_009374237.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanidin 3-O-glucosyltransferase 
5 [Pyrus x bretschneideri]
Length=473

 Score =   473 bits (1216),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 241/465 (52%), Positives = 317/465 (68%), Gaps = 9/465 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  IL SPG+GH+IP L LA RL    N+ +T+F I +  S  E +LL+++      + V
Sbjct  6     HAAILCSPGLGHLIPVLELAKRLVTHRNLTVTIFAIPSPTSKAESELLKAATTPKFCDIV  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALT--KQCRRLDALVVDFFCTEALPM  524
              +PP DIS  +  +   V  L +++R   P  R+A+   K   R   L+VD F TE+L +
Sbjct  66    ELPPPDISGCVGPDAAVVTLLAVMMREVRPAFRSAILGLKPPLRPTLLIVDLFSTESLSI  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+V++  NA F ALT+Y  VLD+E+ G+YV+Q     IPG KPVRPEDVVDPM
Sbjct  126   GDELGIPKYVFIACNAWFLALTIYVRVLDKEVEGEYVDQR----IPGXKPVRPEDVVDPM  181

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR D QY EY+R+G  F  +DGIL+NTWED+   TL A RE   L  V   PVY IGPL
Sbjct  182   LDRTDQQYLEYVRIGSNFPKSDGILINTWEDLQHETLDAFREERLLGGVAKVPVYPIGPL  241

Query  885   TRNIEE--RDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             TR ++     G     +  WL KQP ESV++VS GSGG +S EQ+TE+AWGLELS+QRFI
Sbjct  242   TRPVQPGGSAGPKEEGLFNWLDKQPSESVIFVSLGSGGAVSFEQMTEMAWGLELSQQRFI  301

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVRPPS   +D +FFT+G G +    YLP+GF TRT++ GLVVP+W  Q  IL HPS G
Sbjct  302   WVVRPPS-NSADASFFTSGDGDNDASTYLPKGFLTRTRDIGLVVPLWVPQVDILSHPSIG  360

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GF SHCG NST+ESI NGVP+I WPLY+EQR NATLLTEE+GVAIR   LP K +V REE
Sbjct  361   GFWSHCGWNSTIESITNGVPMIVWPLYAEQRLNATLLTEELGVAIRSKVLPLKKVVGREE  420

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             ++ +V+ ++  + G+ +R RV +LK+S+ KA+S+ GSSYN++ ++
Sbjct  421   IEGMVRKIMVDRDGQAIRGRVKELKLSAAKALSVAGSSYNALSQI  465



>ref|XP_010026160.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Eucalyptus 
grandis]
Length=484

 Score =   471 bits (1211),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 238/462 (52%), Positives = 314/462 (68%), Gaps = 5/462 (1%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             L + +LSSPG GH+IP + L   L   H  + TVFV+    S  E ++++S+     L+ 
Sbjct  7     LRVALLSSPGPGHLIPVIELGKCLVADHGFEATVFVLPLQASRAEAEIIKSAMTPKLLDI  66

Query  348   VGIPPVDISAL-LDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +P  D+SA  L  +   V +L +++R A P  R+AL     R D L+VD F  E L +
Sbjct  67    VELPAPDLSAAGLSPDAAVVTRLVVMMREARPAFRSALEAMEARPDLLIVDMFGAEYLCI  126

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              DEL +PK+V+VP+NA F AL +Y P LD+E+ G+YV + + LEI GCKPVRPEDVVD M
Sbjct  127   GDELGIPKYVFVPSNAWFLALFIYSPALDKEVKGEYVNRTEPLEIRGCKPVRPEDVVDSM  186

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+D QY EY+++       DGIL+N WED+   TL  LR  E L +VV  PVY  GPL
Sbjct  187   LDRSDQQYHEYVQMAGEIPTGDGILLNVWEDLQAETLTVLRNEEFLGRVVNGPVYTAGPL  246

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
             TR +  R    G  +++WL KQP ESV++VSFGSGGT+SAEQ  ELAWGLELS+QRFIWV
Sbjct  247   TRPV--RPAGLGKELLEWLDKQPSESVMFVSFGSGGTMSAEQQVELAWGLELSQQRFIWV  304

Query  1065  VRPPSMRGSDDAFFTTGQG--ADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             +R P+++  D +FF  G+G   D   ++LP GF   T+  G ++P WA Q  IL HPS G
Sbjct  305   LRQPTVKALDGSFFDVGKGDAGDEVLSFLPSGFTAHTRGIGFILPSWASQVEILSHPSVG  364

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFLSHCG NSTLESI NGVP+IAWPLY+EQR N TLLTEE+GVA+RP  LP+K IV REE
Sbjct  365   GFLSHCGWNSTLESIVNGVPMIAWPLYAEQRLNVTLLTEEIGVAVRPKVLPSKKIVGREE  424

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             ++ LV+ ++  K+G  +R+RV  LK S++KA++ GGSSY S+
Sbjct  425   IEKLVRTIMVEKEGHTLRDRVRDLKSSAQKAMARGGSSYESL  466



>ref|XP_003629205.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AET03681.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=513

 Score =   471 bits (1213),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 242/484 (50%), Positives = 332/484 (69%), Gaps = 16/484 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +LSSPG+GH++P + LA R    HN KLT+  IT+  S TE  +L+S+   S  N +
Sbjct  8     HIVLLSSPGLGHLMPIIELAKRFQIHHNFKLTILAITSQTSHTESHILKSATNPSLYNII  67

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              IP  +IS+LL  +     ++ L +R ++P +++ALT       AL+VD F TEALP+A 
Sbjct  68    QIPSPNISSLLPVSATVCTRIFLTMRHSIPSIKSALTNLTLPPSALIVDIFGTEALPLAL  127

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             ELN+P+F+YV ++A F +L VY PVLD++I G Y+EQ++ L+IPGCK V+P D+VDPMLD
Sbjct  128   ELNIPRFIYVASHAWFLSLYVYSPVLDKQIQGPYIEQKEPLKIPGCKSVQPNDLVDPMLD  187

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENE-PLSKVVGKPVYAIGPLT  887
             R +++Y+EYL +   F  +D IL+NTW+++    LKAL + +  LS ++  PV+A+GPL 
Sbjct  188   RYNLEYKEYLTVAKNFSKSDAILVNTWDELQHRELKALNDGDGELSSLLKVPVFAVGPLV  247

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R  E   G     ++QWL KQP+ESV+YVSFGSGGTLS EQ+ ELA+GLELSEQRF+WVV
Sbjct  248   RQAESEIGQASESVIQWLDKQPKESVVYVSFGSGGTLSNEQMNELAFGLELSEQRFVWVV  307

Query  1068  R--PPSMRGSDDAFFTTGQGADGTPN--------YLPEGFNTRTQNQ--GLVVPMWAEQA  1211
             R    +    D AFFTTG G DG  +        +LPEGF  R +N+  GL +  WA Q 
Sbjct  308   RACASTTEAVDAAFFTTGSGGDGFGDELDDQIGKHLPEGFVERIKNKNVGLFLHEWAPQV  367

Query  1212  LILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLP  1391
              IL+HPS GGF+SHCG  S LES+ NGVPIIAWPLY+EQR NA LL EE+GVA+R +  P
Sbjct  368   TILKHPSIGGFVSHCGWGSVLESLTNGVPIIAWPLYAEQRMNAALLVEELGVAVRTVVSP  427

Query  1392  TKGIVTREEVKTLV-KIMLQSKKGK--EMRERVVKLKMSSEKAISIGGSSYNSMCEVLNA  1562
              K +V REE+ +LV K++L  + GK   +RERV ++++S+EKA+  GGSSYN++  V   
Sbjct  428   GKNVVEREEIASLVRKVILVDQNGKRNHVRERVKEVRVSAEKALLQGGSSYNALSHVAKI  487

Query  1563  IEKR  1574
             I K+
Sbjct  488   INKQ  491



>gb|EPS66787.1| hypothetical protein M569_07987 [Genlisea aurea]
Length=487

 Score =   470 bits (1209),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 241/478 (50%), Positives = 330/478 (69%), Gaps = 9/478 (2%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             MD+ N   LHI ++S+PGIGH+IP L+LA RLA +H V++T+  +T A +P E +L    
Sbjct  1     MDHRN---LHIVVVSTPGIGHVIPVLVLAKRLATLHGVRVTIVRVTVAGAPPEPKLFTVP  57

Query  324   DLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFF  503
                  +  + +PPVDIS ++D +T+ V +L ++ RAA   +R+A++    R DA+V D F
Sbjct  58    YPDDLVRILQLPPVDISHVVDESTQIVTRLFMMFRAAASSLRSAISALEPRPDAIVADLF  117

Query  504   CTE--ALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPV  677
               E   +   +  ++PKF ++ +NA F+AL +Y P+LDREI G+Y +  + L IPGC  V
Sbjct  118   SVETPGICTGEFDDIPKFYFIASNAWFSALAIYSPILDREIAGEYADLHEKLAIPGCVSV  177

Query  678   RPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVG  857
              PEDV DPMLDRND QY EYL++G    + DGIL++TWE+++  TLKA RENE    ++ 
Sbjct  178   APEDVPDPMLDRNDEQYGEYLKIGRSIPLFDGILISTWEELEKETLKAFRENETWKSIID  237

Query  858   KPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLE  1037
              PVY IGPLTR   E      + +  WL KQP +SVL+VSFGSGG LS EQ TELAWGLE
Sbjct  238   IPVYPIGPLTRPAGELK--PSSELFSWLDKQPDDSVLFVSFGSGGVLSPEQTTELAWGLE  295

Query  1038  LSEQRFIWVVRPPSMRGSDDAFFTTG-QGADGTPNYLPEGFNTRTQNQGLVVPMWAEQAL  1214
             LS QRF+WVVRPP+   +DD FFT G + +  T  +LPEGF  RT  + +++PMWAEQ  
Sbjct  296   LSRQRFVWVVRPPTSGRADDEFFTVGGERSQETLAHLPEGFVARTGERAILIPMWAEQLE  355

Query  1215  ILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT  1394
             IL HP+ GGFLSHCG NSTLESI NG+P+IAWPLY+EQR NATLLT+++ VA+RP  LP 
Sbjct  356   ILSHPAVGGFLSHCGWNSTLESITNGIPMIAWPLYAEQRMNATLLTDQLSVAVRPAVLPA  415

Query  1395  KGIVTREEVKTLVK-IMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAI  1565
             K +V+REEV  LV+ +M   + G+ MRER  +LK++  +A+  GGSS+ S+ ++L+ I
Sbjct  416   KKVVSREEVARLVRSVMEDDETGRRMRERAQQLKITGAEALINGGSSHKSLSQLLSKI  473



>gb|AGU14106.1| UDP-glycosyltransferase [Cicer arietinum]
Length=487

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 238/474 (50%), Positives = 326/474 (69%), Gaps = 10/474 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +LSSPG+GH+IP + LA R    H   LT+  +T+  S  E Q+L+S+  +S    +
Sbjct  8     HIVLLSSPGLGHLIPIIELAKRFIIHHKFNLTILAVTSQTSHAESQILKSATNSSLYTII  67

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              IP  +IS+LL  +     +L + +R A+P +++ALT       AL+VD F TE+L +A 
Sbjct  68    QIPSPNISSLLPTSATVSTRLSVTMRQAIPSIKSALTNTPLPPSALIVDIFGTESLTLAQ  127

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             ELN+PKF+YV ++A F +L VY P+LD++I GQYV+Q++ L+IPGCKPVRPED++D MLD
Sbjct  128   ELNIPKFIYVASHAWFLSLIVYSPILDKQIEGQYVDQKEPLKIPGCKPVRPEDLIDSMLD  187

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             RND QY+E L +   F  +D +L+NTW+++    +KAL   E LS V+  PV+A+GPL R
Sbjct  188   RNDSQYKESLIVAEKFPESDAVLVNTWDELQQREVKALTNGE-LSGVLKVPVFAVGPLVR  246

Query  891   NIEERDGD-DGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
               E   G     +I+QWL KQPRESV++VSFGSGGT+S EQ+ E+A+GLELSEQRFIWVV
Sbjct  247   QPESETGQLKKPVIIQWLDKQPRESVIFVSFGSGGTVSYEQMKEIAFGLELSEQRFIWVV  306

Query  1068  RPPSMRGSDDAFFTTGQGA-----DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             R  +  G D AFFTTG  +     D    +LPEGF  R +  GL+V  WA Q  +L+HPS
Sbjct  307   RASTGGGVDTAFFTTGSSSFNDELDEIRKHLPEGFEERNKKVGLLVQNWAPQVTVLKHPS  366

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
              GGF++H G  S LESI NGVP+IAWPLY+EQR NA LL EE+GVA+R   +P K +V R
Sbjct  367   IGGFITHSGWGSVLESITNGVPMIAWPLYAEQRMNAALLVEELGVAVRTTVVPGKNVVGR  426

Query  1413  EEVKTLVK---IMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAI  1565
             EE+ +LV+   ++ Q+ K   +RERV ++K+S+EKA+S GGSSY ++ EV N I
Sbjct  427   EEIASLVRNVFLLEQNGKRNHVRERVREIKISAEKALSQGGSSYTALSEVANMI  480



>ref|XP_002310203.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|EEE90653.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=481

 Score =   469 bits (1207),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 235/467 (50%), Positives = 319/467 (68%), Gaps = 6/467 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L L  RL   H   +T+FV+ T  S T+ +L E       +N +
Sbjct  7     HAALLASPGMGHLIPVLELGKRLVTYHGFHVTLFVVATDASTTQSRLKEP---YPNINII  63

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P VDIS L+D     V +L +++R  LP +R+A+        AL+VD F TEA  +A+
Sbjct  64    TLPLVDISGLIDPAATVVTKLAVMMRETLPSLRSAILALKSPPTALIVDLFGTEAFAVAE  123

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+ K+V+  +NA F A+T+Y P +DR +  ++V Q++ L IPGCK VR ED +   LD
Sbjct  124   EFNMLKYVFDTSNAWFFAITIYFPTIDRNLEDKHVIQKQPLRIPGCKSVRFEDTLGAYLD  183

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             RND  Y EY R+G+   MADGILMNTWED++P TL ALR+ + L +V   PVY IGPL R
Sbjct  184   RNDQMYIEYKRIGIEMPMADGILMNTWEDLEPTTLGALRDFQMLGRVAKAPVYPIGPLAR  243

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +      +   ++ WL  QP ESV+YVSFGSGGTLS EQ+ ELAWGLELS+QRF+WVVR
Sbjct  244   PVGPSVPRN--QVLNWLDNQPNESVIYVSFGSGGTLSTEQMAELAWGLELSKQRFVWVVR  301

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    +  AFF    G++G P++LPEGF  RT+  GLVVP+WA Q  IL HPS GGFLS
Sbjct  302   PPIDNDAAGAFFNLDDGSEGIPSFLPEGFLARTREVGLVVPLWAPQVEILAHPSVGGFLS  361

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLESI NGVP+IAWPLY+EQ+ NAT+LTEE+GVA++P  L ++ +V R E++ +
Sbjct  362   HCGWNSTLESITNGVPMIAWPLYAEQKMNATILTEELGVAVQPKTLASERVVVRAEIEMM  421

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLNAIE  1568
             V+ +++ ++G  +R+RV +LK S EKA+S  GGSSYNS+ ++    E
Sbjct  422   VRKIMEDEEGFGIRKRVNELKHSGEKALSSKGGSSYNSLSQIAKQCE  468



>emb|CBI25658.3| unnamed protein product [Vitis vinifera]
Length=458

 Score =   467 bits (1202),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 233/479 (49%), Positives = 323/479 (67%), Gaps = 33/479 (7%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L LA RL   H   +TVF I  + SP E QLL            
Sbjct  7     HAVLLASPGLGHLIPVLELAKRLVTHHAFHVTVFAIAASASPAETQLL------------  54

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
                       LDA+     ++ +++R  +P  RAA+          +VD F  EAL +A 
Sbjct  55    ----------LDADAAVFTRIAVMMREVIPNFRAAMFAMRVPPSLFIVDLFGFEALEIA-  103

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++PK+ +VPT A   ALT+Y P LD E+ G+YV++ + L +PGCK VRPEDV+DPM++
Sbjct  104   EFDMPKYTFVPTAACALALTLYVPTLDVEVKGEYVDRAEPLRLPGCKSVRPEDVIDPMME  163

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R + QY EY+R+ +G   ADGIL+NTWED++P TL+ALR+++ +++    P+Y IGPL R
Sbjct  164   RRNQQYLEYIRMAIGIPKADGILLNTWEDLEPTTLRALRDHKAMAQFAKVPIYPIGPLIR  223

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
             ++ + +    T ++ WL  QP +SV+YVSFGSGGT S+EQ+ ELAWGLELS+QRFIWVVR
Sbjct  224   SVGQEEVR--TELLDWLDLQPIDSVIYVSFGSGGTYSSEQLAELAWGLELSQQRFIWVVR  281

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP       +FFTTG+G +   +YLPEGF TRT+N G+VVP+WA Q  IL HPS GGFLS
Sbjct  282   PPIENDHSGSFFTTGKGGEHPSDYLPEGFLTRTKNVGMVVPLWAPQVEILSHPSVGGFLS  341

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG  STL+SI NGVP++AWPLY+EQR NAT+LTEE+G+A+RP  LPTK +V +EE++ +
Sbjct  342   HCGWGSTLDSILNGVPMVAWPLYAEQRLNATMLTEELGIAVRPEVLPTKRVVRKEEIEKM  401

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAI-----EKRRDLKIC  1592
             V+ +++    KE+RERV ++  + E+A+  GGSSYNS+ +V +A      E R  +K C
Sbjct  402   VRDVIEE---KELRERVKEVMKTGERALRKGGSSYNSLSQVASAATSFHKEYRSPVKHC  457



>gb|ADL67595.1| glycosyltransferase 1 [Populus tomentosa]
Length=481

 Score =   468 bits (1203),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 234/467 (50%), Positives = 318/467 (68%), Gaps = 6/467 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L L  RL   H   +T FV+ T  S T+  L E       +N +
Sbjct  7     HAALLASPGMGHLIPVLELCKRLVTYHGFHVTFFVVATDASTTQSLLKEP---YPNINII  63

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P VDIS L+D     V +L +++R  LP +R+A+        AL+VD F TEA  +A+
Sbjct  64    TLPLVDISGLIDPAATVVTKLAVMMRETLPSLRSAILALKSPPTALIVDLFGTEAFAVAE  123

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+ K+V+  +NA F A+T+Y P +DR +  +++ Q++ L IPGCK VR ED +   LD
Sbjct  124   EFNMLKYVFDTSNAWFFAITIYVPTIDRNLEDRHIIQKQPLRIPGCKSVRFEDTLQAYLD  183

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             RND  Y EY R+G+   MADGILMNTWED++P TL ALR+ + L +V   PVY IGPL R
Sbjct  184   RNDQTYIEYKRIGIEMPMADGILMNTWEDLEPTTLGALRDFQMLGRVAQSPVYPIGPLAR  243

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +      +   +++WL  QP ESV+YVSFGSGGTLS+EQ+ ELAWGLELS+QRF+WVVR
Sbjct  244   PVGPLIPRN--QVLKWLDNQPYESVIYVSFGSGGTLSSEQMAELAWGLELSKQRFVWVVR  301

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             P     +D AFF    G++G P++LPEGF  RT+  GL VPMWA Q  IL HPS GGFLS
Sbjct  302   PSIDNDADGAFFNLDDGSEGIPSFLPEGFLDRTREMGLAVPMWAPQVEILAHPSVGGFLS  361

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLESI NGVP+IAWPLY+EQ+ NAT+LTEE+GVA++P  L ++ +V R E++ +
Sbjct  362   HCGWNSTLESITNGVPLIAWPLYAEQKMNATILTEELGVAVQPKTLASERVVVRAEIEMM  421

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLNAIE  1568
             V+ +++ ++G  +R+RV +LK S EKA+S  GGSSYNS+ ++    E
Sbjct  422   VRKIMEDEEGFGIRKRVNELKHSGEKALSSKGGSSYNSLSQIAKQCE  468



>ref|XP_006425732.1| hypothetical protein CICLE_v10027249mg [Citrus clementina]
 ref|XP_006466730.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Citrus 
sinensis]
 gb|ESR38972.1| hypothetical protein CICLE_v10027249mg [Citrus clementina]
Length=481

 Score =   466 bits (1200),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 228/467 (49%), Positives = 322/467 (69%), Gaps = 6/467 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ +L+SPG+GH+IP L L  R A  ++ ++T+FV+ T  S  + QL    +     N V
Sbjct  7     HVALLASPGMGHLIPVLELGKRFATQNDFQVTIFVVATDTSTVQSQLRNLPN-PHLFNIV  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVDISALLDA+   V ++  ++R +LP +R++++    R  AL  D F TEA  +AD
Sbjct  66    SLPPVDISALLDADASIVIKIIFMMRESLPALRSSISTLKPRPTALFADLFGTEAFQIAD  125

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E  + K+VY+ +NA F A T+Y P +D+ +  ++  +++ L IPGC+ VR +D +D   D
Sbjct  126   EFEMLKYVYIASNAWFLAATIYFPTIDKRLQEEHYGRKQPLMIPGCRSVRFQDTLDAFTD  185

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
               D  + EYLR+G+    ADGIL+NTWED++P TL +LR+   +SK++  P+Y IGP+ R
Sbjct  186   PKDQLFDEYLRIGLEMVTADGILVNTWEDLEPTTLASLRDG--ISKLL--PIYPIGPMVR  241

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +      + + +++WL  QP ESV+YVSFGSGGTLSA Q+ E+AWGLELS+QRFIWVVR
Sbjct  242   TMGSSHMSENSSLLEWLDMQPTESVIYVSFGSGGTLSANQMIEVAWGLELSQQRFIWVVR  301

Query  1071  PPSMRGSDDAFFTTGQGA-DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             PP       +FF  G G+ DGTP+YLP+GF TR    GLVVP WA QA IL H S GGFL
Sbjct  302   PPMDNDVSGSFFKVGDGSSDGTPDYLPDGFLTRNAKMGLVVPDWAPQAEILGHASVGGFL  361

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLESI NGVP+I WPLY+EQ+ NAT+L EE+GVA+RP ++PT+ +V REE++ 
Sbjct  362   SHCGWNSTLESIVNGVPLIVWPLYAEQKMNATMLAEELGVAVRPNEMPTENLVKREEIEM  421

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             +V+ +L  K+G+ +R RV +LK S++KA + GGSSYN++ +V    E
Sbjct  422   MVRRILVDKEGQALRSRVKELKHSAKKASTKGGSSYNALSQVAKQCE  468



>gb|KHN45581.1| Anthocyanidin 3-O-glucosyltransferase 5 [Glycine soja]
Length=475

 Score =   464 bits (1195),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 325/474 (69%), Gaps = 15/474 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ ++SSPG+GH+IP + L  R    HN  +TV  +T+  S TE Q+L S+   S  + +
Sbjct  8     HVVLVSSPGLGHLIPVIELGKRFVLHHNFNVTVLAVTSQTSKTETQILNSAFTPSLCHVI  67

Query  351   GIPPVDISALLDANTKP-VAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              IPP ++  L+D N    V +LC+++R A P +R+ ++K   R  AL+ D F TEA+P+A
Sbjct  68    CIPPPNLVGLIDENAATHVTRLCVMMREAKPAIRSIISKITPRPSALIFDIFSTEAIPIA  127

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              ELN+  +V+  ++A   AL VY PVLD +I G++V+Q++ L+IPGC  VRPEDV DPML
Sbjct  128   RELNILSYVFDASHAWMLALLVYSPVLDEKIEGEFVDQKQALKIPGCNAVRPEDVFDPML  187

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DRND QY+E L +G     +DGIL+NTWE++    L+A   N  +      P+YA+GP+ 
Sbjct  188   DRNDQQYKEALGIGNRITQSDGILVNTWEELQYKDLEAEALNMKI------PIYAVGPIV  241

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R  E         +++WL +QP ESV+YVSFGSGGTLS EQ TELAWGLELSE+RF+WVV
Sbjct  242   RESELEKNSSNESLVKWLDEQPNESVVYVSFGSGGTLSYEQTTELAWGLELSERRFVWVV  301

Query  1068  RPPSMRGSDDAFFTTG----QGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             R P+   +D AFFTTG    +G +G   Y PEGF +RT N GL+VP W++Q  IL+H S 
Sbjct  302   RAPTEGAADSAFFTTGSSESEGDEGL-MYFPEGFLSRTCNLGLLVPEWSQQVTILKHRSV  360

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFLSHCG  STLES+ NGVP+IAWPLY+EQ+ NATLL+EE+GVA+R   LPTK +V RE
Sbjct  361   GGFLSHCGWGSTLESVTNGVPLIAWPLYAEQKMNATLLSEELGVAVRTAVLPTKKVVRRE  420

Query  1416  EVKTLVKIML---QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             E+  +V+ ++   ++ K  E+RERV +++ S+ KA+S+GGSSY ++ +V   IE
Sbjct  421   EIARMVREVIPGNENVKKNEIRERVKEVQRSALKALSVGGSSYTALSQVAKTIE  474



>ref|XP_002273356.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5 isoform X1 
[Vitis vinifera]
Length=502

 Score =   465 bits (1196),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 228/462 (49%), Positives = 314/462 (68%), Gaps = 2/462 (0%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L L  RL   H  ++TVFV+ T  SP +  LL+ +      N V
Sbjct  7     HAALLASPGMGHLIPVLELGKRLITHHGFQVTVFVVATEVSPAQSLLLQQATTPHLPNLV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P V+ S L+D     + QL  +VR +LP +R+A++        L+VD F  EA  +A+
Sbjct  67    SLPVVNDSILVDPEASVLEQLLSMVRGSLPRLRSAISAMKVPPTVLIVDMFGLEAFKIAN  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E  + K+VY+ +NA F A T Y PVLD+ +  +  + ++   IPGCKP+  E V +P+LD
Sbjct  127   EFEMLKYVYITSNAWFLAFTAYLPVLDKLVETKCSDLQEPTRIPGCKPLWVEHVFEPVLD  186

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
               +  Y  Y+R+ V   MADG+L+NTWE+++  TL A+R+++ L ++V  PVY +GPLTR
Sbjct  187   IKNEMYHAYMRMAVEITMADGVLVNTWENLEHPTLAAMRDDKLLGQIVKAPVYPVGPLTR  246

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              IE  D ++G  ++ WL  QP ESV+YVSFGSGGTLSA+Q TELAWGLELS Q F+WV+R
Sbjct  247   PIEPTDSENG--VLDWLGMQPSESVIYVSFGSGGTLSAKQTTELAWGLELSRQNFVWVIR  304

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    +  A FT+  G DG   YLP+GF  RT+  G VVPMWA QA IL HPS GGF++
Sbjct  305   PPMDDDAAAALFTSADGRDGIAEYLPDGFLERTKKVGCVVPMWAPQAQILGHPSVGGFIT  364

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLES+ NGVP+IAWPLY+EQ+ NA +LTEE+GVAIRP   PTKG+V REE+ T+
Sbjct  365   HCGWNSTLESMVNGVPMIAWPLYAEQKMNAVMLTEELGVAIRPNVFPTKGVVGREEIATM  424

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
             V+ +++  +G  +R +V +LK S+EKA+S GGSSY S+  V+
Sbjct  425   VRRLMEDSEGNAIRAKVKELKYSAEKALSKGGSSYTSLSHVV  466



>ref|XP_007047012.1| Anthocyanidin 3-O-glucosyltransferase 5 [Theobroma cacao]
 gb|EOX91169.1| Anthocyanidin 3-O-glucosyltransferase 5 [Theobroma cacao]
Length=472

 Score =   463 bits (1192),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 227/463 (49%), Positives = 321/463 (69%), Gaps = 1/463 (0%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +LSSPG+GH+IP L L  RL  V+N K+T+FV+++  +  E Q+L+SS        +
Sbjct  9     HAVLLSSPGLGHLIPVLELGKRLVTVNNFKVTIFVVSSLTAAAESQVLQSSMSPELCEVI  68

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PP +IS L+DA+   V ++ +L+R   P + +A++        L+VD F TE+L  AD
Sbjct  69    RLPPANISDLVDADAAVVTRIAVLMREIRPALSSAISALKYPPTVLIVDLFGTESLGFAD  128

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             +  +PKFV++P++A F ALT+Y P LD  + G+YV++++ L IPGC+PV+PEDVVDPM+ 
Sbjct  129   DFKIPKFVFIPSHAWFLALTIYLPRLDEVVKGEYVDEKEALFIPGCRPVQPEDVVDPMMC  188

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R+D QY EY+ +G+   MADGIL++TWE+++P TL ALR+N+ L ++   P+Y +GP+ R
Sbjct  189   RSDQQYAEYVHMGMNILMADGILVSTWEELEPETLAALRDNKLLGRISKVPIYPVGPMIR  248

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              I   D     ++  WL KQP  SVL+VSFGSGG LS EQ+ ELAWGLELS QRFIWVVR
Sbjct  249   PIGAVDHSSKKLLFDWLDKQPSVSVLFVSFGSGGMLSNEQMRELAWGLELSRQRFIWVVR  308

Query  1071  PPSMRGSD-DAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
              P+++  D   F      ++   ++LPEGF  RTQN GLVV  WA Q  IL HPS GGF 
Sbjct  309   TPAVKSGDGSFFSVGSGSSNDKLSFLPEGFLGRTQNLGLVVSDWAPQVEILSHPSVGGFF  368

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLESI NGVP+IAWPLY+EQ+ NAT+L E + +A+R   LP+KGIV REE+K 
Sbjct  369   SHCGWNSTLESIMNGVPMIAWPLYAEQKLNATMLAEGLRIAVRSKILPSKGIVGREEIKM  428

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
             LV+ ++   +G+ MR RV +LK+S+E+A +  GSS+ ++ + +
Sbjct  429   LVRKIMVDDEGRAMRARVKELKLSAERAWTRNGSSWKALAQAM  471



>ref|XP_007047009.1| UDP-glucosyl transferase 72E1, putative [Theobroma cacao]
 gb|EOX91166.1| UDP-glucosyl transferase 72E1, putative [Theobroma cacao]
Length=476

 Score =   462 bits (1188),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 229/464 (49%), Positives = 331/464 (71%), Gaps = 12/464 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDLTSRLNN  347
             H+ +L+SPG+GH+IP L LA R    H+ K+TVFV+     S    QLL+S D    L+ 
Sbjct  7     HVALLASPGMGHLIPVLELAKRFVSHHSFKVTVFVVAADHASIAHSQLLQSPD-PDLLDI  65

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             V +P VD+S L++ +     ++ +++  ++P +R+ ++K   R  ALVVD F T+AL +A
Sbjct  66    VLLPFVDLSKLVEPDASLATKIVIMMLESVPFLRSEISKMEFRPTALVVDMFGTDALDIA  125

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM-  704
             DE N+ K+V++ +NA F+A+ +Y P +DR+ + ++V+ +K L IPGCKPV+ ED +D   
Sbjct  126   DEFNMLKYVFIASNAFFSAVVLYSPEIDRKEIDEHVKNQKPLHIPGCKPVKFEDTLDVFF  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             +D +D  Y+ YL +GV   ++DGIL+N+W++++  TLKAL E + +      PVY IGPL
Sbjct  186   MDYDDPSYQGYLGVGVKMSLSDGILVNSWDELEHTTLKALAEAKKV------PVYPIGPL  239

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R IE+     G  I+ WL KQP+ESV+YVSFGSGGTLSA+Q+ ELA GL+LS+QRF+WV
Sbjct  240   VRPIEKPVL--GNQILDWLDKQPKESVIYVSFGSGGTLSAQQVAELALGLDLSQQRFVWV  297

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VRPPS   +  +FFT G G+DG P+YLP+GF+TRTQ++GLVVPMWA Q  +L HPS GGF
Sbjct  298   VRPPSDNDASGSFFTVGNGSDGDPDYLPDGFSTRTQDRGLVVPMWAPQVEVLSHPSIGGF  357

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTK-GIVTREEV  1421
             L+HCG NST+ESI NGVP+IAWPLY+EQ  NA +LTE++G +IR   L +  G+V RE++
Sbjct  358   LTHCGWNSTMESITNGVPMIAWPLYAEQNMNAAILTEDIGASIRAKALESSGGVVGREDI  417

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             K++V+ +L   +G+++R RV +LK S+ KA+S GGSS NS+ +V
Sbjct  418   KSMVRTILVDSEGQDIRARVKELKNSAAKALSEGGSSCNSLSQV  461



>emb|CBI24504.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   461 bits (1185),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 229/461 (50%), Positives = 316/461 (69%), Gaps = 30/461 (7%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L LA RL   H  ++TVF I  + SP E                
Sbjct  7     HAILLASPGLGHLIPVLELAKRLVTHHGFRVTVFAIAASASPAE----------------  50

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
                    S L+DA+     ++ +++R  +P  RAA++        ++VDFF  EAL +  
Sbjct  51    -------SHLVDADAAVFTRIVVMMRETIPSFRAAISAMKFPPSLMIVDFFGFEALEIP-  102

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++PK+ +VP+NA   ALT+Y   LD E+ G+YV++ + L++PGCKPVRPEDVVDPMLD
Sbjct  103   EFDMPKYTFVPSNACLLALTLYVATLDVEVKGEYVDRAEPLQLPGCKPVRPEDVVDPMLD  162

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R + QY EY+R+GVG   ADGIL+NTWED++P TLKALR+++ +++    P+Y +GPLTR
Sbjct  163   RRNQQYLEYMRMGVGITKADGILLNTWEDLEPTTLKALRDHKVMAQFAKVPIYPVGPLTR  222

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              + + +    + ++ WL  QP +SV+YVSFGSGGT S+EQ+ ELAWGLELS+QRFIWVVR
Sbjct  223   PVGKEEAR--SELLDWLDLQPADSVIYVSFGSGGTHSSEQLAELAWGLELSQQRFIWVVR  280

Query  1071  PPSMRGSDDAFFTTGQGADGTP-NYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             PP       +FFTTG+G    P +YLPEGF TRT+N G+VVP+WA Q  IL HPS  GFL
Sbjct  281   PPIENDPSGSFFTTGKGRGEHPSDYLPEGFLTRTKNVGVVVPLWAPQVEILSHPSVRGFL  340

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG  STLESI +GVP++AWPLY+EQR NAT+LTEE+G+A+RP  LPTK +V +EE++ 
Sbjct  341   SHCGWGSTLESILSGVPMVAWPLYAEQRLNATMLTEELGIAVRPEVLPTKRVVRKEEIEK  400

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             +V+ +++       RERV ++  S E+A+  GGSSYNS+ +
Sbjct  401   MVRKVMEENHS---RERVKEVMNSGERALRKGGSSYNSLSQ  438



>gb|KDO79472.1| hypothetical protein CISIN_1g011608mg [Citrus sinensis]
Length=481

 Score =   460 bits (1183),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 226/467 (48%), Positives = 319/467 (68%), Gaps = 6/467 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +L+SPG+GH IP L L  R A  ++ ++T+FV+ T  S  + QL    +     N V
Sbjct  7     HIALLASPGMGHFIPVLELGKRFATQNDFQVTIFVVATDTSTVQSQLRNLPN-PHLFNIV  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVDISALLDA+   V ++  ++R +LP +R++++    R  AL  D F TEA  +AD
Sbjct  66    SLPPVDISALLDADASIVIKIIFMMRESLPALRSSISTLKPRPTALFADLFGTEAFQIAD  125

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E  + K+VY+ +NA F A T+Y P +D+ +  ++  +++ L IPGC+ VR +D ++   D
Sbjct  126   EFEMLKYVYIASNAWFLAATIYFPTIDKRLQEEHYGRKQPLMIPGCRSVRFQDTLEAFTD  185

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
               D  + EYLR+G+    ADGIL+NTWED++P TL +LR+   +SK+   P+Y IGP+ R
Sbjct  186   PKDQLFDEYLRIGLEMVTADGILINTWEDLEPTTLASLRDG--ISKL--PPIYPIGPVVR  241

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
             ++      + + +++WL  QP ESV+YVSFG GGTLSA Q+ E+AWGLELS+QRFIWVVR
Sbjct  242   SMGSSHMSENSSLLEWLDMQPTESVIYVSFGGGGTLSANQMIEVAWGLELSQQRFIWVVR  301

Query  1071  PPSMRGSDDAFFTTGQGA-DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             PP       +FF  G G+ DGTP+YLP+GF TR    GLVVP WA Q  IL H S GGFL
Sbjct  302   PPMDNDVSGSFFKVGDGSSDGTPDYLPDGFLTRNAKMGLVVPDWAPQVEILGHASVGGFL  361

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLESI NGVP+I WPLY+EQ+ NAT+L EE+GVA+RP ++PT+ +V REE++ 
Sbjct  362   SHCGWNSTLESIVNGVPLIVWPLYAEQKMNATMLAEELGVAVRPNEMPTENLVKREEIEM  421

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             +V+ +L  K+G+ +R RV +LK S++KA + GGSSYN++ +V    E
Sbjct  422   MVRRILVDKEGQALRSRVKELKHSAKKASTKGGSSYNALSQVAKQCE  468



>emb|CAN77173.1| hypothetical protein VITISV_035786 [Vitis vinifera]
Length=502

 Score =   461 bits (1185),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 226/462 (49%), Positives = 312/462 (68%), Gaps = 2/462 (0%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L L  RL   H  ++TVFV+ T  SP +  LL+ +      N V
Sbjct  7     HAALLASPGMGHLIPVLELGKRLITHHGFQVTVFVVATEVSPAQSLLLQQATTPHLPNLV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P V+ S L+D     + QL  +VR +LP +R+A++        L+VD F  EA  +A+
Sbjct  67    SLPVVNDSILVDPEASVLEQLLSMVRGSLPRLRSAISAMKVPPTVLIVDMFGLEAFKIAN  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E  + K+VY+ +NA F A T Y PVLD+ +  +  + ++   IPGCKP+  E V +P+LD
Sbjct  127   EFEMLKYVYITSNAWFLAFTAYLPVLDKLVETKCSDLQEPTRIPGCKPLWVEHVFEPVLD  186

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
               +  Y  Y+R+ V   MADG+L+NTWE+++  TL A+R+++ L ++V  PVY +GPLTR
Sbjct  187   IKNEMYHAYMRMAVEITMADGVLVNTWENLEHPTLAAMRDDKLLGQIVKAPVYPVGPLTR  246

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              IE  D ++G  ++ WL  QP ESV+YVSFGSGGTLSA+Q  ELAWGLELS Q F+WV+R
Sbjct  247   PIEPTDSENG--VLDWLGMQPSESVIYVSFGSGGTLSAKQTXELAWGLELSRQNFVWVIR  304

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    +  A FT+  G DG   YLP+GF  RT+  G VVPMWA QA IL HPS GGF++
Sbjct  305   PPMDDDAAAALFTSADGRDGIAEYLPDGFLERTKKVGCVVPMWAPQAQILGHPSVGGFIT  364

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NS LES+ NGVP+IAWPLY+EQ+ NA +LTEE+GVAIRP   PTKG+V REE+ T+
Sbjct  365   HCGWNSXLESMVNGVPMIAWPLYAEQKMNAVMLTEELGVAIRPNVFPTKGVVGREEIATM  424

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
             V+ +++  +G  +R +V +LK S+EKA+S GGSSY S+  V+
Sbjct  425   VRRLMEESEGNAIRAKVKELKYSAEKALSKGGSSYTSLSHVV  466



>ref|XP_002310204.2| hypothetical protein POPTR_0007s12410g [Populus trichocarpa]
 gb|EEE90654.2| hypothetical protein POPTR_0007s12410g [Populus trichocarpa]
Length=480

 Score =   459 bits (1180),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 234/466 (50%), Positives = 310/466 (67%), Gaps = 5/466 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +LSSPG+GH+IP L L  RL   H   +T+FV+TT +S ++ QLL+ S     LN V
Sbjct  7     HAALLSSPGMGHLIPVLELGKRLLTNHGFTVTIFVVTTDNSLSKSQLLKQSPCPDLLNIV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S+L+   T  +AQL +++R ALP +R+A+         L+VDFF TEA+ +AD
Sbjct  67    LLPPVDVSSLITPTTGILAQLAIMMREALPKLRSAILAMEFCPTVLIVDFFGTEAMVIAD  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+ K+ ++ + A F ALT++ P +D+ I   +V+ ++ L IPGCK +   D  +P+LD
Sbjct  127   EFNMLKYAFMTSTAWFLALTLHMPTIDKAIEDNHVKNQQALLIPGCKSLEFRDTFEPVLD  186

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             RND  Y EY R+GV     DGIL+NTW+D++  TL AL + + L +V   P+Y +GPL R
Sbjct  187   RNDQMYIEYKRMGVEMQKFDGILVNTWQDLEGTTLGALEDEKRLGRVAQVPIYPVGPLVR  246

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              I      +   +++WL  QP ESV+YVSFGSGG LSA Q TELA GLE S QRFIWVVR
Sbjct  247   AITPGPKSE---MLEWLDMQPIESVIYVSFGSGGALSARQTTELACGLESSGQRFIWVVR  303

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    S    F T    D TP++LP+GF TRT+  GLVVPMWA Q  IL HPS GGF+S
Sbjct  304   PPIEGDSAATVFKTNHRTDDTPDFLPDGFLTRTRKMGLVVPMWAPQTEILSHPSVGGFVS  363

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLESI NGVP+I WPLY+EQ  NA +L+E++GVAIR   LP K +V REE++T+
Sbjct  364   HCGWNSTLESIVNGVPMITWPLYAEQGMNAAMLSEDIGVAIRSKSLPAKEVVAREEIETM  423

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             V+ ++   KG   R R   LK S+EKA+S GGSSYNS+  V N  E
Sbjct  424   VRTIMD--KGDARRARAKTLKSSAEKALSKGGSSYNSLAHVANDCE  467



>ref|XP_011025719.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5 [Populus euphratica]
Length=481

 Score =   456 bits (1172),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 228/467 (49%), Positives = 315/467 (67%), Gaps = 6/467 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L L  RL   H   +T+FV+ T  S T+  L E       +N +
Sbjct  7     HAALLASPGMGHLIPVLELGKRLVTNHGFHVTLFVVATDASTTQSLLKEP---YPHINII  63

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P VDIS L+D     V  L +++R  LP +R+A+        AL+VD F TEA  +A+
Sbjct  64    ILPFVDISGLIDPAATVVTSLAVMMRETLPSLRSAILALKSPPKALIVDLFGTEAFAVAE  123

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+ K+V+  +NA F A+T+Y P +D+ +  +++ Q++ L IPGCK V+ ED +   LD
Sbjct  124   EFNMLKYVFDTSNAWFFAITIYVPTIDKNVEDKHIIQKQPLSIPGCKSVQFEDTLQAYLD  183

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             RND  Y EY R+G+   MADGILMNTWED++P TL ALR+ + L +V   PVY IGPL R
Sbjct  184   RNDQTYIEYKRIGIEMPMADGILMNTWEDLEPTTLGALRDFQMLGRVAKAPVYPIGPLVR  243

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +      +   ++ WL  QP ESV+YVSFGSGGTLS++Q+ ELAWGLELS+QRF+WVVR
Sbjct  244   PVGPSVPRN--QVLNWLDNQPYESVIYVSFGSGGTLSSDQMAELAWGLELSKQRFVWVVR  301

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    +  AFF    G++G P++LPEGF  RT+  GLVVPMWA Q  IL HPS GGFLS
Sbjct  302   PPIDNDAAGAFFNLDDGSEGIPSFLPEGFLDRTREVGLVVPMWAPQVEILAHPSVGGFLS  361

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLESI NGVP+IAWPLY+EQ+ NAT+LTEE+GVA++P  L ++ +V   E++ +
Sbjct  362   HCGWNSTLESITNGVPMIAWPLYAEQKMNATILTEELGVAVQPKTLASERVVVGAEIEMM  421

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLNAIE  1568
             ++ +++ ++G  +R+RV +LK S   A+S  GGSSYNS+ ++    E
Sbjct  422   IRKIMEDEEGFGIRKRVNELKQSGVNALSSKGGSSYNSLSQIAKHCE  468



>gb|ADL67596.1| glycosyltransferase 2 [Populus tomentosa]
Length=480

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 231/466 (50%), Positives = 310/466 (67%), Gaps = 5/466 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +LSSPG+GH+IP L L  RL   H   +T+FV+TT +S ++ QLL+ S     L+ V
Sbjct  7     HAALLSSPGMGHLIPVLELGKRLVTNHGFTVTIFVVTTDNSLSKSQLLKQSPCPDLLSIV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S+L+   T  +AQL +++R ALP +R+A+         L+VDFF TEA+ +AD
Sbjct  67    LLPPVDVSSLITPTTGILAQLAIMMREALPKLRSAILAMKFCPTVLIVDFFGTEAMVIAD  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+ K+ ++ + A F ALT++ P +D+ I   +V+ ++ L IPGCK +   D  +P+LD
Sbjct  127   EFNMLKYAFMTSTAWFLALTLHMPTIDKAIEDDHVKNQQALLIPGCKSLEFRDTFEPVLD  186

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             RND  Y EY R+GV     DGIL+NTW+D++  TL AL + + L +V   P+Y +GPL R
Sbjct  187   RNDQMYIEYKRMGVEMQKFDGILVNTWQDLEGTTLGALEDQKRLGRVAQVPIYPVGPLVR  246

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              I      +   +++WL  QP ESV+YVSFGSGG LSA+Q TELA GLE S QRFIWVVR
Sbjct  247   AITPGPKSE---MLEWLDMQPVESVIYVSFGSGGALSAKQTTELACGLESSGQRFIWVVR  303

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    S    F T    D TP++LP+GF TRT+  GLVVPMWA Q  IL HP+ GGF+S
Sbjct  304   PPIEGDSAATVFKTNHRTDDTPDFLPDGFLTRTRKTGLVVPMWAPQTEILNHPAVGGFVS  363

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLESI NGVP+I WPL++EQ  NA +LTE++GVAIR   LP K +V R E++T+
Sbjct  364   HCGWNSTLESIVNGVPMITWPLFAEQGMNAAMLTEDIGVAIRSKSLPAKEVVGRGEIETM  423

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             V+ ++   KG   R R   LK S+EKA+S GGSSYNS+  V N  E
Sbjct  424   VRTIMD--KGDARRARAKTLKSSAEKALSNGGSSYNSLAHVANDCE  467



>ref|XP_008241631.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanidin 3-O-glucosyltransferase 
5 [Prunus mume]
Length=449

 Score =   451 bits (1161),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 231/468 (49%), Positives = 311/468 (66%), Gaps = 36/468 (8%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  IL SPG+GH+IP + LA RL   HNV +T+F + +  S  E +LL+++      + +
Sbjct  6     HAAILCSPGMGHLIPVIELAKRLVNHHNVTVTIFAVQSNTSKAESELLKAATSPKFCDII  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAA-LTKQCRRLDALVVDFFCTEALPMA  527
              +P  DIS LLD +   V +L +++R   P  R+A L +   R   L+VD F TE+LP+ 
Sbjct  66    ELPLPDISGLLDPDAGIVMKLSVMMREIRPAFRSAILAEDSPRPTILIVDLFGTESLPIG  125

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             DEL +PK+VY+  NA F ALTVY P+LD+E+ G+YV+  +                    
Sbjct  126   DELGVPKYVYIACNAWFLALTVYVPILDKEVEGEYVDXNQ--------------------  165

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
                  QY EY+R+GV    +DGIL+N W+D+ P TL A ++   L  VV  PVY IGPLT
Sbjct  166   -----QYLEYVRMGVEIPRSDGILLNIWKDLQPKTLDAFKDESLLGGVVKVPVYPIGPLT  220

Query  888   RNIEE------RDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQ  1049
             R+ +       RDGD    +  WL KQP ESV++VS GSGGTL+ EQ+TE+AWGLELS+Q
Sbjct  221   RSAKSAGPTGLRDGD----LFNWLDKQPSESVIFVSLGSGGTLTYEQMTEMAWGLELSQQ  276

Query  1050  RFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             RFIWVVRPP+ +G+D AFFT+G+G D   +YLPEGF TRT+  GLVVP+WA Q  IL HP
Sbjct  277   RFIWVVRPPTSKGADAAFFTSGKGDDDPSSYLPEGFLTRTREIGLVVPIWAPQVDILSHP  336

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVT  1409
             S GGF SHCG NSTLESI NGVP+I WPLY+EQR NATLL++E+GVA+R    P KG+V 
Sbjct  337   SIGGFFSHCGWNSTLESIINGVPMIVWPLYAEQRMNATLLSDELGVAVRSKVPPWKGVVE  396

Query  1410  REEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             REE+K +V+ ++  + G  +R +V +LK+S+ KA+S GGSSYN++ +V
Sbjct  397   REEIKRMVRKIMVEEDGIAIRGKVNELKLSAVKALSQGGSSYNALSQV  444



>ref|XP_011025720.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Populus 
euphratica]
Length=479

 Score =   452 bits (1164),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 231/466 (50%), Positives = 310/466 (67%), Gaps = 6/466 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +LSSPG+GH+IP L L  RL   H   +T+F +TT ++ ++ QLL+ +     LN V
Sbjct  7     HAALLSSPGMGHLIPVLELGKRLVTNHGFTVTIFFVTT-ENFSKSQLLKQTPCPDLLNIV  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S+L+   T  +AQL +++R ALP +R+A+     R   L+VDFF TEA+ +AD
Sbjct  66    LLPPVDVSSLISPTTGILAQLAIMMREALPQLRSAILAMEFRPTVLIVDFFGTEAMVIAD  125

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+ K+ ++ + A F ALT++ P +D+ I   +V+ ++ L IPGCK +   D  +P+LD
Sbjct  126   EFNMLKYAFMTSTAWFLALTLHMPTIDKAIEDNHVKNQQALLIPGCKSLEFRDTFEPVLD  185

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             RND  Y EY R+GV     DGIL+NTW+D++  TL AL + + L +V   P+Y +GPL R
Sbjct  186   RNDQMYIEYKRMGVEMQKFDGILVNTWQDLEGTTLGALEDEKRLGRVAQVPIYPVGPLIR  245

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              I      +   +++WL  QP ESV+YVSFGSGG LSA+Q TELA GLE S QRFIWVVR
Sbjct  246   EITPGPKSE---VIEWLDMQPIESVIYVSFGSGGALSAKQTTELACGLESSGQRFIWVVR  302

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    S    F T  G D TP++LP+GF TRT+  GLVVP+WA Q  IL HPS GGF+S
Sbjct  303   PPIEGDSAATVFKTNHGTDDTPDFLPDGFLTRTRKMGLVVPLWAPQTEILSHPSVGGFVS  362

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NS LESI NGVP+I WPLY+EQ  NA +LTE++GVAIR   LPTK +V REE++ +
Sbjct  363   HCGWNSALESIVNGVPMITWPLYAEQGMNAAMLTEDIGVAIRSKSLPTKEVVGREEIEAM  422

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             V+ ++   KG   R R   LK S+EKA+S GGSS NS+  V N  E
Sbjct  423   VRTIMD--KGDARRARAKTLKSSAEKALSKGGSSCNSLAHVANDCE  466



>ref|XP_008453746.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like, partial 
[Cucumis melo]
Length=490

 Score =   449 bits (1155),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 216/473 (46%), Positives = 322/473 (68%), Gaps = 9/473 (2%)
 Frame = +3

Query  159   QSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSR  338
             +S  H+ ++SSPG+GH+ P+L LA RL+  H + +TVF++ +  S  E +++ ++     
Sbjct  2     ESAAHVALISSPGMGHLFPALELATRLSTHHRLTVTVFIVPSHSSSAENKVIATAQAAGL  61

Query  339   LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEAL  518
                V +PP D+S + +++   V +L + +R  +P  R+A++        L+ D F  E+ 
Sbjct  62    FTVVELPPADMSDVTESSI--VGRLAITMRRHVPIFRSAVSAMTSPPSVLIADIFAVESF  119

Query  519   PMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
              +ADE ++ K+ +V +NA F A+ VY  V DREIVGQYV+Q++ L+IPGC+PVRP DV+D
Sbjct  120   AVADEFDMAKYTFVASNAWFLAVMVYAQVWDREIVGQYVDQKEPLQIPGCEPVRPCDVID  179

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIG  878
             P+LDR ++QY E L+LG+G   +DG+L+NTW+++   TL +L +   L K +  PVY+IG
Sbjct  180   PLLDRTELQYSEILKLGMGIASSDGVLVNTWDELQHRTLASLNDRYLLGK-ISPPVYSIG  238

Query  879   PLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             P+ R    + G   + +  WL KQP ESV+YVSFGSGGTLS EQ+TE+A GLE+S+QRF+
Sbjct  239   PIVRQPGSKKGGS-SELFNWLSKQPSESVIYVSFGSGGTLSFEQMTEVAHGLEMSKQRFV  297

Query  1059  WVVRPPSMRGSDDAFFTTGQGAD--GTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             WVVR P +R SD A+FTTG G++   +  +LPEGF  RT   G VV MWA+Q  +L  P+
Sbjct  298   WVVRAPKVR-SDGAYFTTGDGSEEQSSAKFLPEGFLERTSEVGFVVSMWADQTAVLGSPA  356

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
              GGF +H G NS LE I NGVP++ WPLY+EQR NAT+L EE+GVA+R  +LPTK ++ R
Sbjct  357   VGGFFTHSGWNSALEGITNGVPMVVWPLYAEQRLNATMLAEEIGVAVRSKELPTKALIER  416

Query  1413  EEVKTLV-KIMLQS-KKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAI  1565
             EE+  +V KIM++   +GK +R +  +L+ S+EKA++ GGSSY++   V+  +
Sbjct  417   EEIAAMVRKIMVEEDDEGKAIRAKAKELQRSAEKALAEGGSSYHNFARVVKIV  469



>ref|XP_003526037.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Glycine 
max]
Length=478

 Score =   449 bits (1154),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 235/474 (50%), Positives = 326/474 (69%), Gaps = 12/474 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ +LSSPG+GH+IP++ L  R    HN ++TV  +T+  S TE ++L SS      + +
Sbjct  8     HVVLLSSPGLGHLIPTIELGKRFVHHHNFQVTVLAVTSQTSKTETEILNSS----LCHII  63

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              IP  D++ L++ N   + +L +++  A+P +++ L+K   R  AL+VD F TEA+P+A 
Sbjct  64    DIPSPDLTGLVNENNGVMTRLSVMMSEAVPAIKSILSKITPRPSALIVDIFGTEAIPIAR  123

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             ELN+  +VYV ++A   AL VY PVLD +I G+YV+Q++ L+IPGC PVRPEDVVD MLD
Sbjct  124   ELNILSYVYVASHAWVLALIVYAPVLDEKIEGEYVDQKEALKIPGCNPVRPEDVVDSMLD  183

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGK--PVYAIGPL  884
             RND +Y+E+L++G     +DG+L+NTWE++    L+ALRE   LSK +    PVYA+GP+
Sbjct  184   RNDRKYKEFLKIGNRIPQSDGLLVNTWEELQRKVLEALREGGLLSKALNMKIPVYAVGPI  243

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R  E         +++WL +Q  ESV+YVSFGSGGTLS EQ+ ELA GLE+SEQRF+WV
Sbjct  244   ERESELETSSSNESLVKWLDEQRSESVVYVSFGSGGTLSYEQMRELALGLEMSEQRFVWV  303

Query  1065  VRPPSMRGSDDAFFTTGQGAD---GTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             VR P     D AFFTTG+          YLPEGF +RT+  GL+VP WA+Q  IL+H S 
Sbjct  304   VRAPIEESVDAAFFTTGRSESEEVEMSKYLPEGFISRTRKVGLLVPEWAQQVTILKHRSI  363

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFLSHCG  STLES+ NGVP+IAWPLY+EQR NATLL EE+G+A+R   LPTK +V RE
Sbjct  364   GGFLSHCGWGSTLESVTNGVPLIAWPLYAEQRMNATLLAEELGLALRTAVLPTKKVVRRE  423

Query  1416  EVKTLVKIMLQ---SKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             E++ +V+ ++Q   + K   +RERV + + S+ KA+S GGSSY ++ +V   IE
Sbjct  424   EIEHMVREIIQGDENGKSNGIRERVKETQRSAVKALSEGGSSYVALSQVAKIIE  477



>ref|XP_010026164.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Eucalyptus grandis]
Length=479

 Score =   448 bits (1152),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/467 (48%), Positives = 307/467 (66%), Gaps = 5/467 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPGIGH+IP + L  RLA  H + +TVFV+ +  S     +  S+   +RL  V
Sbjct  7     HAALLASPGIGHLIPVVELGKRLAAHHGLNVTVFVVASDSSIKNSPIFSSASALNRLELV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S L+++ T  V QL  ++RAALP +RAA++    R   L+VD F TEAL +A+
Sbjct  67    LLPPVDVSGLINSTTSAVTQLARIMRAALPSLRAAISAMRARPSVLIVDIFGTEALAVAE  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V+V T ARF A  ++ P +DR+   ++   +K L+IPG +PVR ED ++  LD
Sbjct  127   EYDMLKYVFVTTTARFLAAFIHLPNIDRKTEQEHRILKKPLQIPGLEPVRFEDTLNLFLD  186

Query  711   RND-VQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
               D   Y EY R G     ADGIL+NTW+D++P  L AL + + L +V   PVY +GPL 
Sbjct  187   NIDQCLYAEYTRFGSLIPTADGILVNTWQDLEPSALHALGDEKFLGRVARAPVYPVGPLV  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R +E    D  + +M WL+ QP ESV+YVSFGSGGTLS EQ  ELAWGLELS+QRF+WV 
Sbjct  247   RAVEP---DSKSRVMNWLNMQPVESVIYVSFGSGGTLSTEQTAELAWGLELSQQRFLWVA  303

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +   F       DG PNYLP+GF+TRT ++G+V PMWA QA IL H S GGF+
Sbjct  304   RPPVDDDASGNFSNVSNSQDGMPNYLPDGFHTRTHDRGMVAPMWAPQAEILAHKSVGGFV  363

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLESI NGVP++AWPLY+EQR NA +L E++G A+R    P  G + REE+  
Sbjct  364   SHCGWNSTLESIVNGVPMVAWPLYAEQRTNAAMLVEQLGTAVRSRMRPAHGTIRREEIAD  423

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             +V+ ++ S +G  MR +  +L+ ++ +AI  GGSS+NS+ +V    E
Sbjct  424   MVRSIM-SLEGNGMRTKAKELQRAAAEAIRKGGSSHNSLTQVAKEFE  469



>ref|XP_010040922.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Eucalyptus grandis]
 gb|KCW44777.1| hypothetical protein EUGRSUZ_L01657 [Eucalyptus grandis]
Length=482

 Score =   447 bits (1151),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 225/469 (48%), Positives = 306/469 (65%), Gaps = 5/469 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP + L  RLA  H   +T+FV+    S  E  +  S+   + L  V
Sbjct  7     HAALLASPGMGHLIPVVELGKRLAAHHGFDVTIFVVAPDSSIGESPVFSSASALNHLKLV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVDIS L D+ +  V QL +++R ALP +R A++    R   LVVD F TEAL +A+
Sbjct  67    LLPPVDISGLTDSTSSVVTQLVMMMREALPSLRTAISAMRARPATLVVDLFGTEALAVAE  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V++ + ARF A T++ P +D ++  ++   ++ LEIPG +PVR ED +D  LD
Sbjct  127   EFDMLKYVFITSTARFLAATIHLPTIDGKVEHEHRIMKRPLEIPGLEPVRFEDTLDLFLD  186

Query  711   RNDVQ-YREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             + D   Y EY R+G     ADGIL+NTW+D++P TL AL +++ L +V   PVY +GPL 
Sbjct  187   QTDKSLYAEYTRIGREIPTADGILVNTWQDLEPSTLHALEDDKFLGRVTKAPVYPVGPLV  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R +      +   +M WL  QP ESV+YVSFGSGGTLSAEQ TELAWGLELS+QRF+WVV
Sbjct  247   RPVGPNSKSE---VMNWLGMQPVESVIYVSFGSGGTLSAEQTTELAWGLELSQQRFVWVV  303

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +   FF    G DGTPNYLP GF TRT ++G+VVPMWA Q  IL H S GGF+
Sbjct  304   RPPMDDDASGNFFNGSNGQDGTPNYLPGGFYTRTHDRGMVVPMWAPQTEILAHESVGGFV  363

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLESI NGVP++AWPLY+EQ  NA +L E++G A+R    P  G + REE+  
Sbjct  364   SHCGWNSTLESIVNGVPMVAWPLYAEQGMNAAMLVEKLGTAVRSRMRPAGGPIGREEIAD  423

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             +V+ ++ S KG  MR R  +L+  +  A+  GGSS+NS+  V    E +
Sbjct  424   MVRSVINS-KGNGMRTRAKELQRGAAGAVLEGGSSHNSLTRVAKECEVK  471



>ref|XP_007203198.1| hypothetical protein PRUPE_ppa025290mg [Prunus persica]
 gb|EMJ04397.1| hypothetical protein PRUPE_ppa025290mg [Prunus persica]
Length=490

 Score =   447 bits (1150),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 236/484 (49%), Positives = 319/484 (66%), Gaps = 10/484 (2%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             M+  N S  H  +L SPG+GH+IP L LA +L    N  +T+FV+++  S  E QLL S+
Sbjct  1     METMNNSKQHAALLCSPGLGHLIPILELAKQLVAHQNFTVTIFVVSSQTSHAESQLLNST  60

Query  324   DLTSRL-NNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDF  500
                 +L + V +P  DIS L+  +   V  L +++R      R+AL         L+VD 
Sbjct  61    PTNPQLWHAVQLPSPDISGLVIPDDAVVTILAMMMREVRHAFRSALLGMEVCPTMLIVDL  120

Query  501   FCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVR  680
             F TE+LP+A+EL + KFVYVP+NA F +L VYCPVLD E+ G +V Q++ ++IPGC+ + 
Sbjct  121   FGTESLPIAEELGISKFVYVPSNAWFLSLMVYCPVLDVEVKGDFVHQKEPIQIPGCRSIL  180

Query  681   PE-DVVDPMLDRNDVQYREYLRL-GVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVV  854
             P+ D+ D +  R   +Y +++ +   G    D IL+N WED++P TL ALR+ + L +  
Sbjct  181   PQLDLDDTLSVRAHREYLDFVEIISRGVSKGDAILVNIWEDLEPKTLAALRDEKLLGRYT  240

Query  855   GKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGL  1034
               PVY IGPL R  E   G  G  +  WL KQP ESV+Y+S GSGGTLS EQ+TE+AWGL
Sbjct  241   KVPVYPIGPLIRPTES-SGSRGK-VFDWLDKQPNESVIYLSLGSGGTLSYEQMTEMAWGL  298

Query  1035  ELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPN----YLPEGFNTRTQNQGLVVPMWA  1202
             ELS+QRF+WV+R P+ R +D AFFT G G+ G  +    YLP+GF  RT++ G V+P+WA
Sbjct  299   ELSKQRFVWVIRKPT-RTADGAFFTGGNGSGGDEDSPSKYLPKGFLDRTKDVGFVIPLWA  357

Query  1203  EQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPM  1382
              Q  IL HPS GGFLSHCG NSTLESI NGVP+IAWPLY+EQR N+T+LTEE GVAIR  
Sbjct  358   PQVDILAHPSVGGFLSHCGWNSTLESITNGVPMIAWPLYAEQRMNSTMLTEEFGVAIRSK  417

Query  1383  KLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNA  1562
               P K +V REE++ +V+ +++ K+G  MRERV KLK SS KA+  GGSSYN++ +    
Sbjct  418   IPPWKKVVEREEIEEMVRKIMEEKEGIAMRERVRKLKTSSAKALEKGGSSYNALSQFAKH  477

Query  1563  IEKR  1574
              E R
Sbjct  478   GELR  481



>gb|KCW58591.1| hypothetical protein EUGRSUZ_H01251, partial [Eucalyptus grandis]
Length=463

 Score =   446 bits (1146),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 221/461 (48%), Positives = 305/461 (66%), Gaps = 5/461 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPGIGH+IP + L  RLA  H + +TVFV+ +  S     +  S+   +RL  V
Sbjct  7     HAALLASPGIGHLIPVVELGKRLAAHHGLNVTVFVVASDSSIKNSPIFSSASALNRLELV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S L+++ T  V QL  ++RAALP +RAA++    R   L+VD F TEAL +A+
Sbjct  67    LLPPVDVSGLINSTTSAVTQLARIMRAALPSLRAAISAMRARPSVLIVDIFGTEALAVAE  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V+V T ARF A  ++ P +DR+   ++   +K L+IPG +PVR ED ++  LD
Sbjct  127   EYDMLKYVFVTTTARFLAAFIHLPNIDRKTEQEHRILKKPLQIPGLEPVRFEDTLNLFLD  186

Query  711   RND-VQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
               D   Y EY R G     ADGIL+NTW+D++P  L AL + + L +V   PVY +GPL 
Sbjct  187   NIDQCLYAEYTRFGSLIPTADGILVNTWQDLEPSALHALGDEKFLGRVARAPVYPVGPLV  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R +E    D  + +M WL+ QP ESV+YVSFGSGGTLS EQ  ELAWGLELS+QRF+WV 
Sbjct  247   RAVEP---DSKSRVMNWLNMQPVESVIYVSFGSGGTLSTEQTAELAWGLELSQQRFLWVA  303

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +   F       DG PNYLP+GF+TRT ++G+V PMWA QA IL H S GGF+
Sbjct  304   RPPVDDDASGNFSNVSNSQDGMPNYLPDGFHTRTHDRGMVAPMWAPQAEILAHKSVGGFV  363

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLESI NGVP++AWPLY+EQR NA +L E++G A+R    P  G + REE+  
Sbjct  364   SHCGWNSTLESIVNGVPMVAWPLYAEQRTNAAMLVEQLGTAVRSRMRPAHGTIRREEIAD  423

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             +V+ ++ S +G  MR +  +L+ ++ +AI  GGSS+NS+ +
Sbjct  424   MVRSIM-SLEGNGMRTKAKELQRAAAEAIRKGGSSHNSLTQ  463



>gb|KDP31802.1| hypothetical protein JCGZ_12263 [Jatropha curcas]
Length=470

 Score =   445 bits (1145),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 229/469 (49%), Positives = 324/469 (69%), Gaps = 12/469 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L L  RL   HN ++T+F++ + DS T + LL+S++    L  V
Sbjct  7     HAAMLASPGMGHLIPVLELGKRLITHHNFQVTIFIVAS-DSSTTKSLLKSTN--PNLTIV  63

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P VDI AL++ N   V ++ + +R +LP +R++++    R   LVVD F TEA P+AD
Sbjct  64    ALPLVDIPALVNPNDNIVTKIVVFMRQSLPFLRSSISAMKSRPTVLVVDLFGTEAFPIAD  123

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD--PM  704
             E ++ K+V+V +N  F A+ +Y P +   +V  +V +++ LEIPG +PVR ED ++  P+
Sbjct  124   EFHMLKYVFVTSNEWFLAIAIYSPTV-HNLVQVHVNRKQPLEIPGFRPVRFEDTIEAYPI  182

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             ++ + V Y E+ R+G+   M+DGIL+NTWED+DP TL+ALR++  L  V   PVY +GPL
Sbjct  183   MNFDRV-YGEFSRVGIEIPMSDGILINTWEDLDPSTLEALRDDNKLGNVTRVPVYPVGPL  241

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R +E     +   I++WL  QP ESV+YVSFGSGGT+S EQ+ ELAWGLELS+QRFIWV
Sbjct  242   VRPVEFAVHGNPE-ILKWLELQPSESVIYVSFGSGGTISEEQMIELAWGLELSQQRFIWV  300

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQ-GLVVPMWAEQALILRHPSTGG  1241
             VRPP       ++FT GQ +D   +Y P+GF +RT N+ GLVVP+WA Q  IL H   GG
Sbjct  301   VRPPVNGDVSASYFTVGQESDAIKSYFPDGFLSRTHNKAGLVVPIWAPQREILAHVEVGG  360

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NS+LESI NGVP+IAWPLY+EQ+ NA LL EE+ VA+RP   PT+GI+ REE+
Sbjct  361   FLTHCGWNSSLESITNGVPMIAWPLYAEQKLNAALLAEELRVAVRPKTNPTEGIIGREEI  420

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             + +V+ +++    KEMR RV  LK S+EKA+S GG+SYNS+  V   I+
Sbjct  421   EMMVRNIMED---KEMRNRVKMLKNSAEKALSKGGTSYNSLSLVAKEIK  466



>ref|XP_008241632.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Prunus 
mume]
Length=490

 Score =   445 bits (1145),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 235/484 (49%), Positives = 316/484 (65%), Gaps = 10/484 (2%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             M+  N S  H  +L SPG+GH+IP L LA +L    N  +T+FV+++  S  E QLL S+
Sbjct  1     METMNNSKQHAALLCSPGMGHLIPILELAKQLVAHQNFTVTIFVVSSQTSHAESQLLNST  60

Query  324   DLTSRL-NNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDF  500
                 +L + V +PP DIS L+D +   V  L +++R      R+AL         L+VD 
Sbjct  61    PTNPQLWHVVQLPPPDISGLVDPDDAVVTILAMMMREVRHAFRSALLGMEVCPTMLIVDL  120

Query  501   FCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVR  680
             F TE+LP+A+EL + KFVYVP+NA F +L VYCPVLD E+ G +V Q++ ++IPGC+ + 
Sbjct  121   FGTESLPVAEELGISKFVYVPSNAWFLSLMVYCPVLDVEVKGDFVHQKEPIQIPGCRSIL  180

Query  681   PE-DVVDPMLDRNDVQYREYLRL-GVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVV  854
             P  D+VD +  R   +Y +++ +   G    D IL+N WED++P TL ALR+ + L +  
Sbjct  181   PHLDLVDTLSVRAHKEYLDFVEIISSGVSKGDAILVNIWEDLEPKTLAALRDEKLLGRYT  240

Query  855   GKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGL  1034
               PVY IGPL R  E   G  G  +  WL KQP ESV+Y+S GSGGTL  EQ+TE+AWGL
Sbjct  241   KVPVYPIGPLIRPTES-SGSRGK-VFDWLDKQPNESVIYLSLGSGGTLPYEQMTEMAWGL  298

Query  1035  ELSEQRFIWVVRPPSMRGSDDAFFTTGQG----ADGTPNYLPEGFNTRTQNQGLVVPMWA  1202
             ELS+QRF+WV+R P+ + +D AFFT G G     D    YLP+GF  RT++ GLV+P+WA
Sbjct  299   ELSKQRFVWVIRKPT-QTADGAFFTGGSGNGGDEDSPSKYLPKGFLERTKDVGLVIPLWA  357

Query  1203  EQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPM  1382
              Q  IL HPS GGFLSHCG NSTLESI NGVP+IAWPLY+EQR N+TLLTEE GVA+R  
Sbjct  358   PQVDILAHPSVGGFLSHCGWNSTLESISNGVPMIAWPLYAEQRMNSTLLTEEFGVAVRSK  417

Query  1383  KLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNA  1562
               P K +V REE++ +V+ ++  K+G  MR+RV KLK    KA+  GGSSYN++ +    
Sbjct  418   IPPWKKVVEREEIEEMVRKIMGEKEGFAMRDRVRKLKTRGAKALEKGGSSYNALSQFAKH  477

Query  1563  IEKR  1574
              E R
Sbjct  478   GELR  481



>ref|XP_007047008.1| Anthocyanidin 3-O-glucosyltransferase 5, putative [Theobroma 
cacao]
 gb|EOX91165.1| Anthocyanidin 3-O-glucosyltransferase 5, putative [Theobroma 
cacao]
Length=481

 Score =   444 bits (1143),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 226/475 (48%), Positives = 306/475 (64%), Gaps = 6/475 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+ P L L  RL   H   +T+FV+TT  S ++ QLL+ S  +  L  V
Sbjct  7     HAALLASPGMGHLTPVLELGKRLVSHHGFSVTIFVVTTDTSLSQSQLLKPSQTSYHLEVV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
               PPVDIS+ +D  T  + QL +++R ALP +R+A++       AL+VD F TEA  +A+
Sbjct  67    FFPPVDISSQIDQTTSILTQLAMMMREALPSLRSAISAMKVPPIALIVDMFGTEAFAIAE  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E  + K+V++ +NA F ALTV+ P +D++    +V ++K L IPGCKP+   D  +P+L 
Sbjct  127   EFMMLKYVFITSNAWFLALTVHAPTIDKKEEDDHVNKQKPLVIPGCKPICFVDSFEPILK  186

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              N+  Y EYLR+G     ADGIL+NT+ +++P TL AL +   L  V   PVY IGPL R
Sbjct  187   PNNQVYEEYLRMGTEISTADGILVNTFHELEPQTLAALNDKRKLGLVANAPVYPIGPLVR  246

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
               E     +   ++ WL  QP ESV+YVSFGSGGTL+A+Q TELAWGLE S QRF+WV+R
Sbjct  247   PAEPGVRSE---VLSWLDMQPNESVIYVSFGSGGTLTAKQTTELAWGLEKSLQRFVWVLR  303

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
              P    S    F T  G     NYLP+GF  RT   GLVVPMWA Q  IL HPS GGFLS
Sbjct  304   LPVENDSAATVFKTSNGCADYANYLPDGFLNRTSKTGLVVPMWAPQTEILNHPSIGGFLS  363

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NS+LESI NGVPIIAWPLY+EQ+ NA +L E +G+A+R   LP++ ++ R E++ +
Sbjct  364   HCGWNSSLESIVNGVPIIAWPLYAEQKMNAAMLAEHIGIAVRSKVLPSEDVIERSEIEAM  423

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE---KRRDLK  1586
             V+ ++  K+G+ +R RV  LK  +EKA+S GG SYNS+  V    E   +RR  K
Sbjct  424   VRKLMVGKEGEAIRARVRMLKSWAEKALSNGGGSYNSLANVAKDCEISLQRRITK  478



>emb|CBI17565.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   446 bits (1147),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 223/462 (48%), Positives = 306/462 (66%), Gaps = 23/462 (5%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L L  RL   H  ++TVFV+ T  SP +  LL+ +  T  L N+
Sbjct  7     HAALLASPGMGHLIPVLELGKRLITHHGFQVTVFVVATEVSPAQSLLLQQAT-TPHLPNL  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
                                 L  +VR +LP +R+A++        L+VD F  EA  +A+
Sbjct  66    --------------------LLSMVRGSLPRLRSAISAMKVPPTVLIVDMFGLEAFKIAN  105

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E  + K+VY+ +NA F A T Y PVLD+ +  +  + ++   IPGCKP+  E V +P+LD
Sbjct  106   EFEMLKYVYITSNAWFLAFTAYLPVLDKLVETKCSDLQEPTRIPGCKPLWVEHVFEPVLD  165

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
               +  Y  Y+R+ V   MADG+L+NTWE+++  TL A+R+++ L ++V  PVY +GPLTR
Sbjct  166   IKNEMYHAYMRMAVEITMADGVLVNTWENLEHPTLAAMRDDKLLGQIVKAPVYPVGPLTR  225

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              IE  D ++G  ++ WL  QP ESV+YVSFGSGGTLSA+Q TELAWGLELS Q F+WV+R
Sbjct  226   PIEPTDSENG--VLDWLGMQPSESVIYVSFGSGGTLSAKQTTELAWGLELSRQNFVWVIR  283

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    +  A FT+  G DG   YLP+GF  RT+  G VVPMWA QA IL HPS GGF++
Sbjct  284   PPMDDDAAAALFTSADGRDGIAEYLPDGFLERTKKVGCVVPMWAPQAQILGHPSVGGFIT  343

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLES+ NGVP+IAWPLY+EQ+ NA +LTEE+GVAIRP   PTKG+V REE+ T+
Sbjct  344   HCGWNSTLESMVNGVPMIAWPLYAEQKMNAVMLTEELGVAIRPNVFPTKGVVGREEIATM  403

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
             V+ +++  +G  +R +V +LK S+EKA+S GGSSY S+  V+
Sbjct  404   VRRLMEDSEGNAIRAKVKELKYSAEKALSKGGSSYTSLSHVV  445



>ref|XP_010026163.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Eucalyptus grandis]
 gb|KCW58590.1| hypothetical protein EUGRSUZ_H01250 [Eucalyptus grandis]
Length=481

 Score =   444 bits (1142),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 223/467 (48%), Positives = 314/467 (67%), Gaps = 6/467 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP + L  RLA  H   +TVFV+    S T+  L + S  +S LN  
Sbjct  7     HAVLLASPGMGHLIPVVELGKRLATHHGFDVTVFVVAADASITKSSLFKPSQ-SSPLNLE  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVDISAL+D+    V QL +++R ALP +RAA++    R  AL+VD F TEAL +A+
Sbjct  66    LLPPVDISALVDSTASVVTQLMIMMREALPSLRAAISAMKSRPTALIVDMFGTEALAIAE  125

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V++ + A F A+TV+ P +D E   ++   ++ L+IPGC+ +R ED +D  LD
Sbjct  126   EFDMLKYVFITSTAWFLAVTVHFPYIDEEAEHKHRIMKRPLDIPGCRSIRHEDTLDLFLD  185

Query  711   R-NDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             + N   +  + R+G+    ADGIL+NTW+D++P+TL AL++ + L +V   PVY +GPLT
Sbjct  186   QTNKNLFSGFARVGMEISNADGILVNTWQDLEPLTLCALKDEKSLGRVAKAPVYPVGPLT  245

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R I +    +   +M WL  QP ESV+YVSFGSGGTLSA+Q +ELAWGLELS+ +FIWVV
Sbjct  246   RPIGQSSKSE---VMDWLDMQPTESVIYVSFGSGGTLSAKQTSELAWGLELSQHKFIWVV  302

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +   FF      DGTP+YLP GF TR   +G+VVPMWA Q  IL H S GGF 
Sbjct  303   RPPVDGDASANFFNVTNSHDGTPSYLPNGFYTRIGKRGMVVPMWAPQNEILAHESIGGFF  362

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLES+ NGVP++AWPLY+EQ+ NA +L EE+GVA+RP       ++ REE+  
Sbjct  363   SHCGWNSTLESMVNGVPMVAWPLYAEQQMNAAMLAEELGVAVRPKTQLNAAVIEREEIAG  422

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             +V+ +++  KG EMR +V +L+ S+++ ++ GGSSYNS+  V    E
Sbjct  423   MVRRVME-LKGNEMRGKVKELQASAKRVLTQGGSSYNSLARVSKECE  468



>ref|XP_007047011.1| UDP-glucosyl transferase 72E1, putative [Theobroma cacao]
 gb|EOX91168.1| UDP-glucosyl transferase 72E1, putative [Theobroma cacao]
Length=476

 Score =   442 bits (1137),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 229/464 (49%), Positives = 315/464 (68%), Gaps = 10/464 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L L  R+   H+  +TVFV+  A  P    LL+S      L  +
Sbjct  10    HAALLASPGMGHLIPVLELGKRMVTHHDFLVTVFVV--ASDPASTSLLKSPTPNDDLGII  67

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P VDIS+L+D     VA+L +L+R +LP +R+++     R  ALVVD F  +A  +AD
Sbjct  68    ALPSVDISSLVDPKAPLVAKLLVLMRESLPSLRSSIAAMKCRPTALVVDLFGIDAFAIAD  127

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIV-GQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             E  + ++V+  T A F A+ ++   + + ++  ++V+ +K L++PGCK +R ED ++  L
Sbjct  128   EFGMLRYVFDTTTAWFLAVALHSSSIGKNVILEEHVKSQKPLKVPGCKSLRFEDTLESFL  187

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             + +     +++  G      DGIL+NTWED++  T+KALR+N  L +VV  P+Y +GPL 
Sbjct  188   NIDRFDGSQFM--GTEMTKTDGILINTWEDLESTTIKALRDNNFLGRVVKVPIYPVGPLI  245

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R   ++  D    I  WL KQP ESV+YVSFGSGGTLSA+QITELAWGLE S+QRFIWVV
Sbjct  246   RKDGKQVLDKEVKI--WLDKQPTESVIYVSFGSGGTLSAKQITELAWGLEQSKQRFIWVV  303

Query  1068  RPPSMRGSDDAFFTTGQG-ADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             RPPS   +   +FT G+   DGTP+YLPEGF TRT++ GLV+PMWA QA IL HPS GGF
Sbjct  304   RPPS-ENALGTYFTIGKNDGDGTPDYLPEGFFTRTKDIGLVIPMWAPQAQILSHPSVGGF  362

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             LSHCG NSTLESI NGVP+IAWPLY+EQ+ NA LLTEE G+A+RP    T  IV R+E+ 
Sbjct  363   LSHCGWNSTLESILNGVPMIAWPLYAEQKMNAALLTEEFGIAVRPKVSQTDKIVERDEIA  422

Query  1425  TLV-KIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             T+V KIM+  K+G  MR R+ +L  S+EKA+S GGSSY+S+ ++
Sbjct  423   TMVKKIMVGDKEGHAMRTRIKELNSSAEKALSRGGSSYHSLSQI  466



>ref|XP_004301883.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Fragaria 
vesca subsp. vesca]
Length=493

 Score =   442 bits (1137),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 224/483 (46%), Positives = 316/483 (65%), Gaps = 14/483 (3%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             M+  NQ   H  +L SPG+GH+IP L L  RL    N  +T+F + +  S  E +LL++S
Sbjct  1     MEIANQ---HAALLCSPGMGHLIPVLELGKRLVTHQNFTVTIFFVPSQTSAAESELLDAS  57

Query  324   DLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK----QCRRLDALV  491
                  L+ + +P  D+S LL  +   V +L  ++R   P  RAAL      + RR   L+
Sbjct  58    AFPRGLDIIELPSRDVSCLLHPDAAVVTRLAEMMRQVRPAFRAALHDMINFRHRRPTVLI  117

Query  492   VDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCK  671
             VD F TE+LP+A+E  +PK+VY+ +NA F ++ +Y P LD ++ G++V  +  L IPGC+
Sbjct  118   VDLFGTESLPIAEEFGIPKYVYIASNAWFLSVMIYSPTLDEQVRGEFVNLKDPLAIPGCR  177

Query  672   PVRPE-DVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSK  848
              + PE D+VD +LDR++ QY E++ +G G    DGIL+N W++++  TL ALR+ + L +
Sbjct  178   QLSPELDIVDALLDRSNQQYDEHMLMGRGIPKGDGILINIWKELETKTLAALRDEKFLGR  237

Query  849   VVGKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAW  1028
             +   PV+ IGPL R   +  G  G  ++ WL +QP ESV+YVSFGSGG LS EQ+ ELAW
Sbjct  238   LSNGPVFPIGPLLR--PKSSGSRGD-VLGWLDEQPNESVIYVSFGSGGALSYEQMVELAW  294

Query  1029  GLELSEQRFIWVVRPPSMRGSDDAFFTTG-QGADGTP--NYLPEGFNTRTQNQGLVVPMW  1199
             GLE+S+QRF+WV+R P +  +D+AFFT G  G D +    YLP+GF  RT N GLV+P+W
Sbjct  295   GLEMSQQRFVWVIRSPIVTSADEAFFTAGSHGGDASNPIRYLPKGFLGRTTNTGLVIPLW  354

Query  1200  AEQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRP  1379
             A Q  IL HPS GGFL+HCG NS LESI NGVP+IAWPLY+EQR N TLLTEE+GVA+R 
Sbjct  355   ASQVDILAHPSVGGFLTHCGWNSVLESITNGVPMIAWPLYAEQRLNTTLLTEELGVAVRS  414

Query  1380  MKLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
                P K +V REE++ +V+ +++ K+G  +R+R   LK S  KA+  GGSSYN++ +   
Sbjct  415   KIPPWKNVVEREEIEEMVRKIMEDKEGFALRDRAKNLKFSGAKALEQGGSSYNALSQFTK  474

Query  1560  AIE  1568
               E
Sbjct  475   HAE  477



>ref|XP_010040924.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Eucalyptus grandis]
 gb|KCW44778.1| hypothetical protein EUGRSUZ_L01659 [Eucalyptus grandis]
Length=479

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 218/467 (47%), Positives = 307/467 (66%), Gaps = 5/467 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPGIGH+IP + L  RLA  H + +TVFV+ +  S  E  +  S+   +RL  V
Sbjct  7     HAALLASPGIGHLIPVVELGKRLAAHHGLNVTVFVVASDSSIKESPIFSSASALNRLELV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S L+++ T  V QL  ++RAALP +RAA++    R   ++VD F T+AL +A+
Sbjct  67    LLPPVDVSGLINSTTSAVTQLARIMRAALPSLRAAISAMRARPSVIIVDIFGTKALAVAE  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V+V T ARF A  ++   +DR+   ++   +K L+IPG +PVR ED ++  LD
Sbjct  127   EYDMLKYVFVTTTARFLAAFIHLANIDRKTEQEHRILKKPLQIPGLEPVRFEDTLNLFLD  186

Query  711   RND-VQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
               D   Y EY R+G     ADGIL+NTW+D++P  L AL + + L +V   PVY +GPL 
Sbjct  187   NIDQCLYAEYTRIGSLIPTADGILVNTWQDLEPSALHALGDEKLLGRVARAPVYPVGPLV  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R +E    D  + +M WL+ QP ES++YVSFGSGGTLS EQ  ELAWGLELS+QRF+W  
Sbjct  247   RPVEP---DSKSKVMNWLNMQPVESIIYVSFGSGGTLSTEQTAELAWGLELSQQRFLWAA  303

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +   F +     DG PNYLP+GF+TRT ++G+V PMWA QA IL H S GGF+
Sbjct  304   RPPVDDDASGNFLSVSNSQDGMPNYLPDGFHTRTHDRGMVAPMWAPQAEILAHKSVGGFV  363

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLESI NGVP++AWPLY+EQR NA +L E++G A+R       G + REE+  
Sbjct  364   SHCGWNSTLESIVNGVPMVAWPLYAEQRMNAAMLVEQLGTAVRSRMRSAHGTIGREEIAD  423

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             +V+ ++ S +G  MR +  +L+ ++ +AI  GGSS+NS+ +V    E
Sbjct  424   MVRSIM-SLEGNGMRTKAKELQRAAAEAIRKGGSSHNSLTQVAKECE  469



>gb|ADL67597.1| glycosyltransferase 3 [Populus tomentosa]
Length=465

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 225/457 (49%), Positives = 303/457 (66%), Gaps = 5/457 (1%)
 Frame = +3

Query  198   IGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVGIPPVDISA  377
             +GH+IP L L  RL   H   +T+FV+TT +S ++ QLL+ S     L+ V +PPVD+S+
Sbjct  1     MGHLIPVLELGKRLVTNHGFTVTIFVVTTDNSLSKSQLLKQSPCPDLLSIVLLPPVDVSS  60

Query  378   LLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMADELNLPKFVY  557
             L+   T  +AQL +++R ALP +R+A+         L+VDFF TEA+ +ADE N+ K+ +
Sbjct  61    LITPTTGILAQLAIMMREALPKLRSAILAMKFCPTVLIVDFFGTEAMVIADEFNMLKYAF  120

Query  558   VPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLDRNDVQYREY  737
             + + A F ALT++ P +D+ I   +V+ ++ L IPGCK +   D  +P+LDRND  Y EY
Sbjct  121   MTSTAWFLALTLHMPTIDKAIEDDHVKNQQALLIPGCKSLEFRDTFEPVLDRNDQMYIEY  180

Query  738   LRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTRNIEERDGDD  917
              R+GV     DGIL+NTW+D++  TL AL + + L +V   P+Y +GPL R I      +
Sbjct  181   KRMGVEMQKFDGILVNTWQDLEGTTLGALEDQKRLGRVAQVPIYPVGPLVRAITPGPKSE  240

Query  918   GTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVRPPSMRGSDD  1097
                +++WL  QP ESV+YVSFGSGG LSA+Q TELA GLE S QRFIWVVRPP    S  
Sbjct  241   ---MLEWLDMQPVESVIYVSFGSGGALSAKQTTELACGLESSGQRFIWVVRPPIEGDSAA  297

Query  1098  AFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLSHCGCNSTLE  1277
               F T    D TP++LP+GF TRT+  GLVVPMWA Q  IL HP+ GGF+SHCG NSTLE
Sbjct  298   TVFKTNHRTDDTPDFLPDGFLTRTRKTGLVVPMWAPQTEILNHPAVGGFVSHCGWNSTLE  357

Query  1278  SIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTLVKIMLQSKK  1457
             SI NGVP+I WPL++EQ  NA +LTE++GVAIR   LP K +V R E++T+V+ ++   K
Sbjct  358   SIVNGVPMITWPLFAEQGMNAAMLTEDIGVAIRSKSLPAKEVVGRGEIETMVRTIMD--K  415

Query  1458  GKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             G   R R   LK S+EKA+S GGSSYNS+  V N  E
Sbjct  416   GDARRARAKTLKSSAEKALSNGGSSYNSLAHVANDCE  452



>ref|XP_010070034.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Eucalyptus grandis]
 gb|KCW58592.1| hypothetical protein EUGRSUZ_H01252 [Eucalyptus grandis]
Length=482

 Score =   438 bits (1126),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 217/462 (47%), Positives = 311/462 (67%), Gaps = 5/462 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH IP++ L   LA  H   +T+FV+    S TE  L +     + LN V
Sbjct  7     HAVLLASPGMGHFIPAVELGKHLATHHGFDVTIFVVAADASITESPLFKPPQTPNPLNLV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+SAL+++    V +L +++R ALP ++AA++    R  AL+VD F TEAL +A+
Sbjct  67    LLPPVDVSALVNSTASVVTRLVIMMREALPLLQAAISSMKSRPTALIVDMFGTEALAIAE  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V++ + A F A+TV+ P +D E   ++   ++ L++PGC+ +R ED +D  LD
Sbjct  127   EFDMLKYVFITSTAWFLAVTVHFPYIDEEAEHKHRVMKRPLDVPGCRSIRHEDTLDLFLD  186

Query  711   RNDVQ-YREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             + D   +  + R+G+    ADGIL+NTW+D++P TL+AL   + L +VV   V+ +GPL 
Sbjct  187   QTDRNLFSGFARIGMEISNADGILVNTWQDLEPSTLRALENEKFLGRVVKASVFPVGPLV  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R I +    +   +M WL  QP ESV+YVSFGSGGTLSA+Q TELAWGLELS+QRF+WVV
Sbjct  247   RPIGQSSKSE---VMDWLDMQPMESVIYVSFGSGGTLSAKQTTELAWGLELSQQRFVWVV  303

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +   FF      DGTP+YLP GF TR +N+G+VV MWA Q  IL H S GGFL
Sbjct  304   RPPVDGDASANFFNVTNSHDGTPSYLPSGFFTRIRNKGMVVLMWASQTEILAHKSIGGFL  363

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLES+ NGVP++ WPLY+EQ+ NA +L EE+ VA+RP   P  G++ REE+  
Sbjct  364   SHCGWNSTLESMVNGVPMVVWPLYAEQQMNAAMLAEELKVAVRPKIQPNAGVIEREEIAG  423

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             +V+ +++  KG EMR++V +L+ S+ +A+  GGSSYNS+  V
Sbjct  424   MVRRVME-LKGNEMRDKVKELQRSAIQALMQGGSSYNSLERV  464



>ref|XP_006404007.1| hypothetical protein EUTSA_v10010324mg [Eutrema salsugineum]
 gb|ESQ45460.1| hypothetical protein EUTSA_v10010324mg [Eutrema salsugineum]
Length=488

 Score =   438 bits (1126),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 212/468 (45%), Positives = 323/468 (69%), Gaps = 7/468 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP + L  RLAG H   +T+FV+    +  + Q L S    + L NV
Sbjct  7     HAAMLASPGMGHVIPVIELGKRLAGSHGFHVTIFVLEADAASAQSQFLNSPGCDATLVNV  66

Query  351   -GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              G+P  DIS L+D +     ++  ++R  +P +R+ +++   +  AL+VD F  +AL + 
Sbjct  67    IGLPSPDISGLVDPSVNFAIKILFMMRQTIPTLRSKISEMQHKPTALIVDLFGLDALRLG  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E N+  ++++ +NARF ++ +Y P L++++  +++ ++K L IPGC+PVR ED ++  L
Sbjct  127   REFNMLTYIFIASNARFLSVVMYFPTLEKDVEEEHIIKKKPLAIPGCEPVRFEDTIETFL  186

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             D  D  YRE++  G+ F  ADGI++NTW+D++P TLK+L++ + L ++   PVY IGPL+
Sbjct  187   DPTDQIYREFVPFGLVFPTADGIIVNTWDDMEPKTLKSLQDPKLLGRIARVPVYPIGPLS  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R ++    +    ++ WL+KQP ESVLY+SFGSGG+LSA+Q+TELAWGLELS+QRF+WVV
Sbjct  247   RPVDPSKTNHP--VLDWLNKQPNESVLYISFGSGGSLSAKQLTELAWGLELSQQRFVWVV  304

Query  1068  RPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             RPP    +D A+F+   G   DGTP+YLPEGF +RT  +GLVV  WA QA IL H + GG
Sbjct  305   RPPVDGSADSAYFSVNSGKIQDGTPDYLPEGFVSRTHERGLVVSSWAPQAEILAHQAVGG  364

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLP-TKGIVTREE  1418
             FL+HCG NS LES+ +GVP+IAWPL++EQ+ NATLL EE+G+A+R  KLP ++ +++R E
Sbjct  365   FLTHCGWNSVLESVVSGVPMIAWPLFAEQKMNATLLIEELGIAVRCGKLPSSEEVISRVE  424

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLN  1559
             +   V+ ++  ++G EMRERV KL+ ++E ++S  GGS + S+  V N
Sbjct  425   IDATVRKIMVEEEGCEMRERVKKLRDTAETSLSCDGGSGHESLSRVAN  472



>ref|XP_010099823.1| Anthocyanidin 3-O-glucosyltransferase 5 [Morus notabilis]
 gb|EXB80583.1| Anthocyanidin 3-O-glucosyltransferase 5 [Morus notabilis]
Length=478

 Score =   436 bits (1122),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 220/481 (46%), Positives = 317/481 (66%), Gaps = 27/481 (6%)
 Frame = +3

Query  162   SMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRL  341
             S  H  +LSSPG+GH++P L L NRLA  H   +T+F +T           +S   T  L
Sbjct  4     SRAHAVLLSSPGMGHLVPILELGNRLALHHKFAVTIFNVT-----------KSGQTTPAL  52

Query  342   NN-----VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFC  506
             N+     + +PP+ +S +   +   V    + +R A   + +A++    +   LVVD F 
Sbjct  53    NSPHCHVIDLPPISVSHVAPPDAAMVTICAVTMREAKSVISSAISGMKVKPSVLVVDLFG  112

Query  507   TEALPMADELNLP-KFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRP  683
             T+ L +A+EL +P K++Y+ TNA FT+L +Y P LD+ I G+YV+Q    +IPG +PVRP
Sbjct  113   TDCLCLAEELGIPSKYIYIATNALFTSLVLYLPTLDKLIKGEYVDQTSDFQIPGSRPVRP  172

Query  684   EDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP  863
             ++V+DPM DR++ QY E +R+G+   +ADGIL+NTWE+ +   LK++R+   + +   KP
Sbjct  173   DEVIDPMRDRSNQQYHEMVRVGLQMPIADGILLNTWEEAESSRLKSMRDENLIGRFAKKP  232

Query  864   VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELS  1043
             +Y +GPLT +           I +WL KQP ESV++VSFGSGG LS EQ TE+AWGLELS
Sbjct  233   IYLVGPLTWDPAVSSSGP---IFEWLDKQPAESVIFVSFGSGGKLSYEQTTEVAWGLELS  289

Query  1044  EQRFIWVVRPPSMRGSDDAFFT------TGQGADGTPNY-LPEGFNTRTQNQGLVVPMWA  1202
             +QRFIWVVRPP+   ++ A+F+       G+G    P Y LP+GF  RT++ G V+P WA
Sbjct  290   QQRFIWVVRPPTSGSAESAYFSPVESNDNGKGKSDEPFYFLPKGFLARTRDVGQVLPGWA  349

Query  1203  EQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPM  1382
              Q  IL+HPS GGFLSHCG NSTLES+ N VP+IAWPLY+EQ+ N+T+LTEE+GVA+RP 
Sbjct  350   PQMEILKHPSVGGFLSHCGWNSTLESVTNAVPMIAWPLYAEQKINSTILTEELGVAVRPR  409

Query  1383  KLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNA  1562
             + P KG+V REE++ +V+ +L  K+   +R+RV KLK S E+A+S GG+SYN++ +V   
Sbjct  410   EFPAKGVVGREEIEVMVRKILADKEAFAIRDRVKKLKESGERALSFGGTSYNALSQVAEK  469

Query  1563  I  1565
             +
Sbjct  470   V  470



>ref|XP_010558128.1| PREDICTED: UDP-glycosyltransferase 72E1 [Tarenaya hassleriana]
Length=484

 Score =   436 bits (1121),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 216/471 (46%), Positives = 314/471 (67%), Gaps = 7/471 (1%)
 Frame = +3

Query  177   GILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVGI  356
              +L+SPG+GH+IP + L  RLA  H   +TV+V+    +  + Q L S +  + +N VGI
Sbjct  9     AMLASPGMGHVIPVIELGKRLASDHGFHVTVYVLEADAASAQSQFLNSEE--ALVNVVGI  66

Query  357   PPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMADEL  536
             P  DISA++D +     ++  ++R  +P +R+ +     +  AL+VD F TEAL +ADE 
Sbjct  67    PSPDISAIVDPSAHVGIKIAAMMRETVPALRSKIEAMQHKPTALIVDLFGTEALRLADEF  126

Query  537   NLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLDRN  716
             ++ K+V + +NARF A+ +Y P +D  +  ++V Q K L IPGC+PVR ED +D  LDR 
Sbjct  127   DMLKYVLIASNARFLAVAIYFPTIDEAMEKEHVNQSKPLAIPGCEPVRFEDTLDAYLDRT  186

Query  717   DVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTRNI  896
                YRE + +G  F  +DGIL+NTWE+++P +LK+L++++ L ++   PVY IGPL R +
Sbjct  187   SPLYREMIGMGQAFTTSDGILVNTWEEMEPKSLKSLQDHKLLGRIARVPVYPIGPLCRPV  246

Query  897   EERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVRPP  1076
             E     +   I+ WL +QP ESVLY+SFGSGG+LS +Q+TELAWGLE S QRF+WVVRPP
Sbjct  247   EP--SKNSHPILDWLDQQPDESVLYISFGSGGSLSTKQLTELAWGLEQSRQRFVWVVRPP  304

Query  1077  SMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
                 +  AFF    G+  DGTP YLPEGF TRT+++GLVVP WA QA +L H S GGFL+
Sbjct  305   VDGSAFSAFFAVNNGSVRDGTPEYLPEGFVTRTRDRGLVVPSWAPQAEVLAHRSVGGFLT  364

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLES+ +GVP+IAWPL++EQ  NA LL +E+ VA+R  KLP+ G+++R E++ +
Sbjct  365   HCGWNSTLESVVSGVPMIAWPLFAEQMMNAALLEDELCVAVRSEKLPSDGVISRTEIEAM  424

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLNAIEKRRD  1580
             V  ++  + G EMR RV  L  ++  ++S  GGS+ +S+ ++    E   D
Sbjct  425   VMKVMVEEGGHEMRRRVKDLMNTAANSLSYDGGSARDSLSKLAKECELHLD  475



>ref|XP_004165853.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Cucumis 
sativus]
Length=471

 Score =   435 bits (1119),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 213/471 (45%), Positives = 314/471 (67%), Gaps = 9/471 (2%)
 Frame = +3

Query  159   QSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSR  338
             +S  H+ ++SSPG+GH+ P+L  A RL+  H + +TVF++ +  S  E +++ ++     
Sbjct  2     ESAAHVALISSPGMGHLFPALEFATRLSTRHRLTVTVFIVPSHSSSAENKVIAAAQAAGL  61

Query  339   LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEAL  518
                V +PP D+S + +++   V +L + +R  +P +R+A++        L+ D F  E+ 
Sbjct  62    FTVVELPPADMSDVTESSV--VGRLAITMRRHVPILRSAVSAMTSPPSVLIADIFSIESF  119

Query  519   PMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
              +ADE ++ K+ +V +NA F A+ VY  V DREIVGQYV+Q++ L+IPGC+ VRP DV+D
Sbjct  120   AVADEFDMKKYAFVASNAWFLAVMVYAQVWDREIVGQYVDQKEPLQIPGCESVRPCDVID  179

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIG  878
             P+LDR + QY E L+LG+G   +DG+L+NTW+++   TL +L +   L K +  PVY+IG
Sbjct  180   PLLDRTEQQYFEILKLGMGIASSDGVLVNTWDELQDRTLASLNDRNLLGK-ISPPVYSIG  238

Query  879   PLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             P+ R    + G   + +  WL KQP ESV+YVSFGSGGTLS EQ+TE+A GLE+S QRF+
Sbjct  239   PIVRQPGSKKGGS-SELFNWLSKQPSESVIYVSFGSGGTLSFEQMTEVAHGLEMSRQRFV  297

Query  1059  WVVRPPSMRGSDDAFFTTGQGAD--GTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             WVVR P +R SD AFFTTG  ++      +LPEGF  RT   G VV MWA+Q  +L  P+
Sbjct  298   WVVRAPKVR-SDGAFFTTGDESEEQSLAKFLPEGFLERTSEVGFVVSMWADQTAVLGSPA  356

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
              GGF SH G NS LESI NGVP++ WPLY+EQR NAT+LTEE+GV +R  +LPT  ++ R
Sbjct  357   VGGFFSHSGWNSALESITNGVPMVVWPLYAEQRMNATMLTEEIGVGVRSKELPTNALIER  416

Query  1413  EEVKTLV-KIML-QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             EE+  +V KIM+ +  +GK +R +  +L+ S+ KA+  GGSS+++   V+ 
Sbjct  417   EEIAAMVRKIMVEEDDEGKAIRAKAKELQRSAAKALGEGGSSHHNFARVVK  467



>ref|XP_004149165.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Cucumis 
sativus]
 gb|KGN53244.1| hypothetical protein Csa_4G038620 [Cucumis sativus]
Length=471

 Score =   435 bits (1119),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 213/471 (45%), Positives = 314/471 (67%), Gaps = 9/471 (2%)
 Frame = +3

Query  159   QSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSR  338
             +S  H+ ++SSPG+GH+ P+L  A RL+  H + +TVF++ +  S  E +++ ++     
Sbjct  2     ESAAHVALISSPGMGHLFPALEFATRLSTRHRLTVTVFIVPSRSSSAENKVIAAAQAAGL  61

Query  339   LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEAL  518
                V +PP D+S + +++   V +L + +R  +P +R+A++        L+ D F  E+ 
Sbjct  62    FTVVELPPADMSDVTESSV--VGRLAITMRRHVPILRSAVSAMTSPPSVLIADIFSIESF  119

Query  519   PMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
              +ADE ++ K+ +V +NA F A+ VY  V DREIVGQYV+Q++ L+IPGC+ VRP DV+D
Sbjct  120   AVADEFDMKKYAFVASNAWFLAVMVYAQVWDREIVGQYVDQKEPLQIPGCESVRPCDVID  179

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIG  878
             P+LDR + QY E L+LG+G   +DG+L+NTW+++   TL +L +   L K +  PVY+IG
Sbjct  180   PLLDRTEQQYFEILKLGMGIASSDGVLVNTWDELQDRTLASLNDRNLLGK-ISPPVYSIG  238

Query  879   PLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             P+ R    + G   + +  WL KQP ESV+YVSFGSGGTLS EQ+TE+A GLE+S QRF+
Sbjct  239   PIVRQPGSKKGGS-SELFNWLSKQPSESVIYVSFGSGGTLSFEQMTEVAHGLEMSRQRFV  297

Query  1059  WVVRPPSMRGSDDAFFTTGQGAD--GTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             WVVR P +R SD AFFTTG  ++      +LPEGF  RT   G VV MWA+Q  +L  P+
Sbjct  298   WVVRAPKVR-SDGAFFTTGDESEEQSLAKFLPEGFLERTSEVGFVVSMWADQTAVLGSPA  356

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
              GGF SH G NS LESI NGVP++ WPLY+EQR NAT+LTEE+GV +R  +LPT  ++ R
Sbjct  357   VGGFFSHSGWNSALESITNGVPMVVWPLYAEQRMNATMLTEEIGVGVRSKELPTNALIER  416

Query  1413  EEVKTLV-KIML-QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             EE+  +V KIM+ +  +GK +R +  +L+ S+ KA+  GGSS+++   V+ 
Sbjct  417   EEIAAMVRKIMVEEDDEGKAIRAKAKELQRSAAKALGEGGSSHHNFARVVK  467



>gb|KDO79473.1| hypothetical protein CISIN_1g011099mg [Citrus sinensis]
Length=493

 Score =   436 bits (1121),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 218/474 (46%), Positives = 316/474 (67%), Gaps = 8/474 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ +L+SPG+GH+IP L L  RL   +N   T+FV+    S  +   L +S     L+ V
Sbjct  7     HVALLASPGMGHLIPVLELGKRLVIQNNHHATIFVVANDTSSEQLSKLVNSPDYDILDIV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P +DIS ++  +   V Q+ +++  ++P +R+ ++    R  AL+VD F TEA+ +AD
Sbjct  67    LLPCIDISGIVCTDASLVTQIAVMMHESIPALRSTISAMKYRPTALIVDLFGTEAMAVAD  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQ-YVEQEKGLEIPGCKPVRPEDVVDPML  707
             E  + K++++ +NA F A+T+Y P LD++++ + +V Q+K L+IPGC  VR ED ++  L
Sbjct  127   EFEMLKYMFIASNAWFVAVTIYAPALDKKVLQEEHVNQKKPLKIPGCSAVRFEDTLEAFL  186

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             D     Y  +L++G+    ADGIL+NTWED++  TL ALR+   L +V   PVY +GPL 
Sbjct  187   DPYGPMYDGFLQVGMDMSKADGILVNTWEDLESKTLAALRDFNMLRRVAKAPVYPVGPLA  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R++         +++ WL KQP ESV+YVSFGSGGTLS++Q  ELAWGLE S+QRFIWVV
Sbjct  247   RSVASSPVSGSHVVLDWLDKQPHESVIYVSFGSGGTLSSKQTMELAWGLEQSKQRFIWVV  306

Query  1068  RPPSMRGSDDAFFTTGQGADGTP------NYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             RPP      D++ T G GA  T       +YLPEGF  RT++ GLVVPMWA Q  IL HP
Sbjct  307   RPPLDHDVFDSYLTAGSGALNTAEGALDYHYLPEGFLIRTRDVGLVVPMWAPQPEILAHP  366

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT-KGIV  1406
             S GGFL+HCG NST+ESI NGVP+I WPLY+EQ+ NAT+LTEE+ VAIR  ++P+ K +V
Sbjct  367   SVGGFLTHCGWNSTMESIVNGVPMIVWPLYAEQKMNATMLTEELRVAIRSKEVPSEKSVV  426

Query  1407  TREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
              R E++ +V+ ++  K+G  +R RV +LK S++KA+  GGSSYNS+ ++ +  E
Sbjct  427   ERGEIEMMVRRIVAEKQGHAIRNRVEELKHSAQKALINGGSSYNSLSKIAHECE  480



>ref|XP_010070033.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Eucalyptus grandis]
 gb|KCW58589.1| hypothetical protein EUGRSUZ_H01249 [Eucalyptus grandis]
Length=482

 Score =   435 bits (1119),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 220/469 (47%), Positives = 303/469 (65%), Gaps = 5/469 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP + L   LA  H   +T+FV+       E  +  S+   + L  V
Sbjct  7     HAALLASPGMGHLIPVVELGKCLAAHHGFDVTIFVVAPDSLIRESPVFSSASALNHLKLV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P VDIS L D+ +  V QL +++R ALP +RAA++    R  ALVVD F TEAL +A+
Sbjct  67    LLPQVDISGLPDSTSSVVTQLVMMMRKALPSLRAAISSMRARPTALVVDLFGTEALAVAE  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V++ + AR  A T++ P +D ++  ++   +K L+IPG +P++ ED +D  LD
Sbjct  127   EFDMLKYVFITSTARLLAATIHLPTVDGKVEQEHRIMKKPLQIPGLEPIQFEDTLDLFLD  186

Query  711   RNDVQ-YREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             + D   Y EY R+G     ADGIL+NTW+D++P  L AL +++ L +V   PVY +GPL 
Sbjct  187   QTDKSLYAEYTRIGREIPTADGILVNTWQDLEPSALHALEDDKFLGRVTKAPVYPVGPLV  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R +      +   +M WL  QP ESV+Y SFGSGGTLSAEQ TELAWGLELS+QRF+WVV
Sbjct  247   RPVGPNSKSE---VMNWLDMQPVESVIYFSFGSGGTLSAEQTTELAWGLELSQQRFVWVV  303

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
              PP    +   FF    G DGTPNYLPEGF TRT ++G+VVPMWA Q  IL H S GGF+
Sbjct  304   HPPMDDDASGNFFNGSNGQDGTPNYLPEGFYTRTHDRGMVVPMWAPQTEILAHESVGGFV  363

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLESI NGVP++AWPLY+EQ  NAT+L E++G A+R    P  G + REE+  
Sbjct  364   SHCGWNSTLESIVNGVPMVAWPLYAEQGMNATMLVEKLGTAVRSRTRPAGGPIGREEIAD  423

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             +V+ ++ S KG  MR R  +L+  +  A+  GGSS+NS+  V    E +
Sbjct  424   MVRSVINS-KGNGMRTRAKELQRGAAGAVLEGGSSHNSLTRVAKECEVK  471



>ref|XP_002281768.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5 [Vitis vinifera]
 emb|CBI19653.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   435 bits (1118),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 219/461 (48%), Positives = 307/461 (67%), Gaps = 3/461 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ +L SPG+GHIIP L +A RL   H   ++   ITT  S  + QLL S +L S L+ V
Sbjct  10    HVALLPSPGMGHIIPLLEMAKRLVLHHGFHVSFITITTEASAAQTQLLRSPNLPSGLHVV  69

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PP D+S +L  +   V +LCL+V+ +LP +R+ L +   +  AL+VD FCT+A  +A 
Sbjct  70    ELPPADMSTILHDDMTIVQRLCLIVQESLPYIRSVLRENPPQ--ALIVDIFCTDAFQIAK  127

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             +L++P + +        AL++Y P +DREI G+YV+  K +++PGC  +R ED++D + +
Sbjct  128   DLSIPAYSFFTAPTALLALSLYLPTMDREIEGEYVDLPKPVQVPGCNAIRTEDLLDQVRN  187

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R   +Y+ YL       MA GI +NTWED++PV L+ LREN    ++   PV  IGPL +
Sbjct  188   RKIEEYKWYLLSVSRLPMAVGIFVNTWEDLEPVWLRGLRENSFFQQIPIPPVLPIGPLIK  247

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
               E     D   I +WL KQP +SVL+++ GSGGTL++ Q+TELAWGLELS+QRFI VVR
Sbjct  248   EDEPLTDFDNDCI-EWLDKQPPDSVLFITLGSGGTLTSTQLTELAWGLELSQQRFILVVR  306

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
              PS   +  AFF  G        YLP+GF  RTQ  GLV+P WA Q  +LRHPSTGGFLS
Sbjct  307   TPSDASASGAFFNVGNNVMKAEAYLPQGFMERTQEVGLVIPSWAPQVTVLRHPSTGGFLS  366

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLESI +GVP+IAWPLY+EQR NAT+LTEEVGVA+RP+    K +V REE++ +
Sbjct  367   HCGWNSTLESISHGVPMIAWPLYAEQRMNATMLTEEVGVAVRPVVGEGKNVVGREEIERV  426

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             V+++++ ++GKEMR RV +L+ S+   +  GG S+ ++ EV
Sbjct  427   VRLVMEGEEGKEMRRRVRELQSSALATLKPGGPSFEALSEV  467



>ref|XP_010667699.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Beta 
vulgaris subsp. vulgaris]
Length=485

 Score =   435 bits (1118),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 227/471 (48%), Positives = 310/471 (66%), Gaps = 10/471 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLL--ESSDLTSRLN  344
             H  +L+SPG+GH+IP + LANRL   HN  +T+FV+T    P +  LL  + + L    +
Sbjct  8     HATLLASPGLGHLIPMVELANRLTAHHNFHVTIFVVTMEPGPNKPNLLPNQPNTLKPLYD  67

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
              V +P VD SA +  + K + +L +++R  +  +R+ L    +    LVVD F TE L +
Sbjct  68    LVVLPYVDSSAHMGPSDKIMTRLVIMMRGYVSSLRSELGSMEQNPTLLVVDLFGTEFLTL  127

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             ADE N+ K+VY+P+NA F A TV  P+LD++     V+ E  L IPGCK V  +D++DP+
Sbjct  128   ADEFNMIKYVYIPSNAWFLAQTVCVPLLDKQ-----VKHEGPLIIPGCKRVEYDDILDPV  182

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
              D  +  Y EY+R+ +  G ADG+L+NTWED++P TL + + N+ L ++  KPVY +GPL
Sbjct  183   FDPENKDYDEYVRIALDIGTADGVLVNTWEDLEPTTLFSFKNNKVLKEIFNKPVYPVGPL  242

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R +  R    G  + +WL+KQP+ESVLYVSFGSGGTLS++Q  ELA GLE+S+QRFIWV
Sbjct  243   VRPV--RPECLGEELSEWLNKQPKESVLYVSFGSGGTLSSQQTIELALGLEISQQRFIWV  300

Query  1065  VRPPSMRGSDDAFFTTGQGADG-TPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VRPP       A F    G D     YLP GF TRT+N G V+PMWA Q  IL HPS GG
Sbjct  301   VRPPIEHDGAGALFHAMDGQDHMISQYLPPGFMTRTRNLGKVIPMWAPQMEILAHPSVGG  360

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FLSHCG NSTLES+ NGVPIIAWPLY+EQ  NA L+ EEVGVA+RP  LPTK IV REE+
Sbjct  361   FLSHCGWNSTLESLVNGVPIIAWPLYAEQNMNAALMDEEVGVAVRPKVLPTKVIVGREEI  420

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             K L+  ++   +G ++RERV +++  +++A++  GS+  S  +V N  E R
Sbjct  421   KKLINKIMVDDEGIKIRERVKEVQGYAKRALTTEGSTCKSFVQVANNCEMR  471



>gb|AFJ52924.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=501

 Score =   435 bits (1119),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 240/504 (48%), Positives = 328/504 (65%), Gaps = 22/504 (4%)
 Frame = +3

Query  129   TYSIIMDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITT-ADSPTER  305
             T ++ +D++ Q   HI +L+SPG GH+IP L L  RL   HN  +TVFV+     SP E 
Sbjct  3     TSTVDVDHHPQPP-HIVLLASPGTGHLIPVLELGIRLVTHHNSTVTVFVVAVDHSSPAEA  61

Query  306   QLLESSDLTSR---------LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAAL  458
              L+   D T+R          N V +P  DIS L+D     V ++C+L+R   P +R+A+
Sbjct  62    ALI--LDATARAHYSSKNILFNVVKLPAPDISNLVDQEAAVVTRICVLMRETKPTLRSAM  119

Query  459   TKQCRRLDALVVDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVE  638
                     ALVVD F TE+  +ADE+ + K++   +NA FTALT++ P LD+E+ GQYV+
Sbjct  120   RSLEVLPAALVVDLFGTESFVIADEMGIGKYLLGTSNAWFTALTLHTPALDKEVDGQYVD  179

Query  639   QEKGLEIPGCKPVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLK  818
             Q + L IPGC+ VRP++VVDPMLDRND+QY EY R+G  F  AD IL+NTWED++P TL 
Sbjct  180   QTEPLTIPGCRLVRPDEVVDPMLDRNDMQYVEYKRIGAEFAKADAILINTWEDLEPSTLA  239

Query  819   ALRENEPLS-KVVGKPVYAIGPLTR--NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSG  989
             ALR ++     V+   V +IGPL R  N  ++   D   +  WL KQP++SV+YVSFGS 
Sbjct  240   ALRNDKFFGGSVIKGDVLSIGPLVRPSNNNQKGPTDDDELFSWLDKQPKQSVIYVSFGSA  299

Query  990   GTLSAEQITELAWGLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTP---NYLPEGFN  1160
             GTLS  Q+ ELA GLELS+QRF+WVVR P+    D A+FT G G+D  P   NYLP+GF 
Sbjct  300   GTLSTHQLNELAHGLELSKQRFVWVVRRPT-DFKDSAYFTFG-GSDEIPGRLNYLPDGFL  357

Query  1161  TRTQNQGLVVPMWAEQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNA  1340
              RT++ G+VVP WA QA +L HPS G FLSHCG NSTLES+ N VP++ WP+Y+EQR N+
Sbjct  358   ERTRDVGMVVPNWAPQAEVLCHPSVGWFLSHCGWNSTLESVTNNVPMVVWPMYAEQRMNS  417

Query  1341  TLLTEEVGVAIRPMKLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI  1520
             TLL EE+ VA R   +P +G+V REE+  LVK ++  ++G  +RE+V ++K S EKA+  
Sbjct  418   TLLAEELKVAARTKTMPWRGVVGREEIGELVKKVMVGEEGVLIREKVNEVKCSGEKALKE  477

Query  1521  G-GSSYNSMCEVLNAIEKRRDLKI  1589
             G GSS+ ++  V++    R   K 
Sbjct  478   GSGSSFKALASVVDKCACRYATKF  501



>ref|XP_006425731.1| hypothetical protein CICLE_v10025462mg [Citrus clementina]
 ref|XP_006466731.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Citrus sinensis]
 gb|ESR38971.1| hypothetical protein CICLE_v10025462mg [Citrus clementina]
Length=493

 Score =   434 bits (1117),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 218/473 (46%), Positives = 315/473 (67%), Gaps = 8/473 (2%)
 Frame = +3

Query  174   IGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVG  353
             + +L+SPG+GH+IP L L  RL   +N   T+FV+    S  +   L +S     L+ V 
Sbjct  8     VALLASPGMGHLIPVLELGKRLVIQNNHHATIFVVANDTSSEQLSKLVNSPDYDILDIVL  67

Query  354   IPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMADE  533
             +P +DIS ++  +   V Q+ +++  ++P +R+ ++    R  AL+VD F TEA+ +ADE
Sbjct  68    LPCIDISGIVGTDASLVTQIAVMMHESIPALRSTISAMKYRPTALIVDLFGTEAMAVADE  127

Query  534   LNLPKFVYVPTNARFTALTVYCPVLDREIVGQ-YVEQEKGLEIPGCKPVRPEDVVDPMLD  710
               + K++++ +NA F A+T+Y P LD++++ + +V Q+K L+IPGC  VR ED ++  LD
Sbjct  128   FEMLKYMFIASNAWFVAVTIYAPALDKKVLQEEHVNQKKPLKIPGCSAVRFEDTLEAFLD  187

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
                  Y  +L++G+    ADGIL+NTWED++  TL ALR+   L +V   PVY +GPL R
Sbjct  188   PYGPMYDGFLQVGMDMSKADGILVNTWEDLESKTLAALRDFNMLRRVAKAPVYPVGPLAR  247

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
             ++         +++ WL KQP ESV+YVSFGSGGTLS++Q  ELAWGLE S+QRFIWVVR
Sbjct  248   SVASSPVSGSHVVLDWLDKQPHESVIYVSFGSGGTLSSKQTMELAWGLEQSKQRFIWVVR  307

Query  1071  PPSMRGSDDAFFTTGQGADGTP------NYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             PP      D++ T G GA  T       +YLPEGF  RT++ GLVVPMWA Q  IL HPS
Sbjct  308   PPLDHDVFDSYLTAGSGALNTAEGALDYHYLPEGFLIRTRDVGLVVPMWAPQPEILAHPS  367

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT-KGIVT  1409
              GGFL+HCG NST+ESI NGVP+I WPLY+EQ+ NAT+LTEE+GVAIR  ++P+ K +V 
Sbjct  368   VGGFLTHCGWNSTMESIVNGVPMIVWPLYAEQKMNATMLTEELGVAIRSKEVPSEKSVVG  427

Query  1410  REEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             R E++ +V  ++  K+G  +R RV +LK S++KA+  GGSSYNS+ ++ +  E
Sbjct  428   RGEIEMMVWRIVAEKQGHAIRNRVKELKHSAQKALINGGSSYNSLSKIAHECE  480



>ref|NP_566938.1| UDP-glucosyl transferase 72E1 [Arabidopsis thaliana]
 sp|Q94A84.1|U72E1_ARATH RecName: Full=UDP-glycosyltransferase 72E1 [Arabidopsis thaliana]
 gb|AAK83619.1| AT3g50740/T3A5_120 [Arabidopsis thaliana]
 gb|AAU90060.1| At3g50740 [Arabidopsis thaliana]
 gb|AEE78703.1| UDP-glucosyl transferase 72E1 [Arabidopsis thaliana]
 gb|AHL38734.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=487

 Score =   434 bits (1117),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 205/470 (44%), Positives = 323/470 (69%), Gaps = 6/470 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN-  347
             H+ + +SPG+GHIIP + L  RLAG H   +T+FV+ T  +  + Q L S    + L + 
Sbjct  7     HVAMFASPGMGHIIPVIELGKRLAGSHGFDVTIFVLETDAASAQSQFLNSPGCDAALVDI  66

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             VG+P  DIS L+D +     +L +++R  +P +R+ + +   +  AL+VD F  +A+P+ 
Sbjct  67    VGLPTPDISGLVDPSAFFGIKLLVMMRETIPTIRSKIEEMQHKPTALIVDLFGLDAIPLG  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E N+  ++++ +NARF A+ ++ P LD+++  +++ +++ + +PGC+PVR ED ++  L
Sbjct  127   GEFNMLTYIFIASNARFLAVALFFPTLDKDMEEEHIIKKQPMVMPGCEPVRFEDTLETFL  186

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             D N   YRE++  G  F   DGI++NTW+D++P TLK+L++ + L ++ G PVY IGPL+
Sbjct  187   DPNSQLYREFVPFGSVFPTCDGIIVNTWDDMEPKTLKSLQDPKLLGRIAGVPVYPIGPLS  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R ++    +    ++ WL+KQP ESVLY+SFGSGG+LSA+Q+TELAWGLE+S+QRF+WVV
Sbjct  247   RPVDPSKTNHP--VLDWLNKQPDESVLYISFGSGGSLSAKQLTELAWGLEMSQQRFVWVV  304

Query  1068  RPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             RPP    +  A+ +   G   DGTP+YLPEGF +RT  +G +V  WA QA IL H + GG
Sbjct  305   RPPVDGSACSAYLSANSGKIRDGTPDYLPEGFVSRTHERGFMVSSWAPQAEILAHQAVGG  364

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NS LES+  GVP+IAWPL++EQ  NATLL EE+GVA+R  KLP++G++TR E+
Sbjct  365   FLTHCGWNSILESVVGGVPMIAWPLFAEQMMNATLLNEELGVAVRSKKLPSEGVITRAEI  424

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLNAIE  1568
             + LV+ ++  ++G EMR+++ KLK ++ +++S  GG ++ S+  + +  E
Sbjct  425   EALVRKIMVEEEGAEMRKKIKKLKETAAESLSCDGGVAHESLSRIADESE  474



>ref|XP_002877765.1| UDP-glucosyl transferase 72E1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54024.1| UDP-glucosyl transferase 72E1 [Arabidopsis lyrata subsp. lyrata]
Length=487

 Score =   434 bits (1115),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 206/467 (44%), Positives = 322/467 (69%), Gaps = 6/467 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + +SPG+GHIIP + L  RLAG H   +T+FV+ T  +  + Q L S    + L +V
Sbjct  7     HAAMFASPGMGHIIPVIELGKRLAGSHGFHVTIFVLETDAASAQSQFLNSPGCDAALVDV  66

Query  351   -GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              G+P  DI+ L+D +     +L +++R  +P +R  + +   +  AL+VD F  +A+P+ 
Sbjct  67    VGLPTPDITGLVDPSAFFGIKLLVMMRETIPTLRLKIAEMQHKPTALIVDLFGLDAIPLG  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E N+  ++++ +NARF A+ +Y P LD+++  ++  ++K + +PGC+PVR ED ++  L
Sbjct  127   GEFNMLTYIFIASNARFLAVALYFPTLDKDMEEEHTIKKKPMIMPGCEPVRFEDTLETFL  186

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             D N   Y+E++  G  F  ADGI++NTW+D++P TLK+L++ + L ++ G PVY IGPL+
Sbjct  187   DPNSQLYQEFVPFGSVFPTADGIIVNTWDDMEPKTLKSLQDPKLLGRIAGVPVYPIGPLS  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R ++    +    ++ WL+KQP ESVLY+SFGSGG+LSA+Q+TELAWGLE+S+QRF+WVV
Sbjct  247   RPVDPSKTNHP--VLDWLNKQPDESVLYISFGSGGSLSAKQLTELAWGLEMSQQRFVWVV  304

Query  1068  RPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             RPP    +  A+F+   G   DGTP+YLPEGF +RT  +G VV  WA QA IL H + GG
Sbjct  305   RPPVDGSACSAYFSANSGEIRDGTPDYLPEGFVSRTHERGFVVSSWAPQAEILAHQAVGG  364

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NS LES+ +GVP+IAWPL+++Q  NATL+ EE+G+A+R  KLP++G++ REE+
Sbjct  365   FLTHCGWNSILESVVSGVPMIAWPLFADQMMNATLINEELGIAVRSKKLPSEGVIWREEI  424

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLN  1559
             K LV+ ++  ++G EMR++V KLK ++ +++S  GG ++ S+  + +
Sbjct  425   KALVRKIMVEEEGVEMRKKVKKLKDTAAESLSCDGGVAHESLSRIAD  471



>ref|XP_004238231.1| PREDICTED: hydroquinone glucosyltransferase [Solanum lycopersicum]
Length=476

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/466 (47%), Positives = 302/466 (65%), Gaps = 10/466 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+  L SPG+GHI P    A RL   H   ++ FVITTA S  + +L    +L +    V
Sbjct  11    HVAFLPSPGMGHITPLFEFAKRLVIHHGFHVSFFVITTAASAAQNELFRPENLPADFTAV  70

Query  351   GIPPVD-ISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              IPPV+ IS+ L  + K V QLC++VR +L  + + L K   R  AL++D FCT+A  + 
Sbjct  71    EIPPVENISSFLTDDMKVVTQLCIMVRESLKHLPSLLMKN--RPKALIIDLFCTDAFEIC  128

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             ++L++P + +   +    A ++Y P LD E+ G++V+  + ++ PGC P+ P D++D + 
Sbjct  129   EKLSIPVYSFFTASTILMAFSLYLPTLDSEVEGEFVDLPETIQTPGCSPIHPHDILDQVK  188

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR + +Y  YL       +A GI +N+W+D++PV+LKALREN     +   PVY IGPL 
Sbjct  189   DRKNEEYNWYLLNVSRLPLAVGIFVNSWDDLEPVSLKALRENLFFQNIPLPPVYTIGPLI  248

Query  888   RNIE---ERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             +  E   E+D +    I+ WL  QP +SVL+V FGSGGTL++EQ+TELAWGLELS+QRFI
Sbjct  249   KQDEVVTEQDAE----ILAWLDDQPPDSVLFVVFGSGGTLTSEQLTELAWGLELSQQRFI  304

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
              V R PS   +  AFF  G   +    YLPEGF  RT+ +GLVVP WA Q LIL H STG
Sbjct  305   LVARKPSDASASAAFFNVGSDENDPLLYLPEGFVRRTEGRGLVVPSWAPQTLILNHRSTG  364

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
              FLSHCG NSTLESI NGVPI AWPLY+EQR NAT L EE GVA++  K P + +V R E
Sbjct  365   AFLSHCGWNSTLESITNGVPITAWPLYAEQRMNATFLAEEAGVALKFSKNPGEELVDRNE  424

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
             ++  V+I+++ +KGK+MR R  +LK S++ A++ GGSSY S+C V+
Sbjct  425   IEKNVRIVMEGEKGKDMRRRAKELKESAKIALNSGGSSYESLCSVV  470



>emb|CAB42903.1| UTP-glucose glucosyltransferase like protein [Arabidopsis thaliana]
 emb|CAB62443.1| UTP-glucose glucosyltransferase-like protein [Arabidopsis thaliana]
Length=478

 Score =   430 bits (1105),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 204/467 (44%), Positives = 321/467 (69%), Gaps = 6/467 (1%)
 Frame = +3

Query  180   ILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN-VGI  356
             + +SPG+GHIIP + L  RLAG H   +T+FV+ T  +  + Q L S    + L + VG+
Sbjct  1     MFASPGMGHIIPVIELGKRLAGSHGFDVTIFVLETDAASAQSQFLNSPGCDAALVDIVGL  60

Query  357   PPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMADEL  536
             P  DIS L+D +     +L +++R  +P +R+ + +   +  AL+VD F  +A+P+  E 
Sbjct  61    PTPDISGLVDPSAFFGIKLLVMMRETIPTIRSKIEEMQHKPTALIVDLFGLDAIPLGGEF  120

Query  537   NLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLDRN  716
             N+  ++++ +NARF A+ ++ P LD+++  +++ +++ + +PGC+PVR ED ++  LD N
Sbjct  121   NMLTYIFIASNARFLAVALFFPTLDKDMEEEHIIKKQPMVMPGCEPVRFEDTLETFLDPN  180

Query  717   DVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTRNI  896
                YRE++  G  F   DGI++NTW+D++P TLK+L++ + L ++ G PVY IGPL+R +
Sbjct  181   SQLYREFVPFGSVFPTCDGIIVNTWDDMEPKTLKSLQDPKLLGRIAGVPVYPIGPLSRPV  240

Query  897   EERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVRPP  1076
             +    +    ++ WL+KQP ESVLY+SFGSGG+LSA+Q+TELAWGLE+S+QRF+WVVRPP
Sbjct  241   DPSKTNHP--VLDWLNKQPDESVLYISFGSGGSLSAKQLTELAWGLEMSQQRFVWVVRPP  298

Query  1077  SMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
                 +  A+ +   G   DGTP+YLPEGF +RT  +G +V  WA QA IL H + GGFL+
Sbjct  299   VDGSACSAYLSANSGKIRDGTPDYLPEGFVSRTHERGFMVSSWAPQAEILAHQAVGGFLT  358

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NS LES+  GVP+IAWPL++EQ  NATLL EE+GVA+R  KLP++G++TR E++ L
Sbjct  359   HCGWNSILESVVGGVPMIAWPLFAEQMMNATLLNEELGVAVRSKKLPSEGVITRAEIEAL  418

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLNAIE  1568
             V+ ++  ++G EMR+++ KLK ++ +++S  GG ++ S+  + +  E
Sbjct  419   VRKIMVEEEGAEMRKKIKKLKETAAESLSCDGGVAHESLSRIADESE  465



>ref|XP_006475483.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Citrus sinensis]
 gb|KDO45447.1| hypothetical protein CISIN_1g041419mg [Citrus sinensis]
Length=498

 Score =   430 bits (1105),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 216/478 (45%), Positives = 317/478 (66%), Gaps = 11/478 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +L+SPG+GH+IP + L  RL   H+V++TVFV+ + D  +   +    +  +  N V
Sbjct  9     HICLLASPGMGHLIPVVELGKRLVAHHDVQVTVFVVASHDDASNSNVHAVPNNNNLFNAV  68

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  +IS+L++ +     ++ +L+  +LP +R+A++    R  AL+VDFF TEA+ +AD
Sbjct  69    TLPLANISSLVNPDASLGEKILVLMHKSLPALRSAISAMKFRPTALIVDFFGTEAMDVAD  128

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIV-GQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             E  L K++++ +NA F A  ++ P +D++++  ++   EK +E+PGC PVR +D ++  L
Sbjct  129   EFGLLKYMFIASNAWFLACFIHAPAIDKKLLTDEHFNLEKPMELPGCMPVRFQDSLELFL  188

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
               N+  +     +G+   ++DGIL+NTW+D++P TL +LR++  L +V   PVYAIGPL 
Sbjct  189   HPNEPIFDFISSIGMKMSLSDGILVNTWDDLEPKTLGSLRDDNLLGRVCKAPVYAIGPLV  248

Query  888   RN-------IEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSE  1046
             R+        +    D   +I+ WL++QP +SV+YVSFGSGGTLSA+Q+TELAW LELS+
Sbjct  249   RSPDVASPSTKTSPSDSRVIILDWLNEQPSQSVIYVSFGSGGTLSAKQMTELAWSLELSQ  308

Query  1047  QRFIWVVRPPSMRGSDDAFFTT--GQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             QRFIWVVRPP       ++ T      A    +YLP GF TRT   GLVVP WA QA IL
Sbjct  309   QRFIWVVRPPVENDVSGSYLTVVDNNSAGKLEDYLPHGFLTRTDKVGLVVPAWAPQAEIL  368

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
              HPS GGFLSHCG NST+ESI NGVP+IAWPL++EQ+ NAT+LTEE+GVA R  +LPT+ 
Sbjct  369   AHPSVGGFLSHCGWNSTVESIVNGVPMIAWPLHAEQKMNATMLTEEIGVAFRSKELPTES  428

Query  1401  IVTREEVKTLV-KIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEK  1571
             +VTR+E++ LV KIM+  +    +R R ++LK  ++KA S  GSSY S+ +V    EK
Sbjct  429   LVTRQEIEMLVRKIMVDKEGHSSIRVRAMELKYGAQKATSNSGSSYKSLSQVAKQCEK  486



>gb|AFJ52925.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=506

 Score =   430 bits (1105),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 233/501 (47%), Positives = 319/501 (64%), Gaps = 24/501 (5%)
 Frame = +3

Query  150   NNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITT-ADSPTERQLL----  314
             N++    HI +L+SPG GH+IP L L  RL   HN  +TVFV+ T   SP E  L+    
Sbjct  9     NHHPQPPHIVLLASPGTGHLIPVLELGIRLVTHHNATVTVFVVATDHSSPAEAHLILDAT  68

Query  315   ---ESSDLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDA  485
                  S   +  N V +PP DIS L    T  V  +C+L+R   P +R+A+        A
Sbjct  69    ARAHYSSKNNTFNVVKLPPPDISNLTGPETAVVTHICMLMRETRPTLRSAMRSLEVPPAA  128

Query  486   LVVDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPG  665
             LVVD F TE+  +ADE+ + K++ V +NA FTAL ++ P LDRE+ GQYV+Q + L IPG
Sbjct  129   LVVDLFGTESFAIADEMEIGKYLLVTSNAWFTALALHTPALDREVDGQYVDQTEPLTIPG  188

Query  666   CKPVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLS  845
             C+ +RP++VVDPMLDRND+QY EY R G  F  ADGIL+NTWED++P TL ALR ++   
Sbjct  189   CRSIRPDEVVDPMLDRNDMQYVEYKRTGAEFAKADGILINTWEDLEPSTLAALRNDKFFG  248

Query  846   K-VVGKPVYAIGPLTR-NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITE  1019
             + ++   V +IGPL R +  +R   +   +  WL KQP++SV+YVSFGS GTLS  Q+ E
Sbjct  249   RSIIKGDVLSIGPLVRPSNNQRGPTEDDELFSWLDKQPKQSVIYVSFGSVGTLSTHQLNE  308

Query  1020  LAWGLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMW  1199
             LA+GLELS+QRF+WVVR P+   S+D+   +G+   G  NYLP GF  RT+  G+VVP W
Sbjct  309   LAYGLELSKQRFVWVVRRPT--DSNDSAGGSGE-IPGRLNYLPGGFLERTRYVGMVVPNW  365

Query  1200  AEQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRP  1379
             A QA +L HPS G FLSHCG NSTLES+ NGVP++AWP+Y+EQR N+TLL EE+ VA R 
Sbjct  366   APQAEVLSHPSVGWFLSHCGWNSTLESVTNGVPMVAWPMYAEQRMNSTLLAEELKVAART  425

Query  1380  MKLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-----------GG  1526
               LP +G+V R+E+  LVK ++  ++G  +RE+V ++K S EK   +            G
Sbjct  426   KTLPWRGVVGRDEIAELVKKVMVGEEGVLIREKVNEVKWSGEKVNEVKCSGEKALKEGSG  485

Query  1527  SSYNSMCEVLNAIEKRRDLKI  1589
             SS+ ++  V++    R   K 
Sbjct  486   SSFRALASVVDKCTCRYATKF  506



>ref|XP_006451504.1| hypothetical protein CICLE_v10008085mg [Citrus clementina]
 gb|ESR64744.1| hypothetical protein CICLE_v10008085mg [Citrus clementina]
Length=498

 Score =   429 bits (1103),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 216/478 (45%), Positives = 317/478 (66%), Gaps = 11/478 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +L+SPG+GH+IP + L  RL   H+V++TVFV+ + D  +   +    +  +  N V
Sbjct  9     HICLLASPGMGHLIPVVELGKRLVAHHDVQVTVFVVASHDDASNSNVHAVPNNNNLFNAV  68

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  +IS+L++ +     ++ +L+  +LP +R+A++    R  AL+VDFF TEA+ +AD
Sbjct  69    TLPLANISSLVNPDASLGEKILVLMHKSLPALRSAISAMKFRPTALIVDFFGTEAMDVAD  128

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIV-GQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             E  L K++++ +NA F A  ++ P +D++++  ++   EK +E+PGC PVR +D ++  L
Sbjct  129   EFGLLKYMFIASNAWFLACFIHAPAIDKKLLTDEHFNLEKPMELPGCMPVRFQDSLELFL  188

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
               N+  +     +G+   ++DGIL+NTW+D++P TL +LR++  L +V   PVYAIGPL 
Sbjct  189   HPNEPIFDFISSIGMKMSLSDGILVNTWDDLEPKTLGSLRDDNLLGRVCKAPVYAIGPLV  248

Query  888   RN-------IEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSE  1046
             R+        +    D   +I+ WL++QP +SV+YVSFGSGGTLSA+Q+TELAW LELS+
Sbjct  249   RSPDVASPSTKTSPSDSRVIILDWLNEQPSQSVIYVSFGSGGTLSAKQMTELAWSLELSQ  308

Query  1047  QRFIWVVRPPSMRGSDDAFFTT--GQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             QRFIWVVRPP       ++ T      A    +YLP GF TRT   GLVVP WA QA IL
Sbjct  309   QRFIWVVRPPVENDVSGSYLTVVDNNSAGKLEDYLPHGFLTRTDKVGLVVPEWAPQAEIL  368

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
              HPS GGFLSHCG NST+ESI NGVP+IAWPL++EQ+ NAT+LTEE+GVA R  +LPT+ 
Sbjct  369   AHPSVGGFLSHCGWNSTVESIVNGVPMIAWPLHAEQKMNATMLTEEIGVAFRSKELPTES  428

Query  1401  IVTREEVKTLV-KIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEK  1571
             +VTR+E++ LV KIM+  +    +R R ++LK  ++KA S  GSSY S+ +V    EK
Sbjct  429   LVTRQEIEMLVRKIMVDKEGHSSIRVRAMELKYGAQKATSNSGSSYKSLSQVAKQCEK  486



>ref|XP_007156903.1| hypothetical protein PHAVU_002G026900g [Phaseolus vulgaris]
 gb|ESW28897.1| hypothetical protein PHAVU_002G026900g [Phaseolus vulgaris]
Length=481

 Score =   428 bits (1101),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 219/469 (47%), Positives = 309/469 (66%), Gaps = 4/469 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GHIIP + L  RL   H+  +T+F++TT    T  Q+L+ +   S LN V
Sbjct  7     HAVLLASPGMGHIIPMVELGKRLLTHHSFHVTIFIVTTDSITTTSQILQQTSNLSSLNIV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPM  524
              +PP+D+S  L  N     ++ L +  +LP +R+++T         AL+VD F   ALPM
Sbjct  67    HVPPIDVSHKLPPNPPLAVRIGLTMLDSLPFLRSSITSIDNLPPPSALIVDMFGLPALPM  126

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A +L++  +VY  T+A F+A+TVY  V D++I+  + E  + L IPGC+PVR ED ++P 
Sbjct  127   ARDLSMLTYVYFATSAWFSAVTVYFSVSDKKIMETHAESREPLSIPGCEPVRFEDTLEPF  186

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
                    Y  YL        ADGILMNTWED++P   KALREN  L +     VYA+GPL
Sbjct  187   SSPGGEMYEGYLEAAKQIVAADGILMNTWEDLEPAATKALRENGILGRFTKGEVYAVGPL  246

Query  885   TRNIEER-DGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
              R+ E++ +G     ++QWL  QP ESV+YVSFGSGGT+S  Q+ E+A GLELS+QRF+W
Sbjct  247   VRSAEKKPEGGKKDAVLQWLDGQPDESVIYVSFGSGGTMSENQMREVALGLELSQQRFVW  306

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVRPP    +  AFF    G D T +YLPEGF  RT+  G+VV MWA QA IL+HP+TGG
Sbjct  307   VVRPPCEGDASGAFFDVASGVDYTMSYLPEGFVKRTEGLGVVVSMWAPQAEILQHPATGG  366

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             F++HCG NS LES++NGVP++AWPLY+EQ+ NA +L+EE+GVA+R  +    G+V REEV
Sbjct  367   FVTHCGWNSVLESVENGVPMVAWPLYAEQKMNAFMLSEELGVAVRTAE-KDGGVVGREEV  425

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
               +V+ ++  K+G  MR++V +LK+S EKA+ I GSS++S+ ++    E
Sbjct  426   AEVVRRVMVDKEGVGMRKKVKELKLSGEKALGIFGSSHHSLSQMTKHCE  474



>ref|XP_010507375.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Camelina sativa]
Length=487

 Score =   428 bits (1100),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/481 (43%), Positives = 327/481 (68%), Gaps = 8/481 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLES--SDLTSRLN  344
             H  + +SPG+GH+IP + L  RLAG H   +T+FV+   ++  + Q L S   D TS ++
Sbjct  7     HAAMFASPGMGHVIPVIELGKRLAGSHGFHVTIFVLEDDEASVQSQFLNSPGCDATS-VD  65

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
              + +P  DIS L+D ++    +L +++R  +P +R+ + +   +  AL+VD F  +ALP+
Sbjct  66    VINLPTPDISGLVDPSSFFAIKLLVMMRETIPTLRSKIAEMQYKPTALIVDMFGLDALPL  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
               ELN+  +++VP+NARF A+ +Y P LD+++   ++ +++ + +PGC+PVR ED ++  
Sbjct  126   GGELNMLTYIFVPSNARFLAVILYFPTLDKDMEEDHIIKKQPMVMPGCEPVRFEDTLETF  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LD +D  YRE++  G+ F  ADGI++NTW+D++  TLK+L++   L ++   PVY IGPL
Sbjct  186   LDTSDQLYREFVPFGLAFSTADGIIVNTWDDMESKTLKSLQDPNLLGRIARVPVYPIGPL  245

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R +++   +    +++WL+KQP E+VLY+SFGSGG+LSA+Q+TELAWGLE+S+QRF+WV
Sbjct  246   FRPVDQSKTNHP--VLEWLNKQPDETVLYISFGSGGSLSAKQLTELAWGLEMSQQRFVWV  303

Query  1065  VRPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             VRPP    +  A+F+       D TP YLPEGF +RT  +GLVV  W  QA IL H + G
Sbjct  304   VRPPVDGSACSAYFSVNSTEIRDDTPGYLPEGFVSRTHERGLVVSSWVPQAEILAHQTVG  363

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NS LES+ +GVP+IAWPL+ +Q+ NATLL EE+G+AIR   LP++G++TREE
Sbjct  364   GFLTHCGWNSILESVVSGVPMIAWPLFVDQKMNATLLNEELGIAIRSKILPSEGVITREE  423

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLNAIEKRRDLKICT  1595
             ++ LV+ ++  ++G  MR++V KLK ++ +++S  GG ++ S+  +    + R +   C 
Sbjct  424   IEALVRKIMVEEEGCVMRKKVKKLKDTAVESLSCDGGVAHESLSRITEECKHRLERVSCM  483

Query  1596  Q  1598
             +
Sbjct  484   E  484



>ref|XP_010431232.1| PREDICTED: UDP-glycosyltransferase 72E1 [Camelina sativa]
Length=487

 Score =   427 bits (1098),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/466 (44%), Positives = 320/466 (69%), Gaps = 8/466 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLES--SDLTSRLN  344
             H  + +SPG+GH+IP + L  RLAG H   +T+FV+    +  + Q L S   D TS ++
Sbjct  7     HAAMFASPGMGHVIPVIELGKRLAGSHGFHVTIFVLEDDAASVQSQFLNSPGCDATS-VD  65

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
              + +P  DIS L+D +     +L +++R  +P +R+ + +   +  AL+VD F  +ALP+
Sbjct  66    VISLPTPDISGLVDPSAFFAIKLLVMMRETIPTLRSKIAEMEYKPTALIVDLFGLDALPL  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
               ELN+  +++VP+NARF A+ +Y P LD+++   ++ +++ + IPGC+PVR ED ++  
Sbjct  126   GGELNMLTYIFVPSNARFLAVILYFPTLDKDMEEDHIIKKQPMVIPGCEPVRFEDTLETF  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LD ND  YRE++  G+ F  ADGI++NTW+D++P TLK+L++   L ++   PVY IGPL
Sbjct  186   LDPNDQLYREFVPYGLAFSTADGIIVNTWDDMEPKTLKSLQDPNLLGRIARVPVYPIGPL  245

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R +++   +    ++ WL+KQP E+VLY+SFGSGG+LSA+Q+TELAWGLE+S+QRF+WV
Sbjct  246   FRPVDQSKTNHP--VLDWLNKQPDETVLYISFGSGGSLSAKQLTELAWGLEISQQRFVWV  303

Query  1065  VRPPSMRGSDDAFFTTG--QGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             VRPP    +  A+F+    +  D TP YLPEGF +RT  +GLVV  W  QA IL H + G
Sbjct  304   VRPPVDSSACSAYFSVNSIEIRDDTPGYLPEGFVSRTHERGLVVSSWVPQAEILAHQAVG  363

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NS LES+ +GVP+IAWPL+ +Q+ NATLL EE+G+AIR   LP++G++TREE
Sbjct  364   GFLTHCGWNSILESVVSGVPMIAWPLFVDQKMNATLLNEELGIAIRSKILPSEGVITREE  423

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEV  1553
             ++ LV+ ++  ++G  MR++V KLK ++ +++S  GG ++ S   +
Sbjct  424   IEALVRKIMVEEEGCVMRKKVKKLKDTAVESLSCDGGVAHESFLRI  469



>ref|XP_006293138.1| hypothetical protein CARUB_v10019444mg [Capsella rubella]
 gb|EOA26036.1| hypothetical protein CARUB_v10019444mg [Capsella rubella]
Length=486

 Score =   425 bits (1093),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/465 (45%), Positives = 327/465 (70%), Gaps = 8/465 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLES--SDLTSRLN  344
             H  +L+SPG+GH+IP++ L  RLAG H   +T+FV+    +  + Q L S  SD T  L+
Sbjct  7     HAVLLASPGMGHVIPAIELGKRLAGSHGFHVTLFVLEADAASVQSQFLNSPGSDATF-LD  65

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
              + +P  DIS L+D +     ++ ++VR  +P +R+ + +   +  AL+VDFF  +ALP+
Sbjct  66    VISLPTPDISGLVDPSAVFGIKILVMVRETIPTLRSRIAEMEYKPTALIVDFFGLDALPL  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
               ELN+  ++++ +NARF ++ +Y P LD++   ++   ++ + +PGC+PVR ED ++  
Sbjct  126   GGELNMLTYIFIASNARFLSVALYFPTLDKDKEEEHTINKQPMVMPGCEPVRFEDTLEGF  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LD ND  YRE++ LG+ F  ADGI++NTW+D++P TLK+L++ + + ++   PVY IGPL
Sbjct  186   LDPNDQLYREFVPLGLVFPTADGIIVNTWDDMEPKTLKSLQDPKLMGRIARVPVYPIGPL  245

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
             +R ++    +    I+ WL+KQP +SVLY+SFGSGG+LSA+++TELAWGLE+S+QRF+WV
Sbjct  246   SRPVDTSKTNHP--ILDWLNKQPDKSVLYISFGSGGSLSAKELTELAWGLEMSQQRFVWV  303

Query  1065  VRPPSMRGSDDAFFT--TGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             VRPP    +  A+ +  +G+  DGTP+YLPEGF +RT  +GLV+  WA QA IL H + G
Sbjct  304   VRPPVDGIAGTAYLSVNSGEIKDGTPDYLPEGFVSRTHERGLVISSWAPQAEILAHQAIG  363

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GF++HCG NS LES+ +GVP+IAWPL++EQ+ NATLL EE+G+A+R   LP++G++ REE
Sbjct  364   GFITHCGWNSILESVVSGVPMIAWPLFAEQKMNATLLNEELGIALRSKILPSEGVIAREE  423

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCE  1550
             ++ LV+ ++  ++G EMR++V KLK ++ +++S  GG S + + E
Sbjct  424   IEALVRKIMVEEEGCEMRKKVKKLKDTAVESLSCDGGESLSRITE  468



>ref|XP_009136555.1| PREDICTED: UDP-glycosyltransferase 72E1 [Brassica rapa]
Length=481

 Score =   424 bits (1091),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 213/479 (44%), Positives = 325/479 (68%), Gaps = 12/479 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLES--SDLTSRLN  344
             H  + +SPG+GHIIP + L  RLAG H  ++T+FV+    +  + Q L S   D+T  ++
Sbjct  7     HAAMFASPGMGHIIPVIELGKRLAGTHGFQVTIFVLEADAASAQSQFLNSPGCDVT-LID  65

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
              +G+P  DIS L+D +     +L  ++R  +P +R+ +     +  AL+VD F  +AL +
Sbjct  66    IIGLPSPDISGLVDPSAFFAIKLLTMMRETIPTLRSKIEVMQHKPTALIVDLFGLDALRL  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              +E N+  +V++ TNARF A+ +Y P L++++  +++ ++K L IPGC+PVR ED ++ +
Sbjct  126   GEEFNMLTYVFMTTNARFLAVALYFPTLEKDVEDEHIIKKKPLAIPGCEPVRFEDTLETL  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR D  Y+ ++  G+ F  ADGI++NTW+D++P TLK+L++   L ++   P+Y IGPL
Sbjct  186   LDRTDQIYQVFVPFGLVFPTADGIIVNTWDDMEPKTLKSLQDPNLLGRIARVPLYPIGPL  245

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R ++    +    ++ WL+KQP ESVLY+SFGSGG+LSA Q+TELAWGLELS+QRF+WV
Sbjct  246   CRPVDPSKTNHP--VLDWLNKQPDESVLYISFGSGGSLSATQLTELAWGLELSQQRFVWV  303

Query  1065  VRPPSMRGSDDAFFTTGQGAD---GTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             V PP + GS  + + +   +D   GTP YLP+ F +RT  +GLV+  WA QA IL H + 
Sbjct  304   VHPP-VDGSSCSEYISANSSDVQDGTPEYLPKEFTSRTHERGLVISSWAPQAEILAHQAV  362

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFL+HCG NS LES+ +GVP+IAWPL++EQ+ NATLL EE+GVAIR  KLP++ +V R 
Sbjct  363   GGFLTHCGWNSILESVVSGVPMIAWPLFAEQKMNATLLNEELGVAIRSRKLPSEEVVLRV  422

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIG-GSSYNSMCEVLNAIEK--RRDL  1583
             E+++LV+ ++  ++G EMRE+V KLK ++E ++S   GSSY S+  V    ++   RD+
Sbjct  423   EIESLVRRIMVEEEGCEMREKVKKLKDTAEMSLSCDTGSSYESLSRVAKECDRLLERDI  481



>gb|KFK28349.1| hypothetical protein AALP_AA8G504500 [Arabis alpina]
Length=482

 Score =   424 bits (1090),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 210/471 (45%), Positives = 319/471 (68%), Gaps = 11/471 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + SSPG+GH+IP + LA RL+  H   +TVFV+ T  +  + + L+S   TS ++ V
Sbjct  7     HAAMFSSPGMGHVIPVIELAKRLSVNHGFHVTVFVLETDAASAQSKFLDS---TSDVDVV  63

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  DIS L+D N   V ++  ++   +P +R+ +    ++  AL+VD F T+AL +A 
Sbjct  64    NLPSPDISDLVDPNDHVVTKIGTIMHEVVPALRSKIASMHQKPTALIVDLFGTDALCLAR  123

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+  +V +  NARF  +++Y P LD++   ++  Q K LEIPGC+PVR ED +D  L 
Sbjct  124   EFNMLTYVLIAANARFLGVSMYYPTLDKDTKEEHTVQRKPLEIPGCEPVRYEDAMDAYLI  183

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  YR++++ G+ +  ADGIL+NTWE+++P +L +L++ + L +V   PVY +GPL+R
Sbjct  184   PDEPLYRDFVQYGLAYPKADGILVNTWEEMEPKSLISLQDPKLLGRVARVPVYPVGPLSR  243

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +E    D    ++ WL+ QP +SVLY+SFGSGG+L+A+Q+TELAWGLE S+QRF+WVVR
Sbjct  244   PVESSQTDHP--VLDWLNDQPDDSVLYISFGSGGSLTAKQLTELAWGLEQSQQRFVWVVR  301

Query  1071  PPSMRGSDDAFFTT--GQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             PP    S   +FT    +  D TP YLPEGF TRT ++GLVVP WA QA IL H + GGF
Sbjct  302   PPVDGSSFSEYFTVNGSESKDKTPTYLPEGFITRTSDRGLVVPSWAPQAEILAHQAVGGF  361

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             LSHCG NS+LES+ +GVP+IAWPL++EQ  NA LL++E+G+AIR      + +V+R E++
Sbjct  362   LSHCGWNSSLESVVSGVPMIAWPLFAEQSMNAALLSDELGIAIRVDNF--EKVVSRSEIE  419

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNAIEK  1571
              +V+ ++  + G+EMR +V +LK S+E ++S+  GGS++ S+C+V    E+
Sbjct  420   VIVRKVMAEEDGEEMRMKVKELKDSAEMSLSVECGGSAHESLCKVTVECER  470



>ref|XP_006393862.1| hypothetical protein EUTSA_v10005518mg [Eutrema salsugineum]
 gb|ESQ31148.1| hypothetical protein EUTSA_v10005518mg [Eutrema salsugineum]
Length=481

 Score =   424 bits (1089),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 211/479 (44%), Positives = 325/479 (68%), Gaps = 16/479 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + SSPG+GH+IP + LA RL+  H  ++T+FV+    +  + + L S+D+    + V
Sbjct  7     HAAMFSSPGMGHLIPVMELAKRLSANHGFRVTLFVLENDAASAQSKFLNSTDV----DVV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  DIS L+D     V ++  ++R A+P +R+ L    ++  AL+VD F T+AL +A 
Sbjct  63    NLPLPDISDLVDPADHVVTKIGTIMREAVPALRSKLAAMHQKPTALIVDLFGTDALCLAS  122

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+  +V + +NAR+  + +Y P LD+++  ++  Q K L++PGC+PVR ED +D  L 
Sbjct  123   EFNMLTYVLIASNARYVGVALYYPTLDQDLKEEHTVQRKPLDVPGCEPVRFEDTMDAYLV  182

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  YR+++R  + +  ADGIL+NTWE+I+P +LK+L++ + L +V   PVY IGPL R
Sbjct  183   PDEPLYRDFVRHCLAYPKADGILVNTWEEIEPKSLKSLQDPKLLGRVARVPVYPIGPLCR  242

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +E  + D    ++ WL++QP ESVLYVSFGSGG+L+A Q+TELAWGLE S+QRF+WVVR
Sbjct  243   PVESSETDHP--VLDWLNEQPDESVLYVSFGSGGSLTANQLTELAWGLEQSQQRFVWVVR  300

Query  1071  PPSMRGSDDAFFTT-GQGA-DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             PP    S   +F+  G G+ D TP YLPEGF TRT ++GLVVP WA QA +L H + GGF
Sbjct  301   PPVDGSSSSEYFSVKGDGSRDSTPEYLPEGFVTRTCDRGLVVPSWAPQAEVLAHRAVGGF  360

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG NS LE + +GVP+IAWPL++EQ  NA LL++E+G+A+R  + P    ++R E++
Sbjct  361   LTHCGWNSALEGVVSGVPMIAWPLFAEQSMNAALLSDELGIAVRADRFPEA--ISRSEIE  418

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMC----EVLNAIEKRRDL  1583
              +V+ ++  ++G+EMR +V +L+ S+E ++SI  GGS++ S+C    E +  +E+ RDL
Sbjct  419   AIVRKVMAEEEGEEMRRKVKRLRDSAEMSLSIDGGGSAHESLCRVTDECVRFLERDRDL  477



>ref|XP_006367304.1| PREDICTED: hydroquinone glucosyltransferase-like [Solanum tuberosum]
Length=476

 Score =   423 bits (1088),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/467 (45%), Positives = 304/467 (65%), Gaps = 10/467 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+  L SPG+GHI P    A RL   H   ++ FVITT  S  + +L    +L +    V
Sbjct  11    HVAFLPSPGMGHITPLFEFAKRLVIHHGFHVSFFVITTGASAAQNELFRPENLPADFTAV  70

Query  351   GIPPVD-ISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              IPPV+ IS+    + K + QLC++VR +L  + + L +  +R  AL++D FCT+A  + 
Sbjct  71    EIPPVENISSFFTDDMKLLTQLCIMVRESLKHLPSLLME--KRPKALIIDLFCTDAFEIC  128

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             ++L++P + +   +    A ++Y P LDRE+ G++V+  + ++ PGC P+ P D++D + 
Sbjct  129   EKLSIPVYSFFTASTILMAFSLYLPTLDREVEGEFVDLPEPIQTPGCTPICPHDILDQVK  188

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR + +Y+ YL       +A GI +N+W+D++PV+LKALREN    K+   PVY IGPL 
Sbjct  189   DRKNDEYKWYLLNVSRLPLAAGIFVNSWDDLEPVSLKALRENLFFQKIPLPPVYTIGPLI  248

Query  888   RNIE---ERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             +  E   E+D +    I+ WL  QP +SVL V FGSGGTL++EQ++ELAWGLE+S+QRFI
Sbjct  249   KQDEVVTEKDAE----ILAWLDDQPPDSVLVVVFGSGGTLTSEQLSELAWGLEMSQQRFI  304

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
              VVR PS   +  AFF  G   +    YLPEGF  +T+ +GLVVP WA Q  IL HPS G
Sbjct  305   LVVRKPSDASASAAFFNVGSDENDPLLYLPEGFIKKTEGRGLVVPSWAPQTSILNHPSIG  364

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
              FLSHCG NSTLES+ +GVPIIAWPLY+EQR NATLL EE GVA++  K P + +V R E
Sbjct  365   AFLSHCGWNSTLESVIHGVPIIAWPLYAEQRMNATLLAEEAGVALKFSKDPGEELVDRNE  424

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             ++  V+I+++ +KGK MR R  +LK S++ A++ GGSSY S+C ++ 
Sbjct  425   IEKNVRIVMEGEKGKAMRRRAKELKESAKIALNSGGSSYESLCSIVQ  471



>gb|KFK34320.1| hypothetical protein AALP_AA5G129700 [Arabis alpina]
Length=487

 Score =   423 bits (1088),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 206/467 (44%), Positives = 316/467 (68%), Gaps = 6/467 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + +SPG+GH+IP + L  RLAG H  ++T+FV+    +  + Q L S    + L +V
Sbjct  7     HAAMFASPGMGHVIPVIELGKRLAGSHGFRVTIFVLEADAASAQSQFLNSPGYDATLVDV  66

Query  351   -GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              G+P  DIS L+D +     +L +++R  +P +R+ + +   +  AL+VD F  +ALP+ 
Sbjct  67    IGLPTPDISNLVDPSAFFAIKLLIMMRETIPTLRSKIAEMQHKPTALIVDLFGLDALPLG  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E N+  ++++ +NARF A+ +Y P L++++  +++ ++K L +PGC+PVR ED ++  L
Sbjct  127   GEFNMLTYIFIASNARFIAVALYFPTLEKDVEEEHIIKKKPLALPGCEPVRFEDTLESFL  186

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             D  D  YR ++  G+ F  ADGI++NTW+D++P TLK+L++ + L ++   PVY IGPL 
Sbjct  187   DPTDEIYRVFVPFGLVFPTADGIIVNTWDDMEPKTLKSLQDPKLLGRIARVPVYPIGPLC  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R ++    +    +  WL+KQP ESVLY+SFGSGG+LSA Q+TELAWGLELS+QRF+WVV
Sbjct  247   RPVDPSQTN--LPLFDWLNKQPDESVLYISFGSGGSLSARQLTELAWGLELSQQRFVWVV  304

Query  1068  RPP--SMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             RPP   +  S+      G   DGT +YLP+ F +RT  +GLVVP W  QA IL H + GG
Sbjct  305   RPPIDGLASSEYVSANNGDIRDGTSDYLPKEFISRTHERGLVVPSWVPQAEILAHKAVGG  364

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NS LES+  GVP+IAWPL++EQ+ NATLL EE+G+A+R  KL ++ ++ REEV
Sbjct  365   FLTHCGWNSILESVVTGVPMIAWPLFAEQKMNATLLNEELGIAVRSEKLTSEEVILREEV  424

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLN  1559
             K LV+ ++  ++G +MRE+V KL+ ++E ++S  GGS++ S+  V +
Sbjct  425   KKLVQRIMVEEEGYKMREKVKKLRDTAETSVSCDGGSAHESLSRVAD  471



>ref|XP_010040925.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Eucalyptus 
grandis]
Length=481

 Score =   422 bits (1085),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 217/462 (47%), Positives = 309/462 (67%), Gaps = 6/462 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH IP+L L   LA  H   +T+FV+    S TE  L +     + LN V
Sbjct  7     HAVLLASPGMGHFIPALELGKHLATHHGFDVTIFVVAADASITESPLFKPPQTPNLLNLV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+SAL+++    V +L +++R ALP ++AA++    R  AL+VD F TEAL +A+
Sbjct  67    LLPPVDVSALVNSTASVVTRLVIMMREALPLLQAAISSMKSRPTALIVDMFGTEALAIAE  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V++ + A F A+TV+ P +D E   ++   ++ L++PGC+ +R ED +D   D
Sbjct  127   EFDMLKYVFITSTAWFLAVTVHFPYIDEEAEHKHRVMKRPLDVPGCRSIRHEDTLDLFFD  186

Query  711   RNDVQ-YREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             + D   +  + R+G+    ADGIL+NTW+D++P TL+AL   + L +VV   VY +GPL 
Sbjct  187   QTDRNLFSGFARIGMEISNADGILVNTWQDLEPSTLRALENEKFLGRVVKASVYPVGPLV  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R + +    +   +M WL  QP ESV+YVSFGSGGTLSA+Q TELAWGLELS QRF+WVV
Sbjct  247   RPVGQSSKSE---VMDWLDMQPMESVIYVSFGSGGTLSAKQTTELAWGLELS-QRFVWVV  302

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +   FF      DGTP+YLP GF TR +N+G+VV MWA Q  IL H S GGFL
Sbjct  303   RPPVDGDASANFFNVTNSHDGTPSYLPSGFFTRIRNKGMVVLMWASQTEILAHKSIGGFL  362

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLES+ NGVP++ WPLY+EQ+ NA +L EE+ VA+RP   P  G++ REE+  
Sbjct  363   SHCGWNSTLESMVNGVPMVVWPLYAEQQMNAAMLAEELKVAVRPKIQPNAGVIEREEIAG  422

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             +V+ +++  KG EMR++V +L+ S+ +A+  GGSSYNS+  V
Sbjct  423   MVRRVME-LKGNEMRDKVKELQRSAHQALMQGGSSYNSLERV  463



>ref|XP_009349755.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Pyrus 
x bretschneideri]
Length=486

 Score =   422 bits (1084),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 217/476 (46%), Positives = 306/476 (64%), Gaps = 14/476 (3%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             M+    S  H  +L SPG+GH+IP L L  RL    N  +T+FVI++  S  E QL+ ++
Sbjct  1     MEMITSSKQHAALLCSPGMGHLIPVLELGKRLVTHQNFTVTIFVISSHTSDAESQLINTA  60

Query  324   DLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLD----ALV  491
                     + +P  DIS L+  +   V  L +++R     VR A     R ++     L+
Sbjct  61    ANPKLCRVIELPLPDISGLVAPDAAIVTILAVMMRE----VRHAFWSALRAMEFCPTVLI  116

Query  492   VDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCK  671
             VD F TE+  +ADE  +PK+VY+P +A F +  +Y P LD E+ G++ +Q++ ++IPGC+
Sbjct  117   VDLFGTESFSIADEFGIPKYVYIPCSAWFLSFMIYGPALDLEVKGEFTQQKEPIKIPGCR  176

Query  672   PVRPE-DVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSK  848
              + P+ DVVD   +R   QY +++ +       DG+L+N WED++P TL ALR+ + L +
Sbjct  177   SILPQVDVVDSFQNRTHQQYFDFIEICSQTSKGDGVLVNIWEDLEPNTLAALRDEKLLGR  236

Query  849   VVGKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAW  1028
                 PV+ IGPL R    +  D    +  WL  Q  ESV+YVSFGSGGTLS EQ+TELAW
Sbjct  237   YTNMPVFPIGPLMR--PNKPTDLRGKVFDWLDMQLNESVIYVSFGSGGTLSFEQMTELAW  294

Query  1029  GLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTP--NYLPEGFNTRTQNQGLVVPMWA  1202
             GLELS+QRFIWV+RPP++  +D AFF  G G+D      YLP+GF  RT++ G V+P+WA
Sbjct  295   GLELSQQRFIWVIRPPTLT-ADGAFFIGGSGSDDNNPIKYLPKGFLDRTKDIGFVIPLWA  353

Query  1203  EQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPM  1382
              Q  IL HP+ GGFLSHCG NSTLESI NGVPIIAWPLY+EQR NATLL EE+GVA+R  
Sbjct  354   PQVDILAHPAIGGFLSHCGWNSTLESITNGVPIIAWPLYAEQRMNATLLIEELGVAVRSK  413

Query  1383  KLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
               P K +V REE++ +V+ +++ K+G  +R+RV K+K S  KA+  GGSS+N++ +
Sbjct  414   IPPWKKVVEREEIEEMVRKIMEDKEGFALRDRVKKIKESGAKALEKGGSSHNALSQ  469



>ref|XP_006404008.1| hypothetical protein EUTSA_v10010327mg [Eutrema salsugineum]
 gb|ESQ45461.1| hypothetical protein EUTSA_v10010327mg [Eutrema salsugineum]
Length=486

 Score =   421 bits (1083),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 207/472 (44%), Positives = 320/472 (68%), Gaps = 7/472 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +  SPG+GH+IP++ L  RLAG H   +T+FV+    +  + Q L S    + L +V
Sbjct  7     HAAMFVSPGMGHVIPAIELGKRLAGSHGFHVTIFVLEADAASAQSQFLNSPGFNTALVDV  66

Query  351   -GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              G+P  DIS L+D +     ++  ++R ++  +R+ + +   +  AL+VD    EAL + 
Sbjct  67    IGLPAPDISGLVDPSALIGMKIMTMIRESVQTLRSKIAEMQHKPTALIVDVLSLEALRLG  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E N+  ++++ +NARF AL +Y P LD+++  +++ ++K L IPGC+PVR ED  +  L
Sbjct  127   GEFNMLTYLFIASNARFVALMMYFPTLDKDVQEEHIIKKKPLAIPGCEPVRFEDTFEIFL  186

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             D +   Y+E + LG+ +   DGI++NTW+D++P TLK+L++ E L ++   P+Y IGPL+
Sbjct  187   DPSSKIYQECVPLGLVYSTVDGIIVNTWDDMEPKTLKSLQDPELLGQIARVPIYPIGPLS  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R ++    +    +M WL+KQP ESVLY+SFGSGG+L A+Q+TELAWGLELS+QRF+WVV
Sbjct  247   RPVDPSKTNHP--VMDWLNKQPDESVLYISFGSGGSLPAKQLTELAWGLELSQQRFVWVV  304

Query  1068  RPP--SMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             RPP   +  S+     + +  DG P+YLPEGF +RT  +GLVVP WA QA IL H + GG
Sbjct  305   RPPIAGLACSEYLSVKSSEIQDGAPDYLPEGFVSRTHERGLVVPSWAPQAEILAHQAVGG  364

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NS  ES+ +GVP+IAWPL+++Q  NATLL EE+G+A+R  KLP++G+++R E+
Sbjct  365   FLTHCGWNSIFESVVSGVPMIAWPLFADQMVNATLLNEELGIAVRSKKLPSEGVISRVEI  424

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAIS-IGGSSYNSMCEVLNAIEKR  1574
             +TLV+ M+  ++G EMR++V KL+ ++ K++S  GGS++ S+  V    E+R
Sbjct  425   ETLVR-MIMVEEGCEMRKKVKKLRDTAVKSLSRDGGSAHESLSRVAEECERR  475



>ref|XP_006375073.1| hypothetical protein POPTR_0014s04130g [Populus trichocarpa]
 gb|ERP52870.1| hypothetical protein POPTR_0014s04130g [Populus trichocarpa]
Length=475

 Score =   421 bits (1082),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 208/467 (45%), Positives = 306/467 (66%), Gaps = 5/467 (1%)
 Frame = +3

Query  150   NNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSD  326
              N  +  H+ I+ SPGIGHI P L +A RL  +H+  ++  VI T + S  +  LL+SS 
Sbjct  5     ENETAKPHVAIMPSPGIGHITPLLEIAKRLVVLHDFHVSFIVIATNEASAGQGNLLQSST  64

Query  327   LTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFC  506
             L   L+ V +P VD+ A+        A+LC +V  A+  +++ L K   ++ A+VVD FC
Sbjct  65    LPPGLDVVYLPTVDVFAVTTNGMPLAARLCAIVEEAIKSLKSVLVK-LGKIKAVVVDLFC  123

Query  507   TEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPE  686
             T+A  +  EL++P +++   +      ++Y P LDRE+ G++V+  + +++PGC P+RPE
Sbjct  124   TQAFDICSELSIPAYLFFTASIALLNFSLYLPTLDREVEGEFVDLPEPVKVPGCPPIRPE  183

Query  687   DVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPV  866
             D++D + +R   +Y+ YL     F +  GI +N+WED++P   KA+ E+    ++   PV
Sbjct  184   DLLDQVKNRKIDEYKWYLFHSSRFHLGAGIFLNSWEDLEPANFKAITEDPFFKQIHTPPV  243

Query  867   YAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSE  1046
             + +GPL + IEE         + WL KQP  SVL+VS GSGGTL+ EQ+TELAWGLELS 
Sbjct  244   HPVGPLIK-IEEPLTASDADCLAWLDKQPPNSVLFVSLGSGGTLTVEQLTELAWGLELSH  302

Query  1047  QRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRH  1226
             QRFI+VVR P+   +  AFF  G        YLP GF  RTQ +GLVVP WA Q L+L+H
Sbjct  303   QRFIFVVRMPTNSSASAAFFNAGSDVSDPKTYLPTGFLERTQERGLVVPSWAPQVLVLKH  362

Query  1227  PSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIV  1406
             PSTGGFL+HCG NSTLE++ +G+P+IAWPLY+EQR NAT+L EE+G+AI+P+  P   +V
Sbjct  363   PSTGGFLTHCGWNSTLEAVTHGMPMIAWPLYAEQRMNATILAEEIGIAIKPVAEPGASLV  422

Query  1407  TREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMC  1547
              REEV+ +V++ +   +GKEMR+++ +LK S+ KA+ IGGSSY+S+ 
Sbjct  423   GREEVERVVRLAIL--EGKEMRKKIEELKDSAAKAMEIGGSSYDSLA  467



>ref|XP_009136554.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Brassica rapa]
Length=490

 Score =   421 bits (1083),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 207/474 (44%), Positives = 320/474 (68%), Gaps = 6/474 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + +SPG+GH+IP + LA RLAG H   +T+FV+    +  + Q L S    + L +V
Sbjct  10    HAAMFASPGMGHVIPVIELAKRLAGSHGFHITIFVLEADAASVQSQFLNSPGCVANLFDV  69

Query  351   -GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              G+P  DIS ++D +     +L +++R  +P +R  + +   +  AL+VD     AL + 
Sbjct  70    VGLPSPDISGMVDPSAFFGIKLLIMMRETVPILREKIAEMKHKPTALIVDVLGLYALRLG  129

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             +E N+  +V++ +NARF A+ +Y P LD+++  +++  +K L +PGC+PVR ED ++P  
Sbjct  130   EEFNMLTYVFIASNARFLAVAMYFPTLDKDVEEEHIINKKPLALPGCEPVRFEDTLEPFR  189

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR    Y+E + LG+ +  ADG+++NTW+D++P TL++L++ + L ++   PVY IGPL 
Sbjct  190   DRKGPIYQECVPLGLLYPTADGLIVNTWDDMEPKTLRSLQDPKLLGRIARVPVYPIGPLC  249

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R ++    +    ++ WL+KQP ESVLY+SFGSGG+LSA+QITELAWGLELS+QRF+WVV
Sbjct  250   RPVDSSKTNHP--VLDWLNKQPDESVLYISFGSGGSLSAKQITELAWGLELSQQRFVWVV  307

Query  1068  RPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             RPP       A+F+       DGTP+YLPE F +RT  +GLVVP WA QA IL H + GG
Sbjct  308   RPPVDGLPCSAYFSVNNSGIQDGTPDYLPEEFVSRTHERGLVVPSWAPQAEILAHKAVGG  367

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NS LES+ NGVP+IAWPL+++Q+ NATLL EE+G+A+R  KLP++ + +R E+
Sbjct  368   FLTHCGWNSILESVVNGVPMIAWPLFADQKLNATLLNEELGIAVRSKKLPSEEMTSRVEI  427

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLNAIEKRRD  1580
             + LV+ ++  ++G +MR+ V KLK+++ +A+S  GGS++ S+  V    ++  D
Sbjct  428   EALVRRVMVGEEGCKMRDMVKKLKITAAEAVSCDGGSAHKSLLGVAQQCQRLLD  481



>gb|KFK24026.1| hypothetical protein AALP_AAs56878U000200 [Arabis alpina]
Length=488

 Score =   421 bits (1082),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/473 (44%), Positives = 319/473 (67%), Gaps = 7/473 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + +SPG+GH+IP + L  RLAG H   +T+FV+    +  + Q L S    + L +V
Sbjct  7     HAAMFASPGMGHVIPVIELGKRLAGSHGFHVTIFVLEADAASAQSQFLNSPGCDATLVDV  66

Query  351   -GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P  DIS+L+D +     +L  ++R  +P +R+ + +   +  AL VD    +AL + 
Sbjct  67    VSLPSPDISSLVDPSAFFAIKLLTMMRETIPTLRSKIAEMQHKPTALFVDLLGLDALRLG  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E N+  +V++ +NARF A+ +Y P +++++  +++ ++K L IPGC+P+R ED ++P L
Sbjct  127   KEFNMLTYVFMASNARFLAVAMYFPTVEKDVKEEHIFKKKPLAIPGCEPLRFEDTLEPFL  186

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             D  D  Y+E +  G+ F  ADGI++NTW+ I+P TLK+L++ + L ++   PVY IGPL 
Sbjct  187   DPTDQLYQECVPFGLVFPTADGIIVNTWDTIEPKTLKSLQDPKLLGRIARVPVYPIGPLC  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R ++    +    ++ WL+KQP ESVLY+SFGSGG+LSA+Q+TELAWGLELS+QRF+WVV
Sbjct  247   RAVDPSKTNHP--VLDWLNKQPTESVLYISFGSGGSLSAKQLTELAWGLELSQQRFVWVV  304

Query  1068  RPPSMRGSDDAFFT--TGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             RPP    +  A+F+  + +  DGTPNYLPE F  RT  +GL+VP WA QA IL H + GG
Sbjct  305   RPPVDGSACSAYFSINSSEIQDGTPNYLPEDFVGRTHERGLLVPSWAPQAEILAHKAVGG  364

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NS LES+ +GVP+IAWPL+S+Q+ NATLL EE+G+AIR  K+P++G+++R E+
Sbjct  365   FLTHCGWNSILESVVSGVPMIAWPLFSDQKMNATLLNEELGIAIRSKKVPSEGVISRVEI  424

Query  1422  KTLVKIMLQSKKGKEMRERVVKLK-MSSEKAISI-GGSSYNSMCEVLNAIEKR  1574
             + LV+ ++   +G  MRERV KL+  ++E ++S  GG ++ S+  V +  E R
Sbjct  425   EALVRRIMVEGEGCMMRERVKKLRDTTTETSMSCDGGWAHESLSRVADECEHR  477



>emb|CDP07557.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   420 bits (1080),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 210/462 (45%), Positives = 308/462 (67%), Gaps = 3/462 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +L SPG+GHI P    A RL   H + ++  VIT   S  + QL +S D+ + +  V
Sbjct  10    HIALLPSPGMGHITPLFEFAKRLVTNHGIPVSFLVITADASAAQTQLFQSPDIPAGICIV  69

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              IPPVD+S +++ NT  +++ CL V+ +L  +R+ L +   ++  L+VD F ++A+ +A 
Sbjct  70    NIPPVDMSNVINENTLVLSRGCLTVQESLKPLRSILVEVKPKV--LIVDLFTSQAIEVAR  127

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             EL++  + +   +A   A ++Y P LDRE+ G+YV+  + +++PG +P R ED++D + +
Sbjct  128   ELSISVYSFYTASAGLLAFSLYLPTLDREVEGEYVDLLEPIKVPGTRPQRIEDLLDQVRN  187

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R   +Y+ +L       + DGIL N+WED++P++LKA+RE+E    V   PVY IGPL +
Sbjct  188   RKIDEYKWFLFHMSRLALVDGILENSWEDLEPLSLKAVREHEYYKTVQAPPVYPIGPLIK  247

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
               +E   D    I  WL  QP +SVL+V+FGSGGTL++EQ+TELAWGLE+SEQRFI V R
Sbjct  248   P-DEFITDKDARIFTWLDNQPADSVLFVAFGSGGTLTSEQLTELAWGLEMSEQRFILVAR  306

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
              PS   +  AFF  G   +    YLPEGF  RTQ  GL+V  W  QA IL H S+G FLS
Sbjct  307   NPSDASASAAFFNVGGDQNDPSTYLPEGFAERTQGVGLIVHSWVPQAAILGHSSSGAFLS  366

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NS+LES+ +GVPI+AWPLY+EQR NATLL E VGVA++P+  P K +V REE++ +
Sbjct  367   HCGWNSSLESLSHGVPILAWPLYAEQRMNATLLEEGVGVAVKPVVQPGKKVVGREEIERV  426

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
             V+++++ ++GK MR R  +LK  ++ A+S GGSSYNS+C+V+
Sbjct  427   VRLIMEGEEGKVMRRRAKQLKEKADTALSCGGSSYNSVCQVV  468



>gb|KCW44779.1| hypothetical protein EUGRSUZ_L01660 [Eucalyptus grandis]
Length=505

 Score =   421 bits (1081),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 217/462 (47%), Positives = 309/462 (67%), Gaps = 6/462 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH IP+L L   LA  H   +T+FV+    S TE  L +     + LN V
Sbjct  7     HAVLLASPGMGHFIPALELGKHLATHHGFDVTIFVVAADASITESPLFKPPQTPNLLNLV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+SAL+++    V +L +++R ALP ++AA++    R  AL+VD F TEAL +A+
Sbjct  67    LLPPVDVSALVNSTASVVTRLVIMMREALPLLQAAISSMKSRPTALIVDMFGTEALAIAE  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V++ + A F A+TV+ P +D E   ++   ++ L++PGC+ +R ED +D   D
Sbjct  127   EFDMLKYVFITSTAWFLAVTVHFPYIDEEAEHKHRVMKRPLDVPGCRSIRHEDTLDLFFD  186

Query  711   RNDVQ-YREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             + D   +  + R+G+    ADGIL+NTW+D++P TL+AL   + L +VV   VY +GPL 
Sbjct  187   QTDRNLFSGFARIGMEISNADGILVNTWQDLEPSTLRALENEKFLGRVVKASVYPVGPLV  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R + +    +   +M WL  QP ESV+YVSFGSGGTLSA+Q TELAWGLELS QRF+WVV
Sbjct  247   RPVGQSSKSE---VMDWLDMQPMESVIYVSFGSGGTLSAKQTTELAWGLELS-QRFVWVV  302

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +   FF      DGTP+YLP GF TR +N+G+VV MWA Q  IL H S GGFL
Sbjct  303   RPPVDGDASANFFNVTNSHDGTPSYLPSGFFTRIRNKGMVVLMWASQTEILAHKSIGGFL  362

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLES+ NGVP++ WPLY+EQ+ NA +L EE+ VA+RP   P  G++ REE+  
Sbjct  363   SHCGWNSTLESMVNGVPMVVWPLYAEQQMNAAMLAEELKVAVRPKIQPNAGVIEREEIAG  422

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             +V+ +++  KG EMR++V +L+ S+ +A+  GGSSYNS+  V
Sbjct  423   MVRRVME-LKGNEMRDKVKELQRSAHQALMQGGSSYNSLERV  463



>gb|AFJ52922.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=491

 Score =   419 bits (1078),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 217/491 (44%), Positives = 317/491 (65%), Gaps = 8/491 (2%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             M ++     H+ +L+SPG+GH+IP L L   L   H++ +T+FV++T D+ T + LL++ 
Sbjct  1     MQSSGAGRPHVALLASPGMGHLIPVLELGKHLIANHDISITIFVVST-DAATSKSLLKTC  59

Query  324   DLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFF  503
               T+ L+ V +PPVDISA ++ +   V +L ++++ ++  +R+A++       ALVVD F
Sbjct  60    PNTANLSIVPLPPVDISAHVEPSDHFVTKLIVMMQQSVSNLRSAISLMRTPPSALVVDIF  119

Query  504   CTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRP  683
              TE+  +ADE  + K+ ++ T A F A+TVY  V + E+V ++V  +K L +PGCKP+R 
Sbjct  120   GTESFSVADEFGMLKYAFITTTASFLAVTVYGGVTEHEVV-EHVTLKKPLHVPGCKPIRF  178

Query  684   EDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP  863
             ED +   LD  D  + +  +LG GF +ADGIL+NTWE ++  TL ALR  + L  +V  P
Sbjct  179   EDTLHAYLDYGDRVFDDAQKLGAGFALADGILINTWESLEVQTLAALRSEKHLKNIVKAP  238

Query  864   VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELS  1043
             VY +GPL R        +   +++WL +QP ESV+YVSFGSGGTLS  Q+ ELAWGLELS
Sbjct  239   VYPVGPLVRPSPPTGSTENNTVLEWLDEQPSESVIYVSFGSGGTLSRAQMAELAWGLELS  298

Query  1044  EQRFIWVVRPPSMRGSDDAFFTTGQG--ADGTPNYLPEGFNTRTQNQGLVVPMWAEQALI  1217
               RFIWVVRPP    +  AFF+ G+   +DG   YLP GF  RT+++G+VVPMWA Q  I
Sbjct  299   GHRFIWVVRPPVDDDASAAFFSLGKASESDGAQRYLPGGFIARTKDRGMVVPMWAPQTEI  358

Query  1218  LRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRP-MKLPT  1394
             L H S G F+SHCG NSTLESI NGVP++ WPLY+EQ  NA LLTEE+ VA+RP +    
Sbjct  359   LAHESVGAFVSHCGWNSTLESITNGVPMVVWPLYAEQNLNAVLLTEELRVAVRPAVNEDV  418

Query  1395  KGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAIS--IGGSSYNSMCEVLNAIE  1568
              G+V R E++ LV+ +++ ++GK +RERV ++      A+S  + GSS+ ++ +V    E
Sbjct  419   GGVVKRGEIENLVRKVMEGEEGKGIRERVKEVMEDGGSALSRKLNGSSFRALEKVAGECE  478

Query  1569  -KRRDLKICTQ  1598
                R +K   Q
Sbjct  479   WNHRRVKAKAQ  489



>gb|AFJ52921.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=491

 Score =   419 bits (1078),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 214/480 (45%), Positives = 315/480 (66%), Gaps = 7/480 (1%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             M ++     H+ +L+SPG+GH+IP L L  RL   H++ +T+FV++T D+ T + LL++ 
Sbjct  1     MQSSGAGRPHVALLASPGMGHLIPVLELGKRLIANHDISITIFVVST-DAATSKSLLKTC  59

Query  324   DLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFF  503
               T+ L+ V +PPVDISA ++ +   V +L ++++ ++  +R+A++       AL+VD F
Sbjct  60    PSTTNLSIVPLPPVDISAHVEPSDHFVTKLIVMMQQSVSNLRSAISLMRTPPAALIVDIF  119

Query  504   CTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRP  683
               ++  +ADE  + K+ ++ T A F A+TVY  V + E+V ++V  +K L +PGC P+R 
Sbjct  120   GADSFSVADEFGMLKYAFITTTASFLAVTVYGGVSEDEVV-EHVTLKKPLHVPGCNPIRF  178

Query  684   EDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP  863
             ED +   LD  D  + E  +LG GF +ADGIL+NTWED++  TL ALR  + L  +V  P
Sbjct  179   EDTLHAYLDYGDRVFDEAQKLGAGFALADGILINTWEDLEVQTLAALRSEKHLKNIVKAP  238

Query  864   VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELS  1043
             VY +GPL R  +     +   +++WL +QP ESV+YVSFGSGGTLS  Q+ ELAWGLELS
Sbjct  239   VYPVGPLVRPSQPTGSTENNTVLEWLDEQPSESVIYVSFGSGGTLSRAQMVELAWGLELS  298

Query  1044  EQRFIWVVRPPSMRGSDDAFFTTGQG--ADGTPNYLPEGFNTRTQNQGLVVPMWAEQALI  1217
               RFIWVVRPP    +  AFF+ G+   +DG   YLPEGF  RT ++G+VVPMWA QA I
Sbjct  299   GHRFIWVVRPPVDDDASAAFFSLGKASESDGPQRYLPEGFIARTNDRGMVVPMWAPQAEI  358

Query  1218  LRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRP-MKLPT  1394
             L H S G F+SHCG NSTLESI NGVP++ WPLY+EQ  NA LLTEE+ VA+RP +    
Sbjct  359   LAHESVGAFVSHCGWNSTLESITNGVPMVVWPLYAEQNLNAVLLTEELRVAVRPAVNDDV  418

Query  1395  KGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAIS--IGGSSYNSMCEVLNAIE  1568
              G+V R E++ LV+ +++ ++G+ +RERV ++      A+S  + GSS+ ++ +V    E
Sbjct  419   GGVVKRGEIENLVRKVMEGEEGQCIRERVKEVMEDGGSALSRKLNGSSFRALEKVAGECE  478



>ref|XP_004301886.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   417 bits (1071),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 217/462 (47%), Positives = 306/462 (66%), Gaps = 9/462 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  ++ SPG+GH+IP L LA  LA  HN   TV V+++  SP   Q+++S+   + L+ V
Sbjct  6     HALVVPSPGMGHLIPLLELATCLATHHNFHATVLVVSSNPSPALSQVIQSAKAQNLLDIV  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P        +A       L  ++R     +R+A++    +  A+ VD F   A  +A+
Sbjct  66    ELP-APSGHDTNAAGSVFTHLPAIMRDVRSSLRSAISAMENKPSAMFVDLFGPAAFTVAE  124

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V +  +A   +L +Y PVLD++I G+Y++Q++ L+IPGCKPVRPEDVV PM++
Sbjct  125   EFHMLKYVAL-GSAWTLSLLLYAPVLDKQIEGEYLDQKELLKIPGCKPVRPEDVVKPMMN  183

Query  711   RNDVQYREYLRLGVGF-GMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             R D +Y  ++R+G+    M+DGIL+NTWED++P  LK +RE+    K+V  P+Y+IGP+ 
Sbjct  184   RKDQEYESFIRIGLEIPSMSDGILINTWEDLEPTCLKTMREHPEWKKIVKIPLYSIGPMV  243

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R   +  G   + ++ WL KQP ESVLY+SFGSGG LSAEQI E+AWGLE S+QRFIWVV
Sbjct  244   RLAGQSGGGRRSELLDWLDKQPGESVLYISFGSGGVLSAEQIIEMAWGLEFSKQRFIWVV  303

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             +PPS  G   A     +G D +  YLPEGF  RT ++GLVV  WA Q+ IL H S GGFL
Sbjct  304   QPPSRGGGGGA-----KGNDMS-EYLPEGFMARTHDKGLVVTTWAPQSEILAHSSVGGFL  357

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NS LESI NG+P+IAWPLY+EQ+  ATLL EE+ VAIRP  LPTK +  REE++ 
Sbjct  358   SHCGWNSALESIMNGLPMIAWPLYAEQKMVATLLVEELKVAIRPKVLPTKQVAGREEIEM  417

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             LV+ +++  +G  MR R  +LK S EKA+ +GGSS+  + E+
Sbjct  418   LVRKIMEQTEGDAMRRRTKELKASGEKALGVGGSSFIMLSEL  459



>ref|XP_007047015.1| Anthocyanidin 3-O-glucosyltransferase 5 [Theobroma cacao]
 gb|EOX91172.1| Anthocyanidin 3-O-glucosyltransferase 5 [Theobroma cacao]
Length=473

 Score =   416 bits (1070),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 211/483 (44%), Positives = 310/483 (64%), Gaps = 13/483 (3%)
 Frame = +3

Query  138   IIMDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTE-RQLL  314
             +++ N N    H+ +LSSP   H  P++ L  RL    +VK+TVFV     +     + +
Sbjct  1     MVLSNKNP---HLVLLSSPA--HPTPTIELGKRLVTCQSVKVTVFVSCFVKAAAAVSKTI  55

Query  315   ESSDLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVV  494
              S   T   + + +PP DIS L++     +  +   VR   P   +A++       AL+V
Sbjct  56    GSIPKTELFDVIQLPPADISGLVEPGHTGLTAVVSGVRVTKPAFLSAISALETPPTALIV  115

Query  495   DFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKP  674
               +  E L +ADEL +PK+VY  ++A + AL +Y PVLD E+ G+Y ++++   +PGC P
Sbjct  116   HVYAIECLKIADELKIPKYVYTCSHAWYLALILYTPVLDEEVGGEYADKKEPFLLPGCTP  175

Query  675   VRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVV  854
             VRPED+ DPM+ +    Y E+L++G+ F   DGIL+NTWE++ P TL ALR+ + L  +V
Sbjct  176   VRPEDLPDPMIVQTKKDYLEFLQIGLDFPKVDGILVNTWEELQPKTLAALRDYQLLGSIV  235

Query  855   GKPVYAIGPLTRNIEERDGDDG--TMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAW  1028
               P++ IGP+       +G  G  + +  WL KQP  SVLY+SFGS G LS EQ+TEL+W
Sbjct  236   KAPIFPIGPIAT-----EGTAGLKSELFYWLDKQPSGSVLYISFGSMGGLSVEQMTELSW  290

Query  1029  GLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQ  1208
             GLEL++QRFIWVVRPP  +    +    G  AD   +Y+PEGF +RT+++G+VVP WA Q
Sbjct  291   GLELTQQRFIWVVRPPMAKTGSGSAPKFGHNADDMSSYVPEGFISRTRDRGVVVPHWAPQ  350

Query  1209  ALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKL  1388
               IL HPS GGF +HCG NS +E I NG+P+IAWPLY+EQR NATLLTEE+G+A+R   +
Sbjct  351   VQILSHPSCGGFFTHCGWNSAIECIINGLPMIAWPLYAEQRMNATLLTEELGIAVRSQTI  410

Query  1389  PTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             P+KG+V REEV T+V+ +   ++G+++R RV +LK+ ++KA S GGSSY ++ E++   +
Sbjct  411   PSKGVVGREEVATMVRKIFVDEEGRKIRGRVKELKLGADKAWSHGGSSYEALHEMVKHCQ  470

Query  1569  KRR  1577
             K R
Sbjct  471   KSR  473



>ref|XP_006387833.1| hypothetical protein POPTR_0535s00230g [Populus trichocarpa]
 gb|ERP46747.1| hypothetical protein POPTR_0535s00230g [Populus trichocarpa]
Length=466

 Score =   415 bits (1067),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 221/449 (49%), Positives = 290/449 (65%), Gaps = 16/449 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +LSSPG+GH+IP L L  RL   H   +T+FV     SP         DL   LN V
Sbjct  7     HAALLSSPGMGHLIPVLELGKRLVTNHGFTVTIFV-NCQQSP-------CPDL---LNIV  55

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S+L+   T  +AQL +++R ALP +R+A+         L+VDFF TEA+ +AD
Sbjct  56    LLPPVDVSSLITPTTGILAQLAIMMREALPKLRSAILAMEFCPTVLIVDFFGTEAMVIAD  115

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+ K+ ++ + A F ALT++ P +D+ I   +V+ ++ L IPGCK +   D  +P+LD
Sbjct  116   EFNMLKYAFMTSTAWFLALTLHMPAIDKAIEDNHVKNQQALLIPGCKSLEFRDTFEPVLD  175

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             RND  Y EY R+GV     DGIL+NTW+D++  TL AL + + L +V   P+Y +GPL R
Sbjct  176   RNDQMYIEYKRMGVEMQKFDGILVNTWQDLEGTTLGALEDEKRLGRVAQVPIYPVGPLVR  235

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              I      +   +++WL  QP ESV+YVSFGSGG LSA Q TELA GLE S QRFIWVVR
Sbjct  236   AITPGPKSE---MLEWLDMQPIESVIYVSFGSGGALSARQTTELACGLESSGQRFIWVVR  292

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    S    F T    D TP++LP+GF TRT+  GLVVPMWA Q  IL HPS GGF+S
Sbjct  293   PPIEGDSAATVFKTKHRTDDTPDFLPDGFLTRTRKMGLVVPMWAPQTEILSHPSVGGFVS  352

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             H G NSTLESI NGVP+I WPLY+EQ  NA +LTE++GVAIR   LP K +V REE++T+
Sbjct  353   HGGWNSTLESIVNGVPMITWPLYAEQGMNAAMLTEDIGVAIRSKSLPAKEVVVREEIETM  412

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAIS  1517
             V+ ++   KG   R R   LK S+EKA+S
Sbjct  413   VRTIMD--KGDARRARAKTLKSSAEKALS  439



>ref|XP_011031500.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Populus 
euphratica]
Length=475

 Score =   415 bits (1067),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 205/466 (44%), Positives = 303/466 (65%), Gaps = 5/466 (1%)
 Frame = +3

Query  153   NNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDL  329
             N  +  HI ++ SPGIGHI P L +A RL  +H+  ++  VI T + S  +  LL+SS L
Sbjct  6     NETTKPHIAVMPSPGIGHITPLLEIAKRLVVLHDFHVSFIVIATNEASAGQSNLLQSSTL  65

Query  330   TSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCT  509
                L+ V +PPVD+ A+        A+LC +V  A+  +++ L  +   + A+VVD FCT
Sbjct  66    PPGLDVVYLPPVDVFAVTTNGMPLAARLCAIVVEAIKSLKSVLV-ELGEIKAVVVDLFCT  124

Query  510   EALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPED  689
             +A  +  EL++P +++   +      ++Y P LDRE+ G++V+  + +++PGC P+RPED
Sbjct  125   QAFDICSELSIPAYLFFTASIALLNFSLYLPTLDREVEGEFVDLLEPVKVPGCPPIRPED  184

Query  690   VVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVY  869
             ++D + +R   +Y+ YL     F +A GI +N+WE ++P   KA+ E+    ++   PV+
Sbjct  185   LLDQVKNRKIDEYKWYLFHSSRFHLAAGIFLNSWEGLEPANFKAITEDPFFKQIHTPPVH  244

Query  870   AIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQ  1049
              +GPL +  E     D    + WL KQP  SVL+VS GSGGTL+ EQ+TELAWGLELS Q
Sbjct  245   PVGPLIKLEEPLTASDAD-CLAWLDKQPPNSVLFVSLGSGGTLTVEQLTELAWGLELSHQ  303

Query  1050  RFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             RFI+VVR P+   +  AFF  G   +    YLP GF  RTQ +GLVVP WA Q L+L+HP
Sbjct  304   RFIFVVRMPTNSSASSAFFNAGSDFNDPKTYLPTGFLERTQERGLVVPSWAPQVLVLKHP  363

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVT  1409
             STGGFL+HCG NSTLE++ +G+P+IAWPLY+EQR NAT+L EE+G+AI+P+  P   +V 
Sbjct  364   STGGFLTHCGWNSTLEAVTHGIPMIAWPLYAEQRMNATILAEEIGIAIKPVAEPGASLVG  423

Query  1410  REEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMC  1547
             REEV+ +V++ +   +GKEMR++   LK  + KA+ IGGSS++S+ 
Sbjct  424   REEVERVVRLAIL--EGKEMRKKTEGLKDGAAKAMEIGGSSFDSLA  467



>gb|ADV71360.1| glycosyltransferase GT01K01 [Pueraria montana var. lobata]
Length=481

 Score =   415 bits (1066),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 207/465 (45%), Positives = 305/465 (66%), Gaps = 5/465 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP + L  RL   H + +T+FV+TT  + T  Q+L+ +   + LN +
Sbjct  7     HAALLASPGMGHLIPMVELGKRLLTHHGLHVTIFVVTTDSAATTSQILQQTSNLTSLNII  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAAL--TKQCRRLDALVVDFFCTEALPM  524
              +PP+D+S  L  N     ++ L +  +LP VR+++  T       AL+VD F   A PM
Sbjct  67    HVPPIDVSDKLPPNPPLAIRILLTMLESLPFVRSSILSTTNLPPPSALIVDMFGLAAFPM  126

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A +L +  +VY  T+A F+A+T+Y P +D++++  + E  + L +PGC+ V  ED ++P 
Sbjct  127   ARDLGMLIYVYFATSAWFSAVTLYFPAMDKKLIESHAENHEPLMVPGCEAVLFEDTLEPF  186

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             L      Y  YL        ADGILMNTW+D++P   KA+RE+  L +    PV+A+GPL
Sbjct  187   LSPGGEMYEGYLTAAKEIVTADGILMNTWQDLEPAATKAVREDGILGRFTKGPVHAVGPL  246

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R +E +  D    +++WL  QP +SV+YVSFGSGGT+S +Q+ E+A GLELS+QRF+WV
Sbjct  247   VRTVETKPEDGKDAVLRWLDGQPADSVIYVSFGSGGTMSEDQMREVALGLELSQQRFVWV  306

Query  1065  VRPPSMRGSDDAFF--TTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             VRPP    +  +FF    G G     NYLPEGF  RT+  G+VVPMWA QA IL HP+TG
Sbjct  307   VRPPCEGDASGSFFDVANGGGDVAALNYLPEGFVKRTEGVGVVVPMWAPQAEILGHPATG  366

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GF++HCG NS LES+ NGVP++AWPLY+EQ+ NA +L+EE+GVA+R +     G+V  E+
Sbjct  367   GFVTHCGWNSVLESVLNGVPMVAWPLYAEQKMNAFMLSEELGVAVR-VAEEGGGVVRGEQ  425

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             V  LV+ ++  K+G  MR++V +LK+S EKA++  GSS++S+CE+
Sbjct  426   VAELVRRVMVDKEGVGMRKKVKELKLSGEKALTKFGSSHHSLCEM  470



>ref|XP_002866746.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH43005.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=481

 Score =   415 bits (1066),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/471 (43%), Positives = 320/471 (68%), Gaps = 12/471 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + SSPG+GH+IP + LA RL+  H   +TVFV+ T  +  + + L S+ +    + V
Sbjct  7     HAAMFSSPGMGHVIPVIELAKRLSANHGFHVTVFVLETDAASAQSKFLNSTGV----DIV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  DIS L+D +   V ++ +++R A+P +R+ +    ++  AL++D F T+AL +  
Sbjct  63    NLPSPDISGLVDPDDHVVTKIGVIMREAVPALRSKIASMHQKPTALIIDLFGTDALCLGT  122

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             ELN+  ++++ +NAR+  +++Y P LD++I  ++  Q K L +PGC+PV+ ED +D  L 
Sbjct  123   ELNMLTYLFIASNARYLGVSIYYPTLDKDIKEEHTVQRKPLAVPGCEPVKFEDTMDAYLV  182

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  YR+ +R  + +  ADGIL+NTWE+++P +LK+L++ + L +V   PVY +GPL R
Sbjct  183   PDEPVYRDLVRHCLAYPKADGILVNTWEEMEPKSLKSLQDPKLLGRVARVPVYPVGPLCR  242

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              I+    D    +  WL++QP ESVLY+SFGSGG+L+A+Q+TELAWGLE S+QRF+WVVR
Sbjct  243   PIQSSKTDHP--VFDWLNEQPNESVLYISFGSGGSLTAKQLTELAWGLEHSQQRFVWVVR  300

Query  1071  PPSMRGSDDAFFTT--GQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             PP    S   +F+   G+  D TP YLPEGF TRT ++G V+P WA QA IL H + GGF
Sbjct  301   PPVDGSSCSEYFSANGGETKDNTPEYLPEGFVTRTCDRGFVIPSWAPQAEILAHQAVGGF  360

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG +STLES+  GVP+IAWPL++EQ  NA LL++E+G+A+R +  P + I +R +++
Sbjct  361   LTHCGWSSTLESVLGGVPMIAWPLFAEQNMNAALLSDELGIAVR-VDDPKEAI-SRSKIE  418

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNAIEK  1571
              +V+ ++  K+G+EMR +V KL+ ++E ++SI  GGS++ S+C V    ++
Sbjct  419   AMVRKVMAEKEGEEMRRKVKKLRDTAEMSLSIDGGGSAHESLCRVTKECQR  469



>gb|KCW58582.1| hypothetical protein EUGRSUZ_H01240 [Eucalyptus grandis]
Length=367

 Score =   409 bits (1050),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 253/350 (72%), Gaps = 4/350 (1%)
 Frame = +3

Query  501   FCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVR  680
             F  E L + DEL +PK+V+VP+NA F AL +Y P LD+E+ G+YV + + LEI GCKPVR
Sbjct  2     FGAEYLCIGDELGIPKYVFVPSNAWFLALFIYSPALDKEVKGEYVNRTEPLEIRGCKPVR  61

Query  681   PEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGK  860
             PEDVVD MLDR+D QY EY+++       DGIL+N WED+   TL  LR  E L +VV  
Sbjct  62    PEDVVDSMLDRSDQQYHEYVQMAGEIPTGDGILLNVWEDLQAETLTVLRNEEFLGRVVNG  121

Query  861   PVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLEL  1040
             PVY  GPLTR +  R    G  +++WL KQP ESV++VSFGSGGT+SAEQ  ELAWGLEL
Sbjct  122   PVYTAGPLTRPV--RPAGLGKELLEWLDKQPSESVMFVSFGSGGTMSAEQQVELAWGLEL  179

Query  1041  SEQRFIWVVRPPSMRGSDDAFFTTGQG--ADGTPNYLPEGFNTRTQNQGLVVPMWAEQAL  1214
             S+QRFIWV+R P+++  D +FF  G+G   D   ++LP GF   T+  G ++P WA Q  
Sbjct  180   SQQRFIWVLRQPTVKALDGSFFDVGKGDAGDEVLSFLPSGFTAHTRGIGFILPSWASQVE  239

Query  1215  ILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT  1394
             IL HPS GGFLSHCG NSTLESI NGVP+IAWPLY+EQR N TLLTEE+GVA+RP  LP+
Sbjct  240   ILSHPSVGGFLSHCGWNSTLESIVNGVPMIAWPLYAEQRLNVTLLTEEIGVAVRPKVLPS  299

Query  1395  KGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             K IV REE++ LV+ ++  K+G  +R+RV  LK S++KA++ GGSSY S+
Sbjct  300   KKIVGREEIEKLVRTIMVEKEGHTLRDRVRDLKSSAQKAMARGGSSYESL  349



>ref|NP_201470.1| UDP-glycosyltransferase 72E2 [Arabidopsis thaliana]
 sp|Q9LVR1.1|U72E2_ARATH RecName: Full=UDP-glycosyltransferase 72E2; AltName: Full=Hydroxycinnamate 
4-beta-glucosyltransferase [Arabidopsis thaliana]
 dbj|BAA97275.1| UTP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAL32714.1| UTP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAL47362.1| UTP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AED98252.1| UDP-glycosyltransferase 72E2 [Arabidopsis thaliana]
 gb|AHL38566.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=481

 Score =   412 bits (1060),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/472 (44%), Positives = 319/472 (68%), Gaps = 14/472 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + SSPG+GH+IP + L  RL+  +   +TVFV+ T  +  + + L S+ +    + V
Sbjct  7     HAAMFSSPGMGHVIPVIELGKRLSANNGFHVTVFVLETDAASAQSKFLNSTGV----DIV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  DI  L+D +   V ++ +++RAA+P +R+ +    ++  AL+VD F T+AL +A 
Sbjct  63    KLPSPDIYGLVDPDDHVVTKIGVIMRAAVPALRSKIAAMHQKPTALIVDLFGTDALCLAK  122

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+  +V++PTNARF  +++Y P LD++I  ++  Q   L IPGC+PVR ED +D  L 
Sbjct  123   EFNMLSYVFIPTNARFLGVSIYYPNLDKDIKEEHTVQRNPLAIPGCEPVRFEDTLDAYLV  182

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  YR+++R G+ +  ADGIL+NTWE+++P +LK+L   + L +V   PVY IGPL R
Sbjct  183   PDEPVYRDFVRHGLAYPKADGILVNTWEEMEPKSLKSLLNPKLLGRVARVPVYPIGPLCR  242

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              I+  + D    ++ WL++QP ESVLY+SFGSGG LSA+Q+TELAWGLE S+QRF+WVVR
Sbjct  243   PIQSSETDHP--VLDWLNEQPNESVLYISFGSGGCLSAKQLTELAWGLEQSQQRFVWVVR  300

Query  1071  PPSMRGSDDAFFTTGQGA---DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             PP + GS  + + +  G    D TP YLPEGF +RT ++G VVP WA QA IL H + GG
Sbjct  301   PP-VDGSCCSEYVSANGGGTEDNTPEYLPEGFVSRTSDRGFVVPSWAPQAEILSHRAVGG  359

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG +STLES+  GVP+IAWPL++EQ  NA LL++E+G+A+R +  P + I +R ++
Sbjct  360   FLTHCGWSSTLESVVGGVPMIAWPLFAEQNMNAALLSDELGIAVR-LDDPKEDI-SRWKI  417

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNAIEK  1571
             + LV+ ++  K+G+ MR +V KL+ S+E ++SI  GG ++ S+C V    ++
Sbjct  418   EALVRKVMTEKEGEAMRRKVKKLRDSAEMSLSIDGGGLAHESLCRVTKECQR  469



>ref|XP_004301887.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Fragaria 
vesca subsp. vesca]
Length=480

 Score =   411 bits (1056),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 216/466 (46%), Positives = 306/466 (66%), Gaps = 15/466 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  ++ SP +GH+IP + LA+ L   HN  +TV  +++  SP   Q+++S+      + +
Sbjct  9     HALLVPSPMMGHLIPLMELASSLVTHHNFHVTVIAVSSNSSPELSQVIQSAKTKKLCDII  68

Query  351   GIP-PVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              +P P D ++ +  +      L  ++  A   +R+A++    +  A++VD F T AL +A
Sbjct  69    ELPAPSDQASNMAGSV--FTHLSAVMHDARSPLRSAISLLEVKPAAMIVDIFGTPALTVA  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             +E ++ K+V V + AR   L +Y PVLD++I G+Y+++E+ LEIPGCK VRPEDV  P++
Sbjct  127   EEFHMLKYVMVASCARPLTLLLYAPVLDKQIQGEYLDREELLEIPGCKAVRPEDVAKPLM  186

Query  708   DRNDVQYREYLRLGVGFG-MADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             +R D +Y  YLR       M+DGI++NTWED++  +LKA+RE+    K++  PVY IGPL
Sbjct  187   NRKDREYEAYLRKANDIASMSDGIMINTWEDLEAESLKAMREHPEWKKILQVPVYTIGPL  246

Query  885   TRNIEERDGDDG---TMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
              R+  +  G      + ++ WL KQPRESVLYV+FGS G LSAEQI E+AWGLELS+QRF
Sbjct  247   FRSAGQPGGGSTAPRSELLDWLDKQPRESVLYVAFGSMGVLSAEQIIEMAWGLELSKQRF  306

Query  1056  IWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             IWVV PPS R  D       +G D    YLPEGF  RT   G+VV  WA Q+ IL H S 
Sbjct  307   IWVVHPPSKRSGD-------KGND-ISEYLPEGFMARTHETGVVVTTWAPQSEILAHSSV  358

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GG LSHCG NS++ESI NGVP+IAWPLY+EQ   AT L EE+ VAI+P +LP K +  RE
Sbjct  359   GGTLSHCGWNSSVESILNGVPMIAWPLYAEQTMIATQLVEELKVAIKPKELPAKAVAGRE  418

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             E++ LV+ +++ K+G EMR RV +LK+S EKA+S GGSS+N + E+
Sbjct  419   EIEMLVRKIMKEKEGDEMRARVKELKVSGEKALSEGGSSFNMLSEL  464



>ref|NP_198003.1| UDP-glycosyltransferase 72E3 [Arabidopsis thaliana]
 sp|O81498.1|U72E3_ARATH RecName: Full=UDP-glycosyltransferase 72E3; AltName: Full=Hydroxycinnamate 
4-beta-glucosyltransferase [Arabidopsis thaliana]
 gb|AAC26233.1| contains similarity to UDP-glucoronosyl and UDP-glucosyl transferases 
(Pfam: UDPGT.hmm, score: 85.94) [Arabidopsis thaliana]
 gb|ABO38789.1| At5g26310 [Arabidopsis thaliana]
 gb|AED93550.1| UDP-glycosyltransferase 72E3 [Arabidopsis thaliana]
 gb|AHL38603.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=481

 Score =   410 bits (1055),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 205/471 (44%), Positives = 317/471 (67%), Gaps = 12/471 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + SSPG+GH++P + LA RL+  H   +TVFV+ T  +  + +LL S+ +    + V
Sbjct  7     HAAMFSSPGMGHVLPVIELAKRLSANHGFHVTVFVLETDAASVQSKLLNSTGV----DIV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  DIS L+D N   V ++ +++R A+P +R+ +    +   AL++D F T+AL +A 
Sbjct  63    NLPSPDISGLVDPNAHVVTKIGVIMREAVPTLRSKIVAMHQNPTALIIDLFGTDALCLAA  122

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             ELN+  +V++ +NAR+  +++Y P LD  I  ++  Q K L IPGC+PVR ED++D  L 
Sbjct  123   ELNMLTYVFIASNARYLGVSIYYPTLDEVIKEEHTVQRKPLTIPGCEPVRFEDIMDAYLV  182

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  Y + +R  + +  ADGIL+NTWE+++P +LK+L++ + L +V   PVY +GPL R
Sbjct  183   PDEPVYHDLVRHCLAYPKADGILVNTWEEMEPKSLKSLQDPKLLGRVARVPVYPVGPLCR  242

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              I+    D    +  WL+KQP ESVLY+SFGSGG+L+A+Q+TELAWGLE S+QRFIWVVR
Sbjct  243   PIQSSTTDHP--VFDWLNKQPNESVLYISFGSGGSLTAQQLTELAWGLEESQQRFIWVVR  300

Query  1071  PPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             PP    S   +F+   G   D TP YLPEGF TRT ++G ++P WA QA IL H + GGF
Sbjct  301   PPVDGSSCSDYFSAKGGVTKDNTPEYLPEGFVTRTCDRGFMIPSWAPQAEILAHQAVGGF  360

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG +STLES+  GVP+IAWPL++EQ  NA LL++E+G+++R +  P + I +R +++
Sbjct  361   LTHCGWSSTLESVLCGVPMIAWPLFAEQNMNAALLSDELGISVR-VDDPKEAI-SRSKIE  418

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNAIEK  1571
              +V+ ++   +G+EMR +V KL+ ++E ++SI  GGS++ S+C V    ++
Sbjct  419   AMVRKVMAEDEGEEMRRKVKKLRDTAEMSLSIHGGGSAHESLCRVTKECQR  469



>ref|XP_004301885.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Fragaria 
vesca subsp. vesca]
Length=480

 Score =   410 bits (1055),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 217/465 (47%), Positives = 302/465 (65%), Gaps = 12/465 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  ++ SP +GH+IP + LA+ L   HN  +TV V++   SP   ++++S+      + V
Sbjct  9     HALLVPSPMMGHLIPLMELASSLVTHHNFHVTVVVVSPNSSPELSKVIQSAKTKKLYDIV  68

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P      + +        L  L+  A+  +R+A++    +  A++VD F T AL +A+
Sbjct  69    ELPAPSSGHVSNMAGAVFTNLAALMLDAISSLRSAISVLEVKPAAMIVDIFGTPALTVAE  128

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E ++ K+V V + AR   + +Y PVLD +I G+Y++ E+ LEIPGCK VRPEDV  PM++
Sbjct  129   EFHMLKYVMVASCARPLTVLLYAPVLDTQIQGEYLDCEELLEIPGCKAVRPEDVAKPMMN  188

Query  711   RNDVQYREYLRLGVGFG-MADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             R D +Y  YLR       M+DGI++NTWED++  +LKA+RE+   +K++  PVY IGPL 
Sbjct  189   RKDREYGAYLRKANDIASMSDGIMINTWEDLEAKSLKAMREHPEWNKILKVPVYTIGPLF  248

Query  888   RNIEERDGDDGT---MIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             R+  +  G   T    ++ WL KQP+ESVLYV+FGS G LSAEQI E+AWGLELS+QRFI
Sbjct  249   RSAGQSSGGPTTPRSELLDWLDKQPKESVLYVAFGSMGVLSAEQIIEMAWGLELSKQRFI  308

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVV PPS R  D       +G D    YLPEGF  RT  +G+VV  WA Q+ IL H S G
Sbjct  309   WVVHPPSKRSGD-------KGND-ISEYLPEGFMARTHERGVVVTAWAPQSEILAHSSVG  360

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             G LSHCG NS++ESI NGVP+IAWPLY+EQ   AT L EE+ VAI+P +LPTK +  REE
Sbjct  361   GTLSHCGWNSSVESILNGVPMIAWPLYAEQTMIATQLVEELKVAIKPKELPTKAVAGREE  420

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             ++ LVK +++ K+G EMR RV +LK S EKA+S  GSS+N + E+
Sbjct  421   IEMLVKKIMEQKEGDEMRARVKELKASGEKALSKEGSSFNMLSEL  465



>ref|XP_008338753.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Malus 
domestica]
Length=471

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 211/465 (45%), Positives = 303/465 (65%), Gaps = 17/465 (4%)
 Frame = +3

Query  162   SMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRL  341
             S  H  IL SPG+GH+IP L L  +L    N  +T+F+      P+    L+++  T   
Sbjct  3     SKQHAAILCSPGMGHLIPVLELGKQLVTHQNFAVTIFIF-----PSSEAELKAATCTKIC  57

Query  342   NNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALP  521
             + V +P  D S       KP A L + +R      R+A+         L+VD F TE+ P
Sbjct  58    DIVQLPAPDTS-------KP-ANLIVKMRELRHVFRSAVCAMKFTPTMLIVDLFGTESFP  109

Query  522   MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPE-DVVD  698
             +A+EL +PK+++  +NA F +  + CP  D E+ G +V+ ++ L+IPGC+ +RP  DV+D
Sbjct  110   IAEELGIPKYLFFASNAWFLSFVICCPTFDMEVEGNFVDHKEPLKIPGCRELRPRLDVID  169

Query  699   PMLDRNDVQYREYLRLGVGF-GMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAI  875
              MLDR D +Y +++ +       +DGIL+NTW++++P+TL ALR+   L +    PVY I
Sbjct  170   IMLDRTDQRYHDFVGIASRIPKCSDGILLNTWKELEPITLAALRDENLLGRYSTVPVYPI  229

Query  876   GPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
             GP+ R   E +   G  +  WL KQP ESV++VSFGSGG LS EQ+ ELAWGLE S+QRF
Sbjct  230   GPIIRP-NESNRSVGK-VFDWLDKQPNESVIFVSFGSGGALSHEQMIELAWGLEFSQQRF  287

Query  1056  IWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             IWV+R P++  +D A+FTT    +G   YLPEGF  RT++ GLV+P+WA Q  IL HPS 
Sbjct  288   IWVIRSPTVTTADAAYFTTDGDVEGPLKYLPEGFIDRTKDLGLVIPLWAPQVEILSHPSV  347

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFLSHCG +STLES+ NGVP+IAWPL++EQR NATLLTEE+GVA+R    P K +V R+
Sbjct  348   GGFLSHCGWSSTLESLTNGVPMIAWPLFAEQRTNATLLTEELGVAVRSKVPPWKKVVERK  407

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             E++ +V++++  +KG  +RER+ KLK S+ KA+  GGSS+N++ +
Sbjct  408   EIEEMVRMIMVDQKGFVLRERMKKLKESAAKALEEGGSSHNALSQ  452



>ref|XP_009782200.1| PREDICTED: hydroquinone glucosyltransferase-like [Nicotiana sylvestris]
Length=488

 Score =   410 bits (1053),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/479 (43%), Positives = 305/479 (64%), Gaps = 11/479 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+  L SPG+GHIIP    A RL   H   ++ FVITT  S  + +L  S +L +  + V
Sbjct  17    HVAFLPSPGMGHIIPLFEFAKRLVINHGFHVSFFVITTGASAAQNELFRSDNLPTGFHAV  76

Query  351   GIPPVD-ISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              IPPV+ IS+    + + V +L ++VR +L    ++L     R  AL++D FCT+A  + 
Sbjct  77    EIPPVENISSFFTDDMRVVTRLSIIVRESLKQYLSSLLI-THRPKALIIDLFCTDAFEIC  135

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E+++P + +   +    A ++Y P LDRE+ G++V+  + ++ PGC P+ P D++D + 
Sbjct  136   KEVSIPVYSFFTASTLLMAFSLYLPTLDREVNGEFVDLPEPIQTPGCNPICPHDLLDQVK  195

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR + +Y+ YL       +A GI +N+W+D++PVTL+AL+EN     +   PV+ +GPL 
Sbjct  196   DRKNDEYKWYLLHVSRIPLAAGIFVNSWDDLEPVTLEALKENSFFQNIPIPPVHTLGPLI  255

Query  888   RNIE---ERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             +  E   E+D +    I+ WL  QP +SVL+V FGSGGTL++EQ+TELAWGLE+S QRFI
Sbjct  256   KQDEVVTEKDAE----ILTWLDNQPSDSVLFVVFGSGGTLTSEQLTELAWGLEMSHQRFI  311

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
              V R PS   +  A+F  G   +    YLPEGF  +T+ +GLVVP WA Q  IL HPSTG
Sbjct  312   LVARKPSDASASAAYFNVGSDENDPLMYLPEGFAKKTEGRGLVVPSWAPQVAILNHPSTG  371

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
              FLSHCG NSTLES+ +GVP+IAWPLY+EQR NA  L EEVGV ++    P + +++R+E
Sbjct  372   AFLSHCGWNSTLESVVHGVPMIAWPLYAEQRMNAAFLAEEVGVTMKFPVAPGEELISRKE  431

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKRRDLKICT  1595
             ++ +V+I+++ +KG  MR R  +LK S++ A+  GGSS +S+C V+     + D  +C+
Sbjct  432   IEKMVRIVMEGEKGMAMRRRAQELKESAKIALHNGGSSDDSLCRVVQFW--KSDQSLCS  488



>ref|XP_003611938.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES94896.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=493

 Score =   410 bits (1053),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 214/475 (45%), Positives = 307/475 (65%), Gaps = 9/475 (2%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             +H  +L+SPGIGH+IP++ L  RL   HN  +T+FV+TTA S +++         S LN+
Sbjct  6     IHSVLLASPGIGHLIPTIELGKRLTTHHNFDVTIFVVTTATSDSDKTKSHILQQISNLNS  65

Query  348   VGI---PPVDISALLDANTKPVA-QLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEA  515
             + I   PPVD+S  LD N   +  Q+ L +  +LP +R+ +         L+VD F T A
Sbjct  66    LDIIVTPPVDVSDKLDPNNPSLGLQIVLTMIESLPFIRSEIQSMKNPPSVLIVDIFGTAA  125

Query  516   LPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVV  695
              PMA EL++  +V+  TNA FTA+ +  P +  E   ++ +  + L I GC+PVR ED +
Sbjct  126   FPMARELHMSSYVFFATNAWFTAVNINLPFITDEAFSRHAKNHEPLSILGCEPVRFEDTL  185

Query  696   DPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAI  875
             +  +      ++ Y+ +       DGIL+NTW D++P   KA+ EN  L + V  PVY I
Sbjct  186   ETFVAPWGPIHKRYVEVTREIIAIDGILVNTWHDLEPGATKAVIENGVLGRFVKGPVYPI  245

Query  876   GPLTRNIE-ERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             GPL R  E E+ GD   +I+ WL +QP ESV+Y+SFGSGGT+S  Q+ ELA+GLELS+QR
Sbjct  246   GPLVRTGEPEKGGDSENLILSWLDQQPAESVIYLSFGSGGTMSKGQMRELAYGLELSQQR  305

Query  1053  FIWVVRPPSMRGSDDAFFTTGQGADGT--PNYLPEGFNTRTQNQGLVVPMWAEQALILRH  1226
             FIWVVR P+   +   FF    GADGT   +YLP+GF  RT++ GL VPMWA QA IL+H
Sbjct  306   FIWVVRRPTEDNASATFFNIA-GADGTIMVDYLPKGFLNRTKDVGLCVPMWAPQAEILKH  364

Query  1227  PSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMK-LPTKGI  1403
             PSTGGFL+HCG NS LESI NGVP++AWPLY+EQ+ NAT+L+EE+GVA++  K +   G+
Sbjct  365   PSTGGFLTHCGWNSVLESIHNGVPMVAWPLYAEQKMNATMLSEELGVAVKATKTVAEGGV  424

Query  1404  VTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
             V RE++  +++ ++   +G  MR +V + K+S EKA+S+ GSS+ S+C++    E
Sbjct  425   VCREKIAEVIRKVMVDDEGVAMRVKVKEYKVSGEKALSVFGSSHESLCKMAKDCE  479



>ref|XP_004293221.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   408 bits (1048),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 200/461 (43%), Positives = 297/461 (64%), Gaps = 2/461 (0%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ +L SPG+GHIIP L  A RL   H  +++   ITT  S  +  LL S  L S L+ +
Sbjct  14    HVAVLPSPGMGHIIPLLEFAKRLVVHHGFRVSFLNITTEASTAQTDLLHSPSLPSGLHVI  73

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PP D+S+L++     V +L ++V  +L  +++ L  Q  +  AL++D FCT+   +  
Sbjct  74    DLPPADVSSLVNDEMLVVHRLGVIVEESLRCLKSVLI-QLGKPKALIIDVFCTQGFDVGK  132

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             +L++P + +   +A F A T+Y P +DRE+ G++++  + +++PGC PVR ED++D + D
Sbjct  133   QLSIPVYSFFTPSAAFCAFTLYHPTMDREVEGEFIDLPEPVQVPGCSPVRTEDLLDQIRD  192

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R + +YR Y         A GI +NTWED +PV LKA+REN    K++  P+Y IGPL +
Sbjct  193   RKNDEYRYYFGHVSRLCEASGIFLNTWEDFEPVPLKAIRENPFYQKILTPPIYPIGPLIK  252

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
               +     D    + WL +QP +SVL++  GSGGTL+A Q+TE AWGLE S+QRFIWVVR
Sbjct  253   EHDPLTKADAE-CLAWLDQQPPDSVLFIVPGSGGTLTAAQLTEFAWGLERSQQRFIWVVR  311

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
              P+   +   FF  G   +    YLPEGF  RT+  GLVV  WA Q   LRH STGGFLS
Sbjct  312   KPTDASASATFFNVGGDVNDPKAYLPEGFVERTRGVGLVVRSWASQVAFLRHRSTGGFLS  371

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NS+LES+  G+P+IAWPLY+EQR NAT+L EEVGVA++ +K   + ++ REE++ +
Sbjct  372   HCGWNSSLESMTCGIPMIAWPLYAEQRANATMLAEEVGVAVKAVKSKGQTVIGREEIERV  431

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             V+++++ ++GK MR +  KL+ S+ +A+  GGSS+ S+  V
Sbjct  432   VRLLMEGEEGKVMRSKAKKLQESAARALESGGSSWESLTRV  472



>ref|XP_006495100.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Citrus 
sinensis]
Length=476

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 213/468 (46%), Positives = 304/468 (65%), Gaps = 9/468 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDLTSRLNN  347
             H+ +L SPG+GH+IP L  A RL   H V ++  VITT + S  +  LL S  L   L+ 
Sbjct  9     HVAVLPSPGLGHLIPLLEFAKRLVLNHGVHVSFLVITTNEASAAKNNLLRS--LPHGLDV  66

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALP-GVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +PPVD+SA+   +   V +L  +V  +L   +++ LT+ C   +ALV+D FCT+A  +
Sbjct  67    VDLPPVDVSAVTSDDMPVVTRLHAIVEESLSKSLKSVLTELCNP-NALVIDLFCTQAFEI  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
               +L++P + +V T+  F A   Y P LDRE+ G++V+  + ++IPGC PVRPED++D +
Sbjct  126   CSQLSIPTYSFVTTSVHFFAFITYLPTLDREVQGEFVDLPEPIKIPGCPPVRPEDLLDQV  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
              +R   +Y+ +L       +A GI +N+WE+++ V LKA+RE+    ++   P+Y IGPL
Sbjct  186   RNRKIDEYKFFLLHVSRLPLAAGIFLNSWENLEFVPLKAIREHSFYLQIPTPPIYPIGPL  245

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              +  E     D    + WL KQP +SVL+   GSGGTL+AEQ+TE+AWGLE S+QRFIWV
Sbjct  246   IKEDEPLSASDEE-CLAWLDKQPPDSVLFAVPGSGGTLTAEQVTEMAWGLEQSKQRFIWV  304

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGF--NTRTQNQGLVVPMWAEQALILRHPSTG  1238
             VR PS   +   FF  G   +    YLPEGF   TR Q  G+VVP WA Q  ILRHPSTG
Sbjct  305   VRMPSDASASATFFNVGSDVNDPKAYLPEGFLQRTRAQGAGMVVPSWAPQVHILRHPSTG  364

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLT-EEVGVAIRPMKLPTKGIVTRE  1415
             GFLSHCG NSTLESI +GVP+IAWPLY+EQR NA +LT EE GVA++P   P K ++ RE
Sbjct  365   GFLSHCGWNSTLESICHGVPMIAWPLYAEQRMNAAMLTAEETGVAVKPEIEPGKKVIGRE  424

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             E++ +V+++++ ++GK MR RV +LK S+ + +  GGSS +S+   + 
Sbjct  425   EIERVVRLVMEGEEGKVMRRRVQELKESASRELGDGGSSSDSLASFIK  472



>ref|XP_006433446.1| hypothetical protein CICLE_v10001013mg [Citrus clementina]
 gb|ESR46686.1| hypothetical protein CICLE_v10001013mg [Citrus clementina]
Length=477

 Score =   407 bits (1046),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 213/468 (46%), Positives = 304/468 (65%), Gaps = 9/468 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDLTSRLNN  347
             H+ +L SPG+GH+IP L  A RL   H V ++  VITT + S  +  LL S  L   L+ 
Sbjct  10    HVAVLPSPGLGHLIPLLEFAKRLVLNHGVHVSFLVITTNEASAAKNNLLRS--LPHGLDV  67

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALP-GVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +PPVD+SA+   +   V +L  +V  +L   +++ LT+ C   +ALV+D FCT+A  +
Sbjct  68    VDLPPVDVSAVTSDDMPVVTRLHAIVEESLSKSLKSVLTELCNP-NALVIDLFCTQAFEI  126

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
               +L++P + +V T+  F A   Y P LDRE+ G++V+  + ++IPGC PVRPED++D +
Sbjct  127   CSQLSIPTYSFVTTSVHFFAFITYLPTLDREVQGEFVDLPEPIKIPGCPPVRPEDLLDQV  186

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
              +R   +Y+ +L       +A GI +N+WE+++ V LKA+RE+    ++   P+Y IGPL
Sbjct  187   RNRKIDEYKFFLLHVSRLPLAAGIFLNSWENLEFVPLKAIREHSFYLQIPTPPIYPIGPL  246

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              +  E     D    + WL KQP +SVL+   GSGGTL+AEQ+TE+AWGLE S+QRFIWV
Sbjct  247   IKEDEPLSASDEE-CLAWLDKQPPDSVLFAVPGSGGTLTAEQVTEMAWGLEQSKQRFIWV  305

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGF--NTRTQNQGLVVPMWAEQALILRHPSTG  1238
             VR PS   +   FF  G   +    YLPEGF   TR Q  G+VVP WA Q  ILRHPSTG
Sbjct  306   VRMPSDASASATFFNVGSDVNDPKAYLPEGFLQRTRAQGAGMVVPSWAPQVHILRHPSTG  365

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLT-EEVGVAIRPMKLPTKGIVTRE  1415
             GFLSHCG NSTLESI +GVP+IAWPLY+EQR NA +LT EE GVA++P   P K ++ RE
Sbjct  366   GFLSHCGWNSTLESICHGVPMIAWPLYAEQRMNAAMLTAEETGVAVKPEIEPGKKVIGRE  425

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             E++ +V+++++ ++GK MR RV +LK S+ + +  GGSS +S+   + 
Sbjct  426   EIERVVRLVMEGEEGKVMRRRVQELKESASRELGDGGSSSDSLASFIK  473



>ref|XP_009112325.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 72E2-like 
[Brassica rapa]
Length=478

 Score =   406 bits (1043),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 202/471 (43%), Positives = 311/471 (66%), Gaps = 15/471 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +LSSPG+GHIIP + LA RL+  H  ++TVFV+ T  +  + + L S+ L    + V
Sbjct  7     HAALLSSPGMGHIIPVIELAKRLSTNHGFRVTVFVLETDGTSAQSKFLNSTGL----DVV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  DIS L+      V ++ +++R  +P +R+ +    ++  AL+VD F T+AL +A 
Sbjct  63    NLPSPDISELVHPADHVVTKIGVIMRETVPALRSKIAAMTQKPTALIVDLFGTDALRLAS  122

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E  +  + ++ +NARF  +T+Y P L++ +  ++  Q K LEIPGC+PVR ED +D  L 
Sbjct  123   EFKMLTYAFITSNARFLGVTIYXPTLEKYVKEEHTVQRKPLEIPGCEPVRFEDTLDAYLV  182

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  YR+++R  + +   DGIL+NTW++++P +LK+L++ + L +    PVY IGPL R
Sbjct  183   PDEPLYRDFVRHCLAYPKTDGILVNTWDEMEPKSLKSLQDPKLLGRFARVPVYPIGPLCR  242

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +E         ++ WL++QP ESVLY+SFGSGG+L+A+ +TELAWGLE S+QRF+WVVR
Sbjct  243   PVE--SSKTVHPVLDWLNQQPDESVLYISFGSGGSLTAKLLTELAWGLEQSQQRFVWVVR  300

Query  1071  PPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             PP    S  A+ +   G   D TP YLPEGF TRT ++GLVVP WA QA +L H + GGF
Sbjct  301   PPIDGSSCSAYLSANGGGTKDSTPEYLPEGFVTRTSDRGLVVPSWAPQAEVLAHRAVGGF  360

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG NSTLE + NGVP+IAWPL++EQ  NA LL++E+G+A+R      +   TR E++
Sbjct  361   LTHCGWNSTLEGVVNGVPMIAWPLFAEQNMNAALLSDELGIAVR-----AEEANTRSEIE  415

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNAIEK  1571
              +V+ ++  ++G+EMR +V KL+ ++E ++S   GGS++ S+C V    ++
Sbjct  416   AIVRKVMAEEEGEEMRRKVKKLRDNAEMSLSSEGGGSAHESLCRVTEECQR  466



>gb|KGN48805.1| hypothetical protein Csa_6G501940 [Cucumis sativus]
Length=480

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 220/484 (45%), Positives = 306/484 (63%), Gaps = 17/484 (4%)
 Frame = +3

Query  153   NNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLT  332
               +S  H+ +L SPG+GH+IP L LANRL   HN++ T+FV+ T  S  E  LL+   L 
Sbjct  3     GQESKTHVALLVSPGMGHLIPFLELANRLVLHHNLQATLFVVGTGSSSAESTLLQKPSLV  62

Query  333   SRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTE  512
                 N+   P  +S+L D N      +  ++ A+ P +R+++     R  AL+VD F T 
Sbjct  63    ----NIVSLPHSLSSL-DPNAPICDIIISMMTASFPFLRSSIAAVNPRPAALIVDLFGTP  117

Query  513   ALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDV  692
             AL +A EL +   V++ TNA + +++   P  ++ +V  +V     L IPGC PVR ED 
Sbjct  118   ALSIAHELGMLGLVFMTTNAWYLSVSYLYPSFEKSMVDAHVYNHDPLVIPGCTPVRFEDT  177

Query  693   VDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLS--KVVGKPV  866
             ++      +  Y  + R     G ADGIL NTW+D++P TLKAL E   L   KV   P+
Sbjct  178   IEVFELNQEEVYVGFGRYARELGTADGILSNTWQDLEPTTLKALSEAGTLGYGKVNEVPI  237

Query  867   YAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSE  1046
             Y IGPLTRN E     +   +++WL +QP ESV+YVSFGSGGTL  EQITELAWGLELS+
Sbjct  238   YPIGPLTRNGEPTLESE---VLKWLDRQPDESVIYVSFGSGGTLCEEQITELAWGLELSQ  294

Query  1047  QRFIWVVRPPSMRGSDDAFFTTGQGAD---GTPNYLPEGFNTRTQNQGLVVPMWAEQALI  1217
             QRF+WV+RPP    S  AFFT G+G+        YLPEGF  RT+  GLV+PMW  QA I
Sbjct  295   QRFVWVIRPPEGTESTGAFFTAGRGSSRDYWASKYLPEGFIKRTKEVGLVIPMWGPQAEI  354

Query  1218  LRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTK  1397
             L H S  GF++HCG NS+LESI NGV ++ WPLY+EQ+ NA LLTEE+GVA+R ++   +
Sbjct  355   LSHRSVRGFVTHCGWNSSLESIVNGVAMVTWPLYAEQKMNAALLTEEMGVAVR-LRAEGQ  413

Query  1398  GIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV---LNAIE  1568
             G+V R+E++  V+++++ K+G+ +RERV +LK+S  KA++ GGSSYNS+  V    +   
Sbjct  414   GVVERKEIEKKVRMIMEGKEGEGIRERVKELKISGGKAVTKGGSSYNSLARVASECDIFR  473

Query  1569  KRRD  1580
             +RRD
Sbjct  474   RRRD  477



>ref|XP_010465049.1| PREDICTED: UDP-glycosyltransferase 72E3 isoform X1 [Camelina 
sativa]
 ref|XP_010465056.1| PREDICTED: UDP-glycosyltransferase 72E3 isoform X2 [Camelina 
sativa]
Length=481

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 196/471 (42%), Positives = 315/471 (67%), Gaps = 12/471 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + SSPG+GH++P + LA RL+  H   +TVFV+ T  +  + + L S+ +    + V
Sbjct  7     HAAMFSSPGMGHVMPVIELAKRLSANHGFHVTVFVLETDAASAQSKFLNSTGV----DIV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  +IS L+D     V ++ +++R A+P +R+ +    ++  AL++D F T+AL +  
Sbjct  63    ALPSPNISGLVDPEDHVVTKIGVIMREAVPALRSKIAAMHQKPTALIIDLFGTDALCLGA  122

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             ELN+  +V++ +NAR+  +++Y P LD++    +  Q   L +PGC+PVR +D +D  L 
Sbjct  123   ELNMLTYVFIASNARYLGVSIYYPTLDKDTKEDHTVQRNPLPVPGCEPVRFKDTLDAYLV  182

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  YR+ +R  + +  ADGIL+NTWE+++P +LK+L++ + L +V   PVY +GPL+R
Sbjct  183   PDEPVYRDLVRHCLAYPKADGILVNTWEEMEPKSLKSLQDPKLLGRVARAPVYPVGPLSR  242

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
             +++    +    +  WL++QP ESVLY+SFGSGG+L+A Q+TELAWGLE S+QRF+WVVR
Sbjct  243   SVQSSKNEHP--VFDWLNEQPDESVLYISFGSGGSLTANQLTELAWGLEQSQQRFVWVVR  300

Query  1071  PPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             PP    S   +F+   G   D TP YLPEGF TRT ++G V+P WA QA +L H + GGF
Sbjct  301   PPVDGSSCSEYFSANGGGTKDNTPEYLPEGFVTRTCDRGFVIPSWAPQAEVLAHRAVGGF  360

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG +STLES+  GVP+IAWPL++EQ  NA LL++E+G+A+R     T+  ++R +++
Sbjct  361   LTHCGWSSTLESVVGGVPMIAWPLFAEQNMNAALLSDELGIAVRVDD--TEEAISRSKIE  418

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNAIEK  1571
              LV++++  K+G+EMR +V KL+ ++E + SI  GGS++ S+C V    ++
Sbjct  419   VLVRMVMAEKEGEEMRMKVKKLRDTAEMSSSIDGGGSAHKSLCRVTKECQQ  469



>ref|XP_006573595.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Glycine max]
Length=492

 Score =   405 bits (1040),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 206/462 (45%), Positives = 303/462 (66%), Gaps = 9/462 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +++SPG+GH+IP + L  RL   H+  +T+FV+TT  + T   +L+    TS LN V
Sbjct  7     HAALIASPGMGHLIPMVELGKRLLTHHSFHVTIFVVTTDSAITTSHILQQ---TSNLNIV  63

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAA-LTKQCRRLDALVVDFFCTEALPMA  527
              +PP+D+S  L  N    A++ L +  ++P V ++ L+ +     AL+VD F   A PMA
Sbjct  64    LVPPIDVSHKLPPNPPLAARILLTMLDSIPFVHSSILSTKLPPPSALIVDMFGFAAFPMA  123

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              +L +  +VY  T+A F+A+TVY P +D++++  + E  + L I GC+ VR +D ++P L
Sbjct  124   RDLGMLIYVYFATSAWFSAVTVYVPAMDKKMIESHAENHEPLVILGCEAVRFDDTLEPFL  183

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
                   Y+ YL        ADGILMNTW+D++P   KA+RE+  L +     VY++GPL 
Sbjct  184   SPIGEMYQGYLTAAKEIVTADGILMNTWQDLEPAATKAVREDGILGRFTKAEVYSVGPLV  243

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R +E++       ++ WL  QP ESV+YVSFGSGGT+S  Q+ E+A GLELS+QRF+WVV
Sbjct  244   RTVEKKPE---AAVLSWLDGQPAESVVYVSFGSGGTMSEVQMREVALGLELSQQRFVWVV  300

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +  +FF    G D   NYLPEGF  RT+  G+VVPMWA QA IL HP+TGGF+
Sbjct  301   RPPCEGDASGSFFEVSNGGDVALNYLPEGFVKRTEAVGVVVPMWAPQAEILGHPATGGFV  360

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             +HCG NS LES+ NGVP++AWPLY+EQ+ NA +L+EE+GVA+R  +    G+V RE+V  
Sbjct  361   THCGWNSVLESVLNGVPMVAWPLYAEQKMNAFMLSEELGVAVRVAE--EGGVVRREQVAE  418

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             LV+ ++  ++G  MR++V +LK+S EKA+S  GSS++ +C++
Sbjct  419   LVRRVMVDEEGFGMRKKVKELKVSGEKALSKVGSSHHWLCQM  460



>ref|XP_004160164.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Cucumis sativus]
Length=480

 Score =   404 bits (1038),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 220/484 (45%), Positives = 306/484 (63%), Gaps = 17/484 (4%)
 Frame = +3

Query  153   NNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLT  332
               +S  H+ +L SPG+GH+IP L LANRL   HN++ T+FV+ T  S  E  LL+   L 
Sbjct  3     GQESKTHVALLVSPGMGHLIPFLELANRLVLHHNLQATLFVVGTGSSSAESTLLQKPSLV  62

Query  333   SRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTE  512
                 N+   P  +S+L D N      +  ++ A+ P +R+++     R  AL+VD F T 
Sbjct  63    ----NIVSLPHSLSSL-DPNAPICDIIISMMTASFPFLRSSIAAVNPRPAALIVDLFGTP  117

Query  513   ALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDV  692
             AL +A EL +   V++ TNA + +++   P  ++ +V  +V     L IPGC PVR ED 
Sbjct  118   ALSIAHELGMLGLVFMTTNAWYLSVSYLYPSFEKPMVDAHVYNHDPLVIPGCTPVRFEDT  177

Query  693   VDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLS--KVVGKPV  866
             ++      +  Y  + R     G ADGIL NTW+D++P TLKAL E   L   KV   P+
Sbjct  178   IEVFELNQEEVYVGFGRYARELGTADGILSNTWQDLEPTTLKALSEAGTLGNGKVNEVPI  237

Query  867   YAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSE  1046
             Y IGPLTRN E     +   +++WL +QP ESV+YVSFGSGGTL  EQITELAWGLELS+
Sbjct  238   YPIGPLTRNGEPTLESE---VLKWLDRQPDESVIYVSFGSGGTLCEEQITELAWGLELSQ  294

Query  1047  QRFIWVVRPPSMRGSDDAFFTTGQGAD---GTPNYLPEGFNTRTQNQGLVVPMWAEQALI  1217
             QRF+WV+RPP    S  AFFT G+G+        YLPEGF  RT+  GLV+PMW  QA I
Sbjct  295   QRFVWVIRPPEGTESTGAFFTAGRGSSRDYWASKYLPEGFIKRTKEVGLVIPMWGPQAEI  354

Query  1218  LRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTK  1397
             L H S  GF++HCG NS+LESI NGV ++ WPLY+EQ+ NA LLTEE+GVA+R ++   +
Sbjct  355   LSHRSVRGFVTHCGWNSSLESIVNGVAMVTWPLYAEQKMNAALLTEEMGVAVR-LRAEGQ  413

Query  1398  GIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV---LNAIE  1568
             G+V R+E++  V+++++ K+G+ +RERV +LK+S  KA++ GGSSYNS+  V    +   
Sbjct  414   GVVERKEIEKKVRMIMEGKEGEGIRERVKELKISGGKAVTKGGSSYNSLARVASECDIFR  473

Query  1569  KRRD  1580
             +RRD
Sbjct  474   RRRD  477



>ref|XP_006280388.1| hypothetical protein CARUB_v10026316mg [Capsella rubella]
 gb|EOA13286.1| hypothetical protein CARUB_v10026316mg [Capsella rubella]
Length=482

 Score =   403 bits (1036),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 204/470 (43%), Positives = 315/470 (67%), Gaps = 13/470 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + SSPG+GH+IP + LA RL+  H   +TVFV+ +  +  + + L+S+ +    + V
Sbjct  7     HAAMFSSPGMGHVIPVIELAKRLSANHGFHVTVFVLESDSASAQSKFLDSTGV----DIV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  DIS L+D     V ++ +++R A+P +R+ +    ++  AL++D F T+AL +  
Sbjct  63    SLPSPDISGLVDPEDHVVTKIGVIMREAVPALRSKIAAMHQKPTALIIDLFGTDALCLGA  122

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             ELN+  +V++ +NAR+  +++Y P LD++I   +  Q   L +PGC+PVR ED +D  L 
Sbjct  123   ELNMLTYVFIASNARYLGVSIYYPTLDKDIKEDHTVQRNPLTVPGCEPVRFEDTLDAYLV  182

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  YR+ +R  + +  ADGIL+NTW++++P +LK+L++ + L +V   PVY +GPL R
Sbjct  183   PDEPVYRDLVRHCMAYPKADGILVNTWDEMEPKSLKSLQDPKLLGRVARVPVYPVGPLCR  242

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              IE  + +    +  WL++QP ESVLY+SFGSGG+L+A+Q+TELAWGLE S+QRF+WVVR
Sbjct  243   PIEISEHEHP--VFDWLNEQPDESVLYISFGSGGSLTAKQLTELAWGLEHSQQRFVWVVR  300

Query  1071  PPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             PP    S   +F+   G   D TP YLPEGF TRT  +G V+P WA QA +L H + GGF
Sbjct  301   PPVDGSSCSEYFSGNGGGTKDSTPEYLPEGFVTRTSGRGFVIPSWAPQAEVLAHRAVGGF  360

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG +STLES+  GVP+IAWPL++EQ  NA LL++E+G+A+R +  P + I +R +++
Sbjct  361   LTHCGWSSTLESVVGGVPMIAWPLFAEQNMNAALLSDELGIAVR-VDDPKEEI-SRAKIE  418

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSE-KAISIGGSSYNSMCEVLNAIEK  1571
             TLVK+++  K+G+EMR RV KL+ ++E  ++SI GS   S  E L  + K
Sbjct  419   TLVKMVMAEKEGEEMRGRVKKLRETAEMSSLSIDGS--GSAHESLRTVAK  466



>gb|AAM62659.1| UTP-glucose glucosyltransferase [Arabidopsis thaliana]
Length=472

 Score =   403 bits (1035),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 206/469 (44%), Positives = 315/469 (67%), Gaps = 14/469 (3%)
 Frame = +3

Query  180   ILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVGIP  359
             + SSPG+GH+IP + L  RL+  +   +TVFV+ T  +  + + L S+ +    + V +P
Sbjct  1     MFSSPGMGHVIPVIELGKRLSANNGFHVTVFVLETDAASAQSKFLNSTGV----DIVKLP  56

Query  360   PVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMADELN  539
               DI  L+D +   V ++ +++RAA+P +R+ +    ++  AL+VD F  +AL +A E N
Sbjct  57    SPDIYGLVDPDDHVVTKIGVIMRAAVPALRSKIAAMHQKPTALIVDLFGXDALCLAKEFN  116

Query  540   LPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLDRND  719
             +  +V++PTNARF  +++Y P LD++I  ++  Q   L IPGC+PVR ED +D  L  ++
Sbjct  117   MLSYVFIPTNARFLGVSIYYPNLDKDIKEEHTVQRNPLAIPGCEPVRFEDTLDAYLVPDE  176

Query  720   VQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTRNIE  899
               YR+++R G+ +  ADGIL+NTWE+++P +LK+L   + L +V   PVY IGPL R I+
Sbjct  177   PVYRDFVRHGLAYPKADGILVNTWEEMEPKSLKSLLNPKLLGRVARVPVYPIGPLCRPIQ  236

Query  900   ERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVRPPS  1079
               + D    ++ WL++QP ESVLY+SFGSGG LSA+Q+TELAWGLE S+QRF+WVVRPP 
Sbjct  237   SSETDHP--VLDWLNEQPNESVLYISFGSGGCLSAKQLTELAWGLEQSQQRFVWVVRPP-  293

Query  1080  MRGSDDAFFTTGQGA---DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             + GS  + + +  G    D TP YLPEGF +RT ++G VVP WA QA IL     GGFL+
Sbjct  294   VDGSCCSEYVSANGGGTEDNTPEYLPEGFVSRTSDRGFVVPSWAPQAEILSXRXVGGFLT  353

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG +STLES+  GVP+IAWPL++EQ  NA LL++E+G+A+R +  P + I +R +++ L
Sbjct  354   HCGWSSTLESVVGGVPMIAWPLFAEQNMNAALLSDELGIAVR-LDDPKEDI-SRWKIEAL  411

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNAIEK  1571
             V+ ++  K+G+ MR +V KL+ S+E ++SI  GG ++ S+C V    ++
Sbjct  412   VRKVMTEKEGEAMRRKVKKLRDSAEMSLSIDGGGLAHESLCRVTKECQR  460



>ref|XP_007153279.1| hypothetical protein PHAVU_003G021900g [Phaseolus vulgaris]
 gb|ESW25273.1| hypothetical protein PHAVU_003G021900g [Phaseolus vulgaris]
Length=476

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 209/466 (45%), Positives = 300/466 (64%), Gaps = 8/466 (2%)
 Frame = +3

Query  162   SMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRL  341
             S  H  +L+SPG+GHIIP + L  RL   H+  +T+F++TT  S +  Q+L+ +   S L
Sbjct  4     SKAHAVLLASPGMGHIIPMVELGKRLLTHHSFHVTIFLVTTTTSTS--QILQQTSNLSSL  61

Query  342   NNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEA  515
             N V +PP+D+S  L  N     ++ L +  +LP +R+++T         AL+VD F  +A
Sbjct  62    NIVHVPPIDVSHKLPPNAPIELRIELTMLHSLPFLRSSITSINTLPPPSALIVDMFGLQA  121

Query  516   LPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVV  695
             LPMA +L++  +VY  T+A F A+T+Y  V D++I+  + E  + L IPGCKPVR ED +
Sbjct  122   LPMARDLSMLTYVYFATSAWFAAVTLYFSVADKKIMETHAESREPLPIPGCKPVRFEDTL  181

Query  696   DPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAI  875
             +  L      Y   L        ADGIL+NTWED++P   KALREN  L       V+A+
Sbjct  182   EAFLSPGGAMYEACLEAAKESVAADGILVNTWEDLEPAATKALRENGVLGGFTKGEVHAV  241

Query  876   GPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
             GPL +  E   G     ++QWL  QP ESV+YVSFGSGGT+S  Q+ E+A GLELS QRF
Sbjct  242   GPLVKKAE---GGKKGAVLQWLDGQPDESVIYVSFGSGGTMSENQMREVALGLELSRQRF  298

Query  1056  IWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             +WVVRPP    +  AFF    G D    YLPEGF  RT+  G+VV +WA QA IL HP+T
Sbjct  299   VWVVRPPCEGDASGAFFDVASGVDSAVGYLPEGFVERTEGVGVVVSLWAPQAEILEHPAT  358

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGF++HCG NS LES+++GVP++AWPLY+EQR NA +++E++GVA+R  +    G+V RE
Sbjct  359   GGFVTHCGWNSVLESVESGVPMVAWPLYAEQRMNAFMVSEQLGVAVRVAE-KGGGVVGRE  417

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             EV  +V+ ++  ++G  MR++V +LK+S EKA+ + GSS++S+ ++
Sbjct  418   EVAEMVRRVMVDEEGVRMRKKVKELKLSGEKALCVFGSSHHSLSQM  463



>ref|XP_006434938.1| hypothetical protein CICLE_v10001016mg [Citrus clementina]
 gb|ESR48178.1| hypothetical protein CICLE_v10001016mg [Citrus clementina]
Length=476

 Score =   400 bits (1029),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 204/465 (44%), Positives = 304/465 (65%), Gaps = 6/465 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDLTSRLNN  347
             H+ +L+SPG+GH++P L  A RL   H V +   VITT + S  + +LL S  L   L+ 
Sbjct  12    HVAVLASPGLGHVVPLLEFAKRLVINHGVHVRFLVITTNEASAAQEKLLRS--LPDGLDV  69

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAAL-PGVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +PPVD+SA+   +   + +L  +V  +L   ++A L + C    ALV+D FCT+A  +
Sbjct  70    VDLPPVDVSAVTRDDMPVITRLHAIVDESLKSSLKAVLIELCNP-RALVIDLFCTQAFEI  128

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
               +L++P + +V T+  F A  +Y P LDRE+ G++V+  + +EIPGC PVRPED++D +
Sbjct  129   CSQLSIPTYSFVTTSIHFFAFALYLPTLDREVQGEFVDLPEPIEIPGCPPVRPEDLLDQV  188

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
              +R   +Y  +L       +A GI +N+WE+++ V L+A+RE+    ++   P+Y IGPL
Sbjct  189   RNRKIDEYNLFLLHISRLPLAAGIFLNSWENLELVPLRAIREHSFYLQIPTPPIYPIGPL  248

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              +  E     D    + WL K+P +SV++V+ GSGGTL+AEQ+TE+AWGLE S+QRFIWV
Sbjct  249   IKQDETLSASDEE-CLAWLGKKPSDSVIFVAPGSGGTLTAEQVTEMAWGLEQSKQRFIWV  307

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VR PS   +   FF  G   +    YLPEGF  RT   G+VVP WA Q  ILRH STGGF
Sbjct  308   VRMPSDASASATFFNVGSDVNDPQAYLPEGFLQRTHGMGMVVPSWAPQVEILRHSSTGGF  367

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             LSHCG NS+LESI +GVP+IAWPLY+EQ+ NA +LTEE+GVA++P+    K ++ R E++
Sbjct  368   LSHCGWNSSLESICHGVPMIAWPLYAEQKMNAAMLTEEIGVAVKPVIESGKKVIGRGEIE  427

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
              +V+++++S++G+ MR RV +LK S+ +A+  G SS +S+   + 
Sbjct  428   RVVRLVMESEQGQVMRRRVKELKESASRALEDGVSSSDSLARFVK  472



>ref|XP_009103497.1| PREDICTED: UDP-glycosyltransferase 72E3 [Brassica rapa]
Length=482

 Score =   401 bits (1030),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 207/481 (43%), Positives = 326/481 (68%), Gaps = 19/481 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + SSPG+GH+IP + LA RL+  H  ++TVFV+ T  +  + + L SS +    + V
Sbjct  7     HAAMFSSPGMGHLIPVIELAKRLSANHGFRVTVFVLETDAASAQSKFLTSSGV----DFV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  DIS L++     V ++ +++R  +P +R+ + +  ++  AL++D F T+AL +A 
Sbjct  63    NLPSPDISQLVNPADHVVTKIGVIMRETVPALRSKIAEMNQKPTALIIDLFGTDALCLAS  122

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+  +V + +NAR+  + +Y P LD+++  ++  Q K LEIPGC+PVR ED +D  L 
Sbjct  123   EFNMLTYVLIASNARYVGVAMYYPTLDKDVKEEHTVQRKPLEIPGCEPVRFEDTMDAYLV  182

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  YR+++R  + +  ADGIL+NTW++++P +LK+L++ + L +V   PVY +GPL R
Sbjct  183   PDEPLYRDFIRHCLAYPKADGILVNTWDEMEPRSLKSLQDPKLLGRVARVPVYPVGPLCR  242

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +E  + D    ++ WL++QP ESVLY+SFGSGG+L+A+Q+TELAWGLE S+QRF+WVVR
Sbjct  243   PVETSETDHP--VLDWLNEQPDESVLYISFGSGGSLTAKQLTELAWGLEQSQQRFVWVVR  300

Query  1071  PPSMRGSDDAFFTTGQGA----DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             PP + GS  + + +  G     D TP YLPEGF TRT ++GLVVP WA Q  +L H + G
Sbjct  301   PP-VDGSSCSDYVSANGGGGAKDSTPEYLPEGFVTRTCDRGLVVPSWAPQTEVLAHRAVG  359

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NSTLE + +GVP+IAWPL++EQ  NA LL++E+G+A+R     +K  +TR E
Sbjct  360   GFLTHCGWNSTLEGVVSGVPMIAWPLFAEQNMNAALLSDELGIAVRADD--SKEAITRSE  417

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNA----IEKRRD  1580
             ++ +V+ ++  ++G+EMR RV +L+  +E ++SI  GGS++ S+C+V       +E+ RD
Sbjct  418   IEAVVRKVMAEEEGEEMRRRVKELRDKAEMSLSIDGGGSAHESLCKVTEECTRFLERDRD  477

Query  1581  L  1583
             L
Sbjct  478   L  478



>gb|KHN24742.1| Anthocyanidin 3-O-glucosyltransferase 5 [Glycine soja]
Length=398

 Score =   397 bits (1020),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/397 (52%), Positives = 279/397 (70%), Gaps = 8/397 (2%)
 Frame = +3

Query  402   VAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMADELNLPKFVYVPTNARFT  581
             + +L +++  A+P +++ L+K   R  AL+VD F TEA+P+A ELN+  +VYV ++A   
Sbjct  1     MTRLSVMMSEAVPAIKSILSKITPRPSALIVDIFGTEAIPIARELNILSYVYVASHAWVL  60

Query  582   ALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLDRNDVQYREYLRLGVGFG  761
             AL VY PVLD +I G+YV+Q++ L+IPGC PVRPEDVVD MLDRND +Y+E+L++G    
Sbjct  61    ALIVYAPVLDEKIEGEYVDQKEALKIPGCNPVRPEDVVDSMLDRNDRKYKEFLKIGNRIP  120

Query  762   MADGILMNTWEDIDPVTLKALRENEPLSKVVGK--PVYAIGPLTRNIEERDGDDGTMIMQ  935
              +DG+L+NTWE++    L+ALRE   LSK +    PVYA+GP+ R  E         +++
Sbjct  121   QSDGLLVNTWEELQRKVLEALREGGLLSKALNMKIPVYAVGPIERESELETSSSNESLVK  180

Query  936   WLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVRPPSMRGSDDAFFTTG  1115
             WL +Q  ESV+YVSFGSGGTLS EQ+ ELA GLE+SEQRF+WVVR P     D AFFTTG
Sbjct  181   WLDEQRSESVVYVSFGSGGTLSYEQMRELALGLEMSEQRFVWVVRAPIEESVDAAFFTTG  240

Query  1116  QG---ADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLSHCGCNSTLESIK  1286
             +     D    YLPEGF +RT+  GL+VP WA+Q  IL+H S GGFLSHCG  STLES+ 
Sbjct  241   RSESEEDEMSKYLPEGFISRTRKVGLLVPEWAQQVTILKHRSIGGFLSHCGWGSTLESVT  300

Query  1287  NGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTLVKIMLQSK---K  1457
             NGVP+IAWPLY+EQR NATLL EE+G+A+R   LPTK +V REE++ +V+ ++Q     K
Sbjct  301   NGVPLIAWPLYAEQRMNATLLAEELGLALRTAVLPTKKVVRREEIEHMVREIIQGDENGK  360

Query  1458  GKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
                +RERV + + S+  A+S GGSSY ++ +V   IE
Sbjct  361   SNGIRERVKETQRSAVNALSEGGSSYVALSQVAKIIE  397



>gb|KDO40224.1| hypothetical protein CISIN_1g046326mg [Citrus sinensis]
Length=476

 Score =   399 bits (1026),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 210/468 (45%), Positives = 301/468 (64%), Gaps = 9/468 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDLTSRLNN  347
             H+ +L SPG+GH+IP L  A RL   H V ++  VITT + S  +  LL S  L   L+ 
Sbjct  9     HVAVLPSPGLGHLIPLLEFAKRLVLNHGVHVSFLVITTNEASAAKNNLLRS--LPHGLDV  66

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALP-GVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +PPVD+SA+   +   V +L  +V  +L   +++ LT+ C   +ALV+D FCT+A  +
Sbjct  67    VDLPPVDVSAVTSDDMPVVTRLHAIVEESLSKSLKSVLTELCNP-NALVIDLFCTQAFEI  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
               +L++P + +V T+  F A   Y P LD E+ G++V+  + ++IPGC PVRPED++D +
Sbjct  126   CSQLSIPTYSFVTTSVHFFAFITYLPTLDHEVQGEFVDLPEPIKIPGCPPVRPEDLLDQV  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
              +R   +Y+ +L       +A GI +N+WE+++ V LKA+ E+    ++   P+  IGPL
Sbjct  186   RNRKIDEYKFFLLHVSRLPLAAGIFLNSWENLEFVPLKAIGEHSFYLQIPTPPINPIGPL  245

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              +  E     D    + WL KQP +SVL+   GSGGTL+AEQ+TE+AWGLE S+QRFIWV
Sbjct  246   IKQDEPLSASDEE-CLAWLDKQPPDSVLFAVPGSGGTLTAEQVTEMAWGLEQSKQRFIWV  304

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGF--NTRTQNQGLVVPMWAEQALILRHPSTG  1238
             VR PS   +   FF  G   +    YLPEGF   TR Q  G+VVP WA Q  ILRHPSTG
Sbjct  305   VRMPSDASASATFFNVGSDVNDPKAYLPEGFLQRTRAQGAGMVVPSWAPQVHILRHPSTG  364

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLT-EEVGVAIRPMKLPTKGIVTRE  1415
             GFLSHCG NSTLESI +GVP+IAWPLY+EQR NA +LT EE GVA++P   P K ++ RE
Sbjct  365   GFLSHCGWNSTLESICHGVPMIAWPLYAEQRMNAAMLTAEETGVAVKPETEPGKKVIGRE  424

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             E++ +V+++++ ++GK MR RV +LK S+ + +  GGSS +S+   + 
Sbjct  425   EIERVVRLVMEGEEGKVMRRRVQELKESASRELGDGGSSSDSLASFIK  472



>ref|NP_849978.2| UDP-glycosyltransferase 72D1 [Arabidopsis thaliana]
 sp|Q9ZU72.1|U72D1_ARATH RecName: Full=UDP-glycosyltransferase 72D1 [Arabidopsis thaliana]
 gb|AAD12210.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AEC06782.1| UDP-glycosyltransferase 72D1 [Arabidopsis thaliana]
 gb|AHL38850.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=470

 Score =   397 bits (1021),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 210/468 (45%), Positives = 311/468 (66%), Gaps = 19/468 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITT-ADSPTERQLLESSDLTSRLNN  347
             H  +++SPG+GH+IP L L NRL+ V N+ +T+  +T+ + SPTE + + ++   +    
Sbjct  5     HALLVASPGLGHLIPILELGNRLSSVLNIHVTILAVTSGSSSPTETEAIHAAAARTICQI  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               IP VD+  L++ +     ++ + +RA  P VR A+    R+   ++VDF  TE + +A
Sbjct  65    TEIPSVDVDNLVEPDATIFTKMVVKMRAMKPAVRDAVKLMKRKPTVMIVDFLGTELMSVA  124

Query  528   DELNL-PKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             D++ +  K+VYVPT+A F A+ VY PVLD  + G+YV+ ++ L+IPGCKPV P+++++ M
Sbjct  125   DDVGMTAKYVYVPTHAWFLAVMVYLPVLDTVVEGEYVDIKEPLKIPGCKPVGPKELMETM  184

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+  QY+E +R G+   M+DG+L+NTWE++   TL ALRE+E LS+V+  PVY IGP+
Sbjct  185   LDRSGQQYKECVRAGLEVPMSDGVLVNTWEELQGNTLAALREDEELSRVMKVPVYPIGPI  244

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R  +  D  +   I +WL +Q   SV++V  GSGGTL+ EQ  ELA GLELS QRF+WV
Sbjct  245   VRTNQHVDKPNS--IFEWLDEQRERSVVFVCLGSGGTLTFEQTVELALGLELSGQRFVWV  302

Query  1065  VRPPSMR----GSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             +R P+       SDD   +           LPEGF  RT+  G+VV  WA Q  IL H S
Sbjct  303   LRRPASYLGAISSDDEQVSAS---------LPEGFLDRTRGVGIVVTQWAPQVEILSHRS  353

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
              GGFLSHCG +S LES+  GVPIIAWPLY+EQ  NATLLTEE+GVA+R  +LP++ ++ R
Sbjct  354   IGGFLSHCGWSSALESLTKGVPIIAWPLYAEQWMNATLLTEEIGVAVRTSELPSERVIGR  413

Query  1413  EEVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             EEV +LV+ ++  + ++G+++R +  ++++SSE+A S  GSSYNS+ E
Sbjct  414   EEVASLVRKIMAEEDEEGQKIRAKAEEVRVSSERAWSKDGSSYNSLFE  461



>ref|XP_006409132.1| hypothetical protein EUTSA_v10022671mg [Eutrema salsugineum]
 gb|ESQ50585.1| hypothetical protein EUTSA_v10022671mg [Eutrema salsugineum]
Length=471

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 212/475 (45%), Positives = 311/475 (65%), Gaps = 32/475 (7%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITT-ADSPTERQLLESSDLTSRLNN  347
             H  +++SPG+GH+IP L L NRL+ V NV +T+  +T+ + SPTE + ++++        
Sbjct  5     HALLVASPGLGHLIPILELGNRLSSVLNVHVTILAVTSGSSSPTETEAIQAAVARGTCEV  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P VD+  L+D++     ++ + ++A  P  R A+    R+   ++VDF  T  +P+A
Sbjct  65    TELPSVDVDNLVDSDATVFTKIVVKMQAMKPTFREAVKSMKRKPTVMIVDFLGTGLMPVA  124

Query  528   DELNL-PKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             D++ +  K+VYVP++A F A  VY PVLD+ I G+YV+ ++ + IPGC+ V P+D+++ +
Sbjct  125   DDVGVTAKYVYVPSHAWFLAEMVYLPVLDKVIEGEYVDIKEPMRIPGCRSVGPDDLMETV  184

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR++ QYRE +R+G    M+DG+L+NTWE++   TL ALRE+  LS+V+  PVYAIGP+
Sbjct  185   LDRSNQQYRECVRIGEEVPMSDGVLVNTWEELQGNTLDALREDGELSRVMKIPVYAIGPI  244

Query  885   TRNIEERDGDDGTM-----IMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQ  1049
              RN       +G +     I +WL KQ   SV+YV  GSGGTLS EQ  ELAWGLELS Q
Sbjct  245   VRN-------NGPIKRPNSIFEWLDKQRDRSVVYVCLGSGGTLSLEQTIELAWGLELSGQ  297

Query  1050  RFIWVVRPP------SMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQA  1211
             RF+WV+R P      S R  DD    +          LPEGF  RT+  GLVV  WA Q 
Sbjct  298   RFLWVLRRPISYLGASSRDDDDQVSAS----------LPEGFLDRTRGMGLVVTQWAPQV  347

Query  1212  LILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLP  1391
              IL H S GGFLSHCG +S LES+  GVPI+AWPLY+EQ  NATLLTEE+GVA+R   LP
Sbjct  348   EILSHGSIGGFLSHCGWSSVLESLTKGVPIVAWPLYAEQWMNATLLTEEIGVAVRTSVLP  407

Query  1392  TKGIVTREEVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
              K ++ REEV +LV+ ++  + ++G+++R +  ++++SSE+A + GGSS++S+ E
Sbjct  408   AKKVIGREEVASLVRKIVAEEDEEGRKIRAKAEEVRVSSEQAWAQGGSSHSSLFE  462



>ref|XP_010534239.1| PREDICTED: UDP-glycosyltransferase 72E2-like [Tarenaya hassleriana]
Length=488

 Score =   397 bits (1019),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 206/458 (45%), Positives = 307/458 (67%), Gaps = 15/458 (3%)
 Frame = +3

Query  177   GILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSR---LNN  347
              +L+SPG+GH+IP++ L++RLA +H   +TVFV+       + + L SS   +    ++ 
Sbjct  9     ALLASPGMGHVIPAVELSHRLAALHGFHVTVFVLEADPESAQSRFLSSSSPAATDLDVHV  68

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             + +PP +I+  ++ +   V ++  ++R ++P VR+ +     +  AL+VD F TEAL +A
Sbjct  69    ITLPPPEIT--VNPSAHVVVKIAAMMRESVPAVRSKIAAMPNKPTALIVDLFGTEALRLA  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             DE N+ K+V + +NARF A+ +Y P LD  +  ++V ++K L IPGC+PVR ED +D   
Sbjct  127   DEFNMLKYVLIASNARFLAVVLYFPTLDEAVEKEHVNRKKPLAIPGCEPVRFEDNLDAYQ  186

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR D  Y E++R+G  F   DGIL+NTWE+++P TLK+L++   L +V   PVY IGPL 
Sbjct  187   DRTDPLYHEFMRIGKAFATTDGILVNTWEEMEPKTLKSLQDPNLLGRVARAPVYPIGPLN  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R +E         +++WL KQP ESVLY+SFGSGG+L+A+Q+ ELA+GLELS+QRF+WVV
Sbjct  247   RPVETAKTVRSP-VLEWLDKQPAESVLYISFGSGGSLTAKQLIELAYGLELSQQRFLWVV  305

Query  1068  RPPSMRGSDDAFFTT----GQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             RPP    +   +FT     G G DGTP YLP+GF  RT+N GLVVP WA QA +L H + 
Sbjct  306   RPPVDGSASAEYFTANTGGGNGGDGTPGYLPQGFVARTRNLGLVVPSWAPQAEVLAHVAV  365

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG----I  1403
             GGFL+HCG NSTLESI NG+P+I WPL++EQR NA LL EE+GVA+   + P+ G     
Sbjct  366   GGFLTHCGWNSTLESIVNGIPMITWPLFAEQRMNARLLKEEIGVAVGSEE-PSDGCDCFF  424

Query  1404  VTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAIS  1517
             V+R E++ + + ++  ++  EMR++V+ L+ S+E ++S
Sbjct  425   VSRNEIEGMARKIMAGEEENEMRKKVMMLRNSAENSLS  462



>ref|XP_009149425.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Brassica rapa]
Length=482

 Score =   396 bits (1017),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 316/469 (67%), Gaps = 6/469 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + +SPG+GH+IP + L  RLAG H  ++T+FV+    +  + Q   S    + L +V
Sbjct  7     HAIMFASPGMGHVIPVIELGKRLAGSHGFQVTIFVLEADAASAQSQFFNSPGCDATLIDV  66

Query  351   -GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
              G+P  DIS L++ +      L  ++R  +P +R+ + +   +  AL+VD F  +AL + 
Sbjct  67    IGLPTPDISGLVNPSGFIAINLLTMMRETIPTLRSKIEEMQHKPTALIVDLFGLDALRLG  126

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E N+  +V++ TNARF ALT+Y P L++++  +++ ++K L +PGC+PVR ED ++P L
Sbjct  127   GEFNMLTYVFIATNARFLALTMYFPTLEKDVEEEHIIKKKPLPMPGCEPVRFEDTLEPFL  186

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             D  D  YRE++  G+ F  ADG+++NTWED++P TLK+L + + L  +   PVY IGPL 
Sbjct  187   DPTDHIYREFVPFGLVFPTADGLIVNTWEDMEPKTLKSLHDPKLLGGIARVPVYPIGPLC  246

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R ++    +    ++ WL+KQP ESVLY+SFGSGG+LS+ QITELAWGLELS+QRF+WVV
Sbjct  247   RPVDPLKINHP--VLDWLNKQPEESVLYISFGSGGSLSSNQITELAWGLELSQQRFVWVV  304

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             RPP    +   + +T  G     +YLP+ F +RT  +GLVV  WA QA IL H + GGF 
Sbjct  305   RPPVDGSASSEYLSTNSGE--VHDYLPKEFLSRTNERGLVVSSWAPQAEILAHQAVGGFF  362

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             +HCG NS LES+ +GVP+IAWPL+++Q+ NATLL EE+G+AIR  KL ++ +V+R E+++
Sbjct  363   THCGWNSILESVVSGVPMIAWPLFADQKLNATLLNEELGIAIRSRKLMSEEVVSRVEIES  422

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISI-GGSSYNSMCEVLNAIEK  1571
             LV+ ++  ++G EMRE+V KL+ ++EK++S  GGSS+ S+  V N  ++
Sbjct  423   LVRRIMVEEEGCEMREKVKKLRDTAEKSVSCDGGSSHESLSRVANECDR  471



>ref|XP_006473463.1| PREDICTED: hydroquinone glucosyltransferase-like [Citrus sinensis]
Length=476

 Score =   396 bits (1017),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 203/461 (44%), Positives = 299/461 (65%), Gaps = 8/461 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITT--ADSPTERQLLESSDLTSRLN  344
             H+ +L+S G+GH+IP L  A RL   H V ++  VITT  A +  E+ L     L   L+
Sbjct  12    HVAVLASSGLGHVIPLLEFAKRLVINHGVHVSFLVITTNEASAAQEKHL---RSLPDGLD  68

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAAL-PGVRAALTKQCRRLDALVVDFFCTEALP  521
              V +PPVD+SA+   +   + +L  +V  +L   ++A L + C    ALV+D FCT+A  
Sbjct  69    VVDLPPVDVSAVTRDDMPVITRLHAIVEESLKSSLKAVLIELCNP-RALVIDLFCTQAFE  127

Query  522   MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDP  701
             +  +L++P + +V T+  F A  +Y P LDRE+ G++ +  + +EIPGC PVRPED++D 
Sbjct  128   ICSQLSIPTYSFVTTSIHFFAFALYLPTLDREVQGEFFDLPEPIEIPGCPPVRPEDLLDQ  187

Query  702   MLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGP  881
             + +R   +Y  +L       +A GI +N+WE+++ V L+A+RE+    ++   P+Y IGP
Sbjct  188   VRNRKIDEYNLFLLHISRLPLAAGIFLNSWENLELVPLRAIREHSFYLQIPTPPIYPIGP  247

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             L +  E     D    + WL KQP +SV++V+ GSGGTL+AEQ+ E+AWGLE S+QRFIW
Sbjct  248   LIKQDETLSASDEE-CLAWLGKQPSDSVIFVAPGSGGTLTAEQVIEMAWGLEQSKQRFIW  306

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVR PS   +   FF  G   +    YLPEG   RTQ  G+VVP WA Q  ILRH STGG
Sbjct  307   VVRMPSDASASATFFNVGSDVNDPQAYLPEGVLQRTQGVGMVVPSWAPQVEILRHSSTGG  366

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FLSHCG NS+LESI +GVP+IAWPLY+EQ+ NA +LTEE GVA++P+    K ++ REE+
Sbjct  367   FLSHCGWNSSLESICHGVPMIAWPLYAEQKMNAAMLTEETGVAVKPVIESGKKVIGREEI  426

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             + +V+++++S++G+ MR RV +LK S+ +A+  G SS +S+
Sbjct  427   ERVVRLVMESEQGRVMRRRVKELKESASRALEDGVSSSDSL  467



>ref|XP_010649181.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5 isoform X2 
[Vitis vinifera]
Length=456

 Score =   394 bits (1012),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 205/462 (44%), Positives = 279/462 (60%), Gaps = 48/462 (10%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +L+SPG+GH+IP L L  RL   H  ++TVFV+ T  SP +  LL+ +      N V
Sbjct  7     HAALLASPGMGHLIPVLELGKRLITHHGFQVTVFVVATEVSPAQSLLLQQATTPHLPNLV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P V+ S L+D     + QL  +VR +LP +R+A++        L+VD F  EA  +A+
Sbjct  67    SLPVVNDSILVDPEASVLEQLLSMVRGSLPRLRSAISAMKVPPTVLIVDMFGLEAFKIAN  126

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E  + K+VY+ +NA F A T Y PVLD+ +  +  + ++   IPGCKP+  E V +P+LD
Sbjct  127   EFEMLKYVYITSNAWFLAFTAYLPVLDKLVETKCSDLQEPTRIPGCKPLWVEHVFEPVLD  186

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
               +  Y  Y+R+ V   MA                                         
Sbjct  187   IKNEMYHAYMRMAVEITMA-----------------------------------------  205

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
                  D ++G  ++ WL  QP ESV+YVSFGSGGTLSA+Q TELAWGLELS Q F+WV+R
Sbjct  206   -----DAENG--VLDWLGMQPSESVIYVSFGSGGTLSAKQTTELAWGLELSRQNFVWVIR  258

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP    +  A FT+  G DG   YLP+GF  RT+  G VVPMWA QA IL HPS GGF++
Sbjct  259   PPMDDDAAAALFTSADGRDGIAEYLPDGFLERTKKVGCVVPMWAPQAQILGHPSVGGFIT  318

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLES+ NGVP+IAWPLY+EQ+ NA +LTEE+GVAIRP   PTKG+V REE+ T+
Sbjct  319   HCGWNSTLESMVNGVPMIAWPLYAEQKMNAVMLTEELGVAIRPNVFPTKGVVGREEIATM  378

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
             V+ +++  +G  +R +V +LK S+EKA+S GGSSY S+  V+
Sbjct  379   VRRLMEDSEGNAIRAKVKELKYSAEKALSKGGSSYTSLSHVV  420



>ref|XP_007046303.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY02135.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=485

 Score =   394 bits (1012),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 201/465 (43%), Positives = 301/465 (65%), Gaps = 6/465 (1%)
 Frame = +3

Query  138   IIMDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITT-ADSPTERQLL  314
             ++  N      H+ +L S G+GH+IP L LA RL   H +++++ VITT A    + QLL
Sbjct  1     MVAANKTHIKPHVAVLPSVGMGHLIPLLELAKRLVVEHGMRVSLLVITTNAPLAAQEQLL  60

Query  315   ESSDLTSRLNNVGIPPVDISALLDANTKPV---AQLCLLVRAALPGVRAALTKQCRRLDA  485
              S DL   L+ V +PPVD+  ++ ++   V    +LCL+   +L  +++ L     +  A
Sbjct  61    CSPDLPPDLHIVKLPPVDVDKVISSDIDNVLVLTRLCLITEESLRSLKSVLVA-LGKPRA  119

Query  486   LVVDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPG  665
             LV D F T+A  + +EL++P +++  T+A F+A  ++ P LD ++  ++++  + +++PG
Sbjct  120   LVTDLFTTQAFDVCNELSIPAYLFSTTSAAFSAFALFLPKLDSDVECEFIDLPEPIQVPG  179

Query  666   CKPVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLS  845
             C PVR ED++D + +R   +Y+ +        +A G+ +N+WED++PV+LKA++EN    
Sbjct  180   CIPVRTEDLLDQVRNRKIDEYKWFFFHISRLPLASGVFLNSWEDLEPVSLKAIKENPFFR  239

Query  846   KVVGKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELA  1025
             ++   PV+ +GPL +  EE         ++WL KQP +SVL+V+ GSGGTLS EQ TELA
Sbjct  240   QIPTPPVHPVGPLIKQ-EETLSTSDVECLEWLDKQPPDSVLFVTLGSGGTLSLEQQTELA  298

Query  1026  WGLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAE  1205
             WGLELS+QRFIW VR P+      +FF  G   +    YLPEGF +RTQ  GLVVP WA 
Sbjct  299   WGLELSQQRFIWAVRKPTDATGAGSFFDVGSEENDPKAYLPEGFLSRTQGVGLVVPSWAS  358

Query  1206  QALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMK  1385
             Q  IL HPSTGGFLSHCG NS+LESI +GVP+IAWPLY+EQR NA +L E+VGVA++P  
Sbjct  359   QVAILGHPSTGGFLSHCGWNSSLESIAHGVPMIAWPLYAEQRMNAAMLVEDVGVAVKPKV  418

Query  1386  LPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISI  1520
              P + IV R+EV  +V++++  ++GK +R+RV +LK S+ KA  I
Sbjct  419   EPGRTIVGRQEVDRMVRMVMDGEEGKTIRKRVKELKESAAKAPDI  463



>ref|XP_008441118.1| PREDICTED: UDP-glycosyltransferase 72E1 [Cucumis melo]
Length=467

 Score =   393 bits (1009),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 216/472 (46%), Positives = 304/472 (64%), Gaps = 23/472 (5%)
 Frame = +3

Query  198   IGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVGIPPVDISA  377
             +GH+IP L LANRL   HN++ T+FV+ T  S  E  LL+     S +N + +P    S+
Sbjct  1     MGHLIPFLELANRLVLHHNLQATLFVVGTGSSSAEFALLQKP---SPVNIIPLP--HASS  55

Query  378   LLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMADELNLPKFVY  557
              LD+N      +  ++ A+ P +R+++     R  AL+VD F T AL +A EL +  FV+
Sbjct  56    SLDSNAPIFNIISSMMTASFPFLRSSIAAANPRPAALIVDLFGTPALSIAHELGMLGFVF  115

Query  558   VPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM-LDRNDVQYRE  734
             + T+A F +L V+ P  D+ +V  +V+    L IPGC PVR E+ ++   L++ +V Y  
Sbjct  116   MTTSAWFLSLFVFYPSFDKSMVDAHVDNHDPLVIPGCTPVRFENTIEVFELNQKEV-YVG  174

Query  735   YLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGK----PVYAIGPLTRNIEE  902
             +       G ADGIL NTW+D++P TLKAL E   L K  GK    P++ IGPLT N   
Sbjct  175   FGSFASELGTADGILSNTWQDLEPTTLKALSEAGTLGK--GKVNEVPIFPIGPLTSN---  229

Query  903   RDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVRPPSM  1082
              D    + +++WL +QP ESV+YVSFGSGGTL  EQITELAWGLE+S+QRF+WV+RPP+ 
Sbjct  230   GDPTLESEVLKWLDRQPDESVIYVSFGSGGTLREEQITELAWGLEMSQQRFVWVIRPPAG  289

Query  1083  RGSDDAFFTTGQGADG---TPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLSH  1253
               S   FFT G+G+ G      +LPEGF  RT+  GLV+PMW  QA IL H S  GF++H
Sbjct  290   TESMGTFFTAGRGSSGDDWASEFLPEGFIKRTKEVGLVIPMWGPQAEILSHRSVRGFVTH  349

Query  1254  CGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTLV  1433
             CG NS+LESI NGV ++ WPLY+EQ+ NA +LTEEVGVA+R ++    G+V R+E++  V
Sbjct  350   CGWNSSLESIVNGVAMVTWPLYAEQKMNAAVLTEEVGVAVR-VRAEGDGLVKRKEIENKV  408

Query  1434  KIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV---LNAIEKRRD  1580
             +++++ K+G  +RERV  LK+S EKA++ GGSSYNS+  V    +   +RRD
Sbjct  409   RMIMEGKEGGGIRERVKGLKISGEKAVTKGGSSYNSLARVASECDIFRRRRD  460



>gb|KFK40251.1| hypothetical protein AALP_AA3G349900 [Arabis alpina]
Length=471

 Score =   393 bits (1009),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 210/465 (45%), Positives = 308/465 (66%), Gaps = 12/465 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITT-ADSPTERQLLESSDLTSRLNN  347
             H  +++SPG+GH+IP L L NRL+ V NV + V  +T+ + S TE + + ++  +     
Sbjct  5     HALLVASPGLGHLIPVLELGNRLSSVLNVHINVLAVTSGSSSQTETEAIRAAAASGACKI  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P VD++ L++ +     ++ + +RA  P  R A+    R+   ++VDFF T  + +A
Sbjct  65    TELPSVDVNHLVEPDATVATKIFVTMRAMKPAAREAVKSMSRKPTVMIVDFFGTGLMSLA  124

Query  528   DELNLP-KFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             DE+ +  K+VYVP++A F A+ VY PVLD+ + G+YV+ ++ ++IPGCKPV P+++++ M
Sbjct  125   DEVGMTGKYVYVPSHAWFLAVMVYLPVLDKVVEGEYVDIKEPMKIPGCKPVGPKELMETM  184

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+D QYRE L+ G     +DG+L+NTWE++   TL ALR++  LS+V+  PVYAIGP+
Sbjct  185   LDRSDRQYRECLQGGEEIPTSDGVLVNTWEELQGNTLAALRQDGKLSRVMKVPVYAIGPI  244

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R        D   I QWL +QP  SV+YV  GSGGTLS EQ  ELA GLELS QRF+WV
Sbjct  245   VRTNGSVKKPDS--IFQWLDQQPERSVVYVCLGSGGTLSLEQTMELACGLELSGQRFLWV  302

Query  1065  V-RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             + RP S  G+     ++G   D     LP+GF  RT   GLVV  WA Q  IL H S GG
Sbjct  303   LRRPTSYLGA-----SSGDDDDQVCAGLPDGFLDRTSGVGLVVTQWAPQVEILSHGSIGG  357

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FLSHCG +S LES+  GVPI+AWPLY+EQ  NATLLTEE+GVA+R  +LP K ++ +EEV
Sbjct  358   FLSHCGWSSVLESLTKGVPIVAWPLYAEQWMNATLLTEEIGVAVRTSELPAKEVIGQEEV  417

Query  1422  KTLVK--IMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
               LV+  ++ + ++G+++R +  ++K+SSE+A + GGSS++S+ E
Sbjct  418   AVLVRKIVVEEDEEGRKIRAKAEEVKVSSERAWTQGGSSHSSLFE  462



>emb|CCO13612.1| anthocyanidin 3-O-glucosyltransferase like protein [Arabis alpina]
Length=471

 Score =   392 bits (1008),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 210/465 (45%), Positives = 308/465 (66%), Gaps = 12/465 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITT-ADSPTERQLLESSDLTSRLNN  347
             H  +++SPG+GH+IP L L NRL+ V NV + V  +T+ + S TE + + ++  +     
Sbjct  5     HALLIASPGLGHLIPVLELGNRLSSVLNVHINVLAVTSGSSSQTETEAIRAAAASGACKI  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P VD++ L++ +     ++ + +RA  P  R A+    R+   ++VDFF T  + +A
Sbjct  65    TELPSVDVNHLVEPDATVATKIFVTMRAMKPAAREAVKSMSRKPTVMIVDFFGTGLMSLA  124

Query  528   DELNLP-KFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             DE+ +  K+VYVP++A F A+ VY PVLD+ + G+YV+ ++ ++IPGCKPV P+++++ M
Sbjct  125   DEVGMTGKYVYVPSHAWFLAVMVYLPVLDKVVEGEYVDIKEPMKIPGCKPVGPKELMETM  184

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+D QYRE L+ G     +DG+L+NTWE++   TL ALR++  LS+V+  PVYAIGP+
Sbjct  185   LDRSDRQYRECLQGGEEIPTSDGVLVNTWEELQGNTLAALRQDGKLSRVMKVPVYAIGPI  244

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R        D   I QWL +QP  SV+YV  GSGGTLS EQ  ELA GLELS QRF+WV
Sbjct  245   VRTNGSVKKPDS--IFQWLDQQPERSVVYVCLGSGGTLSLEQTMELASGLELSGQRFLWV  302

Query  1065  V-RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             + RP S  G+     ++G   D     LP+GF  RT   GLVV  WA Q  IL H S GG
Sbjct  303   LRRPTSYLGA-----SSGDDDDQVCAGLPDGFLDRTSGVGLVVTQWAPQVEILSHGSIGG  357

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FLSHCG +S LES+  GVPI+AWPLY+EQ  NATLLTEE+GVA+R  +LP K ++ +EEV
Sbjct  358   FLSHCGWSSVLESLTKGVPIVAWPLYAEQWMNATLLTEEIGVAVRTSELPAKEVIGQEEV  417

Query  1422  KTLVK--IMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
               LV+  ++ + ++G+++R +  ++K+SSE+A + GGSS++S+ E
Sbjct  418   AVLVRKIVVEEDEEGRKIRAKAEEVKVSSERAWTQGGSSHSSLFE  462



>ref|XP_004143577.1| PREDICTED: UDP-glycosyltransferase 72E2-like [Cucumis sativus]
Length=463

 Score =   391 bits (1005),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 214/469 (46%), Positives = 297/469 (63%), Gaps = 17/469 (4%)
 Frame = +3

Query  198   IGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVGIPPVDISA  377
             +GH+IP L LANRL   HN++ T+FV+ T  S  E  LL+   L     N+   P  +S+
Sbjct  1     MGHLIPFLELANRLVLHHNLQATLFVVGTGSSSAESTLLQKPSLV----NIVSLPHSLSS  56

Query  378   LLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMADELNLPKFVY  557
             L D N      +  ++ A+ P +R+++     R  AL+VD F T AL +A EL +   V+
Sbjct  57    L-DPNAPICDIIISMMTASFPFLRSSIAAVNPRPAALIVDLFGTPALSIAHELGMLGLVF  115

Query  558   VPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLDRNDVQYREY  737
             + TNA + +++   P  ++ +V  +V     L IPGC PVR ED ++      +  Y  +
Sbjct  116   MTTNAWYLSVSYLYPSFEKSMVDAHVYNHDPLVIPGCTPVRFEDTIEVFELNQEEVYVGF  175

Query  738   LRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLS--KVVGKPVYAIGPLTRNIEERDG  911
              R     G ADGIL NTW+D++P TLKAL E   L   KV   P+Y IGPLTRN E    
Sbjct  176   GRYARELGTADGILSNTWQDLEPTTLKALSEAGTLGYGKVNEVPIYPIGPLTRNGEPTLE  235

Query  912   DDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVRPPSMRGS  1091
              +   +++WL +QP ESV+YVSFGSGGTL  EQITELAWGLELS+QRF+WV+RPP    S
Sbjct  236   SE---VLKWLDRQPDESVIYVSFGSGGTLCEEQITELAWGLELSQQRFVWVIRPPEGTES  292

Query  1092  DDAFFTTGQGAD---GTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLSHCGC  1262
               AFFT G+G+        YLPEGF  RT+  GLV+PMW  QA IL H S  GF++HCG 
Sbjct  293   TGAFFTAGRGSSRDYWASKYLPEGFIKRTKEVGLVIPMWGPQAEILSHRSVRGFVTHCGW  352

Query  1263  NSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTLVKIM  1442
             NS+LESI NGV ++ WPLY+EQ+ NA LLTEE+GVA+R ++   +G+V R+E++  V+++
Sbjct  353   NSSLESIVNGVAMVTWPLYAEQKMNAALLTEEMGVAVR-LRAEGQGVVERKEIEKKVRMI  411

Query  1443  LQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV---LNAIEKRRD  1580
             ++ K+G+ +RERV +LK+S  KA++ GGSSYNS+  V    +   +RRD
Sbjct  412   MEGKEGEGIRERVKELKISGGKAVTKGGSSYNSLARVASECDIFRRRRD  460



>ref|XP_002884142.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60401.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=470

 Score =   389 bits (998),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 210/471 (45%), Positives = 311/471 (66%), Gaps = 25/471 (5%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITT-ADSPTERQLLESSDLTSRLNN  347
             H  +++SPG+GH+IP L L NRL+ V N+ +T+  +T+ + SPTE + + ++   +    
Sbjct  5     HALLVASPGLGHLIPILELGNRLSSVLNIHVTILAVTSGSSSPTETEAIRAAAARTACEI  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P VDI  L++ +     ++ + +RA    VR A+    R+   ++VDFF T  +  A
Sbjct  65    TELPSVDIDNLVEPDATVATKIVVKMRAMKSKVRDAVESMKRKPTVMIVDFFGTGLMCAA  124

Query  528   DELNL-PKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             D++ L  K+VY+P++A F A+ VY PVLD  + G+YV+ ++ L+IPGCKPV  +++++ M
Sbjct  125   DDVGLTAKYVYIPSHAWFLAVMVYLPVLDTVVEGEYVDIKEPLKIPGCKPVGRKELMETM  184

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+D QY+E +R+G+   M+DG+L+NTWE++   TL A RE+  L++V+   VY IGP+
Sbjct  185   LDRSDQQYKECVRVGLEVPMSDGVLVNTWEELQGNTLAAFREDGELNRVMKVLVYPIGPI  244

Query  885   TR---NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
              R   ++E+ +      I +WL KQ   SVLYV  GSGGTL+ EQ  ELAWGLELS QRF
Sbjct  245   VRTSGHVEKLNS-----IFEWLDKQGERSVLYVCLGSGGTLTFEQTVELAWGLELSGQRF  299

Query  1056  IWVVRPPS----MRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILR  1223
             +WV+R P+       SDD         D     LP+GF  RT   GLVV  WA Q  IL 
Sbjct  300   VWVLRRPASYLGASSSDD---------DQVITSLPDGFLDRTCGVGLVVTQWAPQVEILS  350

Query  1224  HPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGI  1403
             H S GGFLSHCG +S LES+  GVPI+AWPLY+EQ  NATLLTEE+GVA+R ++LP++ +
Sbjct  351   HRSIGGFLSHCGWSSVLESLTKGVPIVAWPLYAEQWMNATLLTEEIGVAVRTLELPSEKV  410

Query  1404  VTREEVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             + REEV +LV+ ++  + ++G+E+R +  ++++SSE+A S GGSSYNS+ E
Sbjct  411   IGREEVASLVRKIVAEEDEEGQEIRAKAEEVRVSSERAWSQGGSSYNSLFE  461



>ref|XP_010029834.1| PREDICTED: UDP-glycosyltransferase 72E1 [Eucalyptus grandis]
 gb|KCW56802.1| hypothetical protein EUGRSUZ_I02470 [Eucalyptus grandis]
Length=492

 Score =   389 bits (998),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 207/466 (44%), Positives = 296/466 (64%), Gaps = 5/466 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +L+SPGIGH+IP L L  R A  H+  +T+FV+TT  S  + QL   S     LN V
Sbjct  9     HIALLASPGIGHLIPVLELGRRFAVQHHFLVTIFVVTTDASAAQSQLPHYSSYRDLLNIV  68

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S L   +   ++QL LL+R A+P +RA + K      AL+VD F TEA  +A+
Sbjct  69    FLPPVDVSDLATGSMAILSQLVLLMRRAMPHIRAEIAKLKPCPSALIVDLFGTEAFEIAN  128

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             + ++ K+++  TNA F ALT+Y P  +      +V   K L IPGC P+  E   D    
Sbjct  129   DFSMLKYMFHTTNAWFLALTLYYPHHNETDKHDHVYLHKPLNIPGCTPLEYEGTFDLDTR  188

Query  711   RND-VQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
              +D V + +Y ++G+     DGIL+NTWE ++P TLKALR+   + +    PV+ +GPL 
Sbjct  189   PDDRVLHEDYAKMGLDMAKVDGILVNTWEGLEPRTLKALRDPNLMGRFSSVPVHPVGPLI  248

Query  888   RNIEERDG-DDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
             R ++  +     + ++ WL  QP  SVLYVSFGSGGTLSA Q+TELAWGLELS QRF+WV
Sbjct  249   RPVQPVENLVCRSKVLDWLDSQPAGSVLYVSFGSGGTLSANQLTELAWGLELSGQRFVWV  308

Query  1065  VRPPSMRGSDDAFFTTGQGA-DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VRPP    +  ++F   +   DGTP+YLP+GF +RT+  GLVV MWA Q  +L H S G 
Sbjct  309   VRPPVESTAFGSYFRQKERTEDGTPDYLPDGFVSRTREVGLVVEMWAPQTEVLAHESVGA  368

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FLSHCG NSTLES+ NGVP+I WPLY+EQ  NA +L+  +G+A R  ++    +V REE+
Sbjct  369   FLSHCGWNSTLESVVNGVPMICWPLYAEQGMNAAMLSGHLGIATRLKEVGPGTVVGREEI  428

Query  1422  KTLVKIMLQSKK--GKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             + +++ +++  +  GK +R  V++L+  +E A++ GGSS+ S+  V
Sbjct  429   EKMIRRLMEKDEEPGKLVRANVLELERQAEAALAKGGSSHGSLERV  474



>ref|XP_010030882.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Eucalyptus grandis]
 gb|KCW56803.1| hypothetical protein EUGRSUZ_I02471 [Eucalyptus grandis]
Length=492

 Score =   388 bits (996),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 212/478 (44%), Positives = 301/478 (63%), Gaps = 6/478 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +L+SPG+GH+IP L L  R A  H   +T+FV+TT  S  + QL   S     LN V
Sbjct  9     HIALLASPGMGHLIPVLELGQRFAVHHRFLVTIFVVTTNASTAKSQLPLYSSYRDLLNIV  68

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S L+  +   V+QL L++R A+P +R  + +      AL+VD F TEA  +A+
Sbjct  69    FLPPVDVSDLVTDSMAIVSQLVLIMRHAMPILRTEIAELKPCPSALMVDLFGTEAFKIAE  128

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E  + K+++   NA F AL++Y P  D      +V   K L IPGC P+  ED VD    
Sbjct  129   EFGMLKYMFDTGNAWFLALSLYYPHQDETNKHGHVYLHKPLNIPGCAPLEYEDTVDLYFQ  188

Query  711   RNDVQYRE-YLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
               D   ++ + ++G+    ADGIL+N+WE ++P TLKALR+   L ++   PV+ +GPL 
Sbjct  189   PEDRALQDDFAKMGLDMARADGILVNSWEYLEPKTLKALRDPNLLGRLSSVPVHPVGPLI  248

Query  888   RNIEE-RDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
             R  +  +D    +  + WL  QP  SVLYVSFGSGGTL+A+Q+TELAWGLELS+QRF+WV
Sbjct  249   RPAKPVKDPVSRSAALDWLDLQPAGSVLYVSFGSGGTLTADQLTELAWGLELSQQRFVWV  308

Query  1065  VRPPSMRGSDDAFFTTGQGA-DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VRPP    +  +FF   +   DGTP+YLP+GF +RT+  GLVV MWA Q  +L H S GG
Sbjct  309   VRPPIEGSAFGSFFRQDKRTEDGTPDYLPDGFVSRTREVGLVVEMWAPQTEVLAHQSVGG  368

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FLSHCG NSTLESI NGVP+I WPLY+EQ  N  +LT+ +G+A R  ++   G+V RE +
Sbjct  369   FLSHCGWNSTLESIINGVPMICWPLYAEQGMNTAVLTDHLGMATRAREVGPGGVVGREVI  428

Query  1422  KTLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEK-RRDLK  1586
             +  ++ ++    + G+  R +V++LK S+E A++ GGSS+ S+  V    +  R DL+
Sbjct  429   EKAIRRVMDEDEEHGRLARAKVLELKHSAEVALAKGGSSHGSLERVAKECKTGRTDLR  486



>ref|XP_011031512.1| PREDICTED: hydroquinone glucosyltransferase-like [Populus euphratica]
Length=481

 Score =   387 bits (994),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 194/462 (42%), Positives = 302/462 (65%), Gaps = 9/462 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDLTSRLNN  347
             H+ +LS P +GHIIP L  + RL   H+  ++  VITT + S  + QLL+S      L+ 
Sbjct  12    HVAVLSVPLMGHIIPLLEFSKRLVVDHDFHVSFLVITTTEASAAQDQLLQSPTFPPGLDV  71

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             V  PP+D+ ++   +   + +LC++V  +L  +++ L K+   L ++V+D F T+A  + 
Sbjct  72    VYFPPIDVLSVTTDDMLMLTRLCVMVEESLKSLKSVL-KELGELRSVVIDKFFTQAFDVC  130

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              EL++P +++  +       ++  P LD E+ G++V+  + L++PGC P   ED+ DP+ 
Sbjct  131   CELSIPAYLFYTSALVMLTFSLSLPTLDCEVEGEFVDLAEPLKVPGCPPFPIEDLFDPLK  190

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             +R   +Y+  L     F +A GI +N+W++++ VT KA+ E+    ++   PV  +GPL 
Sbjct  191   NRKIDEYKWLLFHSSRFHLAAGIFVNSWQELESVTYKAMTEDPFFKQIPTPPVLPVGPLI  250

Query  888   RN---IEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             +    +  RD +     + WL KQP +SVL+V+  SGGTL+A+Q+TELAWG+ELS QRFI
Sbjct  251   KGEPPLTARDIE----YLAWLDKQPSDSVLFVALRSGGTLTADQLTELAWGIELSHQRFI  306

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             +VVR P+   +  A FT G        YLPEGF  RT+ +GLVVP WA Q  +L+HPSTG
Sbjct  307   FVVRKPTNSSASAALFTAGSDIGNPMTYLPEGFLERTKERGLVVPSWAPQVAVLKHPSTG  366

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFLSHCG NSTLE+I NGVP+IAWPL++EQR NAT+L+E+VG+AI+P+  P + +V REE
Sbjct  367   GFLSHCGWNSTLETIINGVPLIAWPLFAEQRMNATILSEQVGIAIKPVVKPGESLVGREE  426

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             V+ +V++++  +KG++MR R  +LK S+ KA+ IGGSS++++
Sbjct  427   VERVVRLVIDGEKGRDMRRRTGELKESAAKALEIGGSSHDAL  468



>ref|XP_010446296.1| PREDICTED: UDP-glycosyltransferase 72E3-like [Camelina sativa]
Length=466

 Score =   387 bits (993),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/462 (41%), Positives = 305/462 (66%), Gaps = 12/462 (3%)
 Frame = +3

Query  198   IGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVGIPPVDISA  377
             +GH++P + LA RL+  H   +TVFV+ T  +  + + + S+ +    + V +P  +IS 
Sbjct  1     MGHVMPVIELAKRLSANHGFHVTVFVLETDAASAQSKFINSTGV----DIVALPSPNISG  56

Query  378   LLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMADELNLPKFVY  557
             L+D     V ++ +++R A+P +R+ +    ++  AL++D F T+AL +  ELN+  +V+
Sbjct  57    LVDPEDHVVTKIGVIMREAVPALRSKIAAMHQKQTALIIDLFGTDALCLGAELNMLTYVF  116

Query  558   VPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLDRNDVQYREY  737
             + +NAR+  +++Y P L ++I   +  Q   L +PGC+PVR ED +D  L  ++  YR+ 
Sbjct  117   IASNARYLGVSIYYPTLGKDIKEDHTVQRNPLTVPGCEPVRFEDTLDAYLVPDEPVYRDL  176

Query  738   LRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTRNIEERDGDD  917
             +R  + +  ADGIL+NTWE+++P +LK+L++ + L +V   P+Y +GPL R ++    + 
Sbjct  177   VRHCLAYPNADGILVNTWEEMEPKSLKSLQDPKLLGRVARVPIYPVGPLCRAVQSSKNEH  236

Query  918   GTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVRPPSMRGSDD  1097
                +  WL++QP ESVLY+SFGSGG+L+A Q+TELAWGLE S+QRF+WVVRPP    S  
Sbjct  237   P--VFDWLNEQPAESVLYISFGSGGSLTANQLTELAWGLEQSQQRFVWVVRPPVDGSSCS  294

Query  1098  AFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLSHCGCNST  1271
              +F+   G   D TP YLPEGF TRT ++G V+P WA QA +L H + GGFL+HCG +ST
Sbjct  295   EYFSANGGGTKDNTPEYLPEGFVTRTCDRGFVIPSWAPQAEVLAHRAVGGFLTHCGWSST  354

Query  1272  LESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTLVKIMLQS  1451
             LES+  GVP+IAWPL++EQ  NA LL++E+G+A+R     T+  ++R +++ LV+ ++  
Sbjct  355   LESVVGGVPMIAWPLFAEQNMNAALLSDELGIAVRVDD--TEEAISRSKIEVLVRKVMAE  412

Query  1452  KKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNAIEK  1571
             K+G+EMR +V KL+ ++E + SI   GS++ S+C V    ++
Sbjct  413   KEGEEMRMKVKKLRDTAEMSSSIDGSGSAHKSLCRVTKECQQ  454



>gb|KCW58587.1| hypothetical protein EUGRSUZ_H01245 [Eucalyptus grandis]
Length=435

 Score =   384 bits (987),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 216/471 (46%), Positives = 288/471 (61%), Gaps = 44/471 (9%)
 Frame = +3

Query  168   LHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNN  347
             L   +LSSPG+GH+IP + L  RL               AD   E +++ES+     L+ 
Sbjct  7     LRAALLSSPGLGHLIPVIELNKRL--------------VADHGFEAEIIESAVTPKLLDV  52

Query  348   VGIPPVDI-SALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +PP D+ +A L      V +L + +R A   +R+ L     + + L+VD F TE L +
Sbjct  53    VELPPPDLLAAGLSPAAAVVTRLFVTMREAWTALRSTLMAMEAQPNVLIVDLFETEHLCI  112

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
              +EL +PK+VYVP+NA F AL +Y   LD++I             PGCKPVRPEDVVDPM
Sbjct  113   GEELGIPKYVYVPSNAWFLALFIYSLTLDKKI-------------PGCKPVRPEDVVDPM  159

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+D QY EY++  V   M DGIL+N WED+   TL ALR  E L +V   P+Y +GPL
Sbjct  160   LDRSDQQYCEYVQQAVKIPMGDGILLNVWEDLQAETLAALRNEEFLGRVADSPIYTVGPL  219

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R +  R    G  +++WL KQ  E VL+VSFGSGGT+S EQ+ ELAWGLELS QRF+WV
Sbjct  220   IRPV--RLAGLGKELLEWLDKQLSELVLFVSFGSGGTMSVEQLVELAWGLELSRQRFVWV  277

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             +R P+ +  D +FF  G+               R +    ++  +A    IL HPS GGF
Sbjct  278   LRKPTTKSLDGSFFDAGK------------VGGREELLTFLLEEFAVD--ILSHPSVGGF  323

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
              SHCG NSTLESI NGVP+I WPLY+EQR NATLLTEE+GVAIRP +LP+K IV REE++
Sbjct  324   RSHCGWNSTLESIVNGVPMITWPLYAEQRLNATLLTEEIGVAIRPKELPSKKIVGREEIE  383

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKRR  1577
              LV+ +L  K+G  MR RV +LK S+E A+   G+SY S+ ++    + R+
Sbjct  384   KLVRTILVEKEGHMMRARVKELKSSAENAMIKEGTSYESLSKMKEDCKMRK  434



>ref|XP_003538841.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Glycine max]
Length=496

 Score =   386 bits (991),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 203/467 (43%), Positives = 303/467 (65%), Gaps = 9/467 (2%)
 Frame = +3

Query  162   SMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRL  341
             S  H  +++SPG+GH+IP L L  RL   H+  +T+F++TT  + T   +L+    TS L
Sbjct  4     SKAHAALVASPGMGHLIPMLELGKRLLTHHSFHVTIFIVTTDSATTTSHILQQ---TSNL  60

Query  342   NNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAA-LTKQCRRLDALVVDFFCTEAL  518
             N V +PP+D+S  L  N    A++ L +  ++P +R++ L+       AL+VD F   A 
Sbjct  61    NIVLVPPIDVSHKLPPNPPLAARIMLTMIDSIPFLRSSILSTNLPPPSALIVDMFGLAAF  120

Query  519   PMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
             P+A +L +  +VY  T+A F+A++VY P +D++++ ++ E  + L IPGC+ VR ED ++
Sbjct  121   PIARDLGMLTYVYFATSAWFSAVSVYVPAMDKKMIERHAEHHEPLVIPGCEAVRFEDTLE  180

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIG  878
             P L      Y  YL        ADGILMNTW+D++P   KA+RE+  L +     VY +G
Sbjct  181   PFLSPIGEMYEGYLAAAKEIVTADGILMNTWQDLEPAATKAVREDGILGRFTKGAVYPVG  240

Query  879   PLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             PL R +E++  D    ++ W+  QP E+V+YVSFGSGGT+S  Q+ E+A GLELS+QRF+
Sbjct  241   PLVRTVEKKAED---AVLSWMDVQPAETVVYVSFGSGGTMSEVQMREVALGLELSQQRFV  297

Query  1059  WVVRPPSMRGSDDAFFTTGQGADG--TPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             WVVRPP    +  +FF   +   G    +YLP+GF  RT+  G+VVPMWA QA IL HP+
Sbjct  298   WVVRPPCEGDTSGSFFEVSKNGSGDVVLDYLPKGFVKRTEGVGVVVPMWAPQAEILGHPA  357

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
             TG F++HCG NS LES+ NGVP++AWPLY+EQ+ NA +L+EE+GVA+R       G+V R
Sbjct  358   TGCFVTHCGWNSVLESVLNGVPMVAWPLYAEQKMNAFMLSEELGVAVRVAGEGGGGVVGR  417

Query  1413  EEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             EE+  LV+ ++  K+G  MR++V +LK+S EKA+S  GSS++ +C++
Sbjct  418   EEIAELVRRVMVDKEGVGMRKKVKELKVSGEKALSKFGSSHHWLCQM  464



>gb|ADL67598.1| glycosyltransferase 4 [Populus tomentosa]
Length=376

 Score =   381 bits (979),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 189/361 (52%), Positives = 246/361 (68%), Gaps = 5/361 (1%)
 Frame = +3

Query  486   LVVDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPG  665
             L+VDFF TEA+ +A+E N+ K+ ++ + A F ALT++ P +D  I   +V+ ++ L IPG
Sbjct  8     LIVDFFGTEAMVIAEEFNMLKYAFMTSTAWFLALTLHMPTIDEAIEDNHVKNQQALLIPG  67

Query  666   CKPVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLS  845
             CK +   D  +P+LDRND  Y EY R+GV     DGIL+NTW+D++  TL AL + + L 
Sbjct  68    CKSLEFRDTFEPVLDRNDQMYIEYKRMGVEMQKFDGILVNTWQDLEGTTLGALEDQKRLG  127

Query  846   KVVGKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELA  1025
             +V   P+Y +GPL R I      +   +++WL  QP ESV+YVSFGSGG LSA+Q TELA
Sbjct  128   RVAQVPIYPVGPLVRAITPGPKSE---MLEWLDMQPVESVIYVSFGSGGALSAKQTTELA  184

Query  1026  WGLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAE  1205
             WGLE S QRFIWVVRPP    S    F T    D TP++LP+GF TRT+  GLVVPMWA 
Sbjct  185   WGLESSGQRFIWVVRPPIEGDSAATVFKTNHRTDDTPDFLPDGFLTRTRKTGLVVPMWAP  244

Query  1206  QALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMK  1385
             Q  IL HPS GGF+SHCG NSTLESI NGVP+I WPL++EQ  NA +LTE++GVAIRP  
Sbjct  245   QTEILNHPSVGGFVSHCGWNSTLESIVNGVPMITWPLFAEQGMNAAMLTEDIGVAIRPKS  304

Query  1386  LPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAI  1565
             LP K +V R E++T+V+ ++   +G   R R   LK S+EKA+S GGSSYNS+  V N  
Sbjct  305   LPAKEVVGRGEIETMVRTIMD--RGDARRARAKTLKSSAEKALSKGGSSYNSLAHVANDC  362

Query  1566  E  1568
             E
Sbjct  363   E  363



>ref|XP_010060922.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Eucalyptus 
grandis]
 gb|KCW67814.1| hypothetical protein EUGRSUZ_F01543 [Eucalyptus grandis]
Length=517

 Score =   386 bits (992),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 303/466 (65%), Gaps = 6/466 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDLTSRLNN  347
             H+ +L++ G+GH+IP L  + RL   H  ++T  V+TT D +P + QLL ++ L   L  
Sbjct  32    HVAVLANSGLGHVIPLLEFSKRLVVSHGFRVTFLVVTTVDPTPAQDQLLNAAGLPRDLRV  91

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             +G+P VD ++++  +++ + ++CL+V A+L  +RA L  +     ALVVD FCT+AL +A
Sbjct  92    LGLPAVDAASVVPEDSRLLTRICLIVEASLKSLRATLI-ELSYPRALVVDLFCTQALDVA  150

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              EL +P + +   +A+  A ++Y P LDRE+ G+ V+    + +PGC P+RP+D++D + 
Sbjct  151   GELGIPAYSFCTMSAKMLAFSLYLPTLDREVTGELVDLPGPIRVPGCPPIRPDDLLDQVK  210

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR + +YR +L     F MA GI +NTWE ++   L+ LRE     +V  + ++AIGPL 
Sbjct  211   DRKNEEYRWFLYHVSRFPMAAGIFLNTWEGLESGLLRVLREESFYRQVPARQIHAIGPLV  270

Query  888   RNIEERDGDDGTMI--MQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
                 + +G   T I    WL +QP ESV+ VS GSGGTL+ EQ  E+AWGLELS+QRF+W
Sbjct  271   HEDGDAEGLRSTDIECFAWLDRQPEESVVLVSLGSGGTLTTEQQVEMAWGLELSQQRFLW  330

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTP-NYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             +VR P+   +  AFF  G+  +  P  YLP+GF  +T+  G+VV  WA Q  IL HPS G
Sbjct  331   IVRKPTDASASAAFFNVGRDEEDDPTKYLPQGFQEKTREVGMVVSSWAAQVAILSHPSVG  390

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
              FLSHCG NS++ES+  GVP+IAWPLY+EQR NA +L E++GVAIRP  +  + +V R+E
Sbjct  391   AFLSHCGWNSSVESLAKGVPMIAWPLYAEQRTNAAMLVEDIGVAIRPSVVEGRKVVGRKE  450

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIG-GSSYNSMCEV  1553
             ++ +V+ ++  ++GK MR R  +++ SS ++++ G GSS+ S+  V
Sbjct  451   IERVVRAVVSGEEGKRMRRRAREIRDSSIESLNQGSGSSHASLAVV  496



>ref|XP_006297598.1| hypothetical protein CARUB_v10013620mg [Capsella rubella]
 gb|EOA30496.1| hypothetical protein CARUB_v10013620mg [Capsella rubella]
Length=470

 Score =   384 bits (987),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 205/471 (44%), Positives = 307/471 (65%), Gaps = 25/471 (5%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPT-ERQLLESSDLTSRLNN  347
             ++ +++SPG+GH+IP L L NRL+ V NV +T+  IT+  S + E + +  +   +    
Sbjct  5     NVVLVASPGLGHLIPILELGNRLSSVLNVNVTILAITSGSSSSAETEAIRVAAARTACQI  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P VDI  L++ +     ++ + +RA    VR A+     +   ++VDF  T  + +A
Sbjct  65    TELPSVDIDNLVEPDATVFTKIMVKIRATKSAVREAVESMKPKPTVMIVDFLGTGLMSVA  124

Query  528   DELNL-PKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             D+L+L  K+VYVP++A F A+ VY PV D  + G+YV+ ++ L+IPGCKPV  +++++ M
Sbjct  125   DDLDLTAKYVYVPSHAWFLAVMVYMPVWDTTVEGEYVDIKEPLKIPGCKPVGRKELMETM  184

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+D QY+E +R G+    +DG+L+NTWE++   TL ALRE+E LS+V+  PVYAIGP+
Sbjct  185   LDRSDQQYKECVRAGLEVPTSDGVLVNTWEELQGNTLAALREDEELSRVIKVPVYAIGPI  244

Query  885   TR---NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
              R   ++E+ +G     I +WL KQ   SV+YV  GSGGTLS EQ  ELAWGLELS Q+F
Sbjct  245   VRSNGHVEKHNG-----IFEWLDKQRERSVVYVCLGSGGTLSFEQTIELAWGLELSGQKF  299

Query  1056  IWVVRPPS----MRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILR  1223
             +WV+R P+       SDD         D     LP+GF  RT   GLV   WA Q  IL 
Sbjct  300   LWVLRRPASYLGASSSDD---------DQVIESLPKGFLDRTCGVGLVTTQWAPQVEILS  350

Query  1224  HPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGI  1403
             H S G FLSHCG +S LES+  GVPI+AWPLY+EQ  NATLLTEE+GVA+R  +LP++ +
Sbjct  351   HRSVGAFLSHCGWSSVLESLTKGVPIVAWPLYAEQWMNATLLTEEIGVAVRTSELPSEKV  410

Query  1404  VTREEVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             + REEV +LV+ ++  + ++G+++R +  ++++SSE+A + GGSS+ ++ E
Sbjct  411   IGREEVASLVRKIVAEEDEEGQKIRAKAEEVRVSSERAWTQGGSSHRALFE  461



>ref|XP_002884141.1| hypothetical protein ARALYDRAFT_319804 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60400.1| hypothetical protein ARALYDRAFT_319804 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   384 bits (985),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 205/466 (44%), Positives = 299/466 (64%), Gaps = 41/466 (9%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNN  347
             H  +++SPG+GH+IP+L L NRL+ V N+ +T+  IT+  S  TE +++ ++     L  
Sbjct  5     HALVVASPGLGHLIPALELGNRLSSVLNINVTILAITSGSSSLTETEMIHAAAARGTLT-  63

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
                                     ++RA  P VR A+    ++   ++VDFF T  L + 
Sbjct  64    ------------------------MMRAMTPAVRDAVKSMKQKPTVMIVDFFGTALLSIT  99

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             D     K+V +P++A F AL VY PVLD+ + G+YV+ ++ ++IPGCKPV P++++D ML
Sbjct  100   DVGVTAKYVNIPSHAWFLALIVYLPVLDKVVEGEYVDIKEPMKIPGCKPVGPKELLDTML  159

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR+D QYRE ++ G+   M+DG+L+NTWE++   TL ALRE+  L++V+  PVY IGP+ 
Sbjct  160   DRSDQQYRECVQSGLEIPMSDGVLVNTWEELQGKTLAALREDMDLNRVMKVPVYPIGPIV  219

Query  888   RN---IEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             R+   IE+R+      I++WL KQ   SV+YV  GSGGTLS EQ  ELAWGLELS Q F+
Sbjct  220   RSNVLIEKRNS-----ILEWLDKQGERSVVYVCLGSGGTLSLEQTMELAWGLELSGQSFL  274

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WV+R P           + +  D     LPEGF  RT+  GLVV  WA Q  IL H S G
Sbjct  275   WVLRRPV-----SYLGGSSKDDDQVSACLPEGFLDRTRGVGLVVTEWAPQVEILSHRSIG  329

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFLSHCG +S LES+  GVPI+AWPLY+EQ  NAT+LTEE+GVAIR  +LP+K ++ REE
Sbjct  330   GFLSHCGWSSVLESLTKGVPIVAWPLYAEQWMNATMLTEEIGVAIRTSELPSKKVIGREE  389

Query  1419  VKTLVK--IMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             V +LVK  ++ + K+G++++ +  ++++SSE+A + GGSS++S+ E
Sbjct  390   VASLVKKIVVEEDKEGRKIKAKSAEVRVSSERAWTHGGSSHSSLVE  435



>ref|XP_004168405.1| PREDICTED: hydroquinone glucosyltransferase-like [Cucumis sativus]
Length=473

 Score =   384 bits (985),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/469 (42%), Positives = 305/469 (65%), Gaps = 12/469 (3%)
 Frame = +3

Query  162   SMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRL  341
             S+ H+ IL SPG+GH+IP +  A RL   H +  T F+I +   P++ Q    + L S +
Sbjct  6     SIPHLAILPSPGMGHLIPLIEFAKRLLSHHRLTFT-FIIASDGPPSQPQQALLNSLPSGI  64

Query  342   NNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR--LDALVVDFFCTEA  515
             +++ +PPV    L   N+K    + L +  +LP +R  L     +  L  LVVD F T+ 
Sbjct  65    HHLFLPPVTFDDL-PPNSKIETIITLTISRSLPSLRNVLKSMVSQSNLVGLVVDLFGTDG  123

Query  516   LPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVV  695
               +A E ++  +++ P+ A F +  ++ P LD  IVG++ +  + ++IPGC P++ +D++
Sbjct  124   FDIAREFDISSYIFFPSTAMFLSFALFLPKLDESIVGEFRDHPEPIKIPGCIPIQGKDLL  183

Query  696   DPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYA  872
             DP+ DR +  Y+  L     + +ADGI +N++ +++P  +K L+E E      GKP VY 
Sbjct  184   DPVQDRKNEAYKWTLHNARRYALADGIFLNSFPELEPGAIKYLQEEE-----AGKPLVYP  238

Query  873   IGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             IGPL + I+  + ++    ++WL +QP  SVL+VSFGSGGTLS+ QI ELA GLE+S QR
Sbjct  239   IGPLVK-IDADEKEERAECLKWLDEQPHGSVLFVSFGSGGTLSSAQIDELALGLEMSGQR  297

Query  1053  FIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             FIWVVR PS + +D  +F+    +D   ++LPEGF  RT+N+G+VVP WA QA IL H S
Sbjct  298   FIWVVRSPSDKAADATYFSVHSQSDPL-DFLPEGFVERTKNRGMVVPSWAPQAQILSHGS  356

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
             TGGFL+HCG NSTLES+ NG+P+IAWPLY+EQR NA +LTEE+ VA++P +   KGIV +
Sbjct  357   TGGFLTHCGWNSTLESVVNGIPLIAWPLYAEQRMNAVILTEEINVALKPKRNDNKGIVEK  416

Query  1413  EEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             EE+  +VK +L+ ++GK++R ++ +L+ +S+KA+   GSS   + +++N
Sbjct  417   EEISKVVKSLLEGEEGKKLRRKMKELEEASKKAVGEDGSSTKIVTDLVN  465



>ref|XP_010489562.1| PREDICTED: UDP-glycosyltransferase 72D1-like isoform X1 [Camelina 
sativa]
 ref|XP_010489563.1| PREDICTED: UDP-glycosyltransferase 72D1-like isoform X2 [Camelina 
sativa]
Length=467

 Score =   383 bits (984),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 202/461 (44%), Positives = 291/461 (63%), Gaps = 8/461 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNN  347
             H  +++SPG+GHIIP L L NRL+ V NV +TV  IT+  S  TE + + ++      + 
Sbjct  5     HALLVASPGLGHIIPVLELGNRLSSVLNVHVTVLAITSGTSSVTETETIHAAAARGTCDI  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             + +P V+I  L++     V ++   +R     V  A+    ++   ++VD F T  L + 
Sbjct  65    IELPSVEIDHLVEPGATVVTKILAKMRVMKSEVWDAVKSMKKKPTVMIVDLFGTGLLSIV  124

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             +   + K+VY+P++A F AL VY PVLD+ + G+YVE ++ ++IP CKP+ P++++D ML
Sbjct  125   EVGVMKKYVYIPSHAWFLALMVYLPVLDKVVQGEYVEIKEPMKIPSCKPIGPKELLDTML  184

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR+D QY E ++ G+   M+DG+L+NTWE++    L A RE+  LS+V+  PVY IGP+ 
Sbjct  185   DRSDQQYLECVQSGLEIPMSDGVLVNTWEELQRNILTAFREDGELSRVIKVPVYPIGPIV  244

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R       D    I +WL KQ   SV+YV  GSGG LS +Q  ELAWGLELS QRF+WV+
Sbjct  245   RT--NGHVDKPYSIFEWLDKQRERSVVYVCLGSGGKLSFKQTMELAWGLELSGQRFLWVL  302

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             R P+             G D   + LPEGF  R +  GLVV  WA Q  IL H S GGFL
Sbjct  303   RSPT-----SYLGACSSGDDQVSSSLPEGFLDRMRGVGLVVTEWAPQVEILSHGSIGGFL  357

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG +S LES+  G+PI+AWPLY+EQ  NATLLTEE+GVAIR  +LP+K ++ REEV  
Sbjct  358   SHCGWSSVLESLTKGIPILAWPLYAEQWMNATLLTEEIGVAIRTSELPSKKVIGREEVAF  417

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             LV  ++  + G+++R +  K+++SSE+A +  GSS+NS+ E
Sbjct  418   LVNKIIAEEDGRKIRSKAEKVRVSSERAWTHDGSSHNSLFE  458



>ref|XP_003524274.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Glycine 
max]
Length=505

 Score =   384 bits (986),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 203/464 (44%), Positives = 293/464 (63%), Gaps = 4/464 (1%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +L SPGIGH+ P L L+  L   H   +T   +TT  S  +  LL S  L   L+ V
Sbjct  19    HIAVLPSPGIGHVTPLLELSKLLVTHHQCHVTFLNVTTESSAAQNNLLHSPTLPPNLHVV  78

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +PPVD+S +++  T  VA+L + +R  L  +   L++   +  AL++D F T       
Sbjct  79    DLPPVDLSTMVNDQTTIVARLSVNLRETLRPLNTILSQLPDKPQALIIDMFGTHVFDTIL  138

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+P F +   +A   A +++ P LDR++ G++V+    +++PGCKP+R ED++D + +
Sbjct  139   E-NIPIFTFFTASAHLLAFSLFLPQLDRDVAGEFVDLPNPVQVPGCKPIRTEDLMDQVRN  197

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
             R   +Y+ YL       M+ GIL+NTW+D++PVTLKAL E+     +   P+Y IGPL +
Sbjct  198   RKIDEYKWYLYHVSRMTMSTGILLNTWQDLEPVTLKALSEHSFYRSINTPPLYPIGPLIK  257

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
               E    ++    + WL  QP  SVL+V+FGSGG LS+EQ  ELAWGLELS  RF+WVVR
Sbjct  258   ETESLTENEPE-CLAWLDNQPAGSVLFVTFGSGGVLSSEQQNELAWGLELSGVRFVWVVR  316

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
              P+   +  AFF  G G D   +YLPEGF +RT+ +GLVV  WA Q  ILRH STG F+S
Sbjct  317   VPNDASAFAAFFNAG-GDDDATSYLPEGFVSRTRERGLVVRSWAPQVAILRHASTGAFVS  375

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIR-PMKLPTKGIVTREEVKT  1427
             HCG NSTLES+ NGVP+IAWPLY+EQR N T + E+VGV +R   K   KG+V REE++ 
Sbjct  376   HCGWNSTLESVANGVPVIAWPLYAEQRMNGTTVEEDVGVGVRVRAKSTEKGVVGREEIER  435

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             +V+++++ ++GKEM+ R  +LK ++ K++S+GG SY     + N
Sbjct  436   VVRMVMEGEEGKEMKRRARELKETAVKSLSVGGPSYEMRAAMAN  479



>ref|XP_004133821.1| PREDICTED: hydroquinone glucosyltransferase-like [Cucumis sativus]
 gb|KGN56443.1| UDP-glucose:glucosyltransferase [Cucumis sativus]
Length=473

 Score =   380 bits (977),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 196/469 (42%), Positives = 304/469 (65%), Gaps = 12/469 (3%)
 Frame = +3

Query  162   SMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRL  341
             S+ H+ IL SPG+GH+IP +  A RL   H +  T F+I +   P++ Q    + L S +
Sbjct  6     SIPHLAILPSPGMGHLIPLIEFAKRLLSHHRLTFT-FIIASDGPPSQPQQALLNSLPSGI  64

Query  342   NNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR--LDALVVDFFCTEA  515
             +++ +P V    L   N+K    + L +  +LP +R  L     +  L  LVVD F T+ 
Sbjct  65    HHLFLPAVTFDDL-PPNSKIETIITLTISRSLPSLRNVLKSMVSQSNLVGLVVDLFGTDG  123

Query  516   LPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVV  695
               +A E ++  +++ P+ A F +  ++ P LD  IVG++ +  + ++IPGC P++ +D++
Sbjct  124   FDIAREFDISSYIFFPSTAMFLSFALFLPKLDESIVGEFRDHPEPIKIPGCIPIQGKDLL  183

Query  696   DPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYA  872
             DP+ DR +  Y+  L     + +ADGI +N++ +++P  +K L+E E      GKP VY 
Sbjct  184   DPVQDRKNEAYKWTLHNARRYALADGIFLNSFPELEPGAIKYLQEEE-----AGKPLVYP  238

Query  873   IGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             IGPL + I+  + ++    ++WL +QP  SVL+VSFGSGGTLS+ QI ELA GLE+S QR
Sbjct  239   IGPLVK-IDADEKEERAECLKWLDEQPHGSVLFVSFGSGGTLSSAQIDELALGLEMSGQR  297

Query  1053  FIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             FIWVVR PS + +D  +F+    +D   ++LPEGF  RT+N+G+VVP WA QA IL H S
Sbjct  298   FIWVVRSPSDKAADATYFSVHSQSDPL-DFLPEGFVERTKNRGMVVPSWAPQAQILSHGS  356

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
             TGGFL+HCG NSTLES+ NG+P+IAWPLY+EQR NA +LTEE+ VA++P +   KGIV +
Sbjct  357   TGGFLTHCGWNSTLESVVNGIPLIAWPLYAEQRMNAVILTEEINVALKPKRNDNKGIVEK  416

Query  1413  EEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             EE+  +VK +L+ ++GK++R ++ +L+ +S+KA+   GSS   + +++N
Sbjct  417   EEISKVVKSLLEGEEGKKLRRKMKELEEASKKAVGEDGSSTKIVTDLVN  465



>ref|XP_009114698.1| PREDICTED: UDP-glycosyltransferase 72D1 [Brassica rapa]
Length=477

 Score =   379 bits (973),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/467 (43%), Positives = 301/467 (64%), Gaps = 18/467 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNN  347
             H  +++SPG+GH+IP L L NRL+ V N+++TV  +T+  S   E + + +         
Sbjct  5     HALLVASPGLGHLIPILELGNRLSSVLNIRVTVLAVTSGSSSLAETEAIRAVVARGTCEV  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P VDI   ++ +     ++   +RA  P V+ A+    ++   ++VDF  T  + +A
Sbjct  65    TELPSVDIDHFVEPDATVFTKIVEKMRATKPVVQDAVKLMTQKPTVMIVDFLGTGMMSIA  124

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             D++ + K+VYV ++A F A+ VY PVLD+ + G+Y++ ++ ++IPGC+PV  +D+++ ML
Sbjct  125   DDVGMAKYVYVASHAWFLAVLVYLPVLDKVVEGEYIDIKEPMKIPGCRPVGADDIMETML  184

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR++  YRE +R G    M+DG+L+NTWE++   TL AL E+  LS+V+  PVYAIGP+ 
Sbjct  185   DRSNRHYRECVRCGEEIPMSDGVLVNTWEELQGNTLAALMEDGELSRVMKVPVYAIGPIV  244

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R+       +   I +WL KQ   SVLYV  GSGGTLS EQ  ELA GLELS Q F+WV+
Sbjct  245   RSNGPTKKPNS--IFEWLDKQRERSVLYVCLGSGGTLSLEQTIELACGLELSGQSFLWVL  302

Query  1068  RPPSM----RGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             R P+       +DD   + G         LPEGF  RT+  GLVV  WA Q  IL H S 
Sbjct  303   RKPTSYLGESSNDDDLVSVG---------LPEGFLDRTRGMGLVVTQWAPQVEILSHGSI  353

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFLSHCG +S LES+  GVPI+AWPLY+EQ  NAT LTEE+GVA+R  +LP+K +++RE
Sbjct  354   GGFLSHCGWSSVLESLTQGVPIVAWPLYAEQWMNATFLTEEIGVAVRTSELPSKRVISRE  413

Query  1416  EVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             EV +LV+ ++  + ++G+++R +  ++++SSE+A + GGSS++S+ E
Sbjct  414   EVASLVRKVMGEEDEEGRKVRAKAEEVRVSSERAWTQGGSSHSSLLE  460



>ref|XP_008437921.1| PREDICTED: hydroquinone glucosyltransferase-like [Cucumis melo]
 gb|ADN34176.1| UDP-glucose:glucosyltransferase [Cucumis melo subsp. melo]
Length=473

 Score =   378 bits (970),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 297/466 (64%), Gaps = 12/466 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ IL SPG+GH+IP +  A RL   H +  T F+I +   P++ Q    + L S ++++
Sbjct  9     HLAILPSPGMGHLIPLIEFAKRLLSHHRLTFT-FIIASDGPPSQPQQALLNSLPSGIDHL  67

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQC--RRLDALVVDFFCTEALPM  524
              +PP+    L   ++K    + L +  +LP +R  L        L  LVVD F T+A  +
Sbjct  68    FLPPLSFDDL-PPDSKIETIITLTISRSLPSLRNVLKSMVPQSNLVGLVVDLFGTDAFDV  126

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A E N+  +++ P+ A   +  ++ P LD  +VG++ +  + ++IPGC  +  +D++DP+
Sbjct  127   AREFNISSYIFFPSTAMLLSFALFLPKLDESVVGEFRDHPEPIKIPGCIAIEGKDLLDPV  186

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGP  881
              DR +  Y+  L     + +ADGI +N++ +++P  +K LRE EP     GKP VY IGP
Sbjct  187   QDRKNEAYKWTLHNAKRYALADGIFLNSFPELEPGAIKYLREEEP-----GKPLVYPIGP  241

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             L + I+  + ++    ++WL +QP  SVL+VSFGSGGTL + QI ELA GLE+S QRFIW
Sbjct  242   LVK-IDADEKEERAECLKWLDEQPHGSVLFVSFGSGGTLKSAQIDELALGLEMSGQRFIW  300

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVR PS + +D  +F+    +D    +LPEGF  RT+N+G+VVP WA QA IL H STGG
Sbjct  301   VVRSPSDKAADATYFSVHSQSDPL-GFLPEGFLERTKNRGMVVPSWAPQAQILSHGSTGG  359

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NSTLES+ NG+P+IAWPLY+EQR NA +LTEE+ VA++P +    GIV +EE+
Sbjct  360   FLTHCGWNSTLESVVNGIPLIAWPLYAEQRMNAVMLTEEINVALKPKRNEKTGIVEKEEI  419

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
               +VK +L+ ++GK++R ++ +LK +SEKA+   GSS   +  ++N
Sbjct  420   SKVVKSLLEGEEGKKLRRKMKELKEASEKAVGEDGSSTKIVTNLVN  465



>gb|AAD12211.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
Length=444

 Score =   376 bits (966),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 204/464 (44%), Positives = 299/464 (64%), Gaps = 37/464 (8%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNN  347
             H+ +++SPG+GH+IP+L L NRL+ V NV +T+  IT+  S  TE + + ++     L+ 
Sbjct  5     HVLLVASPGLGHLIPALELGNRLSFVLNVHVTILAITSGSSSLTETETIHTAAARGTLSK  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             +                         R     VR A+    ++   ++VDFF T  L + 
Sbjct  65    M-------------------------REMKSTVRDAVKSMKQKPTVMIVDFFGTALLSIT  99

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             D     K+VY+P++A F AL VY PVLD+ + G+YV+ ++ ++IPGCKPV P++++D ML
Sbjct  100   DVGVTSKYVYIPSHAWFLALIVYLPVLDKVMEGEYVDIKEPMKIPGCKPVGPKELLDTML  159

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR+D QYR+ +++G+   M+DG+L+NTW ++   TL ALRE+  L++V+  PVY IGP+ 
Sbjct  160   DRSDQQYRDCVQIGLEIPMSDGVLVNTWGELQGKTLAALREDIDLNRVIKVPVYPIGPIV  219

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             R     +  + T   +WL KQ   SV+YV  GSGGTLS EQ  ELAWGLELS Q F+WV+
Sbjct  220   RTNVLIEKPNST--FEWLDKQEERSVVYVCLGSGGTLSFEQTMELAWGLELSCQSFLWVL  277

Query  1068  R-PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             R PPS  G+      + +  D   + LPEGF  RT+  GLVV  WA Q  IL H S GGF
Sbjct  278   RKPPSYLGA------SSKDDDQVSDGLPEGFLDRTRGVGLVVTQWAPQVEILSHRSIGGF  331

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             LSHCG +S LES+  GVPIIAWPLY+EQ  NATLLTEE+G+AIR  +LP+K +++REEV 
Sbjct  332   LSHCGWSSVLESLTKGVPIIAWPLYAEQWMNATLLTEEIGMAIRTSELPSKKVISREEVA  391

Query  1425  TLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             +LVK ++  + K+G++++ +  ++++SSE+A + GGSS++S+ E
Sbjct  392   SLVKKIVAEEDKEGRKIKTKAEEVRVSSERAWTHGGSSHSSLFE  435



>ref|XP_009150723.1| PREDICTED: UDP-glycosyltransferase 72D1-like [Brassica rapa]
 ref|XP_009150724.1| PREDICTED: UDP-glycosyltransferase 72D1-like [Brassica rapa]
 ref|XP_009150725.1| PREDICTED: UDP-glycosyltransferase 72D1-like [Brassica rapa]
Length=469

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 203/469 (43%), Positives = 304/469 (65%), Gaps = 22/469 (5%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +++SPG+GH+IP L L NRL+ V  + +T+  +T+  SP E + + ++         
Sbjct  5     HAVLVASPGLGHLIPILELGNRLSSVLKIHVTILAVTSGSSPIETEAIRAAVARGTCEVR  64

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALP--GVRAALTKQCRRLDALVVDFFCTEALPM  524
              +P +DI    DA      ++  ++RA      V+ A+    R+   ++VD F T  + +
Sbjct  65    ELPSIDIDHSPDATVP--TKIIEMMRATKTKTAVQDAVKSMNRKPTVMIVDIFGTGLMSI  122

Query  525   ADELNL-PKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDP  701
             AD++ +   +VYVP++A F A+ VY PVLDR + G+Y + ++ ++IPGC+PV P+++++ 
Sbjct  123   ADDIGVNATYVYVPSHAWFLAVVVYTPVLDRVVEGEYTDIKEPMKIPGCRPVGPDELMET  182

Query  702   MLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGP  881
             MLDR++ QYRE +R  +   M+ G+L+NTWE++   TL AL E+  LS+V+  PVY IGP
Sbjct  183   MLDRSNPQYRECMRCCMEIPMSHGVLVNTWEELQGNTLSALTEDGELSRVMKAPVYGIGP  242

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             + R+    +  D   I++WL KQP +SV++V  GSGGTLS EQ  ELA+GL+LS QRF+W
Sbjct  243   IVRSSGPTEKADN--ILEWLDKQPDKSVVFVCLGSGGTLSLEQTMELAYGLDLSGQRFLW  300

Query  1062  VVRPPS----MRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             V+R P+       +DD   + G         LPEGF  RT+  GLVV  WA Q  IL H 
Sbjct  301   VLRRPTSYLGASSTDDDQVSAG---------LPEGFLDRTRGMGLVVTQWAPQVEILSHG  351

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVT  1409
             S GGFLSHCG +S LES+  GVPI+AWPLY+EQ  NATLLTE++GVA+R  +LP+K ++ 
Sbjct  352   SIGGFLSHCGWSSVLESLTKGVPIVAWPLYAEQWMNATLLTEDIGVAVRTSELPSKRVIG  411

Query  1410  REEVKTLV-KIML-QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             REEV TLV KIM+ + ++G+++R +  +++ SSE+A + GGSSY S+ E
Sbjct  412   REEVATLVRKIMVEEDEEGQKVRAKAEEVRASSERAWAQGGSSYRSLFE  460



>ref|XP_008338748.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Malus 
domestica]
Length=479

 Score =   376 bits (966),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 202/464 (44%), Positives = 297/464 (64%), Gaps = 13/464 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  IL SPG+GH+IP L L  RL    N  +T+F+     SP+    L+++     L+ V
Sbjct  6     HAAILCSPGMGHLIPVLELGKRLVTHLNFAVTIFI-----SPSSEAELKAATSXKILDIV  60

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              + P DIS L+  +T    +L +++R      R+A+         L+VD F TE+ P+A+
Sbjct  61    QLXPPDISGLVGPDTSVPTKLVVMMRELRXVFRSAVRAMKFTPTMLIVDLFGTESFPIAZ  120

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPE-DVVDPML  707
             EL +PK+++  +NA F +  + C   D+E+ G +V+ ++ L++PGC+  RP+ DV D ML
Sbjct  121   ELGIPKYLFFASNAWFFSFLICCLTFDKEVEGNFVDHKEPLKVPGCREFRPQLDVFDVML  180

Query  708   DRNDVQYREYLRLGVGF-GMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
              R + QY +++ +       +DGIL+N WE+++P TL ALR+   L + +  PVY IGP+
Sbjct  181   YRTNQQYHDFVGIXSRIPKCSDGILLNMWEELEPTTLAALRDENLLGRHLXVPVYPIGPI  240

Query  885   TR--NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
              R  ++    G     +  WL KQP ESV+++SFGSGG LS EQ+TE+AWGLE S+QRFI
Sbjct  241   IRPNDLSCSKGK----VFDWLDKQPSESVIFLSFGSGGALSHEQMTEIAWGLEFSQQRFI  296

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WV+  P+   +D A+ TT    +    YLPEGF  RT++ GLV+P WA Q  IL HPS G
Sbjct  297   WVICAPTTTTADAAYLTTDXDDESPLKYLPEGFVDRTKDLGLVIPXWAPQVEILAHPSVG  356

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFLSHCG +STLES+ NGVP+I WPL++EQR NATLLTEE  VA+R    P K +V R+E
Sbjct  357   GFLSHCGWSSTLESLTNGVPMIVWPLHAEQRVNATLLTEEFEVAVRSKIPPWKKVVDRKE  416

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             ++ +V+++++ +KG  +RER+ KLK S+ KA+  GGSS N++ +
Sbjct  417   IEEMVRMIMEDQKGFVLRERMKKLKESAAKALGEGGSSRNALSQ  460



>emb|CDY72102.1| BnaA07g37370D [Brassica napus]
Length=438

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 199/477 (42%), Positives = 302/477 (63%), Gaps = 55/477 (12%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + SSPG+GH+IP + LA RL+  H  ++TVFV+ T  +  + + L SS +    + V
Sbjct  7     HAAMFSSPGMGHLIPVIELAKRLSANHGFRVTVFVLETDAASAQSKFLTSSGV----DFV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  DIS L++     V ++ +++R  +P +R+ + +  ++  AL++D F T+AL +A 
Sbjct  63    NLPSPDISQLVNPADHVVTKIGVIMRETVPALRSKIAEMNQKPTALIIDLFGTDALCLAS  122

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+              LT                  K LEIPGC+PVR ED +D  L 
Sbjct  123   EFNM--------------LT------------------KPLEIPGCEPVRFEDTMDAYLV  150

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  YR+++R  + +  ADGIL+NTW++++P +LK+L++ + L +V   PVY +GPL R
Sbjct  151   PDEPLYRDFIRHCLAYPKADGILVNTWDEMEPRSLKSLQDPKLLGRVARVPVYPVGPLCR  210

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +E  + D    ++ WL++QP ESVLY+SFGSGG+L+A+Q+TELAWGLE S+QRF+WVVR
Sbjct  211   PVETSETDHP--VLNWLNEQPDESVLYISFGSGGSLTAKQLTELAWGLEQSQQRFVWVVR  268

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP            G   D TP YLPEGF TRT ++GLVVP WA Q  +L H + GGFL+
Sbjct  269   PP---------VDGGGAKDSTPEYLPEGFVTRTCDRGLVVPSWAPQTEVLAHRAVGGFLT  319

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLE + +GVP+IAWPL++EQ  NA LL++E+G+A+R     +K  +TR E++ +
Sbjct  320   HCGWNSTLEGVVSGVPMIAWPLFAEQNMNAALLSDELGIAVRADD--SKEAITRSEIEAV  377

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNA----IEKRRDL  1583
             V+ ++  ++GKEMR RV +L+  +E ++SI  GGS++ S+C+V       +E+ RDL
Sbjct  378   VRKVMAEEEGKEMRRRVKELRDKAEMSLSIDGGGSAHESLCKVTEECTRFLERDRDL  434



>ref|XP_010468740.1| PREDICTED: UDP-glycosyltransferase 72D1 [Camelina sativa]
Length=470

 Score =   375 bits (962),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 209/468 (45%), Positives = 303/468 (65%), Gaps = 19/468 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +++SPG+GH+IP L L NRL+ V NV++T+  +T+  S +       +        +
Sbjct  5     HAVLVASPGLGHLIPILELGNRLSSVLNVQVTILAVTSGSSSSTETEAIRAAAARTACQI  64

Query  351   G-IPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P +DI  L++ +     ++ + VRA    VR A+     +   ++VDF  T  + +A
Sbjct  65    TELPSMDIDNLVEPDATVFTKIMVKVRAMKSSVRDAVESMKPKPTVMIVDFLGTGLMSVA  124

Query  528   DELNL-PKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             D+L L  K+VYVP++A F A+ VY PV D  + G+YVE ++ L+IPGCKP+  +++V+ M
Sbjct  125   DDLGLTAKYVYVPSHAWFLAMMVYLPVWDTTVEGEYVEIKEPLKIPGCKPMGRKELVETM  184

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             L R+D QY+E +R G+   M+DG+L+NTWE++   TL AL+E+E LS+V+  PVY IGP+
Sbjct  185   LYRSDQQYKECVRAGLEVPMSDGVLVNTWEELQGNTLAALKEDEELSRVMKVPVYPIGPI  244

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R+ E  +  +   I +WL KQ   SV+YV  GSGGTLS EQ  ELAWGLELS QRF+W+
Sbjct  245   VRSKEHVEKPN--TIFEWLDKQRERSVVYVCLGSGGTLSLEQTIELAWGLELSGQRFLWI  302

Query  1065  VR-PPSMRGS---DDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             +R P S  GS   DD         D     LPEGF  RT   GLVV  WA Q  IL H S
Sbjct  303   LRRPASYLGSSSIDD---------DQVIASLPEGFLDRTCGVGLVVTQWAPQVEILSHRS  353

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
              GGFLSHCG +S LES+ NGVPI+AWPLY+EQ  NATLLTEE+GVA+R  +LP++ ++ R
Sbjct  354   IGGFLSHCGWSSVLESLTNGVPIMAWPLYAEQWMNATLLTEEIGVAVRTSELPSERVIGR  413

Query  1413  EEVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             EEV  LV+ ++  + ++G+ +R +  ++++SSE+A + GGSS++S+ E
Sbjct  414   EEVAFLVRKIVAEEDEEGQRIRAKAEEVRVSSERAWTKGGSSHSSLFE  461



>gb|KEH27552.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=517

 Score =   376 bits (966),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 211/521 (40%), Positives = 304/521 (58%), Gaps = 57/521 (11%)
 Frame = +3

Query  90    YSPHLYQLPT-RRFTYSIIMDNNNQ-------------------SMLHIGILSSPGIGHI  209
             Y P++   P   ++ + I M+ +NQ                     +H  +L+SPGIGH+
Sbjct  12    YRPNITPFPNVHKYLFIIFMNQHNQEETKLTLYKRNQQLVTMVSQKIHSVLLASPGIGHL  71

Query  210   IPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVGI---PPVDISAL  380
             IP++ L  RL   HN  +T+FV+TTA S +++         S LN++ I   PPVD+S  
Sbjct  72    IPTIELGKRLTTHHNFDVTIFVVTTATSDSDKTKSHILQQISNLNSLDIIVTPPVDVSDK  131

Query  381   LDANTKPVA-QLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMADELNLPKFVY  557
             LD N   +  Q+ L +  +LP +R+ +         L+VD F T A PMA          
Sbjct  132   LDPNNPSLGLQIVLTMIESLPFIRSEIQSMKNPPSVLIVDIFGTAAFPMA----------  181

Query  558   VPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLDRNDVQYREY  737
                                E   ++ +  + L I GC+PVR ED ++  +      ++ Y
Sbjct  182   ------------------HEAFSRHAKNHEPLSILGCEPVRFEDTLETFVAPWGPIHKRY  223

Query  738   LRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTRNIE-ERDGD  914
             + +       DGIL+NTW D++P   KA+ EN  L + V  PVY IGPL R  E E+ GD
Sbjct  224   VEVTREIIAIDGILVNTWHDLEPGATKAVIENGVLGRFVKGPVYPIGPLVRTGEPEKGGD  283

Query  915   DGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVRPPSMRGSD  1094
                +I+ WL +QP ESV+Y+SFGSGGT+S  Q+ ELA+GLELS+QRFIWVVR P+   + 
Sbjct  284   SENLILSWLDQQPAESVIYLSFGSGGTMSKGQMRELAYGLELSQQRFIWVVRRPTEDNAS  343

Query  1095  DAFFTTGQGADGT--PNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLSHCGCNS  1268
               FF    GADGT   +YLP+GF  RT++ GL VPMWA QA IL+HPSTGGFL+HCG NS
Sbjct  344   ATFFNIA-GADGTIMVDYLPKGFLNRTKDVGLCVPMWAPQAEILKHPSTGGFLTHCGWNS  402

Query  1269  TLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMK-LPTKGIVTREEVKTLVKIML  1445
              LESI NGVP++AWPLY+EQ+ NAT+L+EE+GVA++  K +   G+V RE++  +++ ++
Sbjct  403   VLESIHNGVPMVAWPLYAEQKMNATMLSEELGVAVKATKTVAEGGVVCREKIAEVIRKVM  462

Query  1446  QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
                +G  MR +V + K+S EKA+S+ GSS+ S+C++    E
Sbjct  463   VDDEGVAMRVKVKEYKVSGEKALSVFGSSHESLCKMAKDCE  503



>ref|XP_010490444.1| PREDICTED: UDP-glycosyltransferase 72D1-like [Camelina sativa]
Length=475

 Score =   374 bits (961),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 208/468 (44%), Positives = 302/468 (65%), Gaps = 19/468 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +++SPG+GH+IP L L N L+ V NV++T+  +T+  S +       +        +
Sbjct  5     HAVLVASPGLGHLIPILELGNCLSSVLNVQVTILAVTSGSSSSTETEAIRAAAARTACKI  64

Query  351   G-IPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P +DI  L + +     ++ + VRA    VR A+     +   ++VDFF T  + +A
Sbjct  65    TELPSMDIDNLAEPDATVFTKIRVKVRAMKSAVRDAVESMKPKPTVMIVDFFGTGLMSVA  124

Query  528   DELNL-PKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             D+L L  K+VYVP++A F A+ VY PV D  + G+YVE ++ L+IPGCKP+  +++++PM
Sbjct  125   DDLGLTAKYVYVPSHAWFLAVMVYLPVWDTTVEGEYVEIKEPLKIPGCKPMGRKELMEPM  184

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR+D QY+E +R G+   M+DG+L+NTWE++   TL ALRE+E LS+++  PVY IGP 
Sbjct  185   LDRSDQQYKECVRAGLEVPMSDGVLVNTWEELQGNTLAALREDEELSRLMKVPVYPIGPT  244

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              R  E+    +   I +WL KQ   SV+YV  GSGGTLS EQ  ELAWGLELS QRF+W+
Sbjct  245   VRTKEQVGKPNS--IFEWLDKQRERSVVYVCLGSGGTLSFEQTMELAWGLELSGQRFLWI  302

Query  1065  V-RPPSMRGS---DDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             + RP S  GS   DD         D     LP+GF  RT   GLVV  WA Q  IL H S
Sbjct  303   LRRPASYLGSSSIDD---------DQVIASLPDGFLDRTCGVGLVVTQWAPQVEILSHKS  353

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
              GGFLSHCG +S LES+  GVPI+AWPLY+EQ  NATLLTEE+GVA+R  +LP++ ++ R
Sbjct  354   IGGFLSHCGWSSVLESLTQGVPIVAWPLYAEQWMNATLLTEEIGVAVRTSELPSERVIGR  413

Query  1413  EEVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             EEV +LV+ ++  + ++G+ +R +  ++++SSE+A + GGSS++S+ E
Sbjct  414   EEVASLVRKIVAEEDEEGQRIRAKAEEVRVSSERAWTKGGSSHSSLFE  461



>ref|XP_008220762.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Prunus mume]
Length=478

 Score =   374 bits (960),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 295/473 (62%), Gaps = 10/473 (2%)
 Frame = +3

Query  138   IIMDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLE  317
             ++     Q   H+ +L+SPG+GH+IP L LA RL   H  ++T   I+T   P + QLL 
Sbjct  1     MVARETTQKKPHVAVLASPGVGHVIPLLELAKRLVVDHGFQVTFLTISTDAPPAQIQLLN  60

Query  318   SSDLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVD  497
             SS L   L+ + +P VD+S LL  +T    ++ L+VR  L  + + LT     + +L+VD
Sbjct  61    SSTLLPDLHVIHLPHVDVSNLLTPSTGVSVRIVLIVRQTLSYLPSVLTNMQPHIQSLIVD  120

Query  498   FFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPV  677
              FC  A+  A   ++P ++++ T+A FTALT+Y P L  ++ G Y +  + + +PGC P+
Sbjct  121   PFCVGAVEYAAAFSIPTYLFLTTSASFTALTMYFPTLHAQVDGDYSKIAEKVVVPGCNPL  180

Query  678   RPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVG  857
               +D++  +L        E L L     +  G+ +NTWE+++PVTL A+R+N     +  
Sbjct  181   LLDDLIPGVL------MPEVLPLCNQIPLVKGVFINTWEELEPVTLGAVRKNPFFLGLPA  234

Query  858   KPVYAIGPLTRNIEER---DGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAW  1028
              P+Y IGP+T+  E+       +   ++ WL KQP +SV+YVSFGSGGTLS EQ++ELAW
Sbjct  235   PPIYPIGPMTKGNEDEPLTSTLEPKKMLTWLDKQPPDSVVYVSFGSGGTLSGEQMSELAW  294

Query  1029  GLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQ  1208
             GLELS+ RF+W+ RPPS   +  +FF  G  A+G  +YLP+GF  RT+ +GLV+  WA Q
Sbjct  295   GLELSQTRFVWLARPPSEVSASGSFFEAGYDAEGAASYLPDGFLDRTRERGLVISSWAPQ  354

Query  1209  ALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKL  1388
               +L H S  GF++HCG NS LESI  GV +IAWPLY+EQ  NA +L  ++GVA+ P   
Sbjct  355   VAVLSHGSVAGFVTHCGWNSVLESIAQGVGMIAWPLYAEQSMNARMLV-DMGVAVWPKPA  413

Query  1389  PTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMC  1547
               + +V R EV+ +V+ +++ ++GK MR++V++L+ ++ KA+ +GGSS  S+ 
Sbjct  414   GDRAVVGRGEVERVVRSVMEGEQGKAMRQKVIELQGTALKALGLGGSSNASLA  466



>ref|XP_010667692.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like [Beta 
vulgaris subsp. vulgaris]
Length=468

 Score =   372 bits (956),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 197/472 (42%), Positives = 295/472 (63%), Gaps = 12/472 (3%)
 Frame = +3

Query  159   QSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSR  338
              S  H+ +L+SPG GH+IP + LA RLA  H + +T+F +T +    E ++  S+  + R
Sbjct  4     SSKTHVALLASPGSGHLIPVVELAKRLAAHHELTITIFAVTPSVHRAEDEIYGSAISSWR  63

Query  339   --LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTE  512
               +N V +P    +    +    +  L  ++R ALP +R+A+     +  AL+VD F TE
Sbjct  64    GVINTVILPTE--TQNFPSKQSFIPTLLDMMRDALPALRSAINGMKNKPIALIVDQFSTE  121

Query  513   ALP-MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPED  689
             A+  +A E N+ K+V++ +NA F +  +Y P +D+      V +++   IPGC+P+  ED
Sbjct  122   AIKTIAQEFNMFKYVFIASNAMFLSYNLYLPHVDK-----VVNRDEPFYIPGCEPIPGED  176

Query  690   VVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVY  869
             +++     ++  Y++++R+G      DGIL+NTW+D++  TL A ++   + ++   PVY
Sbjct  177   LLELTFIPDERPYKDFVRMGYDIAAVDGILVNTWDDLEAKTLLAFKDLRFMKEIAKAPVY  236

Query  870   AIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQ  1049
              IGP+ R  E + G    +I +WL +QP ESV+YVSFGSGGT+SA+Q  ELA GLELS+Q
Sbjct  237   PIGPVVRTGEPK-GLKPELI-KWLDRQPNESVVYVSFGSGGTISAQQTIELAMGLELSKQ  294

Query  1050  RFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             RFIWV+RPP    +  + F +  G  G   YLP+GF  RT   G +VPMWA Q  IL H 
Sbjct  295   RFIWVIRPPIENDNAGSLFKSMHGEGGLSKYLPDGFVDRTHEVGFIVPMWAPQDEILPHR  354

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVT  1409
             S G F+ HCG NSTLESI NGVPIIAWPLY+EQ+ NAT+L   +G+A+R    P+  +V 
Sbjct  355   SIGAFVCHCGWNSTLESIVNGVPIIAWPLYAEQKMNATMLVNNLGIAVRSHVKPSMELVE  414

Query  1410  REEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAI  1565
             R E+  +V+ ++  K+G  +R RV +LK S+ KA+S GGSSYN++ EV+  I
Sbjct  415   RGEIAKMVRRVMVDKEGIGIRTRVNELKASANKALSEGGSSYNALSEVVKKI  466



>emb|CDY13025.1| BnaC07g03240D [Brassica napus]
Length=470

 Score =   372 bits (956),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 198/469 (42%), Positives = 299/469 (64%), Gaps = 29/469 (6%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNN  347
             H  +++SPG+GH+IP L L NRL+ V N ++TV  +T+  S   E + + +         
Sbjct  5     HALLVASPGLGHLIPILELGNRLSSVLNFRVTVLAVTSGSSSLAETEAIRAVVARGTCEV  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P VDI   ++ +     ++   +RA  P V+ A+    ++   ++VDF  T  + +A
Sbjct  65    TELPSVDIDYFVEPDATVFTKIVEKMRATKPVVQDAIKLMTQKPTVMIVDFLGTGMMSIA  124

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             D++ + K+VYV ++A F A+ VY PVLD+ + G+Y++ ++ ++IPGC+PV  +D+++ ML
Sbjct  125   DDVGMAKYVYVASHAWFLAVLVYLPVLDKVVEGEYIDIKEPMKIPGCRPVGADDLMETML  184

Query  708   DRNDVQYREYLRLG--VGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGP  881
             DR++  YRE +R G  +   M+DG+L+NTWE++   TL AL E+  LS+V+  PVYAIGP
Sbjct  185   DRSNRHYRECVRCGEEIPMTMSDGVLVNTWEELQGNTLAALMEDGELSRVMKVPVYAIGP  244

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             +  +I            +WL KQ   SVLY+  GSGGTLS EQ  ELA GLELS QRF+W
Sbjct  245   IPNSI-----------FEWLDKQRERSVLYLCLGSGGTLSLEQTIELACGLELSGQRFMW  293

Query  1062  VVRPPSM----RGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             V+R P+       +DD   + G         LPEGF  RT+  GLVV  WA Q  IL H 
Sbjct  294   VLRKPASYLGESSNDDDLVSVG---------LPEGFLDRTRGMGLVVTQWAPQVEILSHG  344

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVT  1409
             S GGFLSHCG +S LES+  GVPI+AWPLY+EQ  NA  LTEE+GVAIR  +LP+K +++
Sbjct  345   SIGGFLSHCGWSSVLESLTQGVPIVAWPLYAEQWMNAAFLTEEIGVAIRTSELPSKRVIS  404

Query  1410  REEVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             REEV +LV+ +L  + ++G+++R +  ++++S+E+A + GGSS++S+ E
Sbjct  405   REEVASLVRKVLGEEDEEGRKVRAKAEEVRVSTERAWTQGGSSHSSLLE  453



>gb|AFJ52917.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=483

 Score =   370 bits (950),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 205/495 (41%), Positives = 311/495 (63%), Gaps = 25/495 (5%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             M +N Q+  HI IL SPG+GH+IP + L  RL   HN+ +T  + TT D+P    +    
Sbjct  1     MADNTQTP-HIAILPSPGMGHLIPLVELTKRLVTRHNLAVTFIIPTTTDAPPSAAMKSVL  59

Query  324   DL--TSRLNNVGIPPVDI------SALLDANTKPVAQLCLLVRAALPGVRAAL----TKQ  467
             D   +S ++++  PPV +      S+  DA  + +  L L V  +LP +R A     T  
Sbjct  60    DSLPSSSVDSIFPPPVSLHDVVFNSSASDAKIETI--LSLTVARSLPSLRDAFRSIATSG  117

Query  468   CRRLDALVVDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEK  647
              RRL ALVVD F T+A  +A E     +++ P+ A   +L +Y P LD E+ G Y   E+
Sbjct  118   LRRLSALVVDLFGTDAFDVAAEFGAASYIFYPSTAMALSLFLYLPKLDAEVTGPYSNLEE  177

Query  648   GLEIPGCKPVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALR  827
              ++IPGC PV   D++DP+ DRN+  Y   L     + +ADG+++N++ +++P  +K+L+
Sbjct  178   PVQIPGCIPVNGTDLLDPVQDRNNDAYSWLLHHAKRYRLADGVMVNSFPELEPGAIKSLQ  237

Query  828   ENEPLSKVVGKP-VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSA  1004
             + E   ++  KP VY +GPL      +    G+  + WL  QP  SVL+VSFGSGGTLS 
Sbjct  238   KTE--DQLGRKPMVYPVGPLVNMDSPKK--TGSECLDWLDVQPSGSVLFVSFGSGGTLSY  293

Query  1005  EQITELAWGLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGL  1184
             +QI ELA+GLE+SEQRFIWVVR P  + ++ +FFT  Q  +    +LP GF  RT+ +GL
Sbjct  294   DQINELAFGLEMSEQRFIWVVRSPDDKTANASFFTV-QSQNDPFYFLPNGFLDRTRGRGL  352

Query  1185  VVPMWAEQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVG  1364
             VV  WA QA IL H STGGFL+HCG NSTLES+ NGVP+I WPLY+EQ+ NA +LTE++ 
Sbjct  353   VVSSWAPQAQILSHSSTGGFLTHCGWNSTLESVANGVPLIVWPLYAEQKMNAMMLTEDIK  412

Query  1365  VAIRPMKLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             VA+RP ++ ++ ++ REE+  +++ +++ ++GK++R R+ +LK ++ K +S  GSS  ++
Sbjct  413   VALRPKRMGSR-VIGREEIGNVMRSLMEGEEGKKVRYRMKELKDAARKVLSKDGSSSRAL  471

Query  1545  CEVLNAIEKRRDLKI  1589
              EV   ++K +D K+
Sbjct  472   SEV---VQKWKDQKV  483



>emb|CDY43896.1| BnaA07g01730D [Brassica napus]
Length=468

 Score =   369 bits (947),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 195/467 (42%), Positives = 296/467 (63%), Gaps = 27/467 (6%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNN  347
             H  +++SPG+GH+IP L L NRL+ V N+++TV  +T+  S   E + + +         
Sbjct  5     HALLVASPGLGHLIPILELGNRLSSVLNIRVTVLAVTSGSSSLAETEAIRAVVARGTCEV  64

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
               +P VDI   ++ +     ++   +RA  P V+ A+    ++   ++VDF  T  + +A
Sbjct  65    TELPSVDIDHFVEPDATVFTKIVEKMRATKPVVQDAVKLMTQKPTVMIVDFLGTGMMSIA  124

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
             D++ + K+VYV ++A F A+ VY PVLD+ + G+Y++ ++ ++IPGC+PV  +D+++ ML
Sbjct  125   DDVGMAKYVYVASHAWFLAVLVYLPVLDKVVEGEYIDIKEPMKIPGCRPVGADDLMETML  184

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR++  YRE +R G    M+DG+L+NTWE++   TL AL E+  L +V+  PVYAIGP+ 
Sbjct  185   DRSNRHYRECVRCGEEIPMSDGVLVNTWEELQGNTLAALMEDGELRRVMKVPVYAIGPIP  244

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
              +           I +WL KQ   SVLYV  GSGGTLS EQ  ELA GLELS Q F+WV+
Sbjct  245   NS-----------IFEWLDKQRERSVLYVCLGSGGTLSLEQTIELACGLELSGQSFLWVL  293

Query  1068  RPPSM----RGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             R P+       +DD   +           LPEGF  RT+  GLVV  WA Q  IL   S 
Sbjct  294   RKPTSYLGESSNDDDLLSVA---------LPEGFLDRTRGMGLVVTQWAPQVEILSRGSI  344

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFLSHCG +S LES+  GVPI+AWPLY+EQ  NAT LTEE+GVA+R  +LP+K +++RE
Sbjct  345   GGFLSHCGWSSVLESLTQGVPIVAWPLYAEQWMNATFLTEEIGVAVRTSELPSKRVISRE  404

Query  1416  EVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCE  1550
             EV +LV+ ++  + ++G+++R +  ++++SSE+A + GGSS++S+ E
Sbjct  405   EVASLVRKVMGEEDEEGRKVRAKAEEVRVSSERAWTQGGSSHSSLLE  451



>ref|XP_007224074.1| hypothetical protein PRUPE_ppa015442mg [Prunus persica]
 gb|EMJ25273.1| hypothetical protein PRUPE_ppa015442mg [Prunus persica]
Length=478

 Score =   367 bits (943),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 192/473 (41%), Positives = 290/473 (61%), Gaps = 10/473 (2%)
 Frame = +3

Query  138   IIMDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLE  317
             ++     Q   H+ +L+SPG+GH+ P L LA RL   H  ++T    +T   P + QLL 
Sbjct  1     MVARETTQKKPHVAVLASPGMGHVTPLLQLAKRLVVDHGFQVTFLSTSTDAPPAQIQLLN  60

Query  318   SSDLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVD  497
             SS L   L+ + +P VD+S LL A T    ++ L+V   L  + + LT     + +L+VD
Sbjct  61    SSTLPPDLHVIHLPHVDVSNLLTAATGISVRIILVVLQTLSHLPSVLTNMQPPIQSLIVD  120

Query  498   FFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPV  677
              FC  AL  A   ++P ++++ T+A FTALT+Y P L  ++ G Y +  + + +PGC P+
Sbjct  121   PFCVGALEYAAAFSIPTYLFLTTSASFTALTMYFPTLHAQVDGDYSKIAEKVVVPGCNPL  180

Query  678   RPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVG  857
               +D++  +L        E L L     +  G+ +NTWE+++PV L A+R+N     +  
Sbjct  181   LLDDLIPGVL------MPEVLPLCNRIPLVKGVFINTWEELEPVALGAVRKNPFFLGLPA  234

Query  858   KPVYAIGPLTRNIEER---DGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAW  1028
              PVY IGPLT+  E+       +   ++ WL KQP +SV+YVSFGSGGTLS EQ++ELAW
Sbjct  235   PPVYPIGPLTKGNEDEPLTSTLESKKMLTWLDKQPPDSVVYVSFGSGGTLSGEQMSELAW  294

Query  1029  GLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQ  1208
             GLELS+ RF+WV RPPS   +  +FF  G  A G  +YLP+GF  RT+ +GLV+  WA Q
Sbjct  295   GLELSQTRFVWVARPPSEVSASGSFFEAGYDAKGAASYLPDGFLDRTRERGLVISSWAPQ  354

Query  1209  ALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKL  1388
               +L H S  GF++HCG NS LESI  GV +IAWPLY+EQ  NA +L  ++GVA+ P   
Sbjct  355   VAVLSHGSVAGFVTHCGWNSVLESIAQGVGMIAWPLYAEQSMNARMLV-DMGVAVWPKPA  413

Query  1389  PTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMC  1547
               + +V R EV+ +V+ +++ ++GK MR++V++L+ ++ KA+ +GGSS  S+ 
Sbjct  414   GERAVVGRGEVERVVRSVMEGEQGKAMRQKVIELQGTAFKALGLGGSSNASLA  466



>gb|AGU14069.1| UDP-glycosyltransferase [Cicer arietinum]
Length=427

 Score =   364 bits (935),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/406 (45%), Positives = 266/406 (66%), Gaps = 8/406 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTER--QLLESSDLTSRLN  344
             H+ +L+SPG+GH+IP++ L  RL   HN+  TVFV+TT  S   R   +L+    TS LN
Sbjct  7     HVVLLASPGMGHLIPTIELGKRLTTHHNLNATVFVVTTDHSSDTRTSNILQQ---TSNLN  63

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPM  524
              V +P +D+S  L      VA++ L +  +LP +R+ +        +L+VD F T ALPM
Sbjct  64    IVLVPSIDVSDKLPPKPSLVARIILTLIESLPFIRSQIQSMELPPSSLIVDIFGTVALPM  123

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A +L++  +V+  T+A F+A+T+Y P +D E + ++    + L IPGC+PVR ED ++  
Sbjct  124   ARDLHMSTYVFFATSAWFSAVTIYLPFIDEEALSRHANDHEPLFIPGCEPVRFEDTLETF  183

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             +      +  ++        ADGILMNTW D++P T+KA+ E   L +     VY++GPL
Sbjct  184   VSPYGPTHEGFVNTVKNILTADGILMNTWHDLEPKTIKAVSEQGILGRFTKGSVYSVGPL  243

Query  885   TRNIEE--RDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
              R +E   +  ++G +I+ WL +QP ESV+Y+SFGSGGT+S  Q+ ELA+GLELS+QRF+
Sbjct  244   VRTVEPELKREENGNLILSWLDRQPAESVIYLSFGSGGTMSERQMRELAYGLELSQQRFV  303

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVR P    +  AFF    G+    +YLPEGF TRT+  GL +PMWA QA IL+HPS G
Sbjct  304   WVVRRPIEGDASAAFFERVDGS-AVVDYLPEGFMTRTKEVGLCIPMWAPQAEILKHPSIG  362

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIR  1376
             GF++HCG NSTLESI +GVP++AWPLY+EQ+ NA +L+E++GVA R
Sbjct  363   GFVTHCGWNSTLESILSGVPMVAWPLYAEQKMNAAMLSEKIGVAAR  408



>ref|XP_011037856.1| PREDICTED: hydroquinone glucosyltransferase-like [Populus euphratica]
Length=511

 Score =   366 bits (939),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 205/502 (41%), Positives = 310/502 (62%), Gaps = 16/502 (3%)
 Frame = +3

Query  99    HLYQLPTRRFTYSIIMDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVI  278
             HL Q   R F +  + + ++    H+ IL SPG+GH+IP + LA RL   HN+ +T F+I
Sbjct  21    HL-QTINRSFFFPAMAETDSPP--HVAILPSPGMGHLIPLVELAKRLVHQHNLSVT-FII  76

Query  279   TTADSPTERQLLESSDLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVR---  449
              T  SP++ Q      L S ++++ +PPV +S L + + K    + L V  +LP +R   
Sbjct  77    PTDGSPSKAQRSVLGSLPSTIHSLFLPPVSLSDLPE-DAKIETLISLTVARSLPSLRDVL  135

Query  450   AALTKQCRRLDALVVDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQ  629
             ++L     R+ ALVVD F T+A  +A E     +++ P  A   +L  Y P LD  +  +
Sbjct  136   SSLVASGTRVVALVVDLFGTDAFDVAREFKASPYIFYPAPAMALSLFFYLPKLDEMVSCE  195

Query  630   YVEQEKGLEIPGCKPVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPV  809
             Y E ++ +EIPGC P+   +++DP  DR +  Y+  L     + +ADG+++N++ D++  
Sbjct  196   YSEMQEPVEIPGCLPIHGGELLDPTRDRKNDAYKWLLYHSKRYRLADGVMVNSFIDLERG  255

Query  810   TLKALRENEPLSKVVGKP-VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGS  986
              LKAL+E EP     GKP VY +GPL        G +G+  ++WL  QP  SVL+VSFGS
Sbjct  256   ALKALQEAEP-----GKPPVYPVGPLVNMDSNTSGVEGSECLRWLDDQPLGSVLFVSFGS  310

Query  987   GGTLSAEQITELAWGLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTR  1166
             GGTLS +QITELA GLE+SEQRF+WVVR P+ + ++  +F+     D   ++LP+GF  R
Sbjct  311   GGTLSFDQITELALGLEMSEQRFLWVVRVPNDKLANATYFSVDNHKDPF-DFLPKGFLDR  369

Query  1167  TQNQGLVVPMWAEQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATL  1346
             T+ +GLVVP WA QA +L H STGGFL+HCG NSTLES+ NGVP+I WPLY+EQ+ NA +
Sbjct  370   TKGRGLVVPSWAPQAQVLSHGSTGGFLTHCGWNSTLESVVNGVPLIVWPLYAEQKMNAWM  429

Query  1347  LTEEVGVAIRPMKLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGG  1526
             LT++V VA+RP K    G++ REE+  +V+ +++ ++GK +R R+  LK ++ + +S  G
Sbjct  430   LTKDVKVALRP-KASENGLIGREEIANIVRGLMEGEEGKRVRNRMKDLKDAAAEVLSEDG  488

Query  1527  SSYNSMCEVLNAIEKRRDLKIC  1592
             SS  ++ EV    +  +    C
Sbjct  489   SSTKALSEVARKWKNHKCTHDC  510



>gb|EYU32802.1| hypothetical protein MIMGU_mgv1a005797mg [Erythranthe guttata]
Length=470

 Score =   364 bits (934),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 193/468 (41%), Positives = 283/468 (60%), Gaps = 10/468 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTS-RLNN  347
             H+  L SPG+GH+IP   LA +L   H  +++  VITT  S  + Q   S+   S  L+ 
Sbjct  4     HVAFLPSPGMGHMIPLFQLAKKLTLQHGFRVSFIVITTGASAAQNQFFHSAAAISPHLSI  63

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMA  527
             + +P  D+S ++    + V Q+ ++ R +L  ++  L +   +  +LVVD F T+A+   
Sbjct  64    INLPAADVSGVISEEMRVVTQIAVIARESLKPLKPILAEL--KPSSLVVDIFTTDAIDTC  121

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              +L +P + +   +     L++Y P LDRE+ G+YV+    +EIPGC+ +   D++D + 
Sbjct  122   TDLRIPVYSFFTASTALLTLSLYLPTLDREVEGEYVDLPAPVEIPGCRNMPTADLLDQVK  181

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR + +Y+ YL          GIL+N W+D+D   +KAL EN     +   P+Y +GPL 
Sbjct  182   DRTNDEYKWYLLHVSRLPYTAGILVNAWDDLDQQRIKALTENPFFKNLPTPPIYPVGPLI  241

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
             ++ E     D T I+ WL  QPRESVL+V  GSGGTLS+ Q+ ELA GLELS QRF+ V 
Sbjct  242   KDDEILTEKDAT-ILAWLDSQPRESVLFVCLGSGGTLSSRQLIELAAGLELSRQRFLLVA  300

Query  1068  RPPSMRGSDDAFFTTGQG----ADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             RPP+      A+F+ G G    ADG   Y P+GF  RT+  GLVVP WA Q  +LRH ST
Sbjct  301   RPPTDASGAGAYFSVGSGGGEDADGLSVYFPDGFLDRTRGVGLVVPAWAPQMAVLRHRST  360

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFLSHCG NSTLES+  GVP+IAWPLY+EQR NAT+L EEVGVA++ +      ++ RE
Sbjct  361   GGFLSHCGWNSTLESLVCGVPMIAWPLYAEQRMNATMLVEEVGVAVKVVADAEAEVIGRE  420

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGG--SSYNSMCEV  1553
             E+  +V+ +++ ++GK +R R  +LK ++ KA   GG  S +  +C +
Sbjct  421   EIGRVVRAVMEGEEGKVIRRRAGELKENALKASENGGGLSRFVDICHL  468



>ref|XP_002320190.1| hydroquinone glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE98505.1| hydroquinone glucosyltransferase family protein [Populus trichocarpa]
Length=478

 Score =   363 bits (933),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 200/480 (42%), Positives = 301/480 (63%), Gaps = 17/480 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ IL SPG+GH+IP + LA RL   HN+ +T F+I T  SP++ Q      L S +++V
Sbjct  9     HVAILPSPGMGHLIPLVELAKRLVHQHNLSVT-FIIPTDGSPSKAQRSVLGSLPSTIHSV  67

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVR---AALTKQCRRLDALVVDFFCTEALP  521
              +PPV++S L + + K    + L V  +LP +R   ++L     R+ ALVVD F T+A  
Sbjct  68    FLPPVNLSDLPE-DVKIETLISLTVARSLPSLRDVLSSLVASGTRVVALVVDLFGTDAFD  126

Query  522   MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDP  701
             +A E     +++ P  A   +L  Y P LD  +  +Y E ++ +EIPGC P+   +++DP
Sbjct  127   VAREFKASPYIFYPAPAMALSLFFYLPKLDEMVSCEYSEMQEPVEIPGCLPIHGGELLDP  186

Query  702   MLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIG  878
               DR +  Y+  L     + +A+G+++N++ D++   LKAL+E EP     GKP VY +G
Sbjct  187   TRDRKNDAYKWLLHHSKRYRLAEGVMVNSFIDLERGALKALQEVEP-----GKPPVYPVG  241

Query  879   PLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             PL        G +G+  ++WL  QP  SVL+VSFGSGGTLS +QITELA GLE+SEQRF+
Sbjct  242   PLVNMDSNTSGVEGSECLKWLDDQPLGSVLFVSFGSGGTLSFDQITELALGLEMSEQRFL  301

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WV R P+ + ++  +F+     D   ++LP+GF  RT+ +GLVVP WA QA +L H STG
Sbjct  302   WVARVPNDKVANATYFSVDNHKDPF-DFLPKGFLDRTKGRGLVVPSWAPQAQVLSHGSTG  360

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NSTLES+ N VP+I WPLY+EQ+ NA +LT++V VA+RP K    G++ REE
Sbjct  361   GFLTHCGWNSTLESVVNAVPLIVWPLYAEQKMNAWMLTKDVEVALRP-KASENGLIGREE  419

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKRRDLKICTQ  1598
             +  +V+ +++ ++GK +R R+  LK ++ + +S  GSS  ++ EV    +  +    CTQ
Sbjct  420   IANIVRGLMEGEEGKRVRNRMKDLKDAAAEVLSEAGSSTKALSEVARKWKNHK----CTQ  475



>ref|XP_007051600.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOX95757.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=471

 Score =   363 bits (932),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/464 (43%), Positives = 293/464 (63%), Gaps = 13/464 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI IL SPG+GH+IP +  A RL   HN  +T FVI T  SP++ Q      L S +++V
Sbjct  8     HIAILPSPGMGHLIPLVEFAKRLVHQHNFTVT-FVIPTDGSPSKAQKSTLDSLPSSIDSV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR--LDALVVDFFCTEALPM  524
              +PPVD+S L +  +K    + L V  +LP +R AL     R  L  LVVD F T+A  +
Sbjct  67    FLPPVDLSDLPEG-SKIETVISLTVARSLPFIRDALKSLAARTKLVGLVVDLFGTDAFDV  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A E N+  +++ P+ A   +L +Y P LD+ +  +Y +  + + IPGC P+    ++DP 
Sbjct  126   AREFNVSPYIFFPSTAMTLSLFLYLPKLDQMVSCEYRDLPEMVRIPGCIPIYGNQLLDPT  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGP  881
              DR +  Y+  L     + +A+GI++N++ D++   +KAL++ EP     GKP +Y +GP
Sbjct  186   QDRKNDSYKWLLHHTKRYRLAEGIMVNSFVDLEGGAIKALQDKEP-----GKPPIYPVGP  240

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             L  N++     DG+  ++WL  QP  SVLYVSFGSGGTLS  QI ELA GLE+S+QRF+W
Sbjct  241   LV-NVDSSSKADGSGCLKWLDGQPHGSVLYVSFGSGGTLSYNQINELALGLEMSQQRFLW  299

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVR P+ + ++  FF+  Q      ++LP+GF  RT+ +GLVVP WA QA +L H STGG
Sbjct  300   VVRSPNDQVANATFFSV-QSQQDPFDFLPKGFLERTKGRGLVVPSWAPQAQVLSHGSTGG  358

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NS LES+ NGVP+IAWPLY+EQ+ NA +L E++ VA+R  K    G+V R+E+
Sbjct  359   FLTHCGWNSALESVVNGVPLIAWPLYAEQKMNAVMLAEDIKVALR-AKPNENGLVCRDEI  417

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
                VK +++ ++GK +R R+  LK ++ K +S  GSS  ++ EV
Sbjct  418   AKAVKGLMEGEEGKGVRNRMKDLKEAAAKVLSENGSSGKALSEV  461



>gb|AFJ52923.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=475

 Score =   363 bits (932),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 201/471 (43%), Positives = 310/471 (66%), Gaps = 9/471 (2%)
 Frame = +3

Query  162   SMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVIT-TADSPTERQLLESSDLTSR  338
             S  H+ +L+SPG+GH+ P   LA RL    ++ +T  VIT T  SP + QLL S+ L   
Sbjct  2     SKFHVAVLASPGLGHVTPLFELAKRLVTHFDLHVTFLVITSTIPSPAQDQLLHSATLPQD  61

Query  339   LNNVGIPPVDISALLDANTKPVAQLCLLVRAAL-PGVRAALTKQCRRLDALVVDFFCTEA  515
             L+ V +PPVD S+L+  +   + QLC++V+ +L   +++AL +   +  AL++D FCT+A
Sbjct  62    LHVVDLPPVDASSLVTDDMLLLTQLCVMVQHSLNSSLKSALLQ--IKPKALIIDIFCTQA  119

Query  516   LPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVV  695
               +  +L++P + +   +A    L++Y P +DR+I GQ+V   + + +PGC P+R  D++
Sbjct  120   FDICKDLHIPVYSFFTASAALMTLSLYLPTMDRDIQGQFVYLPEPVNVPGCTPIRTHDLL  179

Query  696   DPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAI  875
             D + +RN+ +Y+ YL       +A GI +N+WE I+PV++KA++E+    ++   PV+++
Sbjct  180   DQVRNRNNDEYKWYLYHVARLPLAAGIFLNSWEGIEPVSIKAVKEHSFYKEIPIPPVFSV  239

Query  876   GPLTRNIEERD-GDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             GPL + +E     D    +++WL  QP ESVL+V+ GSGGT +  Q+ ELA GLE SEQR
Sbjct  240   GPLIKQVECIPLTDSDLDLLRWLDDQPSESVLFVALGSGGTFTIHQLEELAVGLEQSEQR  299

Query  1053  FIWVVRPPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRH  1226
             F+ VVR PS R S  +FF  G G   D    YLPEGF  RT+ +G+VV  WA QA +L H
Sbjct  300   FVLVVRFPSDRSSA-SFFDVGSGKEDDDPVAYLPEGFVERTKGKGMVVRSWAPQAEVLSH  358

Query  1227  PSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIV  1406
             PSTGGFLSHCG NSTLES+ NGVP+IAWPLY+EQR NAT+L EE GVA++  ++  + +V
Sbjct  359   PSTGGFLSHCGWNSTLESVSNGVPMIAWPLYAEQRMNATILEEEAGVAVKTCRVVGEDVV  418

Query  1407  T-REEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
               REE++ +V+++++ +KGK +R++   LK S+  +++ GG S  S+ +V+
Sbjct  419   VGREEIEKVVRLVMEGEKGKLLRKKAKLLKKSAALSLNDGGDSCESLAKVV  469



>ref|XP_008376064.1| PREDICTED: hydroquinone glucosyltransferase-like [Malus domestica]
Length=472

 Score =   362 bits (929),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 199/471 (42%), Positives = 290/471 (62%), Gaps = 12/471 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI IL SPG+GH+IP    A RL   HN  +T FV+     PT+ Q      L + +++V
Sbjct  8     HIAILPSPGMGHLIPLAEFAKRLVHRHNFTVT-FVVPCDGPPTKAQKSVLDALPTAIDHV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR--LDALVVDFFCTEALPM  524
              +PPV    L    +K    + L V  +L  +R AL+    R  L  LVVD F T+A  +
Sbjct  67    FLPPVCFDDL-PQGSKIETIISLTVARSLASLRDALSSLASRAKLVGLVVDLFGTDAFDV  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A E NL  +++ P+ A   +L +Y P L   +  +Y +    + IPGC P+   ++++P+
Sbjct  126   AKEFNLSNYIFFPSTAMALSLFLYAPELHETVSCEYRDLSDPVTIPGCIPIPGSELLEPV  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGP  881
              DR D  Y+ +L     + MADGI++N++ +++   LKAL+E EP     GKP VY +GP
Sbjct  186   QDRRDEAYKWFLHHARRYRMADGIMVNSFTELERGALKALQEKEP-----GKPPVYPVGP  240

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             L +       D  +  ++WL +QPR SVLYVSFGSGGTLS +QI ELA GLE+SEQRF+W
Sbjct  241   LVKMEFSVLDDQSSKCLKWLDEQPRSSVLYVSFGSGGTLSYDQINELALGLEMSEQRFLW  300

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVR PS + ++  +FT     D    +LP+GF  RTQ +GLVVP WA QA IL H STG 
Sbjct  301   VVRSPSDKAANATYFTAHSQKDPL-KFLPKGFMDRTQGRGLVVPNWAPQAQILSHESTGX  359

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NS+LESI NGVP++AWPLY+EQ+ NA + T++V VA+RP K    G+V REE+
Sbjct  360   FLTHCGWNSSLESIVNGVPLVAWPLYAEQKMNAYMFTKDVKVALRP-KPDEYGLVGREEI  418

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
               +V+ +++ ++GK +R R+  LK +   A+S  G+S  ++ +V+  ++ +
Sbjct  419   AMVVQALMEGEEGKRLRNRMKDLKDAGATALSDDGASTKALSDVVTKLKTQ  469



>ref|XP_004133820.1| PREDICTED: hydroquinone glucosyltransferase-like [Cucumis sativus]
 ref|XP_004168406.1| PREDICTED: hydroquinone glucosyltransferase-like [Cucumis sativus]
 gb|KGN56441.1| Hydroquinone glucosyltransferase [Cucumis sativus]
Length=481

 Score =   362 bits (930),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 191/470 (41%), Positives = 295/470 (63%), Gaps = 10/470 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ ++ SPG+GH+IP +  A RL  +H   +T FVI +   P + Q+   S L S +++V
Sbjct  19    HVVMMVSPGMGHLIPLVEFAKRLVLLHRFTVT-FVIPSGGPPPKAQISLLSSLPSAIDHV  77

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQC--RRLDALVVDFFCTEALPM  524
              +PPV ++ L    TK    + L V  +LP +R         R   A VVD FCT A+ +
Sbjct  78    FLPPVSLNDL-PPQTKGETIIVLTVTRSLPSLRDQFKSMLTQRNPVAFVVDQFCTIAIDL  136

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A E N+P +VY+P +A   +L ++ P LD+ +VG+Y +  + +++P C P   + + DP 
Sbjct  137   AREFNVPPYVYLPCSATTLSLVLHMPELDKSVVGEYTDLTEPIKLPACSPFPAKALPDPF  196

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR D  Y+ +L     FG+ADGI +N++ +++P  + AL+    L +    P+Y +GP+
Sbjct  197   LDRKDDSYKYFLESMSRFGLADGIFVNSFPELEPDPINALK----LEESGYPPIYPVGPI  252

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              + ++    ++    ++WL +QP  SVL+VSFGSGGTLS+ Q  ELA GLE+S Q+FIWV
Sbjct  253   VK-MDSSGSEEEIECLKWLDEQPHGSVLFVSFGSGGTLSSIQNNELAMGLEMSGQKFIWV  311

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VR P  + ++ +FF+     D    +LPEGF  R + +GL++P WA QA IL H STGGF
Sbjct  312   VRSPHDKEANASFFSVHSQNDPL-KFLPEGFVERNKGRGLLLPSWAPQAQILSHGSTGGF  370

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             LSHCG NSTLES+ NGVP+IAWPLY+EQR NA +L EE+ VA++       GI+ +EE+ 
Sbjct  371   LSHCGWNSTLESLVNGVPMIAWPLYAEQRLNAVILIEEIKVALKVKMNEESGIIEKEEIA  430

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
              +VK + +S++GK++RE++ +L+++ E+ +  GGSS  ++ EV+     R
Sbjct  431   KVVKSLFESEEGKKVREKMEELRVAGERVVGEGGSSSRTVLEVVQKWRNR  480



>ref|XP_008350138.1| PREDICTED: hydroquinone glucosyltransferase [Malus domestica]
Length=473

 Score =   360 bits (924),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 200/474 (42%), Positives = 292/474 (62%), Gaps = 17/474 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI IL +PG+GH+IP    A RL  +HN  +T FV+     PT+ Q      L + +++V
Sbjct  8     HIAILPTPGMGHLIPLAEFAKRLVHLHNFTVT-FVVPCDGPPTKAQKSVLDALPTAIDHV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR--LDALVVDFFCTEALPM  524
              +PPV    L    +K    + L V  +L  +R AL+    R  L  LVVD F T+A  +
Sbjct  67    FLPPVCFDDL-PQGSKIETIISLTVARSLASLRDALSSLASRTKLVGLVVDLFGTDAFDV  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A E NL  +++ P+ A   +L +Y P L   +  +Y +    + IPGC P+   +++DP+
Sbjct  126   AKEFNLSNYIFFPSTAMALSLFLYLPKLHETVSCEYRDLSDPVTIPGCIPIPGSELLDPV  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGP  881
              DR D  Y+  L     + +ADGI++N++ +++P  LKAL+E EP     GKP VY +GP
Sbjct  186   QDRRDEAYKWLLHHTKRYRLADGIIVNSFTELEPGALKALQEKEP-----GKPPVYPVGP  240

Query  882   LTRNIEERDG---DDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             L +   E  G   D  +  ++WL +QPR SVLYVSFGSGGTLS +QI ELA GLE+SEQR
Sbjct  241   LVKM--EFSGVLDDQSSKCLKWLDEQPRGSVLYVSFGSGGTLSYDQINELAIGLEMSEQR  298

Query  1053  FIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             F+WVVR PS + ++  +FT     D    +LPEGF  RTQ +GLVVP WA QA IL H S
Sbjct  299   FLWVVRSPSDQAANTTYFTVHSQNDPL-EFLPEGFLDRTQGRGLVVPNWAPQAHILSHES  357

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
              GGFL+HCG NS LES+ NGVP+IAWPLY+EQ+ NA + T+++ VA+RP K    G++ R
Sbjct  358   IGGFLTHCGWNSALESVVNGVPLIAWPLYAEQKMNAFMFTKDLKVALRP-KPDEHGLIGR  416

Query  1413  EEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             EE+  +V+  ++ ++GK +R R+ +LK +  KA+S  G+S  ++ + +  ++ +
Sbjct  417   EEIAMVVQSFMEGEEGKRLRNRMKELKDAGAKALSENGASTKALSDAITKLKAQ  470



>emb|CDY30762.1| BnaC07g16620D [Brassica napus]
Length=449

 Score =   359 bits (921),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 197/479 (41%), Positives = 304/479 (63%), Gaps = 48/479 (10%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  + SSPG+GH+IP + LA RL+  H  ++TVFV+ T  +  + + L SS +    + V
Sbjct  7     HAAMFSSPGMGHLIPVIELAKRLSANHGFRVTVFVLETDAASAQSKFLNSSGV----DFV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              +P  DIS L++     V ++ +++R  +P +R+ + +  ++  AL++D F T+AL +  
Sbjct  63    NLPSPDISQLVNPADHVVTKIGVIMRETVPALRSKIAEMNQKPTALIIDLFGTDALCLTS  122

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
             E N+              LT                  K LEIPGC+PVR ED +D  L 
Sbjct  123   EFNM--------------LT------------------KPLEIPGCEPVRFEDTMDAYLV  150

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  YR+++R  + +  ADGIL+NTW++++P +L++L++ + L +V   PVY +GPL R
Sbjct  151   PDEPLYRDFVRHCLAYPKADGILVNTWDEMEPKSLRSLQDPKLLGRVARVPVYPVGPLCR  210

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +E  + +    ++ WL++QP ESVLY+SFGSGG+L+A+Q+TELAWGLE S+QRF+WVVR
Sbjct  211   PVETSETNHP--VLDWLNEQPDESVLYISFGSGGSLTAKQLTELAWGLEQSQQRFVWVVR  268

Query  1071  PPSMRGSDDAFFTTGQGA--DGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             PP    S   +FT   G   D TP YLPEGF TRT ++GLVVP WA Q  +L H + GGF
Sbjct  269   PPVDGSSCSDYFTANGGGAKDSTPEYLPEGFVTRTCDRGLVVPSWAPQTEVLAHRAVGGF  328

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG NSTLE + +GVP+IAWPL++EQ  NA LL++E+G+A+R     +K  +TR E++
Sbjct  329   LTHCGWNSTLEGVVSGVPMIAWPLFAEQNMNAALLSDELGIAVRADD--SKEAITRSEIE  386

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNA----IEKRRDL  1583
             ++ + ++  ++G+EMR RV  L+  +E ++SI  GGS++ S+C+V       +E+ RDL
Sbjct  387   SVARKVMAEEEGEEMRRRVKTLRDKAEMSLSIDGGGSAHESLCKVTEECTRFLERDRDL  445



>dbj|BAF75896.1| glucosyltransferase [Cyclamen persicum]
Length=473

 Score =   358 bits (918),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 198/471 (42%), Positives = 293/471 (62%), Gaps = 16/471 (3%)
 Frame = +3

Query  156   NQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP---TERQLLESSD  326
             N +  H+ ++ SPG+GH+IP   LA RL   H +  T FVI T DSP    ++  LE+  
Sbjct  3     NGTSPHVVLVPSPGMGHLIPLGELAKRLVLNHGLTAT-FVIPT-DSPLSAAQKGFLEA--  58

Query  327   LTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALT--KQCRRLDALVVDF  500
             L   ++++ +PP D+  L  ++ K    +CL +  +L  +RAA+   K   RL A+VVD 
Sbjct  59    LPRGIDHLVLPPADLDDL-PSDVKAETVICLTIVRSLHNLRAAIKSLKATNRLVAMVVDL  117

Query  501   FCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVR  680
             F T+A  +A E+N+  +++ P+ A   +  +Y P LD     +Y +    ++IPGC P+ 
Sbjct  118   FGTDAFEIAKEVNISPYIFYPSTAMALSFFLYLPTLDHSTPSEYRDLPDPVQIPGCIPIH  177

Query  681   PEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGK  860
               D++DP  DR +  Y+  L     + +A+GI++N++++++P  + AL+E          
Sbjct  178   GSDLLDPAQDRKNDAYKWLLHHAKRYTLAEGIMVNSFKELEPGAIGALQEE----GSGNP  233

Query  861   PVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLEL  1040
             PVY +GPL +    R   D +  ++WL  QP  SVL++SFGSGGTLS+EQ TELA GLEL
Sbjct  234   PVYPVGPLVKMGHARGMVDRSGCLEWLDGQPHGSVLFISFGSGGTLSSEQTTELALGLEL  293

Query  1041  SEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALIL  1220
             SEQ+F+W+VR P+ + SD AFF      D +  YLP+GF  RT+  GLV+P WA QA IL
Sbjct  294   SEQKFLWIVRSPNDKTSDAAFFNPNAENDPS-TYLPKGFLERTKGVGLVLPSWAPQAQIL  352

Query  1221  RHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKG  1400
              H STGGFL+HCG NSTLES+ NGVP+IAWPLY+EQ+ NA +LTE++ VA+RP K    G
Sbjct  353   SHGSTGGFLTHCGWNSTLESVVNGVPLIAWPLYAEQKMNAVMLTEDIKVALRP-KCSKSG  411

Query  1401  IVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             +V R E+  +VK +++ ++GK +R R+  LK  SEK +S  G S   + E+
Sbjct  412   LVERAEIAKIVKSLMEGEEGKRLRSRMRDLKNVSEKRLSADGESTKMLREL  462



>ref|XP_010095793.1| Hydroquinone glucosyltransferase [Morus notabilis]
 gb|EXB62213.1| Hydroquinone glucosyltransferase [Morus notabilis]
Length=480

 Score =   358 bits (918),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 200/479 (42%), Positives = 300/479 (63%), Gaps = 18/479 (4%)
 Frame = +3

Query  144   MDNNNQSML------HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTER  305
             MDN+ Q         H+ I  SPG+GH+IP + LA +L G H++ +T FV+ +   P++ 
Sbjct  1     MDNDLQPQTQKKKTPHVAIFPSPGMGHLIPLVELAKKLVGNHHLTVT-FVVPSDGPPSKE  59

Query  306   QLLESSDLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR--L  479
                    L   +++V +PPV+   L +  +K    + L V  +LP +R  LT    R  L
Sbjct  60    MKFVLKGLPESIDHVFLPPVNFDDLPEG-SKIETLITLTVARSLPYLRHVLTSLASRVSL  118

Query  480   DALVVDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEI  659
               LVVD F T+AL ++ EL+L  +++ P+ A   +L +Y P LD     +Y E    +EI
Sbjct  119   VGLVVDLFGTDALDVSRELHLSSYIFFPSTAMALSLFLYLPKLDETTSCEYWELTDPVEI  178

Query  660   PGCKPVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEP  839
             PGC P+  ++++DP+ DR +  Y+  L     + +ADGIL+N++++++P  + +L + E 
Sbjct  179   PGCVPIPGKELLDPLQDRKNDAYKWTLHNTKRYRLADGILVNSFKELEPGAISSLLKRED  238

Query  840   LSKVVGKP-VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQIT  1016
                  GKP VY +GPL  NIE     D +  + WL  QP  SVL+VSFGSGGTLS+ Q+ 
Sbjct  239   -----GKPRVYPVGPLV-NIEPSTKVDESNSLTWLDSQPHGSVLFVSFGSGGTLSSHQLH  292

Query  1017  ELAWGLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPM  1196
             ELA+GLE SEQRF+WVVR P+ + ++  +F      D + ++LP+GF  RT+ +GLVV  
Sbjct  293   ELAFGLEKSEQRFLWVVRRPNDKVANATYFNVNGQNDTSFDFLPDGFLDRTKYRGLVVHS  352

Query  1197  WAEQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIR  1376
             WA QA IL H STGGFL+HCG NSTLES+ NGVP+IAWPLY+EQ+ NA +LT+++ VAIR
Sbjct  353   WAPQAQILSHGSTGGFLTHCGWNSTLESVVNGVPLIAWPLYAEQKMNAFMLTQDMKVAIR  412

Query  1377  PMKLPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             P K    G+V +EE+  +VK +++ ++GK++R R+  LK ++ KA+S  G S  ++ EV
Sbjct  413   P-KANENGVVEKEEIGRVVKALIEGEEGKKLRNRMKDLKEAASKALSEDGDSTKALTEV  470



>ref|XP_011023207.1| PREDICTED: hydroquinone glucosyltransferase-like [Populus euphratica]
Length=494

 Score =   358 bits (918),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 200/479 (42%), Positives = 302/479 (63%), Gaps = 22/479 (5%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ IL SPG+GH+IP + LA RL   HN  +T FVI T  S ++ Q      L S +++V
Sbjct  34    HVAILPSPGMGHLIPLVELAKRLVHQHNFSIT-FVIPTDGSTSKAQRSVLGSLPSAIHSV  92

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVR---AALTKQCRRLDALVVDFFCTEALP  521
              +PPV++S L + + +    + L V  +LP +R    +L     R+ ALVVD F T A  
Sbjct  93    FLPPVNLSDLPE-DVRIETTISLTVARSLPSLRDVFRSLVDGGARVVALVVDLFGTGAFD  151

Query  522   MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDP  701
             +A E N+  +++ P+ A   +L  Y P LD  +  +Y E ++ ++IPGC P+   +++DP
Sbjct  152   VAREFNVSPYIFFPSTAMALSLFFYLPKLDEMVSCEYREMQEPVKIPGCLPIYGGELLDP  211

Query  702   MLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIG  878
             + DR +  Y+  L     + MA+G+++N++ D++   LKAL+E EP     GKP VY +G
Sbjct  212   IQDRKNDAYKWLLYHTKRYRMAEGVMVNSFMDLEKGALKALQEVEP-----GKPTVYPVG  266

Query  879   PLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             PL  N++   G +G+  ++WL  QP  SVL+VSFGSGGTLS +QITELA GLE+SEQRF+
Sbjct  267   PLV-NMDSSAGVEGSECLRWLDDQPHGSVLFVSFGSGGTLSLDQITELALGLEMSEQRFL  325

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVR P+   S+  FF+     D   ++LP+GF+ RT+ +GL VP WA Q  +L H STG
Sbjct  326   WVVRSPNDAVSNATFFSVDSHKDPF-DFLPKGFSDRTKGRGLAVPSWAPQPQVLSHGSTG  384

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NSTLES+ NGVP+I WPLY+EQ+ NA +LT+++ VA+RP K    G++ REE
Sbjct  385   GFLTHCGWNSTLESVVNGVPLIVWPLYAEQKMNAWMLTKDIEVALRP-KASENGLIGREE  443

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKRRDLKICT  1595
             +  +V+ +++ ++GK +R R+  LK ++ + +S  GS        L+ +  R + + CT
Sbjct  444   IANVVRGLMEGEEGKRVRYRMKDLKEAAARVLSEDGS--------LSELAHRWNNQKCT  494



>ref|XP_008233208.1| PREDICTED: hydroquinone glucosyltransferase-like [Prunus mume]
Length=475

 Score =   357 bits (916),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 195/467 (42%), Positives = 286/467 (61%), Gaps = 13/467 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI IL SPG+GH+IP    A ++   HN  +T F++     PT+ Q      L   +++V
Sbjct  10    HIAILPSPGMGHLIPLAEFAKQVVHYHNFTVT-FIVPCDGPPTKAQKSVLDALPIAIDHV  68

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR--LDALVVDFFCTEALPM  524
              +P V    L    +K    + L V  +L  +  A+     R  L  LVVD F T+A  +
Sbjct  69    FLPSVSFDDL-PQGSKIETLISLTVSRSLTSLHDAIKSLISRANLVGLVVDLFGTDAFDV  127

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A+E NL K+++ P+ A   +L +Y P LD     +Y E  + + IPGC P+   D++DP+
Sbjct  128   AEEFNLSKYIFFPSTAMALSLFLYLPKLDETTSCEYRELAEPVTIPGCIPIHGRDLLDPV  187

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGP  881
              DR D  Y+  L     + +ADGI++N++ +++P  L+AL+ +EP     GKP VY +GP
Sbjct  188   QDRKDEAYKWVLHHSKRYRLADGIMVNSFAELEPGALRALQGSEP-----GKPPVYPVGP  242

Query  882   LTR-NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             L +        +  +  ++WL +QPR SVLYVSFGSGGTLS +QI ELA GLE+SEQRF+
Sbjct  243   LVKMEFSNALDEQSSKCLKWLDEQPRGSVLYVSFGSGGTLSYDQINELALGLEMSEQRFL  302

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVR PS + ++  +F+     D    +LP+GF  RTQ +GLVVP WA QA IL H STG
Sbjct  303   WVVRSPSDKAANATYFSVHSQNDPL-EFLPKGFLGRTQGRGLVVPNWAPQAQILGHMSTG  361

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NS LES+ NGVP++AWPLY+EQ+ NA + TE++ VA+RP K    G+V REE
Sbjct  362   GFLTHCGWNSALESVVNGVPLVAWPLYAEQKMNAVMFTEDIKVALRP-KASENGLVGREE  420

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             +  +V+ +++ + GK +R R+  LK ++ KA+S  G+S  ++  V+ 
Sbjct  421   IALVVQALMEGEDGKRLRNRMKDLKDAAAKALSEDGASTRALAHVVT  467



>ref|XP_009350467.1| PREDICTED: hydroquinone glucosyltransferase-like [Pyrus x bretschneideri]
Length=473

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 198/472 (42%), Positives = 289/472 (61%), Gaps = 13/472 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI IL +PG+GH+IP    A RL  +HN  +T FV+     PT+ Q      L + +++V
Sbjct  8     HIAILPTPGMGHLIPLAEFAKRLVHLHNFTVT-FVVPCDGLPTKAQKSVLEALPTAIDHV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR--LDALVVDFFCTEALPM  524
              +PPV    L    +K    + L V  +L   R AL+    R  L  LVVD F T+A  +
Sbjct  67    FLPPVCFDDL-PQGSKIETIISLTVARSLASFRDALSSLASRAKLVGLVVDLFGTDAFDV  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A E NL  +++ P+ A   +L +Y P L   +  +Y E    + IPGC P+   +++DP+
Sbjct  126   AKEFNLSNYIFFPSTAMTLSLFLYLPKLHETVSCEYRELSDPVTIPGCIPIPGSELLDPV  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGP  881
              DR D  Y+  L     + +ADGI++N++ +++P  LKAL+E EP     GKP VY +GP
Sbjct  186   QDRRDEAYKWVLHHTKRYRLADGIMVNSFTELEPGALKALQEKEP-----GKPPVYPVGP  240

Query  882   LTR-NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             L + +      D  +  ++WL +QPR SVLYVSFGSGGTLS +QI ELA GLE+S QRF+
Sbjct  241   LVKMDFGGVLDDQSSKCLKWLDEQPRGSVLYVSFGSGGTLSYDQINELALGLEMSGQRFL  300

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVR PS   ++ A+FT     D    +LP+GF   TQ +GLVVP WA QA IL H S G
Sbjct  301   WVVRSPSDHAANTAYFTVHSKNDPL-EFLPKGFLESTQGRGLVVPNWAPQAHILSHESIG  359

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NSTLES+ NGVP+IAWPL++EQ+ NA + T+++ VA+RP K    G+V REE
Sbjct  360   GFLTHCGWNSTLESVVNGVPLIAWPLFAEQKMNAFMFTKDLKVALRP-KPDEHGLVGREE  418

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             +  +V+ ++Q ++GK +R R+ +L+ +  KA+   G+S  ++ E +  ++ +
Sbjct  419   IAMVVQALMQGEEGKRLRNRMKELEDAGAKALGENGASTKALSEAITKLKTQ  470



>ref|XP_009377276.1| PREDICTED: hydroquinone glucosyltransferase-like [Pyrus x bretschneideri]
 ref|XP_009377277.1| PREDICTED: hydroquinone glucosyltransferase-like [Pyrus x bretschneideri]
Length=473

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 198/472 (42%), Positives = 289/472 (61%), Gaps = 13/472 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI IL +PG+GH+IP    A RL  +HN  +T FV+     PT+ Q      L + +++V
Sbjct  8     HIAILPTPGMGHLIPLAEFAKRLVHLHNFTVT-FVVPCDGLPTKAQKSVLEALPTAIDHV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR--LDALVVDFFCTEALPM  524
              +PPV    L    +K    + L V  +L   R AL+    R  L  LVVD F T+A  +
Sbjct  67    FLPPVCFDDL-PQGSKIETIISLTVARSLASFRDALSSLASRAKLVGLVVDLFGTDAFDV  125

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A E NL  +++ P+ A   +L +Y P L   +  +Y E    + IPGC P+   +++DP+
Sbjct  126   AKEFNLSNYIFFPSTAMTLSLFLYLPKLHETVSCEYRELSDPVTIPGCIPIPGSELLDPV  185

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGP  881
              DR D  Y+  L     + +ADGI++N++ +++P  LKAL+E EP     GKP VY +GP
Sbjct  186   QDRRDEAYKWVLHHTKRYRLADGIMVNSFTELEPGALKALQEKEP-----GKPPVYPVGP  240

Query  882   LTR-NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             L + +      D  +  ++WL +QPR SVLYVSFGSGGTLS +QI ELA GLE+S QRF+
Sbjct  241   LVKMDFGGVLDDQSSKCLKWLDEQPRGSVLYVSFGSGGTLSYDQINELALGLEMSGQRFL  300

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVR PS   ++ A+FT     D    +LP+GF   TQ +GLVVP WA QA IL H S G
Sbjct  301   WVVRSPSDHAANTAYFTVHSKNDPL-EFLPKGFLESTQGRGLVVPNWAPQAHILSHESIG  359

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NSTLES+ NGVP+IAWPL++EQ+ NA + T+++ VA+RP K    G+V REE
Sbjct  360   GFLTHCGWNSTLESVVNGVPLIAWPLFAEQKMNAFMFTKDLKVALRP-KPDEHGLVGREE  418

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             +  +V+ ++Q ++GK +R R+ +L+ +  KA+   G+S  ++ E +  ++ +
Sbjct  419   IAMVVQALMQGEEGKRLRNRMKELEDAGAKALGEKGASTKALSEAITKLKTQ  470



>gb|KDP28511.1| hypothetical protein JCGZ_14282 [Jatropha curcas]
Length=469

 Score =   355 bits (911),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 193/464 (42%), Positives = 290/464 (63%), Gaps = 13/464 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI IL SPG+GH+IP +  A RLA  HN+ +  F++ T   P++ Q      L S ++  
Sbjct  6     HIAILPSPGMGHLIPLVEFAKRLAFQHNISVK-FIVPTDGPPSKAQKSVLDSLPSTISYT  64

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPM  524
              +PPV  S L  ++ K    + L V  + P +R  L       RL ALVVD F T+A  +
Sbjct  65    FLPPVSFSDL-PSDAKIETLISLTVTRSFPSLREELKSLVSTTRLAALVVDLFGTDAFDV  123

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A E N+  +++ P+ A   +L    P LD     +Y E ++ ++IPGC P+  +D++DP+
Sbjct  124   AREFNVSPYIFYPSTAMALSLFFTLPKLDETTSCEYRELKEPVKIPGCIPIHGKDLLDPV  183

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGP  881
              DR D  Y+  L     +  A+GI++N++ +++   +KAL+E EP     GKP VY IGP
Sbjct  184   QDRKDDAYKWVLHHAKRYRQAEGIMLNSFMEMEGGAIKALQEEEP-----GKPPVYPIGP  238

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             L  N++ +   +   I++WL  QP  SVLYVSFGSGG+LS  QITELA GLE+S+QRF+W
Sbjct  239   LV-NMDSKSKPEEAEILKWLDDQPHGSVLYVSFGSGGSLSYNQITELALGLEMSDQRFLW  297

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVR P+  G  +A + + Q  +   ++LP+GF  RT+ +GLVV  WA QA +L H +TGG
Sbjct  298   VVRSPN-DGVANATYFSVQSQNDPFDFLPKGFLDRTKGRGLVVSSWAPQAKVLSHGATGG  356

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NSTLES+ NGVP+IAWPLY+EQ+ NA +LTE++ VA+RP K    G++ REE+
Sbjct  357   FLTHCGWNSTLESVVNGVPLIAWPLYAEQKMNAVMLTEDIKVALRP-KPSENGLIVREEI  415

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
                ++ +++ ++GK++R R+  LK ++   +S  GSS  ++  +
Sbjct  416   ANTIRSLMEGEEGKKVRNRMKNLKDAASDVLSENGSSTKALSRL  459



>ref|XP_008437917.1| PREDICTED: hydroquinone glucosyltransferase-like [Cucumis melo]
Length=482

 Score =   355 bits (911),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 187/465 (40%), Positives = 290/465 (62%), Gaps = 11/465 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ ++ SPG+GH+IP +  A RL  +H   +T FVI +   P++ Q+   S L S +++V
Sbjct  19    HVVMMPSPGMGHLIPLVEFAKRLVLLHRFTVT-FVIPSGGPPSKAQISVLSSLPSAIDHV  77

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQC--RRLDALVVDFFCTEALPM  524
              +PP  ++ L    TK    + L V  +LP +R         R L A VVD F T A  +
Sbjct  78    FLPPPSLNDL-PPQTKAETIIVLSVTRSLPSLRDQFKSMVTQRNLVAFVVDQFGTIAFDL  136

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
               E N+P +VY+P +A   +L ++   LD+ +VG Y +  + + +P C P+  + + DP 
Sbjct  137   VREFNVPPYVYLPCSATTLSLILHMSELDKSVVGDYTDLTEPIRLPACSPIPAKALPDPF  196

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
             LDR D  Y+ +L     FG+A+GI +N++ +++P  + AL+  E        P++ +GP+
Sbjct  197   LDRKDDSYKYFLESMSRFGLAEGIFVNSFPELEPNPINALKSEESY-----PPIHPVGPI  251

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              + I+    ++G   + WL +QP  SVL+VSFGSGGTLS+ Q  ELA GLE+S Q+FIWV
Sbjct  252   VK-IDSSGSEEGIECLNWLDEQPHGSVLFVSFGSGGTLSSIQNNELAMGLEMSGQKFIWV  310

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VR P  + ++ +FF+     D    +LPEGF  R + +GLV+P WA QA IL H STGGF
Sbjct  311   VRSPHDKEANASFFSVHSENDPL-QFLPEGFVERNRGRGLVLPSWAPQAQILSHGSTGGF  369

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             LSHCG NSTLES+ NGVP+IAWPLY+EQ+ N+ +LTEE+ VA++       GI+ +EE+ 
Sbjct  370   LSHCGWNSTLESLVNGVPLIAWPLYAEQKLNSVILTEEIKVALKLKMNEESGIIEKEEIA  429

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
              +VK + +S++G+++RE++ +L+ + E+A+  GGSS  ++ EV+ 
Sbjct  430   KVVKSLFESEEGQKVREKMEELRAAGERAVGEGGSSSRTLLEVVQ  474



>emb|CBI34463.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   354 bits (909),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 195/463 (42%), Positives = 285/463 (62%), Gaps = 12/463 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI I+ +PG+GH+IP +  A RL   HN  +T F+I T  SP   Q      L + +N V
Sbjct  7     HIAIVPNPGMGHLIPLIEFARRLVLHHNFSVT-FLIPTDGSPVTPQKSVLKALPTSINYV  65

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPM  524
              +PPV    L + + +   ++ L +  ++P +R +L    +  RL ALVVD F T+A  +
Sbjct  66    FLPPVAFDDLPE-DVRIETRISLSMTRSVPALRDSLRTLTESTRLVALVVDLFGTDAFDV  124

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A+E  +P +++ PT A   +L  + P LD++   +Y +  + ++ PGC PV+  D++DP+
Sbjct  125   ANEFGIPPYIFFPTTAMVLSLIFHVPELDQKFSCEYRDLPEPVKFPGCVPVQGRDLIDPL  184

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
              DR +  Y+  +     +    GI++N++ D++P   KAL+E EP       PVY +GPL
Sbjct  185   QDRKNEAYKWVVHHAKRYKTGPGIIVNSFMDLEPGAFKALKEIEPDYP----PVYPVGPL  240

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
             TR+    +GDDG+  + WL  QP  SVL+VSFGSGGTLS EQITELA GLE+S QRF+WV
Sbjct  241   TRS-GSTNGDDGSECLTWLDHQPSGSVLFVSFGSGGTLSQEQITELALGLEMSGQRFLWV  299

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             V+ P    ++ +FF+  Q      ++LP+GF  RTQ  GLVV  WA Q  +L H STGGF
Sbjct  300   VKSPHETAANASFFS-AQTIKDPFDFLPKGFLDRTQGLGLVVSSWAPQVQVLSHGSTGGF  358

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG NSTLE+I  GVPIIAWPL++EQR NATLL  ++  A+        G+V+REE+ 
Sbjct  359   LTHCGWNSTLETIVQGVPIIAWPLFAEQRMNATLLANDLKAAVTLNN--NNGLVSREEIA  416

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
               VK +++ +KGK +R ++  LK ++  A+S  GSS  S+ EV
Sbjct  417   KTVKSLIEGEKGKMIRNKIKDLKDAATMALSQDGSSTRSLAEV  459



>ref|XP_010053796.1| PREDICTED: hydroquinone glucosyltransferase-like [Eucalyptus 
grandis]
Length=475

 Score =   354 bits (909),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 296/475 (62%), Gaps = 15/475 (3%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPT--ERQLLE  317
             M+  + ++ H+ I+ +PG+GH+IP    A RL   HN  +T FV+    SP   +R LL+
Sbjct  1     MERPSTTVPHVAIVPTPGMGHLIPLAEFAKRLVLCHNFSVT-FVVPNDGSPAKAQRSLLD  59

Query  318   SSDLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALT--KQCRRLDALV  491
             S  L   +  V +PPV    L    T+    + L +  ++P +R  +   K+  RL ALV
Sbjct  60    S--LPPSITYVFLPPVCFDDLPAETTRIETIIALTLARSVPSLRDEVRRLKESTRLVALV  117

Query  492   VDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCK  671
              D F T++  +A E N+  +++ PT A   +L ++ P LD  +  +Y +  + L++PGC 
Sbjct  118   ADLFGTDSFDVAQEFNVSPYIFFPTTAMCLSLFLHLPKLDEAVSCEYRDLPEPLKLPGCI  177

Query  672   PVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKV  851
             P+   D++DP+ DR +  Y+  L     + +A+GIL+N++E+++P   + L+  EP    
Sbjct  178   PIHGRDLLDPVQDRRNDAYKWVLHHAKRYKLAEGILVNSFEELEPGPFEYLKREEP----  233

Query  852   VGKP-VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAW  1028
              G+P VY +GPL  N+E+    DG+  ++WL  QP  SVLYVSFGSGGTLS +QI ELA 
Sbjct  234   -GRPPVYPVGPLV-NMEQSSKSDGSECLKWLDGQPDGSVLYVSFGSGGTLSFDQIQELAL  291

Query  1029  GLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQ  1208
             GLE+SE RF+WVVR P+ + ++  +FT     +    +LP+GF  RT+ +GLV+P WA Q
Sbjct  292   GLEMSEHRFLWVVRTPNDKAANATYFTVYSQNEPF-QFLPKGFLERTKGRGLVLPSWAPQ  350

Query  1209  ALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKL  1388
             A +L H STGGFL+HCG NSTLES+ NGVP+I WPLY+EQ+ NA +LT+++ VA+RP   
Sbjct  351   AQVLAHRSTGGFLTHCGWNSTLESMVNGVPLITWPLYAEQKMNALMLTQDIKVALRPRAD  410

Query  1389  PTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
                G+V R+E+  +VK +++ ++GK++R R+  LK +S K +   GSS  ++ E+
Sbjct  411   AETGLVGRDEISRVVKGLMEGEEGKKIRNRMKDLKDASAKVLGEDGSSARALSEL  465



>gb|KEH18691.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/462 (40%), Positives = 284/462 (61%), Gaps = 14/462 (3%)
 Frame = +3

Query  174   IGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVG  353
             + +  +PG+GH+IP +  A RL+  HN+ +T F+I     P++ Q    + L   +++V 
Sbjct  19    VAMFPTPGMGHLIPMVEFAKRLSK-HNLPIT-FIIPNDGPPSKAQTTVLTSLPHGISHVF  76

Query  354   IPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPMA  527
             +PPV +S L   NTKP   +   +  +LP +   L       RL AL++D F T+A  MA
Sbjct  77    LPPVTLSDL-PPNTKPEPLMIATILRSLPSLHQTLLSLMTSHRLSALIIDLFGTDAFDMA  135

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              EL++P ++Y P+ A   +   Y P LD+++ G++ +  + L IPGC  V  +D+ DP+ 
Sbjct  136   AELDIPSYLYFPSTANMLSFAFYFPQLDQKVQGEFRDILEPLNIPGCFAVHGKDLPDPVQ  195

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DR D  Y+ +L       +A GI+ N++ +++P  +  L++NEP       PVY +GPL 
Sbjct  196   DRKDEAYKCFLHQMTRHRLAKGIIENSFFELEPEAITFLQKNEP-------PVYPVGPLV  248

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
                   +G +  M  QWL +QPR SV+YV+FGS G L++ Q  E+A+GLE+SEQRF+WV+
Sbjct  249   NEDSINNGSEFDMCFQWLDEQPRGSVIYVNFGSEGILTSAQTDEIAYGLEMSEQRFLWVL  308

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             R P  +  +D+ F      D    +LP GF  RT+ +GLV+P WA QA +L H S GGF+
Sbjct  309   RCPKDKVENDSNFIANSNVDPF-EFLPNGFTERTKGKGLVLPYWAPQAQVLSHISIGGFV  367

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLES+ NGVP+IAWPLY+EQ+ NA LL+E V VAIRP K+   G+V REE+ +
Sbjct  368   SHCGWNSTLESVVNGVPLIAWPLYAEQKMNAVLLSENVKVAIRP-KVGENGLVQREEIAS  426

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             +VK ++  ++ +++R R+  LK ++  A+   GSS   +CE+
Sbjct  427   VVKRLMVGEEEQKIRYRMKDLKEAAINALKENGSSTKQICEL  468



>gb|ACD87062.1| UDP-glucosyltransferase [Rhodiola sachalinensis]
Length=473

 Score =   353 bits (905),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 294/466 (63%), Gaps = 17/466 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTE--RQLLESSDLTSRLN  344
             HI +L SPG+GH+IP    A RL   HN  +T F+I T   P+   RQ+L S  L + ++
Sbjct  10    HIALLPSPGMGHLIPMAEFAKRLVHHHNFTVT-FIIPTDGPPSAAYRQVLAS--LPTSIS  66

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEAL  518
             ++ +PPVD+S ++ ++ +    + L V  +LP +   +      + L AL VD F T+A 
Sbjct  67    HIFLPPVDLSDVVPSHPRIETLISLTVVRSLPSLHNTIASLLASKNLAALFVDLFGTDAF  126

Query  519   PMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
               A +L +  +++ P+ A   +L ++ P LDR +  +Y      + IPGC P+R  D+ D
Sbjct  127   DPAIDLGVSPYIFFPSTAMTLSLILHMPELDRSVTCEYRHMTDLVRIPGCIPIRGSDLFD  186

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAI  875
             P+ DR D  Y+  +     + MA+GI+ N++ +++P  LK L+  EP     G+P VYA+
Sbjct  187   PVQDRTDEAYKRIVHHAKRYPMAEGIIENSFMELEPGALKYLQSVEP-----GRPPVYAV  241

Query  876   GPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
              PL +   E D   G+ I++WL  QP  SVL++SFGSGGTLS +Q+TELA GLE S+QRF
Sbjct  242   RPLIKMDYEVD-SSGSKIIEWLDGQPIGSVLFISFGSGGTLSFDQMTELAHGLESSQQRF  300

Query  1056  IWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             +WVVR PS+   + A+F+  Q  +    YLP+GF  RT ++GLVVP WA QA IL H ST
Sbjct  301   LWVVRSPSLI-PNSAYFS-AQSQNDPLAYLPDGFLNRTSDRGLVVPNWAPQAQILSHGST  358

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGF+SHCG NS LES+  GVPIIAWPLY+EQ+ N+ ++ E+V VA+RP  +  +G+V R 
Sbjct  359   GGFMSHCGWNSILESVVYGVPIIAWPLYAEQKTNSIIVVEDVKVAVRPAGV-GEGLVKRL  417

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             EV T VK +++ ++GK++R R+  LK ++ +AI + G+S  ++ E+
Sbjct  418   EVATAVKALMEGEEGKKVRNRMRDLKDAAARAICVDGASTKAIAEL  463



>ref|XP_009788732.1| PREDICTED: hydroquinone glucosyltransferase-like [Nicotiana sylvestris]
Length=478

 Score =   353 bits (905),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 189/470 (40%), Positives = 298/470 (63%), Gaps = 13/470 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDLTSRLNN  347
             H+ +L +PG+GH+IP +  A RL   H+  +TV + T    S ++++ L S  L S +N 
Sbjct  15    HVVLLPTPGMGHLIPLVEFAKRLIHEHDFSITVILPTNGPISESQKKFLNS--LPSTMNY  72

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAA--LTKQCRRLDALVVDFFCTEALP  521
             + +PPV+   L + + K   ++ L V  +LP  R    L  + ++  ALVVD F T+   
Sbjct  73    LLLPPVNFDDLPE-DVKAETRISLTVTRSLPSFRKVFMLLVETKKTVALVVDLFGTDTFD  131

Query  522   MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDP  701
             +A E N+  +++ PT A   +L +Y P LD  +  +Y E ++ + IPGC P+  ++++DP
Sbjct  132   VAKEFNVSPYIFYPTTAMCLSLFLYLPTLDAAVSCEYRELKEPVRIPGCVPIEAKELLDP  191

Query  702   MLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGP  881
             + DR +  Y+  L     + MA+GI++N++++++P  +KAL E EP       PVYA+GP
Sbjct  192   VQDRKNDAYKWLLHHTKRYKMAEGIVVNSFKELEPGAIKALHEEEPDKP----PVYAVGP  247

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             L  +++     +    ++WL +QP  SVLY+SFGSGGTLS EQ+ ELA GLE+S+QRF+W
Sbjct  248   LI-HMDVSSKAEELECLKWLDEQPCNSVLYISFGSGGTLSHEQLIELAMGLEMSDQRFLW  306

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             V+R P+ R ++  +F   Q +    ++LP+GF  RT+ QGL+VP WA QA IL H STGG
Sbjct  307   VIRCPNDRIANATYFNI-QSSSNPFDFLPQGFLERTKGQGLMVPNWAPQAQILSHSSTGG  365

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NSTLES+ +G+P+IAWPLY+EQR NA +L E++ VA+R +K    GIV REE+
Sbjct  366   FLTHCGWNSTLESVVHGIPLIAWPLYAEQRMNAIMLNEDLKVALR-LKTCENGIVGREEI  424

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEK  1571
               +V+ +++ + GK +R R+  LK ++ K +   GSS  ++ E+ + + K
Sbjct  425   AEVVRELMEGEGGKGVRSRMRDLKDAAAKVLGENGSSTKALAELASKMRK  474



>gb|AFJ52916.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=466

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 193/478 (40%), Positives = 299/478 (63%), Gaps = 26/478 (5%)
 Frame = +3

Query  198   IGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDL--TSRLNNVGIPPVDI  371
             +GH+IP + L  RL   HN+ +T  + TT D+P    +    D   ++ ++ +  PPV +
Sbjct  1     MGHLIPLVELTKRLVTCHNLNVTFIIPTTTDAPPSAAMKSVLDSLPSASVDTIFPPPVSL  60

Query  372   S------ALLDANTK-----PVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEAL  518
             +      +  DA  +     P AQ    +R A    R+  T   RRL ALVVD F T+A 
Sbjct  61    NDFVLNPSAFDAKIETIIPLPAAQSLPPLRDAF---RSIATSGRRRLSALVVDLFGTDAF  117

Query  519   PMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
              +A E     +V+ P+ A   +L +Y P LD E+ G Y + ++ ++IPGC PV   D++D
Sbjct  118   DVAAEFGAASYVFYPSTAMALSLFLYLPTLDAEVTGAYSDLDEPVQIPGCIPVNGTDLLD  177

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAI  875
             P+ DRN+  Y   L     + +ADG+++N++ +++P  +K+L++ E   ++  KP VY +
Sbjct  178   PVQDRNNDAYSWLLHHAKRYRLADGVMVNSFPELEPGAIKSLQKTE--DQLGKKPMVYPV  235

Query  876   GPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
             GPL     +     G+  + WL  QP  SVL+VSFGSGGTLS +QI ELA+GLE+SEQRF
Sbjct  236   GPLVN--MDSSKKTGSECLDWLDVQPSGSVLFVSFGSGGTLSYDQINELAFGLEMSEQRF  293

Query  1056  IWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             IWVVR P  + ++ +FFT  Q  +   ++LP+GF  RT+ +GLVV  WA QA IL H ST
Sbjct  294   IWVVRSPDDKTANASFFTV-QSQNDPFHFLPKGFLDRTRERGLVVSSWAPQAQILSHNST  352

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFL+HCG NSTLES+ NGVP+I WPLY+EQ+ NA +LTE++ VA+RP ++ ++ ++ RE
Sbjct  353   GGFLTHCGWNSTLESVANGVPLIVWPLYAEQKMNAVMLTEDIKVALRPKRVGSR-VIGRE  411

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKRRDLKI  1589
             E+   V+ +++ ++GK++R R+ +LK +++K +S  GSS  ++ EV   ++K +D K+
Sbjct  412   EIGNTVRSLMEGEEGKKVRYRMKELKDAAKKVLSKDGSSSRALSEV---VQKWKDQKV  466



>emb|CDX81377.1| BnaC09g07880D [Brassica napus]
Length=437

 Score =   351 bits (901),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 195/469 (42%), Positives = 292/469 (62%), Gaps = 52/469 (11%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H  +LSSPG+GHIIP + LA RL+  H  ++TVFV+ T  + ++ + L S+ +    + V
Sbjct  7     HAALLSSPGMGHIIPGIELAKRLSAHHGFQVTVFVLETDAASSQSKYLNSTGV----DIV  62

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVVDFFCTEALPMAD  530
              IP  DIS L+D     V ++ +++R A+P +R+ +    ++  AL+VD F T+AL +A 
Sbjct  63    NIPSPDISGLVDPADHVVTKIGIMMREAVPALRSNIAAMIQKPTALIVDLFGTDALCLA-  121

Query  531   ELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPMLD  710
                          A F  LT                  K LEIPGC+PV+ ED +D  L 
Sbjct  122   -------------AEFKMLT------------------KPLEIPGCEPVQFEDTLDAYLV  150

Query  711   RNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLTR  890
              ++  Y++++R  + +  ADGIL+NTW++++P +LK+L++ + L +    PVY IGPL R
Sbjct  151   PDEPLYQDFVRHCLAYPKADGILVNTWDEMEPKSLKSLQDPKLLGRFARVPVYPIGPLCR  210

Query  891   NIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVVR  1070
              +E         I+ WL+ QP ESVLY+SFGSGG+L+A+ +TELAWGLE S+QRF+WVVR
Sbjct  211   PVESSKTVHP--ILDWLNNQPDESVLYISFGSGGSLTAKLLTELAWGLEQSQQRFVWVVR  268

Query  1071  PPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFLS  1250
             PP            G     TP YLPEGF TRT ++GLVVP WA QA +L H + GGFL+
Sbjct  269   PP----------VDGLSCGATPEYLPEGFVTRTSDRGLVVPSWAPQAEVLAHRAVGGFLT  318

Query  1251  HCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKTL  1430
             HCG NSTLES+ +GVP+IAWPL+++Q  NA LL++E+G+A+R   L  K   TR E++ +
Sbjct  319   HCGWNSTLESVVSGVPMIAWPLFADQFMNAVLLSDELGIAVRADSL--KEATTRTEIEAI  376

Query  1431  VKIMLQSKKGKEMRERVVKLKMSSEKAISI--GGSSYNSMCEVLNAIEK  1571
             ++ ++  ++G+EMR  V KL+ ++E ++S   GGS++ S+C V    ++
Sbjct  377   LRKVMVEEEGEEMRRIVKKLRDNAEMSLSSDGGGSAHESLCRVTEECQR  425



>ref|XP_002301402.2| hypothetical protein POPTR_0002s17000g [Populus trichocarpa]
 gb|EEE80675.2| hypothetical protein POPTR_0002s17000g [Populus trichocarpa]
Length=494

 Score =   353 bits (905),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 194/457 (42%), Positives = 292/457 (64%), Gaps = 14/457 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ IL SPG+GH+IP + LA RL   HN  +T FVI T  S ++ Q      L S +++V
Sbjct  34    HVAILPSPGMGHLIPLVELAKRLVHQHNFSIT-FVIPTDGSTSKAQRSVLGSLPSAIHSV  92

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVR---AALTKQCRRLDALVVDFFCTEALP  521
              +P V++S L + + K    +   V  +LP +R    +L     R+ ALVVD F T+A  
Sbjct  93    FLPQVNLSDLPE-DVKIETTISHTVARSLPSLRDVFRSLVDGGARVVALVVDLFGTDAFD  151

Query  522   MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDP  701
             +A E N+  +++ P+ A   +L  + P LD  +  +Y E ++ ++IPGC P+   +++DP
Sbjct  152   VAREFNVSPYIFFPSTAMALSLFFHLPKLDEMVSCEYREMQEPVKIPGCLPIHGGELLDP  211

Query  702   MLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIG  878
               DR +  Y+  L     + MA+G+++N++ D++   LKAL+E EP     GKP VY +G
Sbjct  212   TQDRKNDAYKWLLYHTNRYRMAEGVMVNSFMDLEKGALKALQEVEP-----GKPTVYPVG  266

Query  879   PLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             PL  N++   G +G+  ++WL  QP  SVL+VSFGSGGTLS +QITELA GLE+SEQRF+
Sbjct  267   PLV-NMDSSAGVEGSECLRWLDDQPHGSVLFVSFGSGGTLSLDQITELALGLEMSEQRFL  325

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVR P+ + S+  FF+     D   ++LP+GF+ RT+ +GL VP WA Q  +L H STG
Sbjct  326   WVVRSPNDKVSNATFFSVDSHKDPF-DFLPKGFSDRTKGRGLAVPSWAPQPQVLGHGSTG  384

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NSTLES+ NGVP+I WPLY+EQ+ NA +LT+++ VA+RP K    G++ REE
Sbjct  385   GFLTHCGWNSTLESVVNGVPLIVWPLYAEQKMNAWMLTKDIKVALRP-KASENGLIGREE  443

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGS  1529
             +   V+ +++ ++GK +R R+  LK ++ + +S  GS
Sbjct  444   IANAVRGLMEGEEGKRVRNRMKDLKEAAARVLSEDGS  480



>gb|KCW78150.1| hypothetical protein EUGRSUZ_D02351 [Eucalyptus grandis]
Length=530

 Score =   354 bits (908),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 296/475 (62%), Gaps = 15/475 (3%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPT--ERQLLE  317
             M+  + ++ H+ I+ +PG+GH+IP    A RL   HN  +T FV+    SP   +R LL+
Sbjct  1     MERPSTTVPHVAIVPTPGMGHLIPLAEFAKRLVLCHNFSVT-FVVPNDGSPAKAQRSLLD  59

Query  318   SSDLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALT--KQCRRLDALV  491
             S  L   +  V +PPV    L    T+    + L +  ++P +R  +   K+  RL ALV
Sbjct  60    S--LPPSITYVFLPPVCFDDLPAETTRIETIIALTLARSVPSLRDEVRRLKESTRLVALV  117

Query  492   VDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCK  671
              D F T++  +A E N+  +++ PT A   +L ++ P LD  +  +Y +  + L++PGC 
Sbjct  118   ADLFGTDSFDVAQEFNVSPYIFFPTTAMCLSLFLHLPKLDEAVSCEYRDLPEPLKLPGCI  177

Query  672   PVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKV  851
             P+   D++DP+ DR +  Y+  L     + +A+GIL+N++E+++P   + L+  EP    
Sbjct  178   PIHGRDLLDPVQDRRNDAYKWVLHHAKRYKLAEGILVNSFEELEPGPFEYLKREEP----  233

Query  852   VGKP-VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAW  1028
              G+P VY +GPL  N+E+    DG+  ++WL  QP  SVLYVSFGSGGTLS +QI ELA 
Sbjct  234   -GRPPVYPVGPLV-NMEQSSKSDGSECLKWLDGQPDGSVLYVSFGSGGTLSFDQIQELAL  291

Query  1029  GLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQ  1208
             GLE+SE RF+WVVR P+ + ++  +FT     +    +LP+GF  RT+ +GLV+P WA Q
Sbjct  292   GLEMSEHRFLWVVRTPNDKAANATYFTVYSQNEPF-QFLPKGFLERTKGRGLVLPSWAPQ  350

Query  1209  ALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKL  1388
             A +L H STGGFL+HCG NSTLES+ NGVP+I WPLY+EQ+ NA +LT+++ VA+RP   
Sbjct  351   AQVLAHRSTGGFLTHCGWNSTLESMVNGVPLITWPLYAEQKMNALMLTQDIKVALRPRAD  410

Query  1389  PTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
                G+V R+E+  +VK +++ ++GK++R R+  LK +S K +   GSS  ++ E+
Sbjct  411   AETGLVGRDEISRVVKGLMEGEEGKKIRNRMKDLKDASAKVLGEDGSSARALSEL  465



>gb|KDO84452.1| hypothetical protein CISIN_1g047445mg [Citrus sinensis]
Length=436

 Score =   351 bits (900),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 181/398 (45%), Positives = 255/398 (64%), Gaps = 6/398 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDLTSRLNN  347
             H+ +L+SPG+GH++P L  A RL   H V +   VITT + S  + +LL S  L   L+ 
Sbjct  12    HVAVLASPGLGHVVPLLEFAKRLVINHGVHVRFLVITTNEASAAQEKLLRS--LPDGLDV  69

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAAL-PGVRAALTKQCRRLDALVVDFFCTEALPM  524
             V +PPVD+SA+   +   + +L  +V  +L   ++A L + C    ALV+D FCT+A  +
Sbjct  70    VDLPPVDVSAVTRDDMPVITRLHAIVDESLKSSLKAVLIELCNP-RALVIDLFCTQAFEI  128

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
               +L++P + +V T+  F A  +Y P LDRE+ G++ +  + +EIPGC PVRPED++D +
Sbjct  129   CSQLSIPTYSFVTTSIHFFAFALYLPTLDREVQGEFFDLPEPIEIPGCPPVRPEDLLDQV  188

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
              +R   +Y  +L       +A GI +N WE+++ V L+A+RE+    ++   P+Y IGPL
Sbjct  189   RNRKIDEYNLFLLHISRLPLAAGIFLNPWENLELVPLRAIREHSFYLQIPTPPIYPIGPL  248

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              +  E     D    + WL KQP +SV++V+ GSGGTL+AEQ+ E+AWGLE S+QRFIWV
Sbjct  249   IKQDETLSASDEE-CLAWLGKQPSDSVIFVAPGSGGTLTAEQVIEMAWGLEQSKQRFIWV  307

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VR PS   +   FF  G   +    YLPEGF  RT   G+VVP WA Q  ILRH STGGF
Sbjct  308   VRMPSDASASATFFNVGSDVNDPQAYLPEGFLQRTHGMGMVVPSWAPQVEILRHSSTGGF  367

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEE  1358
             LSHCG NS+LESI +GVP+IAWPLY+EQ+ NA +LTEE
Sbjct  368   LSHCGWNSSLESICHGVPMIAWPLYAEQKMNAAMLTEE  405



>dbj|BAI65909.1| UDP-sugar:glycosyltransferase [Forsythia x intermedia]
Length=474

 Score =   352 bits (902),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 192/474 (41%), Positives = 296/474 (62%), Gaps = 14/474 (3%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESS  323
             M+N      H+ I+ +PG+GH+IP +  A ++   HN  ++ F+I +    +  Q L   
Sbjct  1     MENTTNPPTHVAIVPTPGMGHLIPLVEFAKKIIQKHNFMVS-FIIPSDGPLSSAQKLFLE  59

Query  324   DLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAA---LTKQCRRLDALVV  494
              L  R++ V +PPV    L + + K   ++ L V  +L  +R A   L  +  RL A VV
Sbjct  60    KLPPRIDYVVLPPVCFDDLPE-DVKIETRISLTVSRSLSSLRDAVQSLVSKKIRLAAFVV  118

Query  495   DFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKP  674
             D F T+A  +A E  +  ++++PT A   +L +    LD  +  ++ +  + + IPGC P
Sbjct  119   DLFGTDAFDVAIEFKISPYIFIPTTAMCLSLFLNLSKLDESVPCEFRDMSEKVHIPGCMP  178

Query  675   VRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVV  854
             +   D++DP+ DR +  Y+  L     + MA+GI++N++++++P  ++ L+E E      
Sbjct  179   IHGSDLLDPLQDRKNDAYKWVLHHSKRYRMAEGIILNSFKELEPGAIQYLQEQE-----T  233

Query  855   GKP-VYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWG  1031
             GKP VY +GPL +   + + +D ++ ++WL++QP  SVLY+SFGSGGTLS EQ+ E+A G
Sbjct  234   GKPPVYCVGPLIQMGSKSENNDESVCLKWLNEQPSGSVLYISFGSGGTLSHEQMIEIALG  293

Query  1032  LELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQA  1211
             L++SEQRF+WV+R P+   + +A + + Q +     YLP GF  RT+ +GLVVP WA QA
Sbjct  294   LDMSEQRFLWVIRCPN--DTANATYFSIQNSGDPLAYLPPGFLDRTKGRGLVVPSWAPQA  351

Query  1212  LILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLP  1391
              IL H STGGFLSHCG NSTLESI NGVP+IAWPLY+EQR NA +LTE+V VA+RP K  
Sbjct  352   QILSHGSTGGFLSHCGWNSTLESIVNGVPLIAWPLYAEQRSNAVMLTEDVKVALRP-KFN  410

Query  1392  TKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
               G+VTR E+  +VK +++ ++GK +R R+  LK ++ K +S  GSS  S+ E+
Sbjct  411   ENGLVTRLEIAKVVKGLMEGEEGKAIRSRMRDLKDAAAKVLSDDGSSTKSLAEL  464



>ref|XP_004516402.1| PREDICTED: hydroquinone glucosyltransferase-like [Cicer arietinum]
 gb|AGU14143.1| UDP-glycosyltransferase [Cicer arietinum]
Length=479

 Score =   352 bits (902),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 187/466 (40%), Positives = 291/466 (62%), Gaps = 15/466 (3%)
 Frame = +3

Query  174   IGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVG  353
             + ++ SPG+GH+IP +  A RL   HN+ +T F+I +   P++ Q+   + L   ++++ 
Sbjct  10    VTMMPSPGMGHLIPMIEFAKRLINHHNLHVT-FIIPSDGPPSKAQITVLTSLPRGISHIF  68

Query  354   IPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPMA  527
             +PP+ +S L   NTK    + L V  +LP +R  +       R+ AL VD F T+A  +A
Sbjct  69    LPPITLSDL-PPNTKIEPLISLTVLRSLPSLRQTILSLTSSHRIAALTVDLFGTDAFDVA  127

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E N+  +V+ P+     +   Y P LD+E+  ++ +  + ++IPG  PV  +D++ P+ 
Sbjct  128   AEFNIASYVFFPSPTMVLSFAFYLPQLDQEVQCEFRDLHEPVKIPGSTPVHGKDLLYPVQ  187

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGPL  884
             DR D  Y+ +L     + +A GI+ N++ +++P  +K L+ NEP     G+P VY +GPL
Sbjct  188   DRKDDAYKCFLYHAKRYRLAHGIIENSFVELEPEVIKLLQINEP-----GRPLVYPVGPL  242

Query  885   TRNIEERDGDDGTMI---MQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
                   R G DG  I   + WL +QPR SV++V FGSGGTLS+ Q+ ELA GLE SEQRF
Sbjct  243   VNEDSSRTGVDGVEIDKCLSWLDEQPRGSVIFVCFGSGGTLSSAQMNELAIGLETSEQRF  302

Query  1056  IWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             +WVVR P  + ++ + F      D   ++LP GF  RT+ +GLVVP WA QA +L H ST
Sbjct  303   LWVVRCPKDKVANVSNFIADSNVDPF-DFLPNGFVERTKEKGLVVPYWAPQAKVLNHGST  361

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFL+HCG NS LES+ NGVP++AWPLY+EQ+ NA L++EEV VA+RP K+   G+V R+
Sbjct  362   GGFLTHCGWNSVLESVVNGVPLVAWPLYAEQKMNAVLVSEEVKVAMRP-KVSENGLVERD  420

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             E+  +VK +++ ++GK++R +++ LK ++  A+   GSS   +CE+
Sbjct  421   EIANVVKRLMEGEEGKKLRNKMMDLKEAASIALKENGSSTKKICEL  466



>gb|ABL85472.1| glycosyltransferase UGT72B9 [Maclura pomifera]
Length=481

 Score =   351 bits (901),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 196/475 (41%), Positives = 296/475 (62%), Gaps = 25/475 (5%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTE--RQLLESSDLTSRLN  344
             H+ IL SPG+GH+IP +  A RL   H   +T F++ T   P++  R LL+S  L   ++
Sbjct  12    HVAILPSPGMGHVIPLVEFAKRLVENHRFSVT-FLVPTDGPPSKAMRSLLQSRGLPEAID  70

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR----LDALVVDFFCTE  512
             +V +PPV+   L +  +K   ++ L V  +LP +R AL     R    L  L+VD F T+
Sbjct  71    HVFLPPVNFDDLPEG-SKIETRISLTVARSLPALRDALVSHVSRRRVRLVGLLVDLFGTD  129

Query  513   ALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDV  692
             AL +A E N+P +V+ P +A   +L +  P LD     +Y E  + ++IPGC PV   ++
Sbjct  130   ALDVAREFNVPSYVFYPPSAMSLSLVLQLPTLDETTSCEYRELPEPVKIPGCVPVPGTEL  189

Query  693   VDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VY  869
              DP+ DR +  Y+  L     + +ADGI++N++ D++P  + +L++      V GKP VY
Sbjct  190   PDPLHDRKNDAYQWILHTARRYRLADGIIVNSFNDLEPGPISSLQQ----EGVDGKPRVY  245

Query  870   AIGPLT-----RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGL  1034
              +GPLT      NIEE +       + WL  QP  SVL+VSFGSGGTLS+ QI ELA GL
Sbjct  246   PVGPLTYKGMTNNIEELN------CLTWLDNQPHSSVLFVSFGSGGTLSSHQINELALGL  299

Query  1035  ELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQAL  1214
             E SEQRF+WVVR P+ + ++ ++F  G   + + ++LP+GF  RT+++GL+V  WA Q  
Sbjct  300   ENSEQRFLWVVRRPNDKVTNASYFNNGTQNESSFDFLPDGFMDRTRSRGLMVDSWAPQPQ  359

Query  1215  ILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPT  1394
             IL H STGGFL+HCG NS LESI NGVP++AWPL++EQ+ NA +LT+ + VA+RP     
Sbjct  360   ILSHSSTGGFLTHCGWNSILESIVNGVPLVAWPLFAEQKMNAFMLTQHIKVALRP-GAGE  418

Query  1395  KGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
              G+V REE+  +VK +++ ++GK +R R+ +LK ++ +A S  G+S  ++ EV +
Sbjct  419   NGVVEREEIARVVKALMEEEEGKILRNRMKELKETASRAQSEDGASTKALVEVAD  473



>dbj|BAF49302.1| putative glycosyltransferase [Clitoria ternatea]
Length=479

 Score =   351 bits (900),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 187/463 (40%), Positives = 293/463 (63%), Gaps = 12/463 (3%)
 Frame = +3

Query  174   IGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVG  353
             + ++ +PG+GH+IP +  + RL   HN+ +T FVI T   P++ Q      L   ++++ 
Sbjct  14    LAVVPTPGMGHLIPLIEFSKRLVRYHNLAVT-FVIPTEIPPSKAQTTVLKALPDSISHIF  72

Query  354   IPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPMA  527
             +PPV +S L    TK   ++ L V  +LP +R A         + A+VVD F T+   +A
Sbjct  73    LPPVTLSDL-PPETKIETRISLTVLRSLPALRQAFRSLTAAHTVSAVVVDLFGTDVFDVA  131

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E N+P ++Y P+ A   +L +  P LD+E+  ++ E  + ++IPGC PV   D++DP+ 
Sbjct  132   AEFNVPPYIYYPSTAMVLSLFLQLPKLDQEVHCEFHELPEPVKIPGCVPVNGSDLLDPVQ  191

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGPL  884
             DR +  Y+  L     +  A+GI+ N++ +++P  +K L++ EP     GKP VY +GP+
Sbjct  192   DRKNDAYKWVLHHAKRYSEAEGIIENSFLELEPGAIKELQKEEP-----GKPPVYPVGPI  246

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
                     G+ G+  ++WL +QP  SVL+VSFGSGGTLS+ QI ELA GLE+SEQRF+WV
Sbjct  247   VNMDCGGSGERGSECLRWLDEQPDGSVLFVSFGSGGTLSSGQINELAHGLEMSEQRFLWV  306

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VR P  + ++ ++F+    +D    +LP+GF  RT+ +GLVVP WA Q  IL H STGGF
Sbjct  307   VRSPHDKFANASYFSAENPSDSL-GFLPKGFLERTKGRGLVVPSWAPQPQILAHGSTGGF  365

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG NSTLES+ NGVP++AWPLY+EQ+ NA +LT +V VA+RP  +   G+V R+E+ 
Sbjct  366   LTHCGWNSTLESVVNGVPLVAWPLYAEQKMNAVMLTRDVKVALRPC-VGENGLVERQEIA  424

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             ++VK +++ ++GK++R R+  LK ++ KAI+  G S + +  +
Sbjct  425   SVVKCLMEGEEGKKLRYRIKDLKDAAAKAIAENGPSTHHISHL  467



>gb|AIE12483.1| UGT6 [Panax ginseng]
Length=465

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 288/467 (62%), Gaps = 20/467 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP---TERQLLESSDLTSRL  341
             HI I  SPG+GH+IP +  A R    H  K T  +I   D P    ++  L++  L + +
Sbjct  6     HIAIFPSPGMGHLIPLVQFAKRFISQH--KFTATLIVPTDGPLLKAQKTFLDA--LPAGI  61

Query  342   NNVGIPPVDISAL-LDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTE  512
               V +PPV++  L  D N +   Q+ + V  +LP +R         ++L ALVVD F T+
Sbjct  62    GYVVLPPVNLDDLPSDVNIE--TQIAITVARSLPSLRDVFKSLLATKKLVALVVDLFGTD  119

Query  513   ALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDV  692
             A  +A+E  +  +++ P+ A   +  ++ P LD     +Y +    +++PGC P+   D+
Sbjct  120   AFDVANEFKVSPYIFFPSTAMSLSFFLHLPKLDEAESCEYRDLSGPIQLPGCIPIHGRDL  179

Query  693   VDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYA  872
             +DP+ DR +  Y+  L     + +A+GI++N+++D++   +KAL+E   +      PVY 
Sbjct  180   LDPVQDRKNDAYKWILHHTKRYRLAEGIMVNSFKDLEEGAIKALQEESDIP-----PVYP  234

Query  873   IGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             +GPL + I+     DG+  ++WL  QPR SVL++SFGSGGTLS++QI ELA GLE+SEQR
Sbjct  235   VGPLIQ-IDSSSAADGSECLRWLDNQPRGSVLFISFGSGGTLSSDQINELALGLEMSEQR  293

Query  1053  FIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             F+WVVR P+   ++  FF      D   ++LP+GF  RT   GLVVP WA QA ILRH S
Sbjct  294   FLWVVRSPNNEAANANFFNVESQKDPF-DFLPKGFLERTNGNGLVVPSWAPQAQILRHHS  352

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
             TGGFL+HCG NS LE++ NG+P+IAWPLY+EQ+ NA +L+E + VA+RP ++   G+V R
Sbjct  353   TGGFLTHCGWNSILETVVNGIPLIAWPLYAEQKMNAVMLSEGLKVALRP-QVDENGLVGR  411

Query  1413  EEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
              ++  +VK +++ ++GK +R R+  LK ++ K +S GGSS  SM E+
Sbjct  412   AKIAKVVKCLMEGEEGKRLRNRMRDLKDAAAKVLSDGGSSTKSMAEL  458



>ref|XP_006847344.1| hypothetical protein AMTR_s00015p00251000 [Amborella trichopoda]
 gb|ERN08925.1| hypothetical protein AMTR_s00015p00251000 [Amborella trichopoda]
Length=470

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 200/481 (42%), Positives = 291/481 (60%), Gaps = 33/481 (7%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ IL SPG+GH+IP ++ A  LA  H+  +T   +TT  S  +  +L      S LN+V
Sbjct  8     HVAILPSPGMGHLIPLVVFAKHLAATHSFSITFINLTTDSSAAQSSVL------SNLNDV  61

Query  351   GI--------PPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRL--DALVVDF  500
             G+        PP D+S L  ++ K   ++ L +  +L  +RA L     +     LV D 
Sbjct  62    GLSSVQFVDLPPADLSDL-PSSAKIETRISLTMFRSLSSLRALLGDLTSKFPNTVLVADI  120

Query  501   FCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCK-PV  677
             F T+A  +ADEL+LPK+++ P+NA F +L    P LD ++ G+Y +  + L +PGC  P 
Sbjct  121   FGTDAFDVADELSLPKYLFFPSNATFLSLVCQLPALDTKVSGEYRDLRE-LRLPGCSSPF  179

Query  678   RPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVG  857
               +D+V P+ DR D  Y  +L     +  ADGI +NT+E ++   L+ L+EN    +   
Sbjct  180   PGKDLVSPLQDRKDAAYAWFLHQAKRYPRADGIFVNTFEALESQALQFLKEN----RASF  235

Query  858   KPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLE  1037
               V+ +GPLT    E D D     ++WL +QP  SV++VSFGSGGTLS EQ   LA GLE
Sbjct  236   PEVFPVGPLTLEQPENDSD----CLRWLDEQPPGSVVFVSFGSGGTLSYEQYQNLAHGLE  291

Query  1038  LSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALI  1217
              S QRF+WV+R P +     AFFT     D    YLPEGF  RT+  G+VVP WA Q  +
Sbjct  292   KSGQRFLWVIRTPELTEGPAAFFTVESKGD-PKAYLPEGFLERTKGVGMVVPSWAPQTRV  350

Query  1218  LRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTK  1397
             L H +TGGFL+HCG NSTLESI+NG+P+IAWPLY+EQ+ NA LL +E+ VAIRP K+   
Sbjct  351   LAHAATGGFLTHCGWNSTLESIQNGIPLIAWPLYAEQKMNAILLVDEIKVAIRP-KIQED  409

Query  1398  GIVTREEVKTLVKIMLQSKKGKEMRERVVKLK-MSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             GI+  EE++ +V+ +++ ++GK +R ++  L+  ++  A++ GGSSY S+   +NA +K 
Sbjct  410   GIIKEEEIERVVRGLMEGEEGKALRAKMRDLRDAAAATALAEGGSSYGSL---VNATQKW  466

Query  1575  R  1577
             R
Sbjct  467   R  467



>gb|AFJ52928.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=474

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 191/478 (40%), Positives = 305/478 (64%), Gaps = 23/478 (5%)
 Frame = +3

Query  150   NNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSD  326
             +++Q   H+ I  SPG+GH+IP + L+ +L   HN+ +TV + +    S  + Q L+S  
Sbjct  2     SSSQQKPHVVIFPSPGMGHLIPLVELSKKLVLTHNLSVTVMIPSLGPPSKAQAQFLDSLP  61

Query  327   LTSRLNNVGIPPVDISAL-LDANTKPVAQLCLLVRAALPGVRAA---LTKQCRRLDALVV  494
              +  +N++ +PP + +   +DA  + +  LCL V  A+P +R A   L ++ +R  AL+V
Sbjct  62    -SGLINHIALPPANRADFPVDAQAETL--LCLTVAHAIPSLRDAFKSLVEKGKRPVALIV  118

Query  495   DFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCK-  671
             D FCT+A  +A E  +P +  + +NA   ++  + P LD E+VG+Y + +  +  PGC+ 
Sbjct  119   DLFCTDAFDVASEFGVPGYAAMLSNAMSMSMVAHLPKLDEEVVGEYTDMKDPILFPGCRV  178

Query  672   PVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKV  851
              VR  ++  P L+R D  Y+ +L       +A+G+L+N++ D++  T++ L+EN      
Sbjct  179   AVRGTELPSPALNRKDDGYKWFLHNAKQMDLAEGVLINSFTDLEGETIQFLQEN------  232

Query  852   VGKPVYAIGPLTRNIEERDGD--DGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELA  1025
             + KP+Y IGP+   I+  DG   D    M+WL  QP  SV  VSFGSGGTLS+ Q+TELA
Sbjct  233   MNKPIYPIGPI---IQSSDGSISDPNGCMKWLDNQPSGSVTLVSFGSGGTLSSAQLTELA  289

Query  1026  WGLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAE  1205
              GLE S++RFIWVVR P+   S+ ++F+ G+ +    N+LP+GF  RT+++GLVVP WA 
Sbjct  290   LGLEASQKRFIWVVRSPNDAASNASYFS-GRSSSNPFNFLPDGFVDRTKDRGLVVPSWAP  348

Query  1206  QALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMK  1385
             Q  +L H +TGGF+SHCG NSTLES+ NGVP+IAWPLY+EQ+ NA LL ++  VA+RP+ 
Sbjct  349   QMQVLSHVATGGFMSHCGWNSTLESLVNGVPMIAWPLYAEQKMNAVLLEKDFAVALRPIA  408

Query  1386  LPTKGIVTREEVKTLVKIMLQ-SKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
                 G++ REE+  +VK +++  ++G  +R+R+ KLK+++ +A+   GSS  S+ E++
Sbjct  409   R-EDGVIGREEIAEVVKELMEGGEQGAGVRKRMEKLKVAAAEAVGDEGSSTKSLAELV  465



>ref|NP_179446.2| UDP-glycosyltransferase family protein [Arabidopsis thaliana]
 gb|AEC06781.1| UDP-glycosyltransferase-like protein [Arabidopsis thaliana]
 gb|AHL38851.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=380

 Score =   346 bits (888),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 258/372 (69%), Gaps = 11/372 (3%)
 Frame = +3

Query  444   VRAALTKQCRRLDALVVDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIV  623
             VR A+    ++   ++VDFF T  L + D     K+VY+P++A F AL VY PVLD+ + 
Sbjct  8     VRDAVKSMKQKPTVMIVDFFGTALLSITDVGVTSKYVYIPSHAWFLALIVYLPVLDKVME  67

Query  624   GQYVEQEKGLEIPGCKPVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDID  803
             G+YV+ ++ ++IPGCKPV P++++D MLDR+D QYR+ +++G+   M+DG+L+NTW ++ 
Sbjct  68    GEYVDIKEPMKIPGCKPVGPKELLDTMLDRSDQQYRDCVQIGLEIPMSDGVLVNTWGELQ  127

Query  804   PVTLKALRENEPLSKVVGKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFG  983
               TL ALRE+  L++V+  PVY IGP+ R     +  + T   +WL KQ   SV+YV  G
Sbjct  128   GKTLAALREDIDLNRVIKVPVYPIGPIVRTNVLIEKPNST--FEWLDKQEERSVVYVCLG  185

Query  984   SGGTLSAEQITELAWGLELSEQRFIWVVR-PPSMRGSDDAFFTTGQGADGTPNYLPEGFN  1160
             SGGTLS EQ  ELAWGLELS Q F+WV+R PPS  G+      + +  D   + LPEGF 
Sbjct  186   SGGTLSFEQTMELAWGLELSCQSFLWVLRKPPSYLGA------SSKDDDQVSDGLPEGFL  239

Query  1161  TRTQNQGLVVPMWAEQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNA  1340
              RT+  GLVV  WA Q  IL H S GGFLSHCG +S LES+  GVPIIAWPLY+EQ  NA
Sbjct  240   DRTRGVGLVVTQWAPQVEILSHRSIGGFLSHCGWSSVLESLTKGVPIIAWPLYAEQWMNA  299

Query  1341  TLLTEEVGVAIRPMKLPTKGIVTREEVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAI  1514
             TLLTEE+G+AIR  +LP+K +++REEV +LVK ++  + K+G++++ +  ++++SSE+A 
Sbjct  300   TLLTEEIGMAIRTSELPSKKVISREEVASLVKKIVAEEDKEGRKIKTKAEEVRVSSERAW  359

Query  1515  SIGGSSYNSMCE  1550
             + GGSS++S+ E
Sbjct  360   THGGSSHSSLFE  371



>dbj|BAC43482.2| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
Length=380

 Score =   346 bits (887),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 258/372 (69%), Gaps = 11/372 (3%)
 Frame = +3

Query  444   VRAALTKQCRRLDALVVDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIV  623
             VR A+    ++   ++VDFF T  L + D     K+VY+P++A F AL VY PVLD+ + 
Sbjct  8     VRDAVKSMKQKPTVMIVDFFGTALLSITDVGVTSKYVYIPSHAWFLALIVYLPVLDKVME  67

Query  624   GQYVEQEKGLEIPGCKPVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDID  803
             G+YV+ ++ ++IPGCKPV P++++D MLDR+D QYR+ +++G+   M+DG+L+NTW ++ 
Sbjct  68    GEYVDIKEPMKIPGCKPVGPKELLDTMLDRSDQQYRDCVQIGLEIPMSDGVLVNTWGELQ  127

Query  804   PVTLKALRENEPLSKVVGKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFG  983
               TL ALRE+  L++V+  PVY IGP+ R     +  + T   +WL KQ   SV+YV  G
Sbjct  128   GKTLAALREDIDLNRVIKVPVYPIGPIVRTNVLIEKPNST--FEWLDKQEERSVVYVCLG  185

Query  984   SGGTLSAEQITELAWGLELSEQRFIWVVR-PPSMRGSDDAFFTTGQGADGTPNYLPEGFN  1160
             SGGTLS EQ  ELAWGLELS Q F+WV+R PPS  G+      + +  D   + LPEGF 
Sbjct  186   SGGTLSFEQTMELAWGLELSCQSFLWVLRKPPSYLGA------SSRDDDQVSDGLPEGFL  239

Query  1161  TRTQNQGLVVPMWAEQALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNA  1340
              RT+  GLVV  WA Q  IL H S GGFLSHCG +S LES+  GVPIIAWPLY+EQ  NA
Sbjct  240   DRTRGVGLVVTQWAPQVEILSHRSIGGFLSHCGWSSVLESLTKGVPIIAWPLYAEQWMNA  299

Query  1341  TLLTEEVGVAIRPMKLPTKGIVTREEVKTLVKIML--QSKKGKEMRERVVKLKMSSEKAI  1514
             TLLTEE+G+AIR  +LP+K +++REEV +LVK ++  + K+G++++ +  ++++SSE+A 
Sbjct  300   TLLTEEIGMAIRTSELPSKKVISREEVASLVKKIVAEEDKEGRKIKTKAEEVRVSSERAW  359

Query  1515  SIGGSSYNSMCE  1550
             + GGSS++S+ E
Sbjct  360   THGGSSHSSLFE  371



>gb|AIZ00426.1| UDP-glycosyltransferase [Panax ginseng]
Length=465

 Score =   348 bits (894),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 186/466 (40%), Positives = 287/466 (62%), Gaps = 18/466 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP---TERQLLESSDLTSRL  341
             HI I  SPG+GH+IP +  A R    H  K T  +I   D P    ++  L++  L + +
Sbjct  6     HIAIFPSPGMGHLIPLVQFAKRFISQH--KFTATLIVPTDGPLVKAQKTFLDA--LPAGI  61

Query  342   NNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEA  515
               V +PPV++  L  +N     Q+ + V  +LP +R         ++L ALVVD F T+A
Sbjct  62    AYVVLPPVNLDDL-PSNVNIETQIAITVARSLPSLRDVFKSLLATKKLVALVVDLFGTDA  120

Query  516   LPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVV  695
               +A+E  +  +++ P+ A   +  ++ P LD     +Y +    +++PGC P+   D++
Sbjct  121   FDVANEFKVSPYIFFPSTAMSLSFFLHLPKLDEAESCEYRDLSGPIQLPGCIPIHGRDLL  180

Query  696   DPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAI  875
             DP+ DR +  Y+  L     + +A+GI++N+++D++   +KAL+E   +      PVY +
Sbjct  181   DPVQDRKNDAYKWILHHTKRYRLAEGIMVNSFKDLEEGAIKALQEESDIP-----PVYPV  235

Query  876   GPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
             GPL + I+     DG+  ++WL  QPR SVL++SFGSGGTLS++QI ELA GLE+SEQRF
Sbjct  236   GPLIQ-IDSSSVADGSECLRWLDNQPRGSVLFISFGSGGTLSSDQINELALGLEMSEQRF  294

Query  1056  IWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             +WVVR P+   ++  FF      D   ++LP+GF  RT   GLVVP WA QA ILRH ST
Sbjct  295   LWVVRSPNNEAANANFFNVESQKDPF-DFLPKGFLERTNGNGLVVPSWAPQAQILRHHST  353

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFL+HCG NS LE++ NG+P+IAWPLY+EQ+ NA +L+E + VA+RP ++   G+V R 
Sbjct  354   GGFLTHCGWNSILETVVNGIPLIAWPLYAEQKMNAVMLSEGLKVALRP-QVDENGLVGRA  412

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             ++  +VK +++ ++GK +R R+  LK ++ K +S GGSS  SM E+
Sbjct  413   KIAKVVKCLMEGEEGKRLRNRMRDLKDAAAKVLSDGGSSTKSMAEL  458



>ref|XP_004231207.1| PREDICTED: hydroquinone glucosyltransferase [Solanum lycopersicum]
 gb|ADI33725.1| glycosyltransferase [Solanum lycopersicum]
Length=476

 Score =   349 bits (895),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 191/472 (40%), Positives = 299/472 (63%), Gaps = 14/472 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNN  347
             HI IL SPG+GH+IP +  A R+   H+   +V +I   D P +  Q +  + L S ++ 
Sbjct  6     HIAILPSPGMGHLIPLVEFAKRIFLHHH--FSVSLILPTDGPISNAQKIFLNSLPSSMDY  63

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALP  521
               +PPV+   L + + K   ++ L V  +L  +R  L    + ++  ALVVD F T+A  
Sbjct  64    HLLPPVNFDDLPE-DVKIETRISLTVSRSLTSLRQVLESIIESKKTVALVVDLFGTDAFD  122

Query  522   MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDP  701
             +A +L +  +++ P+ A   +L ++ P LD  +  +Y +    ++IPGC P+  +D++DP
Sbjct  123   VAIDLKISPYIFFPSTAMGLSLFLHLPNLDETVSCEYRDLPDPIQIPGCTPIHGKDLLDP  182

Query  702   MLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIG  878
             + DRND  Y+  L     +GMA+GI++N++++++   + AL+++EP     GKP VY +G
Sbjct  183   VQDRNDESYKWLLHHAKRYGMAEGIIVNSFKELEGGAIGALQKDEP-----GKPTVYPVG  237

Query  879   PLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             PL + ++     DG+  M WL +QPR SVLY+S+GSGGTLS EQ+ E+A GLE+SEQRF+
Sbjct  238   PLIQ-MDSGSKVDGSECMTWLDEQPRGSVLYISYGSGGTLSHEQLIEVAAGLEMSEQRFL  296

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVR P+ + ++  FF   Q +     +LP+GF  RT+  GLV+P WA QA IL H STG
Sbjct  297   WVVRCPNDKIANATFFNV-QDSTNPLEFLPKGFLERTKGFGLVLPNWAPQARILSHESTG  355

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NSTLES+ +GVP+IAWPLY+EQ+ NA +L+E++ VA+RP      GIV R E
Sbjct  356   GFLTHCGWNSTLESVVHGVPLIAWPLYAEQKMNAVMLSEDIKVALRPKVNEENGIVGRLE  415

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             +  +VK +++ ++GK +R R+  LK ++ K +S  GSS  ++ E+   + K+
Sbjct  416   IAKVVKGLMEGEEGKGVRSRMRDLKDAAAKVLSEDGSSTKALAELATKLRKK  467



>gb|KEH18690.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   349 bits (895),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 183/462 (40%), Positives = 282/462 (61%), Gaps = 14/462 (3%)
 Frame = +3

Query  174   IGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVG  353
             + +  +PG+GH+IP +  A RL+  HN+ +T F+I     P++ Q    + L   +++V 
Sbjct  19    VAMFPTPGMGHLIPMVEFAKRLSK-HNLPIT-FIIPNDGPPSKAQTTVLTSLPHGISHVF  76

Query  354   IPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPMA  527
             +PP+ +S L   NTKP   +      +LP +   L       RL AL+VD F T+   MA
Sbjct  77    LPPITLSDL-PPNTKPETLMTATTVRSLPSLHQTLLSLMTSHRLSALIVDLFGTDVFDMA  135

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              EL++P ++Y PTNA   +   Y P L + + G++ +  + L IPGC     +D+ DP+ 
Sbjct  136   AELDIPSYLYFPTNANNLSFAFYFPQLAQRVQGEFRDIPEPLNIPGCFAFHGKDLADPVQ  195

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPLT  887
             DRND  Y+ +L     + +A GI+ N++ +++P  +  L++NEP       PVY +GPL 
Sbjct  196   DRNDEAYKCFLHHVTRYKLAKGIIENSFLELEPEAITFLKKNEP-------PVYPVGPLV  248

Query  888   RNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWVV  1067
                   +G +  +  QWL +QPR SV++V+FGS G L++ Q  E+A+GLE+SEQRF+WV+
Sbjct  249   NEDSINNGSEFDVCFQWLDEQPRGSVIFVNFGSEGILTSAQTDEIAYGLEMSEQRFLWVL  308

Query  1068  RPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGFL  1247
             R P  +  +D+ F      D    +LP G+  RT+ +GLV+P WA QA +L H S GGF+
Sbjct  309   RCPKDKVENDSNFIANSNVDPF-EFLPNGYIERTKGKGLVLPYWAPQAQVLSHISIGGFV  367

Query  1248  SHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVKT  1427
             SHCG NSTLES+ NGVP+IAWPLY+EQ+ NA LL+E V VAIRP K+   G+V REE+ +
Sbjct  368   SHCGWNSTLESVVNGVPLIAWPLYAEQKMNAVLLSENVKVAIRP-KVGENGLVQREEIAS  426

Query  1428  LVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             +VK ++  ++ +++R R+  LK ++  A+   GSS   +CE+
Sbjct  427   VVKRLMVGEEEQKIRYRMKDLKEAAINALKENGSSTKQICEL  468



>ref|XP_010053798.1| PREDICTED: hydroquinone glucosyltransferase-like [Eucalyptus 
grandis]
Length=477

 Score =   349 bits (895),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 187/465 (40%), Positives = 293/465 (63%), Gaps = 11/465 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI I+ SPGI H+IP    A RL   H+  L  F+I    SP++ Q      L   + +V
Sbjct  9     HITIVPSPGISHLIPLAEFAKRLVHHHSF-LVTFIIPNDGSPSKAQQSLLGSLAPSIAHV  67

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPM  524
              +PPV +  L    T+    + L +  +LP +R  + +  +  RL ALVVD F T+A  +
Sbjct  68    FLPPVTLDDLPAETTRIETIIALTLARSLPSLRHEMRRLQESTRLVALVVDPFGTDAFNV  127

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A+E  +  F++ PT A   +L ++ P LD  +  +Y +  + ++IPGC P+   D+++P+
Sbjct  128   AEEFGVSPFLFFPTAAMCLSLFLHLPTLDEAVSCEYRDLPEPVKIPGCIPIHGRDLIEPV  187

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGP  881
              DR++  Y+  L       +A+GIL+N++E+++P  ++ L+  EP     GKP VY++GP
Sbjct  188   QDRHNDAYKWILHHARRCRLAEGILLNSFEELEPRVIEYLQGEEP-----GKPLVYSVGP  242

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             L  NI++    DG+  ++WL +QP+ SVLYVSFGSGGTLS +QI ELA GLE+SE RF+W
Sbjct  243   LV-NIKQSSKSDGSECLKWLDEQPKCSVLYVSFGSGGTLSYDQIQELALGLEMSEHRFLW  301

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVR P+ + ++ A+ T G        +LP+GF  RT+ +GLVVP W  QA +L H STGG
Sbjct  302   VVRTPNDKAANAAYLT-GDSQIEPFEFLPKGFLERTKGRGLVVPSWVPQAQVLSHSSTGG  360

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NSTLES+ NGVP+IAWPL++EQ+ NA +LT+++ VA+RP       +V R+E+
Sbjct  361   FLTHCGWNSTLESMLNGVPLIAWPLFAEQKMNALMLTQDIKVALRPRANAESSLVGRDEI  420

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
               +VK +++ ++G+ +R R+ +LK ++ + +   GSS  ++ E++
Sbjct  421   AKVVKDLMEGEEGRLVRNRMRELKDAAAQVLGEDGSSTRALSELV  465



>gb|AGU14071.1| UDP-glycosyltransferase [Cicer arietinum]
Length=472

 Score =   348 bits (894),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 187/463 (40%), Positives = 293/463 (63%), Gaps = 13/463 (3%)
 Frame = +3

Query  174   IGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVG  353
             + +L SPG+GH+IP +  A R+   HN+ +T F+I T  SP++ Q+     L   ++++ 
Sbjct  8     VAMLPSPGMGHLIPMIEFAKRIILHHNIHVT-FIIPTEASPSKAQISVLQSLPKSISHIF  66

Query  354   IPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPMA  527
             +PPV   A L +NTK    + L V  +LP +R           L A++VD F TEA  +A
Sbjct  67    LPPVSF-ADLPSNTKIETLISLTVLRSLPSLRQTFRSLSDSYTLTAVIVDLFGTEAFDVA  125

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E NLP++V+ P+ A   +  +Y   LD+E+  +Y E  + + IPGC P+  +D++DP+ 
Sbjct  126   VEFNLPRYVFYPSTAMALSFFLYLSRLDQEVHCEYNELTEPVHIPGCIPIHGKDLLDPVQ  185

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGPL  884
             DR +  Y+  LR    +  ADGI+ N++ +++P  +K L++ EP     GKP VY +GPL
Sbjct  186   DRKNDAYKWVLRNAERYREADGIIENSFVELEPGPIKELQKEEP-----GKPPVYPVGPL  240

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
                   + G + +  ++WL  QP  SVL+VSFGSGGTL++ QI ELA GLE+SEQRF+WV
Sbjct  241   VNKDVAQTGSN-SECLKWLDGQPHGSVLFVSFGSGGTLTSNQIIELALGLEMSEQRFLWV  299

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VR P+ + ++ ++F+    AD   ++LP+GF  RT  +GLVV  WA Q  +L H STGGF
Sbjct  300   VRSPNDKVANASYFSADTQADPF-DFLPKGFLERTNKRGLVVSSWAPQPQVLAHGSTGGF  358

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG NS LES+ N VP++ WPLY+EQ+ NA +LTE+V VA+RP  +   G+V R+E+ 
Sbjct  359   LTHCGWNSILESVVNAVPLVVWPLYAEQKMNAVILTEDVKVALRP-NVGENGLVERQEIA  417

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             ++VK +++ ++GK++R ++  LK ++ K +   G+S N + ++
Sbjct  418   SVVKCLMEGEEGKKLRYQMKDLKDAAVKTLGENGTSTNYISKL  460



>ref|XP_004494807.1| PREDICTED: hydroquinone glucosyltransferase-like [Cicer arietinum]
Length=480

 Score =   348 bits (894),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 187/463 (40%), Positives = 293/463 (63%), Gaps = 13/463 (3%)
 Frame = +3

Query  174   IGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNVG  353
             + +L SPG+GH+IP +  A R+   HN+ +T F+I T  SP++ Q+     L   ++++ 
Sbjct  16    VAMLPSPGMGHLIPMIEFAKRIILHHNIHVT-FIIPTEASPSKAQISVLQSLPKSISHIF  74

Query  354   IPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPMA  527
             +PPV   A L +NTK    + L V  +LP +R           L A++VD F TEA  +A
Sbjct  75    LPPVSF-ADLPSNTKIETLISLTVLRSLPSLRQTFRSLSDSYTLTAVIVDLFGTEAFDVA  133

Query  528   DELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPML  707
              E NLP++V+ P+ A   +  +Y   LD+E+  +Y E  + + IPGC P+  +D++DP+ 
Sbjct  134   VEFNLPRYVFYPSTAMALSFFLYLSRLDQEVHCEYNELTEPVHIPGCIPIHGKDLLDPVQ  193

Query  708   DRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGPL  884
             DR +  Y+  LR    +  ADGI+ N++ +++P  +K L++ EP     GKP VY +GPL
Sbjct  194   DRKNDAYKWVLRNAERYREADGIIENSFVELEPGPIKELQKEEP-----GKPPVYPVGPL  248

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
                   + G + +  ++WL  QP  SVL+VSFGSGGTL++ QI ELA GLE+SEQRF+WV
Sbjct  249   VNKDVAQTGSN-SECLKWLDGQPHGSVLFVSFGSGGTLTSNQIIELALGLEMSEQRFLWV  307

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VR P+ + ++ ++F+    AD   ++LP+GF  RT  +GLVV  WA Q  +L H STGGF
Sbjct  308   VRSPNDKVANASYFSADTQADPF-DFLPKGFLERTNKRGLVVSSWAPQPQVLAHGSTGGF  366

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             L+HCG NS LES+ N VP++ WPLY+EQ+ NA +LTE+V VA+RP  +   G+V R+E+ 
Sbjct  367   LTHCGWNSILESVVNAVPLVVWPLYAEQKMNAVILTEDVKVALRP-NVGENGLVERQEIA  425

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             ++VK +++ ++GK++R ++  LK ++ K +   G+S N + ++
Sbjct  426   SVVKCLMEGEEGKKLRYQMKDLKDAAVKTLGENGTSTNYISKL  468



>ref|XP_010097012.1| Hydroquinone glucosyltransferase [Morus notabilis]
 gb|EXB66639.1| Hydroquinone glucosyltransferase [Morus notabilis]
Length=480

 Score =   347 bits (891),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 186/471 (39%), Positives = 289/471 (61%), Gaps = 9/471 (2%)
 Frame = +3

Query  159   QSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSR  338
             Q+  H+ IL SPG+GH+IP +  A R    HN  +T F++ T+ SP+       + L   
Sbjct  7     QTRQHVAILPSPGMGHVIPMVEFAKRFVRNHNFTVT-FLVPTSGSPSTAMRSVFNGLPDS  65

Query  339   LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR---LDALVVDFFCT  509
             + +V +PPV+   L +  +K   ++ L V  +L  +R AL     R   + ALVVD F  
Sbjct  66    IEHVFLPPVNFDDLPEG-SKLETRIALTVVRSLASLRDALASLFSRRVGVVALVVDHFGL  124

Query  510   EALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPED  689
             +A  +A E NLP +++ P+ A   +L ++ P LD     +Y E    ++IPGC P+  +D
Sbjct  125   DAFDVAREFNLPSYLFYPSPAMVLSLILHLPELDESTSSEYWELTDPVKIPGCFPIPGKD  184

Query  690   VVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVY  869
             ++DP+ DR    Y+  L     + + DGI++NT+ D++P  + +L+E E   K+    VY
Sbjct  185   LLDPIQDRKSDVYKLTLHKAKQYRLVDGIIVNTFNDLEPRAISSLQEREATEKL--PRVY  242

Query  870   AIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQ  1049
              +GPL +       ++ +  + WL  QPR SVL++SFGSGGTLS++Q  ELA GLE SEQ
Sbjct  243   PVGPLAKIQRTNLTEEESQCLIWLDGQPRVSVLFISFGSGGTLSSDQTNELALGLENSEQ  302

Query  1050  RFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHP  1229
             RF+WVVRPP+ R +  A+F      + + ++LP+GF  RT+++GLVV  WA QA IL H 
Sbjct  303   RFLWVVRPPNDRAASAAYFKVNSQNESSFDFLPDGFLGRTRDRGLVVHSWAPQAQILSHS  362

Query  1230  STGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVT  1409
             S GGFL+HCG NS LES+ NGVP+I WPL++EQR NA +LTE++ VA+RP K    G+V 
Sbjct  363   SIGGFLTHCGWNSILESMVNGVPMIVWPLFAEQRMNAFMLTEDIKVALRP-KASENGVVE  421

Query  1410  REEVKTLVKIMLQSKKGKE-MRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             REE+  ++K +++  + +E +R+R+ +LK +   A++  G+S  ++ +V +
Sbjct  422   REEIARVIKALMEGGEDREKLRKRIEELKEAGSTALTEDGNSTKALADVAD  472



>ref|XP_011005719.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 5-like, partial 
[Populus euphratica]
Length=311

 Score =   341 bits (874),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/293 (57%), Positives = 211/293 (72%), Gaps = 2/293 (1%)
 Frame = +3

Query  669   KPVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSK  848
             K V+PEDVVDPMLDR D QY EY+R+ +     DGIL+N WED++P TL+ALR+ E L +
Sbjct  1     KAVQPEDVVDPMLDRTDQQYLEYVRMAMEIPTCDGILLNIWEDLEPKTLEALRDEELLGQ  60

Query  849   VVGKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAW  1028
             +   PVY +GPLTR  +  D   G + + WL KQP ESV+YVSFGSGGTLS EQ  ELAW
Sbjct  61    LCKAPVYPVGPLTRPPKPLDSRSGELFI-WLDKQPSESVIYVSFGSGGTLSLEQTVELAW  119

Query  1029  GLELSEQRFIWVVRPPSMRGSDDAFFTTGQG-ADGTPNYLPEGFNTRTQNQGLVVPMWAE  1205
             GLELS+QRFIWVVR PS +  D +FF+ G G A    +  PEGF  R Q  GLV+  WA 
Sbjct  120   GLELSQQRFIWVVRSPSRKKGDGSFFSAGSGEASSMASCFPEGFLDRIQEVGLVIQDWAP  179

Query  1206  QALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMK  1385
             Q  IL HPS GGF+SHCG NSTLESI NGVP+IAWPLYSEQR NA LLTEE+GVA+RP  
Sbjct  180   QVDILNHPSVGGFISHCGWNSTLESITNGVPMIAWPLYSEQRMNAALLTEELGVAVRPSI  239

Query  1386  LPTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             L ++G+V REE++ +++ +   K+   ++ RV KLK S+ + IS GGSS+N++
Sbjct  240   LASEGMVGREEIEMMIRKITVDKEATNIKNRVKKLKYSAAETISKGGSSHNAL  292



>gb|AFJ52927.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=473

 Score =   347 bits (889),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 187/474 (39%), Positives = 302/474 (64%), Gaps = 17/474 (4%)
 Frame = +3

Query  153   NNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTAD-SPTERQLLESSDL  329
             ++Q   H+ I  SPG+GH+IP + L+ +L   HN+ +TV + +    S  + Q L+S   
Sbjct  2     SSQQKPHVVIFPSPGMGHLIPFVELSKKLVLSHNLSVTVMIPSLGPPSKAQAQFLDSLP-  60

Query  330   TSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAAL---TKQCRRLDALVVDF  500
                +N++ +PP +  A   A+ +    LCL V  A+P +R AL    ++ +R  AL+VD 
Sbjct  61    DGLINHIALPPAN-RADFPADAQAETLLCLTVAHAIPSLRDALKSFVEKGKRPVALIVDL  119

Query  501   FCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCK-PV  677
             FCT+A  +A E  +P +V + +NA   ++  + P LD E+VG+Y + ++ +  PGC+  +
Sbjct  120   FCTDAFDVASEFGVPGYVAMLSNAMLMSMVAHLPKLDEEVVGEYTDMKEPILFPGCRVAI  179

Query  678   RPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVG  857
                ++  P L+R +  Y+ +L       +A+G+L+N++ D++  T++ L++N      + 
Sbjct  180   HGSELPSPALNRKNDGYKWFLHNVKHMDLAEGVLINSFTDLEGETIRFLQKN------MN  233

Query  858   KPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLE  1037
             KP+Y IGP+ ++ +    D    I +WL  QP  SVL VSFGSGGTLS+ Q+TELA GLE
Sbjct  234   KPIYPIGPIIQSGDSSITDPSGCI-KWLDHQPDGSVLLVSFGSGGTLSSAQLTELALGLE  292

Query  1038  LSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALI  1217
              S++RFIWVVR P+   S+ ++F+ G+ +    ++LPEGF  RT+++GLVVP WA Q  +
Sbjct  293   ASQKRFIWVVRSPNDAASNASYFS-GRSSSNPFDFLPEGFVDRTKDRGLVVPSWAPQMQV  351

Query  1218  LRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTK  1397
             L H +TGGF+SHCG NSTLES+ NGVP+IAWPLY+EQ+ NA LL ++ GVA+RP+     
Sbjct  352   LSHLATGGFMSHCGWNSTLESLMNGVPMIAWPLYAEQKMNAVLLEKDFGVALRPIAR-ED  410

Query  1398  GIVTREEVKTLVKIMLQ-SKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
             G++ REE+  +VK +++   +G  +R+R+ KLK+++ +A+   GSS  S+ E++
Sbjct  411   GVIGREEISEVVKELMEGGDQGAAVRKRMEKLKLAAAEAVGDEGSSTKSLAELV  464



>ref|XP_010531180.1| PREDICTED: UDP-glycosyltransferase 72D1 [Tarenaya hassleriana]
Length=452

 Score =   346 bits (887),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 189/468 (40%), Positives = 289/468 (62%), Gaps = 37/468 (8%)
 Frame = +3

Query  153   NNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFV------ITTADSPTERQLL  314
                S  H  +L+ PG+GH+IP L LA+RL+   + ++TVF+      +++A+S T R  +
Sbjct  2     GTHSKPHALLLARPGMGHVIPVLELAHRLSSSLHFRVTVFLGPFGRAMSSAESHTARAAM  61

Query  315   ESSDLTSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRLDALVV  494
                    R     +PPVD+++L++ +   V +L + +R   P V A       +   L+V
Sbjct  62    ARGSFDVR----ELPPVDVTSLVEPDAAAVTKLTVTMREMRPAVLATALGMRPKPTVLIV  117

Query  495   DFFCTEALPMADELNLP-KFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCK  671
             D F TE L +A+E+ +  K+V+V ++A F AL VY PVLD+ + G+Y EQ++ ++IPGC+
Sbjct  118   DLFGTEVLSIAEEIGVAAKYVFVASHALFLALKVYLPVLDKLVEGEYTEQKEPMKIPGCR  177

Query  672   PVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKV  851
             PVRP++++DPMLDR++ QY+E +R+ +    +DG+ +  W ++   TL AL  N  L ++
Sbjct  178   PVRPDELIDPMLDRSNRQYQECVRVSLEIPTSDGVFIFIWGELQGETLAALDGNGELGRI  237

Query  852   VGKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWG  1031
             +  PVY IG + R  +  +   G+ + +WL +QP  SV+YV  GSGGTLS +Q TE+AWG
Sbjct  238   MRVPVYPIGSIIRPNDPTERPIGS-VFEWLDQQPGRSVVYVCLGSGGTLSFQQTTEMAWG  296

Query  1032  LELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQA  1211
             LE S QRF+WV+R P++R  D A            + LPEGF  R             + 
Sbjct  297   LEHSGQRFLWVLRRPTVRTGDVA------------SVLPEGFMDRVGRT---------RC  335

Query  1212  LILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLP  1391
                +  S GGFLSHCG NSTLES++NGVP++ WPLY+EQR NA +LTEE+GV +RP + P
Sbjct  336   GSHKQRSVGGFLSHCGWNSTLESLRNGVPMVTWPLYAEQRMNAVVLTEEIGVGVRPRRFP  395

Query  1392  T-KGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSS  1532
             T +G++ REE+  LV+ ++       MR++  ++K+SSE+A S GGSS
Sbjct  396   TAEGVIGREEIAELVRRVMVDGG---MRDKAREIKLSSERAWSDGGSS  440



>gb|AEM43001.1| UDP-glucosyltransferase [Siraitia grosvenorii]
Length=493

 Score =   346 bits (888),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 186/464 (40%), Positives = 281/464 (61%), Gaps = 10/464 (2%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             H+ +L SPG+GH+IP L  A RL  +H   +T F I + D P++ Q+   S L S ++ V
Sbjct  16    HVVMLPSPGMGHLIPLLEFAKRLLFLHRFTVT-FAIPSGDPPSKAQISILSSLPSGIDYV  74

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQC--RRLDALVVDFFCTEALPM  524
              +PPV+   L   +TK    + L V  +LP  R           L ALVVD F T+A  +
Sbjct  75    FLPPVNFHDL-PKDTKAEVFIVLAVARSLPSFRDLFKSMVANTNLVALVVDQFGTDAFDV  133

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A E N+  +++ P  A   +  +  P  D  +  +Y E  + + + GC P+  +D+ DP 
Sbjct  134   AREFNVSPYIFFPCAAMTLSFLLRLPEFDETVAEEYRELPEPIRLSGCAPIPGKDLADPF  193

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGPL  884
              DR +  Y+ +L     + +ADGI +N++ +++P  +KAL E E    +V    + +GPL
Sbjct  194   HDRENDAYKLFLHNAKRYALADGIFLNSFPELEPGAIKALLEEESRKPLV----HPVGPL  249

Query  885   TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIWV  1064
              + I+    ++G   ++WL +QP  SVL+VSFGSGGTLS++QI ELA GLE+S  RFIWV
Sbjct  250   VQ-IDSSGSEEGAECLKWLEEQPHGSVLFVSFGSGGTLSSDQINELALGLEMSGHRFIWV  308

Query  1065  VRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGGF  1244
             VR PS   ++ +FF+     D   ++LPEGF   T+ + +VVP WA QA IL H STGGF
Sbjct  309   VRSPSDEAANASFFSVHSQNDPL-SFLPEGFLEGTRGRSVVVPSWAPQAQILSHSSTGGF  367

Query  1245  LSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEVK  1424
             LSHCG NSTLES+  GVP+IAWPLY+EQ+ NA LLTE++ VA+RP      GIV +EE+ 
Sbjct  368   LSHCGWNSTLESVVYGVPLIAWPLYAEQKMNAILLTEDIKVALRPKTNEKTGIVEKEEIA  427

Query  1425  TLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVL  1556
               VK +++ + GK++R ++  L+ ++E+ +   GSS  ++ +++
Sbjct  428   EAVKTLMEGEDGKKLRSKMKYLRNAAERVLEEDGSSSKALSQMV  471



>ref|XP_011093530.1| PREDICTED: hydroquinone glucosyltransferase [Sesamum indicum]
Length=476

 Score =   345 bits (886),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 190/464 (41%), Positives = 289/464 (62%), Gaps = 12/464 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNN  347
             HI +L SPG+GH+IP +  A +L  +H+ +++  +I   D P +  Q    S L   ++ 
Sbjct  12    HIAVLPSPGMGHLIPIVEFAKKL--LHHHRISTTLIMPTDGPLSNAQNTLFSTLPPGIDY  69

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRR--LDALVVDFFCTEALP  521
             + +P ++   L   + K   ++ L V  +LP +R A+     R  L ALVVD F T+   
Sbjct  70    ILLPTLNFDDL-PPDVKIETRISLTVTRSLPSLRDAVKSLLERTPLAALVVDLFGTDGFE  128

Query  522   MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDP  701
             +A E  +P +++ P+ A   +L +Y P LD  +  +Y E  + L IPGC P+   D++DP
Sbjct  129   VALEFKIPPYIFFPSTAMALSLFLYLPKLDETVSCEYREVAEKLLIPGCTPIDGRDLLDP  188

Query  702   MLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVYAIGP  881
             + DR +  Y+  L     + MA+GI++N++++++P  ++AL+E E    VV    Y IGP
Sbjct  189   LQDRKNDAYKWVLHHTKRYRMAEGIILNSFKELEPGAIEALQEKEDRKPVV----YPIGP  244

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             L +   + + D+  + ++WL +QPR SVLYVSFGSGGTLS +++ ELA GLE+SEQRF+W
Sbjct  245   LIQTGPKPEVDESCVCLKWLDEQPRGSVLYVSFGSGGTLSHDEMVELALGLEMSEQRFLW  304

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             V R P+   ++  +F   Q ++    YLP+GF  RT+ +GLVVP WA QA IL H STG 
Sbjct  305   VARCPNDTTANATYFNI-QSSNDPLAYLPDGFLERTKGRGLVVPTWAPQAHILGHESTGA  363

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NS LES+ NGVP+IAWPLY+EQR NA +L E+V VA+RP K    G V R+E+
Sbjct  364   FLTHCGWNSILESVVNGVPMIAWPLYAEQRMNALMLHEDVRVALRP-KAGENGFVGRDEI  422

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
                VK +++ ++GKE+R R+  LK ++ K +S+ GSS   + E+
Sbjct  423   AKTVKGLVEGEEGKEIRSRMRDLKDAAAKVLSVNGSSTKILAEL  466



>ref|XP_010053797.1| PREDICTED: hydroquinone glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW78151.1| hypothetical protein EUGRSUZ_D02353 [Eucalyptus grandis]
Length=477

 Score =   345 bits (886),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 188/466 (40%), Positives = 290/466 (62%), Gaps = 15/466 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPT--ERQLLESSDLTSRLN  344
             HI I+ +PG+GH+IP    A RL   H+  +T FVI    SP   +R LL+S  L   + 
Sbjct  9     HIAIVPTPGMGHLIPLAEFAKRLIHRHSFSVT-FVIPNDGSPAKAQRSLLDS--LPPSIT  65

Query  345   NVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALT--KQCRRLDALVVDFFCTEAL  518
              V +PPV    L    T+    + L +  ++P +R  +   K+  RL ALV D F T++ 
Sbjct  66    YVFLPPVCFDDLPAETTRIETIVALTLARSVPSLRDEVRRLKESTRLVALVADLFGTDSF  125

Query  519   PMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
              +A E N+  +++ PT A   +L ++ P+LD  +  +Y +  + ++IPGC P+  +D++D
Sbjct  126   DVAQEFNVSPYIFFPTTAMCLSLFLHLPMLDEAVSCEYRDLPEPVKIPGCIPIHGKDLLD  185

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAI  875
             P+ DR +  Y+  L     + + +GIL+N++E+++P  ++ L+  EP     G+P VY +
Sbjct  186   PVQDRRNDAYKWILHHARRYRLVEGILLNSFEELEPGAVEYLKREEP-----GRPPVYPV  240

Query  876   GPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
             GPL  N+E+    DG   ++WL +Q   SV+YVSFGS GTLS +QI ELA GLE+SE RF
Sbjct  241   GPLV-NMEQSSKSDGWECLKWLDEQLDGSVVYVSFGSWGTLSYDQIQELALGLEMSEHRF  299

Query  1056  IWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             +WVVR P+   ++  +FT     +    +LP+GF  RT+ +GLV+P WA QA +L H ST
Sbjct  300   LWVVRTPNDIAANATYFTVYSQNEPF-QFLPKGFLERTKGRGLVLPSWAPQAQVLAHRST  358

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFL+HCG NSTLESI NGVP++ WPLY+EQR NA +LT+++ VA+RP   P  G+V R+
Sbjct  359   GGFLTHCGWNSTLESIVNGVPLVTWPLYAEQRMNALMLTQDIKVALRPSADPESGLVGRD  418

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             E+  +VK +++ ++GK +R R+  LK ++ K +   GSS  ++ E+
Sbjct  419   EIARVVKRLMEGEEGKRIRNRMKDLKDAAAKVLGKDGSSTRALSEL  464



>ref|XP_010266460.1| PREDICTED: hydroquinone glucosyltransferase-like [Nelumbo nucifera]
Length=470

 Score =   345 bits (885),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 190/471 (40%), Positives = 293/471 (62%), Gaps = 13/471 (3%)
 Frame = +3

Query  159   QSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSR  338
             Q   HI I+ +PG+GH+IP +  A RL   H+  +T F++ T   P++ Q      L   
Sbjct  5     QRTPHIVIVPTPGMGHLIPLIEFAKRLVHHHHFTVT-FIVPTDGPPSKAQTSVLDSLPKT  63

Query  339   LNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTE  512
             ++++ +PPV+   L D + K   ++ L V  +LP +R AL       R  ALV D F T+
Sbjct  64    ISSLFLPPVNFDDLPD-DAKIETRISLTVVRSLPSLRDALKTLVSTTRPVALVADLFGTD  122

Query  513   ALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDV  692
             A  +A E  LP +++ P+ A    L  + P LD+    +Y + ++ +E+PGC P+   ++
Sbjct  123   AFDVAKEFKLPPYIFFPSTATTLNLFFHLPELDQRYSCEYRDLQEPVELPGCLPIPGREL  182

Query  693   VDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VY  869
             +DP+ D+ +  Y+  L     + +A+G+++N++ D++P  LKALR++ P     G+P VY
Sbjct  183   LDPVQDKKNEAYKWLLHHTKRYLLAEGVMVNSFMDLEPGPLKALRQDIP-----GRPPVY  237

Query  870   AIGPLTRNIEERDGD-DGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSE  1046
              +GPL R      G  +    ++WL  QP  SVL+VSFGSGGTLS EQ+TELA GLE+SE
Sbjct  238   PVGPLIRTSSSDAGAAERPHCLKWLDDQPSGSVLFVSFGSGGTLSHEQLTELALGLEMSE  297

Query  1047  QRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRH  1226
             QRF+WVVR PS + ++  +F+   G     ++LP+GF  RT+  GLVV  WA Q  IL H
Sbjct  298   QRFLWVVRSPSQKAANATYFSV-HGLSDPFDFLPKGFLERTKGLGLVVSSWAPQTEILSH  356

Query  1227  PSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIV  1406
              STGGFL+HCG NSTLES+  GVP+IAWPLY+EQ+ NA +L+E++ V++R  K+   G+V
Sbjct  357   GSTGGFLTHCGWNSTLESVVYGVPLIAWPLYAEQKMNAFMLSEDLKVSLR-AKVNEDGLV  415

Query  1407  TREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
              R E+ T+VK +++ ++GK +R R+  LK ++ + +S  GSS  ++ EV+N
Sbjct  416   GRAEIATVVKGLMEGEEGKRIRSRMKDLKDAAARVLSEDGSSTKALFEVVN  466



>ref|XP_009365904.1| PREDICTED: UDP-glycosyltransferase 72E1-like [Pyrus x bretschneideri]
Length=468

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 194/471 (41%), Positives = 287/471 (61%), Gaps = 20/471 (4%)
 Frame = +3

Query  150   NNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDL  329
              ++Q   H+ +L+SPGIGH+ P L LA RL   H   +T   I T   P + QLL +  L
Sbjct  2     ESSQKKPHVAVLASPGIGHVTPLLELAKRLVVDHGFHVTFLSIITDAPPAQLQLLSNPSL  61

Query  330   TSRLNNVGIPPVDISALLDANTKPVA---QLCLLVRAALPGVRAALTKQCRRLDALVVDF  500
              S L+ V +P VD+S       +P+    ++ L+V+  L  +   L      + +LVVD 
Sbjct  62    PSDLHVVSLPRVDVS------QQPIGISVRIFLVVQETLKSLPFVLKNLQPPIKSLVVDP  115

Query  501   FCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVR  680
             FC EAL +  +L++P +V++ ++A   A T+Y P ++ E+ G Y +  + + +PGCKP+ 
Sbjct  116   FCIEALEITADLSIPTYVFMTSSASLLAFTMYFPTINAEVNGDYSKIAEEVIVPGCKPLL  175

Query  681   PEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGK  860
              +D+V  +L        E L +   F    GIL+NTWE+++PVTL +LREN     +   
Sbjct  176   LDDLVPGVL------LPEVLPMCNRFPTVKGILVNTWEELEPVTLLSLRENPFFLGLPAP  229

Query  861   PVYAIGPLTRNIEERDGD-DGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLE  1037
             PVY IGPLT+  +      + +  + WL +QP  SV+YVSFGSGGTLS EQ++ELAWGLE
Sbjct  230   PVYPIGPLTKEDKPVTSTLESSKFLTWLDEQPIGSVVYVSFGSGGTLSREQMSELAWGLE  289

Query  1038  LSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALI  1217
             LS++RF+WV RPP+   +  +FF  G   D   +YLPEGF  RT+ +GLV P WA Q  +
Sbjct  290   LSQKRFVWVARPPNDSSASGSFFKAGFNTDYPASYLPEGFLDRTRGRGLVTPSWAPQVAV  349

Query  1218  LRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTK  1397
             L H S  GF++HCG NS LES+ +GV +IAWPLY+EQR NA  L  +VGVA+ P      
Sbjct  350   LSHRSVAGFVTHCGWNSVLESVLHGVAMIAWPLYAEQRMNARFLV-DVGVAVWPEAEEDD  408

Query  1398  G--IVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSM  1544
             G  +V R EV+ +V+ +L+ ++G+ +R RV +L+ ++ KA+ + GSS  S+
Sbjct  409   GKKVVGRCEVERVVRTILE-EEGEGVRRRVRELQGTAVKALEVDGSSSGSL  458



>emb|CDP08704.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 190/478 (40%), Positives = 287/478 (60%), Gaps = 18/478 (4%)
 Frame = +3

Query  174   IGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNNV  350
             + +L SPG+GH+IP +  A RL   H+  +T+ + T  D P ++ Q    + L + ++ +
Sbjct  7     VALLPSPGMGHLIPLVEFAKRLILQHDFSVTIILPT--DGPLSKAQTTFLAALPAAIDYI  64

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALPM  524
              +PPV+   L D + +   ++ L V  +LP +R AL       +L ALVVD F T+A  +
Sbjct  65    LLPPVNFDDLAD-DVRIETRISLTVTRSLPSLRDALKSLVDTAKLAALVVDLFGTDAFDV  123

Query  525   ADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDPM  704
             A+E  LP +++ P+ A   A   Y P L   +  ++ +    + +PGC P+   D++DP 
Sbjct  124   ANEFKLPPYIFFPSTATALAFFSYLPKLHEMVACEFRDLPGPIRVPGCVPIHGRDLLDPA  183

Query  705   LDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIGP  881
              DR +  Y+  L     + +A+GI++N+++D++P  LKAL+E EP     GKP VY +GP
Sbjct  184   QDRKNDAYKWLLHHARRYSLAEGIVVNSFKDLEPGPLKALQEQEP-----GKPPVYPVGP  238

Query  882   LTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFIW  1061
             L +        +    ++WL  QP  SVLY+SFGSGGTLS  Q+ ELA+GLE+SEQRF+W
Sbjct  239   LIQMGSGEKRGEEPECLKWLDDQPSGSVLYISFGSGGTLSHNQLVELAFGLEMSEQRFLW  298

Query  1062  VVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTGG  1241
             VVR P+   ++  +FT     D    ++PEGF  R + +G +VP WA QA IL H STGG
Sbjct  299   VVRSPNDGVANATYFTVNSQNDPL-AFMPEGFLDRIKGRGFLVPSWAPQAKILGHSSTGG  357

Query  1242  FLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREEV  1421
             FL+HCG NSTLES+  G+P+IAWPLY+EQ+ NA +L E++ VA RP K    G V R E+
Sbjct  358   FLTHCGWNSTLESVVEGIPLIAWPLYAEQKMNAVMLAEDLKVASRP-KADENGFVGRVEI  416

Query  1422  KTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKRRDLKICT  1595
               +VK +++ ++GK +R R+ +LK ++ K +S  GSS     E L  +  +   KICT
Sbjct  417   ANMVKRLMEGEEGKGLRSRMKELKDAAAKVLSQDGSS----TEALAQVAGKWQAKICT  470



>sp|Q9AR73.1|HQGT_RAUSE RecName: Full=Hydroquinone glucosyltransferase; AltName: Full=Arbutin 
synthase [Rauvolfia serpentina]
 emb|CAC35167.1| arbutin synthase [Rauvolfia serpentina]
Length=470

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 192/472 (41%), Positives = 287/472 (61%), Gaps = 15/472 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNN  347
             HI ++ +PG+GH+IP +  A RL   HN  +T  + T    P  ++  L++  L + +N 
Sbjct  6     HIAMVPTPGMGHLIPLVEFAKRLVLRHNFGVTFIIPTDGPLPKAQKSFLDA--LPAGVNY  63

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALP  521
             V +PPV    L  A+ +   ++CL +  +LP VR A+       +L ALVVD F T+A  
Sbjct  64    VLLPPVSFDDL-PADVRIETRICLTITRSLPFVRDAVKTLLATTKLAALVVDLFGTDAFD  122

Query  522   MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDP  701
             +A E  +  +++ PT A   +L  + P LD+ +  +Y +  + L+IPGC P+  +D +DP
Sbjct  123   VAIEFKVSPYIFYPTTAMCLSLFFHLPKLDQMVSCEYRDVPEPLQIPGCIPIHGKDFLDP  182

Query  702   MLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIG  878
               DR +  Y+  L     + +A+GI++NT+ D++P  LKAL+E +      GKP VY IG
Sbjct  183   AQDRKNDAYKCLLHQAKRYRLAEGIMVNTFNDLEPGPLKALQEEDQ-----GKPPVYPIG  237

Query  879   PLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRFI  1058
             PL R       DD    ++WL  QPR SVL++SFGSGG +S  Q  ELA GLE+SEQRF+
Sbjct  238   PLIRADSSSKVDD-CECLKWLDDQPRGSVLFISFGSGGAVSHNQFIELALGLEMSEQRFL  296

Query  1059  WVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPSTG  1238
             WVVR P+ + ++  +F+  Q  +    YLPEGF  RT+ + L+VP WA Q  IL H STG
Sbjct  297   WVVRSPNDKIANATYFSI-QNQNDALAYLPEGFLERTKGRCLLVPSWAPQTEILSHGSTG  355

Query  1239  GFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTREE  1418
             GFL+HCG NS LES+ NGVP+IAWPLY+EQ+ NA +LTE + VA+RP K    G++ R E
Sbjct  356   GFLTHCGWNSILESVVNGVPLIAWPLYAEQKMNAVMLTEGLKVALRP-KAGENGLIGRVE  414

Query  1419  VKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
             +   VK +++ ++GK+ R  +  LK ++ +A+S  GSS  ++ E+    E +
Sbjct  415   IANAVKGLMEGEEGKKFRSTMKDLKDAASRALSDDGSSTKALAELACKWENK  466



>ref|XP_006847343.1| hypothetical protein AMTR_s00015p00249680 [Amborella trichopoda]
 gb|ERN08924.1| hypothetical protein AMTR_s00015p00249680 [Amborella trichopoda]
Length=471

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 193/483 (40%), Positives = 287/483 (59%), Gaps = 20/483 (4%)
 Frame = +3

Query  144   MDNNNQSMLHIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLES-  320
             M    Q+  H+ IL SPG+GH+IP +  + RL   H+  +T   + T  S  +  +L + 
Sbjct  1     MAMEAQTGTHVAILPSPGMGHLIPLVAFSKRLVATHSFSITFINLITDSSAAQSSVLSTL  60

Query  321   SDL-TSRLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTKQCRRL--DALV  491
             +D+  S L +V +PP D+S L   + K   ++ L VR +L  +R  L     +     +V
Sbjct  61    NDVGLSSLQSVDLPPADLSDL-PISAKIETRISLTVRRSLSSLRTLLCDLTSKFPNTVMV  119

Query  492   VDFFCTEALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCK  671
              D F T+A  +ADEL+LPK+++ P NA    L    P LD ++ G++ +  + L +PGC 
Sbjct  120   ADIFGTDAFDVADELSLPKYLFFPANATALCLMSQLPALDAQVSGEFRDLPE-LRLPGCS  178

Query  672   -PVRPEDVVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSK  848
              P   +D++ P+ DR D  Y   L     +  ADGI +NT+E ++   L+ L+EN    +
Sbjct  179   SPFPGKDLLAPLQDRKDAAYSWLLHQAKRYRQADGIFVNTFEGLESQALQFLKEN----R  234

Query  849   VVGKPVYAIGPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAW  1028
                  V+ +GPLT  + E D +     ++WL +QP  SVL+VSFGSGGTLS  Q   LA 
Sbjct  235   ASFPEVFPVGPLTLELPENDSE----CLRWLDEQPPGSVLFVSFGSGGTLSCGQYQNLAH  290

Query  1029  GLELSEQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQ  1208
             GLE S QRF+WV+R P +     AFFT     D    YLP+GF  RT+  G+VVP WA Q
Sbjct  291   GLEKSGQRFLWVIRTPEVTEGPAAFFTVESKGD-PKAYLPQGFLERTKGVGMVVPSWAPQ  349

Query  1209  ALILRHPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKL  1388
               +L H +TGGFL+HCG NSTLES +NG+P+IAWPLY+EQ+ NA LL +E+ VAIRP K+
Sbjct  350   TRVLAHAATGGFLTHCGWNSTLESFQNGIPLIAWPLYAEQKMNAILLVDEIKVAIRP-KM  408

Query  1389  PTKGIVTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIE  1568
                GI+  EE+  +V+ +++ ++GK +R ++  L+ ++  A++ GGSSY+S   V+NA +
Sbjct  409   QEDGIIKVEEIDRVVRGLMEGEEGKALRAKMRDLRDAASTAVAEGGSSYHS---VVNATQ  465

Query  1569  KRR  1577
               R
Sbjct  466   IWR  468



>ref|XP_004306692.1| PREDICTED: hydroquinone glucosyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   341 bits (875),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 194/468 (41%), Positives = 293/468 (63%), Gaps = 15/468 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSPTERQLLESSDLTSRLNNV  350
             HI +  SPG+GH+IP   LA +L   HN  +T F++     PT+ Q      L   +++V
Sbjct  8     HIAMHPSPGMGHLIPLTELAKQLVHRHNFTVT-FIVPCDGPPTKAQKSVLDALPPSIDHV  66

Query  351   GIPPVDISALLDANTKPVAQLCLLVRAALP----GVRAALTKQCRRLDALVVDFFCTEAL  518
              +PPV    L    T+    + L V  +LP     V++ + ++  +L  LVVD F T+A 
Sbjct  67    FLPPVSFDDL-PTGTQMETVISLTVSRSLPYLRDTVKSLIGREGTKLVGLVVDLFGTDAF  125

Query  519   PMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVD  698
              +A E N+  +++  + A   +L +Y P LD  +  +Y E E+ ++IPGC P+  ++++D
Sbjct  126   EVAREFNISSYIFYCSTAMALSLFLYLPKLDEAVSCEYWELEEPVKIPGCVPIPGKELLD  185

Query  699   PMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAI  875
             P+ +R D  Y+  L     + +A+GIL+N++ +++P  LKAL+E EP     GKP VY +
Sbjct  186   PVQNRKDEAYKWVLHHAKRYRLAEGILVNSFMELEPGALKALQEKEP-----GKPPVYPV  240

Query  876   GPLTRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQRF  1055
             GPL + ++ +   D +  ++WL +QPR SVLYVSFGSGGTLS +Q+TELA GLE+SEQRF
Sbjct  241   GPLVK-LDSKAVADESKCLKWLDEQPRGSVLYVSFGSGGTLSYKQVTELALGLEMSEQRF  299

Query  1056  IWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPST  1235
             +WVVR PS   ++  +F+   G      +LP+GF  RT+ +GLVVP WA QA IL H ST
Sbjct  300   LWVVRSPSDEAANATYFSV-HGKGDPLAFLPKGFLERTKGRGLVVPNWAPQAHILGHEST  358

Query  1236  GGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTRE  1415
             GGFL+HCG NS LESI NGVP +AWPLY+EQ+ NA +   E+ VA+RP +    G V RE
Sbjct  359   GGFLTHCGWNSALESIANGVPFVAWPLYAEQKMNAFMFIHEIKVALRP-RADENGFVERE  417

Query  1416  EVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLN  1559
             EV  +VK +++ ++GK +R R+  LK ++ K++S  G+S  ++ +V+ 
Sbjct  418   EVAVVVKGLMEGEEGKRLRNRMKDLKDAARKSLSDEGASTKALSDVVT  465



>dbj|BAG80556.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=476

 Score =   341 bits (875),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 189/474 (40%), Positives = 295/474 (62%), Gaps = 17/474 (4%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-TERQLLESSDLTSRLNN  347
             HI IL SPG+GH+IP +  + RL  + N   +V +I   D P +  Q +  + L   ++ 
Sbjct  10    HIAILPSPGMGHLIPLVEFSKRL--IQNHHFSVTLILPTDGPVSNAQKIYLNSLPCSMDY  67

Query  348   VGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALTK--QCRRLDALVVDFFCTEALP  521
               +PPV+   L   +TK   ++ L V  +LP +R       + ++  ALVVD F T+A  
Sbjct  68    HLLPPVNFDDL-PLDTKMETRISLTVTRSLPSLREVFKTLVETKKTVALVVDLFGTDAFD  126

Query  522   MADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPEDVVDP  701
             +A++  +  +++ P+ A   +L +Y P LD  +  +Y +    ++IPGC P+  +D++DP
Sbjct  127   VANDFKVSPYIFYPSTAMALSLFLYLPKLDETVSCEYTDLPDPVQIPGCIPIHGKDLLDP  186

Query  702   MLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKP-VYAIG  878
             + DR +  Y+  L     + MA+GI+ N++++++   +KAL+E EP     GKP VY +G
Sbjct  187   VQDRKNEAYKWVLHHSKRYRMAEGIVANSFKELEGGAIKALQEEEP-----GKPPVYPVG  241

Query  879   PLTRNIEERDGD--DGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELSEQR  1052
             PL + ++   G   D +  + WL +QPR SVLY+SFGSGGTLS EQ+ ELA GLE+SEQR
Sbjct  242   PLIQ-MDSGSGSKADRSECLTWLDEQPRGSVLYISFGSGGTLSHEQMIELASGLEMSEQR  300

Query  1053  FIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILRHPS  1232
             F+WV+R P+ + +   +F   Q +    ++LP+GF  +T+  GLVVP WA QA IL H S
Sbjct  301   FLWVIRTPNDKMASATYFNV-QDSTNPLDFLPKGFLEKTKGLGLVVPNWAPQAQILGHGS  359

Query  1233  TGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGIVTR  1412
             T GFL+HCG NSTLES+ +GVP IAWPLY+EQ+ NA +L+E++ VA+RP K    GIV R
Sbjct  360   TSGFLTHCGWNSTLESVVHGVPFIAWPLYAEQKMNAVMLSEDIKVALRP-KANENGIVGR  418

Query  1413  EEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEVLNAIEKR  1574
              E+  +VK +++ ++GK +R R+  LK ++ K +S  GSS  ++ E+   ++K+
Sbjct  419   LEIAKVVKGLMEGEEGKVVRSRMRDLKDAAAKVLSEDGSSTKALAELATKLKKK  472



>gb|KDO53104.1| hypothetical protein CISIN_1g011396mg [Citrus sinensis]
Length=487

 Score =   342 bits (876),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 189/470 (40%), Positives = 284/470 (60%), Gaps = 16/470 (3%)
 Frame = +3

Query  171   HIGILSSPGIGHIIPSLLLANRLAGVHNVKLTVFVITTADSP-----TERQLLESSDLTS  335
             H+ ++ +PGIGH+IP + LA RL   HN  +T+F+ T  D        +RQ+LES  L +
Sbjct  13    HVAMVPTPGIGHLIPQVELAKRLVHQHNFLVTIFIPTIDDGTGSSMEPQRQVLES--LPT  70

Query  336   RLNNVGIPPVDISALLDANTKPVAQLCLLVRAALPGVRAALT--KQCRRLDALVVDFFCT  509
              ++ + +PPV    L D + +   ++ L +  +L  +R AL    +  RL ALVVD F +
Sbjct  71    SISTIFLPPVSFDDLPD-DVRMETRITLTLARSLSSLRDALKVLAESTRLVALVVDIFGS  129

Query  510   EALPMADELNLPKFVYVPTNARFTALTVYCPVLDREIVGQYVEQEKGLEIPGCKPVRPED  689
              A  +A+E  +P +++  T A   +L  + P LD +   +Y +  + +++PGC P+   D
Sbjct  130   AAFDVANEFGVPVYIFFTTTAMVLSLIFHLPELDVKFSCEYRDVPEPVQLPGCVPINGRD  189

Query  690   VVDPMLDRNDVQYREYLRLGVGFGMADGILMNTWEDIDPVTLKALRENEPLSKVVGKPVY  869
               DP   R +  YR +L     + +A GI++N++ D++    KAL E +  S     PVY
Sbjct  190   FADPFQQRKNEAYRIFLSFSKQYLVAAGIMVNSFMDLETGAFKALMEGD--SSFKPPPVY  247

Query  870   AIGPL--TRNIEERDGDDGTMIMQWLHKQPRESVLYVSFGSGGTLSAEQITELAWGLELS  1043
              +GPL  T +  E + D     ++WL +QP ESVL+V FGSGGTLS EQ+ ELA GLE+S
Sbjct  248   PVGPLVQTGSTNETNNDRRHECLKWLDEQPSESVLFVCFGSGGTLSPEQLNELALGLEMS  307

Query  1044  EQRFIWVVRPPSMRGSDDAFFTTGQGADGTPNYLPEGFNTRTQNQGLVVPMWAEQALILR  1223
              QRF+WVVR P  R ++  +F   Q      ++LP+GF  RT+  GLVVP W+ Q  +LR
Sbjct  308   GQRFLWVVRSPHERAANATYFGI-QSMKDPFDFLPKGFLDRTKGVGLVVPSWSPQVQVLR  366

Query  1224  HPSTGGFLSHCGCNSTLESIKNGVPIIAWPLYSEQRQNATLLTEEVGVAIRPMKLPTKGI  1403
             H STGGFLSHCG NS LESI +GVPIIAWPLY+EQ+ NA LL +++ V+ R +K+   G+
Sbjct  367   HGSTGGFLSHCGWNSILESIVHGVPIIAWPLYAEQKMNAVLLIDDLKVSFR-VKVNENGL  425

Query  1404  VTREEVKTLVKIMLQSKKGKEMRERVVKLKMSSEKAISIGGSSYNSMCEV  1553
             V RE++    K ++Q ++GK +R ++  LK ++  A+S  GSS  S+ +V
Sbjct  426   VGREDIANYAKGLIQGEEGKLLRSKMRALKDAAANALSPDGSSTKSLAQV  475



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4976291382601