BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25114_g2_i8 len=1752 path=[36683:0-110 40110:111-113 27099:114-208
23205:209-232 27217:233-334 27318:335-406 23403:407-459
23456:460-470 23467:471-504 23500:505-727 23722:728-1096
13749:1097-1143 24137:1144-1397 24391:1398-1533 15524:1534-1751]

Length=1752
                                                                      Score     E

ref|XP_009611380.1|  PREDICTED: zinc finger CCCH domain-containin...    627   0.0      
ref|XP_009793876.1|  PREDICTED: zinc finger CCCH domain-containin...    625   0.0      
ref|XP_009611379.1|  PREDICTED: zinc finger CCCH domain-containin...    622   0.0      
ref|XP_006353234.1|  PREDICTED: zinc finger CCCH domain-containin...    620   0.0      
ref|XP_004250094.1|  PREDICTED: zinc finger CCCH domain-containin...    620   0.0      
ref|XP_009611378.1|  PREDICTED: zinc finger CCCH domain-containin...    617   0.0      
ref|XP_009611374.1|  PREDICTED: zinc finger CCCH domain-containin...    612   0.0      
ref|XP_007205202.1|  hypothetical protein PRUPE_ppa005813mg             606   0.0      
ref|XP_008218439.1|  PREDICTED: zinc finger CCCH domain-containin...    604   0.0      
ref|XP_011014133.1|  PREDICTED: zinc finger CCCH domain-containin...    602   0.0      
gb|KDP23293.1|  hypothetical protein JCGZ_23126                         594   0.0      
ref|XP_009769498.1|  PREDICTED: zinc finger CCCH domain-containin...    593   0.0      
ref|XP_002512627.1|  nucleic acid binding protein, putative             592   0.0      Ricinus communis
ref|XP_011014371.1|  PREDICTED: zinc finger CCCH domain-containin...    592   0.0      
ref|XP_006428579.1|  hypothetical protein CICLE_v10011741mg             590   0.0      
ref|XP_002325901.2|  zinc finger family protein                         590   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002278934.2|  PREDICTED: zinc finger CCCH domain-containin...    589   0.0      Vitis vinifera
ref|XP_011015459.1|  PREDICTED: zinc finger CCCH domain-containin...    585   0.0      
ref|XP_004302155.1|  PREDICTED: zinc finger CCCH domain-containin...    585   0.0      
ref|XP_008359920.1|  PREDICTED: zinc finger CCCH domain-containin...    585   0.0      
ref|XP_009626542.1|  PREDICTED: zinc finger CCCH domain-containin...    582   0.0      
ref|XP_009338000.1|  PREDICTED: zinc finger CCCH domain-containin...    581   0.0      
ref|XP_008359919.1|  PREDICTED: zinc finger CCCH domain-containin...    580   0.0      
ref|XP_009337999.1|  PREDICTED: zinc finger CCCH domain-containin...    576   0.0      
ref|XP_008355849.1|  PREDICTED: zinc finger CCCH domain-containin...    575   0.0      
ref|XP_010038283.1|  PREDICTED: zinc finger CCCH domain-containin...    567   0.0      
ref|XP_007029391.1|  Zinc finger CCCH domain-containing protein 3...    563   0.0      
ref|XP_006428577.1|  hypothetical protein CICLE_v10011741mg             558   0.0      
ref|XP_011084651.1|  PREDICTED: zinc finger CCCH domain-containin...    556   0.0      
ref|XP_003534518.1|  PREDICTED: zinc finger CCCH domain-containin...    554   0.0      
emb|CDP04213.1|  unnamed protein product                                551   0.0      
ref|XP_008812314.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    553   0.0      
ref|XP_010245962.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    551   0.0      
ref|XP_007029392.1|  Zinc finger CCCH domain-containing protein 3...    550   0.0      
gb|KCW84568.1|  hypothetical protein EUGRSUZ_B01407                     550   0.0      
ref|XP_006606433.1|  PREDICTED: zinc finger CCCH domain-containin...    550   0.0      
ref|XP_007143976.1|  hypothetical protein PHAVU_007G118500g             550   0.0      
ref|XP_010929825.1|  PREDICTED: zinc finger CCCH domain-containin...    549   0.0      
ref|XP_009769503.1|  PREDICTED: zinc finger CCCH domain-containin...    546   0.0      
ref|XP_007139732.1|  hypothetical protein PHAVU_008G054800g             546   0.0      
ref|XP_003536159.1|  PREDICTED: zinc finger CCCH domain-containin...    546   0.0      
ref|XP_006587810.1|  PREDICTED: zinc finger CCCH domain-containin...    545   0.0      
ref|XP_006602842.1|  PREDICTED: zinc finger CCCH domain-containin...    543   0.0      
ref|XP_007139733.1|  hypothetical protein PHAVU_008G054800g             542   0.0      
gb|EYU39704.1|  hypothetical protein MIMGU_mgv1a0076882mg               539   0.0      
ref|XP_010929827.1|  PREDICTED: zinc finger CCCH domain-containin...    538   0.0      
ref|XP_003624157.1|  Zinc finger CCCH domain-containing protein         538   0.0      
ref|XP_008443710.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    538   0.0      
ref|XP_010111067.1|  Zinc finger CCCH domain-containing protein Z...    537   0.0      
ref|XP_009626543.1|  PREDICTED: zinc finger CCCH domain-containin...    536   0.0      
gb|ACC85690.1|  zinc finger protein                                     535   0.0      Medicago sativa [alfalfa]
gb|KEH23393.1|  zinc finger CCCH domain protein                         532   0.0      
gb|KHN04981.1|  Zinc finger CCCH domain-containing protein ZFN-like     532   0.0      
ref|XP_010525081.1|  PREDICTED: zinc finger CCCH domain-containin...    531   0.0      
sp|Q9SWF9.1|ZFNL_PEA  RecName: Full=Zinc finger CCCH domain-conta...    530   0.0      Pisum sativum [garden pea]
gb|ABD28369.2|  Zinc finger, CCCH-type; Sugar transporter superfa...    529   1e-180   Medicago truncatula
gb|KHN14776.1|  Zinc finger CCCH domain-containing protein ZFN-like     528   2e-180   
ref|XP_010673925.1|  PREDICTED: zinc finger CCCH domain-containin...    528   1e-179   
ref|XP_006848460.1|  hypothetical protein AMTR_s00013p00248880          522   2e-177   
ref|XP_010673926.1|  PREDICTED: zinc finger CCCH domain-containin...    520   2e-176   
gb|KHG12066.1|  Zinc finger CCCH domain-containing protein ZFN-li...    518   3e-176   
ref|XP_010525082.1|  PREDICTED: zinc finger CCCH domain-containin...    517   9e-176   
ref|XP_009420319.1|  PREDICTED: zinc finger CCCH domain-containin...    506   1e-171   
ref|XP_008792910.1|  PREDICTED: zinc finger CCCH domain-containin...    508   2e-171   
gb|KCW84570.1|  hypothetical protein EUGRSUZ_B01407                     502   2e-171   
ref|XP_009420318.1|  PREDICTED: zinc finger CCCH domain-containin...    505   3e-171   
ref|XP_010927660.1|  PREDICTED: zinc finger CCCH domain-containin...    506   7e-171   
ref|XP_008794629.1|  PREDICTED: zinc finger CCCH domain-containin...    503   6e-170   
ref|XP_011077184.1|  PREDICTED: zinc finger CCCH domain-containin...    501   6e-170   
ref|XP_009416573.1|  PREDICTED: zinc finger CCCH domain-containin...    502   1e-169   
ref|XP_009392477.1|  PREDICTED: zinc finger CCCH domain-containin...    500   2e-169   
ref|XP_008810537.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    501   4e-169   
ref|XP_011077187.1|  PREDICTED: zinc finger CCCH domain-containin...    498   7e-169   
ref|XP_010929826.1|  PREDICTED: zinc finger CCCH domain-containin...    498   3e-168   
ref|XP_009416574.1|  PREDICTED: zinc finger CCCH domain-containin...    493   2e-166   
ref|XP_009406323.1|  PREDICTED: zinc finger CCCH domain-containin...    491   4e-166   
ref|XP_004142565.1|  PREDICTED: zinc finger CCCH domain-containin...    486   9e-165   
gb|ADN33845.1|  nucleic acid binding protein                            486   9e-165   
ref|XP_006662931.1|  PREDICTED: zinc finger CCCH domain-containin...    484   2e-163   
sp|Q2R4J4.2|C3H63_ORYSJ  RecName: Full=Zinc finger CCCH domain-co...    484   7e-163   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067878.1|  Os11g0472000                                       483   1e-162   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006480414.1|  PREDICTED: zinc finger CCCH domain-containin...    483   1e-162   
ref|XP_002450713.1|  hypothetical protein SORBIDRAFT_05g013190          483   2e-162   Sorghum bicolor [broomcorn]
gb|ABG22481.1|  Zinc finger CCCH type domain containing protein Z...    481   4e-162   
gb|EEE52080.1|  hypothetical protein OsJ_33853                          485   6e-162   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008792915.1|  PREDICTED: zinc finger CCCH domain-containin...    480   2e-161   
ref|XP_009382899.1|  PREDICTED: zinc finger CCCH domain-containin...    481   3e-161   
ref|XP_008676803.1|  PREDICTED: hypothetical protein isoform X1         479   5e-161   
ref|NP_001066624.1|  Os12g0405100                                       479   1e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010237293.1|  PREDICTED: zinc finger CCCH domain-containin...    478   3e-160   
ref|XP_004979252.1|  PREDICTED: zinc finger CCCH domain-containin...    478   4e-160   
ref|NP_001141157.1|  hypothetical protein                               477   4e-160   Zea mays [maize]
ref|XP_009769505.1|  PREDICTED: zinc finger CCCH domain-containin...    474   4e-160   
ref|XP_003576637.1|  PREDICTED: zinc finger CCCH domain-containin...    477   4e-160   
ref|XP_008676804.1|  PREDICTED: hypothetical protein isoform X2         474   1e-159   
ref|XP_006663969.1|  PREDICTED: zinc finger CCCH domain-containin...    476   2e-159   
ref|XP_009769504.1|  PREDICTED: zinc finger CCCH domain-containin...    473   3e-159   
ref|XP_004979251.1|  PREDICTED: zinc finger CCCH domain-containin...    475   3e-159   
ref|XP_010558591.1|  PREDICTED: zinc finger CCCH domain-containin...    472   1e-158   
ref|XP_003577562.1|  PREDICTED: zinc finger CCCH domain-containin...    472   4e-158   
ref|XP_010913061.1|  PREDICTED: zinc finger CCCH domain-containin...    468   3e-157   
ref|XP_006663970.1|  PREDICTED: zinc finger CCCH domain-containin...    467   2e-156   
gb|KFK37691.1|  hypothetical protein AALP_AA3G016100                    465   3e-156   
ref|NP_566183.1|  zinc finger protein 1                                 464   9e-156   Arabidopsis thaliana [mouse-ear cress]
gb|EMS50271.1|  Zinc finger CCCH domain-containing protein 12           464   2e-155   
ref|XP_010501847.1|  PREDICTED: zinc finger CCCH domain-containin...    464   2e-155   
ref|XP_010485612.1|  PREDICTED: zinc finger CCCH domain-containin...    462   5e-155   
ref|XP_009626545.1|  PREDICTED: zinc finger CCCH domain-containin...    461   6e-155   
ref|NP_001130819.1|  uncharacterized protein LOC100191923               464   8e-155   Zea mays [maize]
ref|NP_001045201.2|  Os01g0917400                                       462   2e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010929828.1|  PREDICTED: zinc finger CCCH domain-containin...    460   2e-154   
ref|XP_002882253.1|  hypothetical protein ARALYDRAFT_477525             461   3e-154   
gb|EAY76977.1|  hypothetical protein OsI_04935                          462   3e-154   Oryza sativa Indica Group [Indian rice]
gb|ACU21592.1|  Zinc finger protein                                     462   4e-154   
ref|XP_009626544.1|  PREDICTED: zinc finger CCCH domain-containin...    459   4e-154   
gb|AAD33769.1|AF138743_1  zinc finger protein 1                         460   1e-153   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ99149.1|  predicted protein                                      458   2e-153   
ref|XP_010463709.1|  PREDICTED: zinc finger CCCH domain-containin...    458   4e-153   
ref|XP_008792914.1|  PREDICTED: zinc finger CCCH domain-containin...    459   5e-153   
gb|EEE55890.1|  hypothetical protein OsJ_04549                          455   2e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006408379.1|  hypothetical protein EUTSA_v10020900mg             455   3e-152   
ref|XP_010501886.1|  PREDICTED: zinc finger CCCH domain-containin...    454   7e-152   
gb|AAF26977.1|AC018363_22  zinc finger protein 1 (zfn1)                 452   2e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006606434.1|  PREDICTED: zinc finger CCCH domain-containin...    449   3e-150   
emb|CDY51531.1|  BnaA05g33310D                                          449   7e-150   
ref|XP_010463710.1|  PREDICTED: zinc finger CCCH domain-containin...    449   9e-150   
ref|XP_006645228.1|  PREDICTED: zinc finger CCCH domain-containin...    445   2e-148   
emb|CDY28712.1|  BnaCnng05980D                                          445   2e-148   
ref|XP_006408377.1|  hypothetical protein EUTSA_v10020900mg             444   3e-148   
ref|XP_009147316.1|  PREDICTED: zinc finger CCCH domain-containin...    444   4e-148   
gb|ACF82040.1|  unknown                                                 443   6e-147   Zea mays [maize]
ref|XP_006408378.1|  hypothetical protein EUTSA_v10020900mg             441   7e-147   
ref|NP_001150019.1|  zinc finger CCCH type domain-containing prot...    441   6e-146   Zea mays [maize]
ref|XP_003564925.1|  PREDICTED: zinc finger CCCH domain-containin...    441   7e-146   
ref|XP_004971057.1|  PREDICTED: zinc finger CCCH domain-containin...    439   1e-145   
emb|CDY53749.1|  BnaAnng12770D                                          436   7e-145   
ref|XP_009118604.1|  PREDICTED: zinc finger CCCH domain-containin...    435   9e-145   
gb|ACN33948.1|  unknown                                                 436   1e-144   Zea mays [maize]
emb|CDY67901.1|  BnaCnng56860D                                          435   1e-144   
dbj|BAJ86320.1|  predicted protein                                      437   2e-144   
emb|CDX74233.1|  BnaA03g28140D                                          433   6e-144   
ref|XP_011077188.1|  PREDICTED: zinc finger CCCH domain-containin...    431   8e-144   
gb|ACN40302.1|  unknown                                                 432   3e-142   Picea sitchensis
ref|XP_009392482.1|  PREDICTED: zinc finger CCCH domain-containin...    426   2e-141   
ref|XP_009392481.1|  PREDICTED: zinc finger CCCH domain-containin...    426   3e-141   
ref|XP_009118612.1|  PREDICTED: zinc finger CCCH domain-containin...    426   4e-141   
ref|XP_009134712.1|  PREDICTED: zinc finger CCCH domain-containin...    426   5e-141   
ref|NP_001132883.1|  uncharacterized protein LOC100194377               428   5e-141   Zea mays [maize]
ref|XP_009416576.1|  PREDICTED: zinc finger CCCH domain-containin...    426   6e-141   
emb|CDX92015.1|  BnaC03g33170D                                          425   8e-141   
emb|CBI17647.3|  unnamed protein product                                420   1e-139   
tpg|DAA56151.1|  TPA: hypothetical protein ZEAMMB73_608000              424   2e-139   
ref|XP_006400193.1|  hypothetical protein EUTSA_v10013743mg             418   9e-138   
ref|XP_004495537.1|  PREDICTED: zinc finger CCCH domain-containin...    417   1e-137   
ref|XP_009134713.1|  PREDICTED: zinc finger CCCH domain-containin...    417   1e-137   
ref|XP_010453818.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    418   3e-137   
ref|XP_006287837.1|  hypothetical protein CARUB_v10001057mg             415   4e-136   
ref|XP_008672228.1|  PREDICTED: uncharacterized protein LOC100194...    414   5e-136   
gb|KHG30243.1|  Zinc finger CCCH domain-containing protein ZFN-li...    410   2e-135   
ref|NP_851041.1|  zinc finger nuclease 3                                409   2e-134   Arabidopsis thaliana [mouse-ear cress]
gb|EEC69137.1|  hypothetical protein OsI_38063                          406   3e-133   Oryza sativa Indica Group [Indian rice]
gb|KFK25872.1|  hypothetical protein AALP_AA8G173100                    405   1e-132   
ref|NP_568332.2|  zinc finger nuclease 3                                400   3e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392483.1|  PREDICTED: zinc finger CCCH domain-containin...    399   6e-131   
ref|NP_974790.1|  zinc finger nuclease 3                                398   1e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492565.1|  PREDICTED: zinc finger CCCH domain-containin...    400   3e-130   
ref|XP_009416575.1|  PREDICTED: zinc finger CCCH domain-containin...    399   4e-130   
ref|XP_010420349.1|  PREDICTED: zinc finger CCCH domain-containin...    399   5e-130   
ref|XP_010420350.1|  PREDICTED: zinc finger CCCH domain-containin...    393   8e-128   
ref|XP_006376056.1|  hypothetical protein POPTR_0013s08490g             384   2e-126   
dbj|BAD87736.1|  putative zinc finger protein                           377   1e-122   Oryza sativa Japonica Group [Japonica rice]
gb|KDO47609.1|  hypothetical protein CISIN_1g0472481mg                  373   2e-122   
ref|XP_002871723.1|  hypothetical protein ARALYDRAFT_488510             376   5e-122   
ref|XP_006296584.1|  hypothetical protein CARUB_v100138730mg            371   2e-120   
gb|KHN40466.1|  Zinc finger CCCH domain-containing protein ZFN-like     371   4e-120   
gb|AFW84181.1|  hypothetical protein ZEAMMB73_594165                    369   5e-119   
ref|XP_010929824.1|  PREDICTED: zinc finger CCCH domain-containin...    344   7e-111   
ref|XP_001768387.1|  predicted protein                                  345   2e-110   
gb|KFK25871.1|  hypothetical protein AALP_AA8G173100                    343   2e-109   
gb|ACF80171.1|  unknown                                                 338   1e-107   Zea mays [maize]
ref|XP_004172583.1|  PREDICTED: zinc finger CCCH domain-containin...    332   3e-107   
ref|XP_010523985.1|  PREDICTED: zinc finger CCCH domain-containin...    332   2e-103   
ref|XP_010545037.1|  PREDICTED: zinc finger CCCH domain-containin...    331   8e-103   
ref|XP_006855486.1|  hypothetical protein AMTR_s00057p00193570          329   2e-102   
gb|EPS74454.1|  hypothetical protein M569_00301                         316   1e-100   
ref|XP_010545038.1|  PREDICTED: zinc finger CCCH domain-containin...    322   2e-99    
ref|XP_006397979.1|  hypothetical protein EUTSA_v10001399mg             322   6e-99    
gb|KHG22563.1|  hypothetical protein F383_29382                         315   7e-97    
ref|XP_009378917.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    318   9e-97    
ref|NP_182306.2|  zinc finger CCCH domain-containing protein 32         315   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294141.1|  hypothetical protein CARUB_v10023134mg             314   2e-96    
ref|XP_011090931.1|  PREDICTED: zinc finger CCCH domain-containin...    315   2e-96    
ref|XP_010243539.1|  PREDICTED: zinc finger CCCH domain-containin...    313   4e-96    
ref|XP_010921758.1|  PREDICTED: zinc finger CCCH domain-containin...    313   7e-96    
ref|XP_010241841.1|  PREDICTED: zinc finger CCCH domain-containin...    311   2e-95    
ref|XP_007050814.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    311   2e-95    
ref|XP_011013662.1|  PREDICTED: zinc finger CCCH domain-containin...    311   3e-95    
ref|XP_010270053.1|  PREDICTED: zinc finger CCCH domain-containin...    310   3e-95    
ref|XP_002314462.1|  hypothetical protein POPTR_0010s02320g             309   8e-95    Populus trichocarpa [western balsam poplar]
ref|XP_007200997.1|  hypothetical protein PRUPE_ppa005229mg             309   1e-94    
ref|XP_002276435.1|  PREDICTED: zinc finger CCCH domain-containin...    308   4e-94    Vitis vinifera
ref|XP_010652064.1|  PREDICTED: zinc finger CCCH domain-containin...    308   4e-94    
ref|XP_008802110.1|  PREDICTED: zinc finger CCCH domain-containin...    308   5e-94    
ref|XP_011018690.1|  PREDICTED: zinc finger CCCH domain-containin...    308   5e-94    
gb|EYU22370.1|  hypothetical protein MIMGU_mgv1a005385mg                307   1e-93    
ref|XP_002516892.1|  nucleic acid binding protein, putative             307   2e-93    Ricinus communis
ref|XP_008438828.1|  PREDICTED: zinc finger CCCH domain-containin...    306   2e-93    
ref|XP_006380188.1|  hypothetical protein POPTR_0008s22730g             306   3e-93    
ref|XP_010507840.1|  PREDICTED: zinc finger CCCH domain-containin...    305   4e-93    
ref|XP_002520668.1|  nucleic acid binding protein, putative             305   8e-93    Ricinus communis
ref|XP_008796231.1|  PREDICTED: zinc finger CCCH domain-containin...    304   1e-92    
ref|XP_002880326.1|  zinc finger (CCCH-type) family protein             304   1e-92    
emb|CAN78551.1|  hypothetical protein VITISV_003243                     306   1e-92    Vitis vinifera
ref|XP_004134198.1|  PREDICTED: zinc finger CCCH domain-containin...    305   1e-92    
ref|XP_007222805.1|  hypothetical protein PRUPE_ppa005056mg             304   2e-92    
ref|XP_008223126.1|  PREDICTED: zinc finger CCCH domain-containin...    304   2e-92    
ref|XP_010684493.1|  PREDICTED: zinc finger CCCH domain-containin...    303   4e-92    
ref|XP_010558473.1|  PREDICTED: zinc finger CCCH domain-containin...    303   7e-92    
ref|XP_004309682.1|  PREDICTED: zinc finger CCCH domain-containin...    301   1e-91    
ref|XP_010938478.1|  PREDICTED: zinc finger CCCH domain-containin...    301   1e-91    
ref|XP_009802826.1|  PREDICTED: zinc finger CCCH domain-containin...    302   1e-91    
ref|XP_008235007.1|  PREDICTED: zinc finger CCCH domain-containin...    301   2e-91    
ref|XP_006419655.1|  hypothetical protein CICLE_v10004882mg             301   2e-91    
ref|XP_009339837.1|  PREDICTED: zinc finger CCCH domain-containin...    301   2e-91    
ref|XP_009417930.1|  PREDICTED: zinc finger CCCH domain-containin...    301   2e-91    
ref|XP_010112757.1|  Zinc finger CCCH domain-containing protein 32      301   2e-91    
gb|AAC63639.1|  unknown protein                                         303   4e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KCW58527.1|  hypothetical protein EUGRSUZ_H01196                     298   6e-91    
ref|XP_011071464.1|  PREDICTED: zinc finger CCCH domain-containin...    300   7e-91    
ref|XP_006444253.1|  hypothetical protein CICLE_v10019968mg             300   8e-91    
ref|XP_008386632.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    300   8e-91    
emb|CDP03533.1|  unnamed protein product                                298   1e-90    
ref|XP_010069978.1|  PREDICTED: zinc finger CCCH domain-containin...    300   1e-90    
gb|KDP28101.1|  hypothetical protein JCGZ_13872                         299   1e-90    
ref|XP_009631342.1|  PREDICTED: zinc finger CCCH domain-containin...    300   1e-90    
ref|XP_009391577.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    299   1e-90    
ref|XP_010252578.1|  PREDICTED: zinc finger CCCH domain-containin...    298   2e-90    
gb|KDP40004.1|  hypothetical protein JCGZ_02002                         298   2e-90    
ref|XP_008389189.1|  PREDICTED: zinc finger CCCH domain-containin...    301   3e-90    
ref|XP_009588295.1|  PREDICTED: zinc finger CCCH domain-containin...    298   3e-90    
ref|XP_002528968.1|  zinc finger protein, putative                      297   5e-90    Ricinus communis
gb|ABR16930.1|  unknown                                                 300   7e-90    Picea sitchensis
ref|XP_009776613.1|  PREDICTED: zinc finger CCCH domain-containin...    295   9e-90    
ref|XP_004296815.1|  PREDICTED: zinc finger CCCH domain-containin...    297   1e-89    
ref|XP_009774842.1|  PREDICTED: zinc finger CCCH domain-containin...    297   1e-89    
gb|KHN29278.1|  Zinc finger CCCH domain-containing protein ZFN-like     289   1e-89    
gb|KGN57087.1|  hypothetical protein Csa_3G152140                       296   2e-89    
ref|XP_009369128.1|  PREDICTED: zinc finger CCCH domain-containin...    296   2e-89    
ref|XP_009802825.1|  PREDICTED: zinc finger CCCH domain-containin...    296   2e-89    
ref|XP_006366677.1|  PREDICTED: zinc finger CCCH domain-containin...    293   2e-89    
ref|XP_004495983.1|  PREDICTED: zinc finger CCCH domain-containin...    295   4e-89    
ref|XP_007049197.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    293   6e-89    
ref|XP_004240519.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    291   2e-88    
ref|XP_009626457.1|  PREDICTED: zinc finger CCCH domain-containin...    292   2e-88    
ref|XP_003518955.1|  PREDICTED: zinc finger CCCH domain-containin...    293   3e-88    
ref|XP_010666382.1|  PREDICTED: zinc finger CCCH domain-containin...    293   3e-88    
ref|XP_002320490.1|  ZINC FINGER protein 2                              292   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_003529584.1|  PREDICTED: zinc finger CCCH domain-containin...    293   4e-88    
emb|CDO98891.1|  unnamed protein product                                293   7e-88    
ref|XP_006447662.1|  hypothetical protein CICLE_v10015215mg             290   1e-87    
ref|XP_008340827.1|  PREDICTED: zinc finger CCCH domain-containin...    291   2e-87    
ref|XP_010666383.1|  PREDICTED: zinc finger CCCH domain-containin...    290   2e-87    
ref|XP_004304076.1|  PREDICTED: zinc finger CCCH domain-containin...    290   2e-87    
ref|XP_004508292.1|  PREDICTED: zinc finger CCCH domain-containin...    290   4e-87    
ref|XP_008379695.1|  PREDICTED: zinc finger CCCH domain-containin...    290   4e-87    
gb|ABR16973.1|  unknown                                                 290   6e-87    Picea sitchensis
ref|XP_009352233.1|  PREDICTED: zinc finger CCCH domain-containin...    289   7e-87    
ref|XP_009365130.1|  PREDICTED: zinc finger CCCH domain-containin...    289   7e-87    
ref|XP_007144548.1|  hypothetical protein PHAVU_007G165200g             288   1e-86    
gb|KHN46585.1|  Zinc finger CCCH domain-containing protein 32           288   1e-86    
ref|XP_006342757.1|  PREDICTED: zinc finger CCCH domain-containin...    289   2e-86    
ref|XP_006359417.1|  PREDICTED: zinc finger CCCH domain-containin...    285   7e-86    
ref|XP_002302855.1|  ZINC FINGER protein 2                              285   1e-85    Populus trichocarpa [western balsam poplar]
ref|XP_003550189.1|  PREDICTED: zinc finger CCCH domain-containin...    285   3e-85    
ref|XP_009142498.1|  PREDICTED: zinc finger CCCH domain-containin...    284   4e-85    
ref|XP_009142499.1|  PREDICTED: zinc finger CCCH domain-containin...    284   4e-85    
ref|XP_008229811.1|  PREDICTED: zinc finger CCCH domain-containin...    284   7e-85    
ref|XP_007215353.1|  hypothetical protein PRUPE_ppa005469mg             283   8e-85    
emb|CDX80137.1|  BnaA05g00190D                                          283   8e-85    
gb|KHF99697.1|  hypothetical protein F383_18975                         283   1e-84    
ref|XP_004229205.1|  PREDICTED: zinc finger CCCH domain-containin...    284   1e-84    
ref|XP_006359420.1|  PREDICTED: zinc finger CCCH domain-containin...    282   2e-84    
gb|KHG06790.1|  hypothetical protein F383_05075                         282   2e-84    
gb|EYU45569.1|  hypothetical protein MIMGU_mgv1a006413mg                282   2e-84    
ref|XP_009411695.1|  PREDICTED: zinc finger CCCH domain-containin...    282   3e-84    
ref|XP_004247451.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    282   3e-84    
ref|XP_002275775.1|  PREDICTED: zinc finger CCCH domain-containin...    281   3e-84    
gb|KHG04581.1|  hypothetical protein F383_30084                         278   5e-84    
gb|KHG01635.1|  hypothetical protein F383_21492                         280   8e-84    
gb|EPS74440.1|  hypothetical protein M569_00316                         277   2e-83    
ref|XP_011007757.1|  PREDICTED: zinc finger CCCH domain-containin...    280   2e-83    
ref|XP_007035523.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    280   2e-83    
gb|KHG05173.1|  hypothetical protein F383_31227                         278   4e-83    
ref|XP_007154244.1|  hypothetical protein PHAVU_003G102600g             280   5e-83    
ref|XP_010524751.1|  PREDICTED: zinc finger CCCH domain-containin...    278   8e-83    
ref|XP_008353591.1|  PREDICTED: zinc finger CCCH domain-containin...    278   1e-82    
ref|XP_008342144.1|  PREDICTED: zinc finger CCCH domain-containin...    278   1e-82    
gb|KHG07834.1|  hypothetical protein F383_35307                         278   1e-82    
emb|CDY53022.1|  BnaC04g00080D                                          276   6e-82    
ref|XP_006287665.1|  hypothetical protein CARUB_v10000876mg             275   2e-81    
gb|EYU46720.1|  hypothetical protein MIMGU_mgv1a008599mg                270   5e-81    
emb|CDX70825.1|  BnaC03g09090D                                          271   6e-81    
gb|EYU46719.1|  hypothetical protein MIMGU_mgv1a008599mg                270   6e-81    
gb|EYU46718.1|  hypothetical protein MIMGU_mgv1a008599mg                270   7e-81    
ref|XP_008803514.1|  PREDICTED: zinc finger CCCH domain-containin...    272   8e-81    
ref|XP_008803515.1|  PREDICTED: zinc finger CCCH domain-containin...    271   1e-80    
ref|XP_008803512.1|  PREDICTED: zinc finger CCCH domain-containin...    272   1e-80    
ref|NP_197356.2|  zinc finger CCCH domain-containing protein 58         273   1e-80    
ref|XP_010454106.1|  PREDICTED: zinc finger CCCH domain-containin...    272   2e-80    
ref|XP_011008920.1|  PREDICTED: zinc finger CCCH domain-containin...    272   2e-80    
ref|XP_008803513.1|  PREDICTED: zinc finger CCCH domain-containin...    271   2e-80    
gb|AES91820.2|  zinc finger C-x8-C-x5-C-x3-H type protein               273   3e-80    
ref|XP_009417932.1|  PREDICTED: zinc finger CCCH domain-containin...    267   3e-80    
ref|XP_009417931.1|  PREDICTED: zinc finger CCCH domain-containin...    267   3e-80    
ref|XP_009418524.1|  PREDICTED: zinc finger CCCH domain-containin...    270   7e-80    
ref|XP_010037077.1|  PREDICTED: zinc finger CCCH domain-containin...    270   1e-79    
ref|XP_008456401.1|  PREDICTED: zinc finger CCCH domain-containin...    269   1e-79    
ref|XP_010454104.1|  PREDICTED: zinc finger CCCH domain-containin...    269   2e-79    
gb|KDO59557.1|  hypothetical protein CISIN_1g013033mg                   267   5e-79    
ref|XP_003566542.1|  PREDICTED: zinc finger CCCH domain-containin...    268   7e-79    
emb|CAN76191.1|  hypothetical protein VITISV_020358                     268   7e-79    
ref|XP_006644012.1|  PREDICTED: zinc finger CCCH domain-containin...    267   8e-79    
gb|EMT01168.1|  Zinc finger CCCH domain-containing protein 6            268   1e-78    
emb|CDM82679.1|  unnamed protein product                                267   1e-78    
gb|KFK26093.1|  hypothetical protein AALP_AA8G202000                    266   2e-78    
ref|XP_008796233.1|  PREDICTED: zinc finger CCCH domain-containin...    262   3e-78    
emb|CDX88932.1|  BnaA03g07170D                                          265   4e-78    
ref|XP_004143196.1|  PREDICTED: zinc finger CCCH domain-containin...    265   6e-78    
ref|XP_010420624.1|  PREDICTED: zinc finger CCCH domain-containin...    265   6e-78    
ref|XP_010420626.1|  PREDICTED: zinc finger CCCH domain-containin...    265   7e-78    
ref|XP_010546927.1|  PREDICTED: zinc finger CCCH domain-containin...    265   8e-78    
ref|XP_009394545.1|  PREDICTED: zinc finger CCCH domain-containin...    264   8e-78    
ref|XP_008799408.1|  PREDICTED: zinc finger CCCH domain-containin...    264   8e-78    
gb|KEH43245.1|  zinc finger C-x8-C-x5-C-x3-H type protein               261   8e-78    
gb|KEH43244.1|  zinc finger C-x8-C-x5-C-x3-H type protein               261   9e-78    
ref|XP_010928414.1|  PREDICTED: zinc finger CCCH domain-containin...    263   1e-77    
ref|XP_010492867.1|  PREDICTED: zinc finger CCCH domain-containin...    265   1e-77    
dbj|BAK02824.1|  predicted protein                                      265   1e-77    
gb|KEH43243.1|  zinc finger C-x8-C-x5-C-x3-H type protein               261   1e-77    
ref|XP_009385235.1|  PREDICTED: zinc finger CCCH domain-containin...    263   1e-77    
ref|XP_009126264.1|  PREDICTED: zinc finger CCCH domain-containin...    264   1e-77    
ref|XP_011085489.1|  PREDICTED: zinc finger CCCH domain-containin...    263   2e-77    
ref|XP_010492866.1|  PREDICTED: zinc finger CCCH domain-containin...    264   2e-77    
ref|XP_011085488.1|  PREDICTED: zinc finger CCCH domain-containin...    262   2e-77    
emb|CDM82689.1|  unnamed protein product                                264   3e-77    
ref|XP_010943244.1|  PREDICTED: zinc finger CCCH domain-containin...    263   3e-77    
ref|XP_004967811.1|  PREDICTED: zinc finger CCCH domain-containin...    263   6e-77    
ref|XP_004495985.1|  PREDICTED: zinc finger CCCH domain-containin...    258   1e-76    
ref|XP_010110220.1|  Zinc finger CCCH domain-containing protein 3       261   1e-76    
gb|EYU43920.1|  hypothetical protein MIMGU_mgv1a0053871mg               258   1e-76    
ref|XP_007144549.1|  hypothetical protein PHAVU_007G165200g             258   2e-76    
ref|XP_002871822.1|  hypothetical protein ARALYDRAFT_488738             262   2e-76    
ref|XP_006407949.1|  hypothetical protein EUTSA_v10020686mg             261   3e-76    
ref|XP_010546925.1|  PREDICTED: zinc finger CCCH domain-containin...    261   3e-76    
ref|XP_010270054.1|  PREDICTED: zinc finger CCCH domain-containin...    258   3e-76    
emb|CDX74105.1|  BnaA03g29420D                                          260   5e-76    
gb|EPS71438.1|  hypothetical protein M569_03319                         260   6e-76    
emb|CDX95738.1|  BnaC03g26190D                                          258   8e-76    
ref|XP_010649761.1|  PREDICTED: zinc finger CCCH domain-containin...    257   8e-76    
ref|XP_009134895.1|  PREDICTED: zinc finger CCCH domain-containin...    259   9e-76    
dbj|BAJ86598.1|  predicted protein                                      259   1e-75    
ref|XP_003616871.1|  Zinc finger CCCH domain-containing protein         258   2e-75    
ref|XP_006400404.1|  hypothetical protein EUTSA_v10013460mg             259   2e-75    
emb|CDY02619.1|  BnaC02g08160D                                          257   2e-75    
ref|XP_009131673.1|  PREDICTED: zinc finger CCCH domain-containin...    257   2e-75    
ref|XP_006575106.1|  PREDICTED: zinc finger CCCH domain-containin...    255   2e-75    
ref|XP_008796232.1|  PREDICTED: zinc finger CCCH domain-containin...    257   3e-75    
ref|XP_006575107.1|  PREDICTED: zinc finger CCCH domain-containin...    255   3e-75    
ref|NP_001042632.2|  Os01g0257400                                       258   4e-75    
gb|KDO75085.1|  hypothetical protein CISIN_1g0118532mg                  254   4e-75    
ref|XP_006294140.1|  hypothetical protein CARUB_v10023134mg             257   4e-75    
ref|XP_009131674.1|  PREDICTED: zinc finger CCCH domain-containin...    256   5e-75    
emb|CDX92600.1|  BnaA10g16390D                                          257   5e-75    
emb|CDY13900.1|  BnaC09g39260D                                          256   6e-75    
gb|KDO75084.1|  hypothetical protein CISIN_1g0118532mg                  254   7e-75    
gb|EMS67785.1|  Zinc finger CCCH domain-containing protein 5            257   7e-75    
ref|NP_001078077.1|  zinc finger CCCH domain-containing protein 32      256   1e-74    
ref|XP_004169150.1|  PREDICTED: zinc finger CCCH domain-containin...    255   1e-74    
ref|XP_003518958.1|  PREDICTED: zinc finger CCCH domain-containin...    253   1e-74    
gb|AGT16494.1|  zinc finger CCCH type domain-containing protein         256   2e-74    
ref|XP_009133833.1|  PREDICTED: zinc finger CCCH domain-containin...    255   2e-74    
ref|XP_003593956.1|  Zinc finger CCCH domain-containing protein         256   2e-74    
ref|NP_001150919.1|  zinc finger CCCH type domain-containing prot...    256   3e-74    
ref|XP_010943246.1|  PREDICTED: zinc finger CCCH domain-containin...    255   3e-74    
ref|XP_003566545.1|  PREDICTED: zinc finger CCCH domain-containin...    256   3e-74    
ref|XP_002457593.1|  hypothetical protein SORBIDRAFT_03g009930          256   4e-74    
ref|NP_001150480.1|  LOC100284111                                       256   4e-74    
gb|ACN33323.1|  unknown                                                 255   5e-74    
gb|AGT16495.1|  zinc finger CCCH type domain-containing protein         255   7e-74    
ref|NP_001150792.1|  zinc finger CCCH type domain-containing prot...    254   7e-74    
ref|XP_009120963.1|  PREDICTED: zinc finger CCCH domain-containin...    254   8e-74    
dbj|BAD81402.1|  putative floral homeotic protein HUA1                  254   1e-73    
emb|CDY08054.1|  BnaC03g34690D                                          253   1e-73    
gb|ACN28458.1|  unknown                                                 253   2e-73    
ref|NP_001042637.1|  Os01g0258700                                       254   2e-73    
ref|XP_004491091.1|  PREDICTED: zinc finger CCCH domain-containin...    252   2e-73    
dbj|BAG99345.1|  unnamed protein product                                254   2e-73    
ref|NP_001147888.1|  zinc finger CCCH type domain-containing prot...    253   2e-73    
ref|XP_004486037.1|  PREDICTED: zinc finger CCCH domain-containin...    254   3e-73    
gb|AFW79656.1|  zinc finger CCCH type domain-containing protein Z...    253   3e-73    
gb|KHN46586.1|  Zinc finger CCCH domain-containing protein 32           248   3e-73    
ref|XP_011100472.1|  PREDICTED: zinc finger CCCH domain-containin...    251   3e-73    
ref|XP_010522373.1|  PREDICTED: zinc finger CCCH domain-containin...    251   4e-73    
ref|XP_009631343.1|  PREDICTED: zinc finger CCCH domain-containin...    249   7e-73    
ref|XP_011100471.1|  PREDICTED: zinc finger CCCH domain-containin...    251   8e-73    
gb|KFK38099.1|  hypothetical protein AALP_AA3G069300                    251   1e-72    
ref|XP_002457592.1|  hypothetical protein SORBIDRAFT_03g009920          250   2e-72    
ref|XP_010507789.1|  PREDICTED: zinc finger CCCH domain-containin...    249   2e-72    
gb|KDO59558.1|  hypothetical protein CISIN_1g013033mg                   249   3e-72    
ref|XP_010688921.1|  PREDICTED: zinc finger CCCH domain-containin...    249   4e-72    
gb|AAF08587.1|AC011623_20  hypothetical protein                         249   4e-72    
ref|XP_004967813.1|  PREDICTED: zinc finger CCCH domain-containin...    249   5e-72    
ref|XP_010518502.1|  PREDICTED: zinc finger CCCH domain-containin...    249   5e-72    
ref|XP_009415456.1|  PREDICTED: zinc finger CCCH domain-containin...    248   8e-72    
ref|XP_010464213.1|  PREDICTED: zinc finger CCCH domain-containin...    249   9e-72    
ref|XP_010507842.1|  PREDICTED: zinc finger CCCH domain-containin...    249   1e-71    
dbj|BAF02113.1|  hypothetical protein                                   249   1e-71    
ref|NP_187292.2|  zinc finger CCCH domain-containing protein 34         249   1e-71    
ref|XP_006366678.1|  PREDICTED: zinc finger CCCH domain-containin...    244   1e-71    
gb|KHN03379.1|  Zinc finger CCCH domain-containing protein 58           244   2e-71    
ref|XP_003609624.1|  Zinc finger CCCH domain-containing protein         245   2e-71    
ref|XP_006852277.1|  hypothetical protein AMTR_s00049p00179390          245   2e-71    
ref|NP_001288815.1|  CCCH type zinc finger protein                      248   2e-71    
ref|XP_010556971.1|  PREDICTED: zinc finger CCCH domain-containin...    246   4e-71    
ref|XP_004967812.1|  PREDICTED: zinc finger CCCH domain-containin...    247   5e-71    
ref|XP_010024648.1|  PREDICTED: zinc finger CCCH domain-containin...    246   9e-71    
ref|XP_007141660.1|  hypothetical protein PHAVU_008G214600g             245   9e-71    
ref|XP_010439690.1|  PREDICTED: zinc finger CCCH domain-containin...    246   1e-70    
ref|XP_007141661.1|  hypothetical protein PHAVU_008G214600g             245   1e-70    
ref|XP_010024647.1|  PREDICTED: zinc finger CCCH domain-containin...    246   2e-70    
ref|XP_010688919.1|  PREDICTED: zinc finger CCCH domain-containin...    245   2e-70    
ref|XP_006595836.1|  PREDICTED: zinc finger CCCH domain-containin...    244   3e-70    
ref|XP_003545603.1|  PREDICTED: zinc finger CCCH domain-containin...    244   3e-70    
emb|CDY58107.1|  BnaA02g35100D                                          244   3e-70    
ref|XP_009129667.1|  PREDICTED: zinc finger CCCH domain-containin...    244   5e-70    
emb|CDY24694.1|  BnaA05g30930D                                          243   6e-70    
ref|XP_010457569.1|  PREDICTED: zinc finger CCCH domain-containin...    243   6e-70    
ref|XP_010542997.1|  PREDICTED: zinc finger CCCH domain-containin...    243   8e-70    
gb|KHN44751.1|  Zinc finger CCCH domain-containing protein 3            242   1e-69    
ref|XP_006297647.1|  hypothetical protein CARUB_v10013665mg             243   1e-69    
ref|XP_011085490.1|  PREDICTED: zinc finger CCCH domain-containin...    241   1e-69    
ref|XP_003609623.1|  Zinc finger CCCH domain-containing protein         246   2e-69    
ref|XP_003519444.1|  PREDICTED: zinc finger CCCH domain-containin...    241   2e-69    
gb|KHN38500.1|  Zinc finger CCCH domain-containing protein 3            241   3e-69    
gb|KFK42845.1|  hypothetical protein AALP_AA1G046700                    241   3e-69    
ref|XP_010486149.1|  PREDICTED: zinc finger CCCH domain-containin...    242   5e-69    
ref|XP_006307705.1|  hypothetical protein CARUB_v10009335mg             240   5e-69    
ref|XP_002884577.1|  hypothetical protein ARALYDRAFT_477944             241   5e-69    
ref|XP_002892258.1|  predicted protein                                  240   5e-69    
ref|XP_009791088.1|  PREDICTED: zinc finger CCCH domain-containin...    243   5e-69    
ref|XP_003541660.1|  PREDICTED: zinc finger CCCH domain-containin...    243   5e-69    
gb|KHN47309.1|  Zinc finger CCCH domain-containing protein 32           242   6e-69    
ref|XP_006418072.1|  hypothetical protein EUTSA_v10007912mg             239   7e-69    
ref|XP_009791087.1|  PREDICTED: zinc finger CCCH domain-containin...    243   7e-69    
ref|NP_563725.1|  zinc finger CCCH domain-containing protein 3          239   9e-69    
ref|XP_010532994.1|  PREDICTED: zinc finger CCCH domain-containin...    238   1e-68    
ref|XP_010475174.1|  PREDICTED: zinc finger CCCH domain-containin...    239   1e-68    
ref|XP_010484523.1|  PREDICTED: zinc finger CCCH domain-containin...    239   2e-68    
ref|XP_008355482.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    235   3e-68    
emb|CDY05262.1|  BnaC05g45410D                                          239   3e-68    
gb|EEC80695.1|  hypothetical protein OsI_23121                          231   4e-68    
ref|XP_006597530.1|  PREDICTED: zinc finger CCCH domain-containin...    239   5e-68    
ref|XP_009791086.1|  PREDICTED: zinc finger CCCH domain-containin...    240   6e-68    
ref|NP_190414.1|  zinc finger CCCH domain-containing protein 43         237   2e-67    
ref|XP_010532995.1|  PREDICTED: zinc finger CCCH domain-containin...    235   2e-67    
ref|XP_009418525.1|  PREDICTED: zinc finger CCCH domain-containin...    233   4e-67    
ref|XP_004495984.1|  PREDICTED: zinc finger CCCH domain-containin...    236   6e-67    
ref|XP_010248777.1|  PREDICTED: zinc finger CCCH domain-containin...    235   1e-66    
dbj|BAG99488.1|  unnamed protein product                                228   2e-66    
ref|XP_002875904.1|  zinc finger (CCCH-type) family protein             234   2e-66    
gb|KHN03740.1|  Zinc finger CCCH domain-containing protein 32           234   3e-66    
ref|XP_010248778.1|  PREDICTED: zinc finger CCCH domain-containin...    234   4e-66    
ref|XP_002277300.1|  PREDICTED: zinc finger CCCH domain-containin...    234   5e-66    
gb|KDO47608.1|  hypothetical protein CISIN_1g0472482mg                  225   5e-66    
ref|XP_010426337.1|  PREDICTED: zinc finger CCCH domain-containin...    233   6e-66    
ref|XP_004236314.1|  PREDICTED: zinc finger CCCH domain-containin...    234   7e-66    
ref|XP_009613172.1|  PREDICTED: zinc finger CCCH domain-containin...    234   8e-66    
ref|XP_010319044.1|  PREDICTED: zinc finger CCCH domain-containin...    234   9e-66    
ref|XP_009124920.1|  PREDICTED: zinc finger CCCH domain-containin...    232   1e-65    
ref|XP_008239614.1|  PREDICTED: zinc finger CCCH domain-containin...    233   1e-65    
ref|XP_009613171.1|  PREDICTED: zinc finger CCCH domain-containin...    234   1e-65    
ref|XP_007037859.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    233   2e-65    
gb|EMS58335.1|  Zinc finger CCCH domain-containing protein 6            229   3e-65    
ref|XP_009613170.1|  PREDICTED: zinc finger CCCH domain-containin...    233   4e-65    
ref|XP_010322276.1|  PREDICTED: zinc finger CCCH domain-containin...    229   4e-65    
ref|XP_010426336.1|  PREDICTED: zinc finger CCCH domain-containin...    231   6e-65    
ref|XP_010322275.1|  PREDICTED: zinc finger CCCH domain-containin...    229   7e-65    
ref|XP_010503474.1|  PREDICTED: zinc finger CCCH domain-containin...    229   2e-64    
ref|XP_009803258.1|  PREDICTED: zinc finger CCCH domain-containin...    230   2e-64    
ref|XP_009803257.1|  PREDICTED: zinc finger CCCH domain-containin...    230   2e-64    
ref|XP_006291144.1|  hypothetical protein CARUB_v10017261mg             229   2e-64    
gb|AAF40461.1|AC004809_19  Contains similarity to zinc finger pro...    226   6e-64    
ref|XP_010503473.1|  PREDICTED: zinc finger CCCH domain-containin...    228   8e-64    
ref|XP_006645727.1|  PREDICTED: zinc finger CCCH domain-containin...    226   1e-63    
ref|XP_002881253.1|  hypothetical protein ARALYDRAFT_345050             227   1e-63    
ref|XP_010413928.1|  PREDICTED: zinc finger CCCH domain-containin...    227   1e-63    
gb|KFK31098.1|  hypothetical protein AALP_AA6G067900                    227   1e-63    
ref|XP_002511264.1|  nucleic acid binding protein, putative             228   1e-63    
ref|XP_008439243.1|  PREDICTED: zinc finger CCCH domain-containin...    227   2e-63    
ref|XP_010469532.1|  PREDICTED: zinc finger CCCH domain-containin...    226   2e-63    



>ref|XP_009611380.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=433

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/407 (82%), Positives = 359/407 (88%), Gaps = 5/407 (1%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS E++ESG YPVR+GEPDCSYY
Sbjct  1     MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRESIESGHYPVREGEPDCSYY  55

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP NRKLAIA ARMKGEYPER+GQPECQYYLKTG CKFGATCKFH
Sbjct  56    IRTGLCRFGSTCRFNHPPNRKLAIATARMKGEYPERMGQPECQYYLKTGTCKFGATCKFH  115

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGSTCKFHHPQPSNMMV LRGS
Sbjct  116   HPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGS  175

Query  567   PAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSV  746
             P YPPV S TTPGQLSYPLSR SFI   RWQ PSSYTPLI+PQGVVSVPGFAYSGQ+GS+
Sbjct  176   PVYPPVPSATTPGQLSYPLSRGSFIPGARWQAPSSYTPLIMPQGVVSVPGFAYSGQMGSI  235

Query  747   SSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQ  926
             SSPE QQ T GNSQ YG SRS + AN+GSQG+   YR  ++PMGYYALQ ENVFPER GQ
Sbjct  236   SSPEGQQQTAGNSQVYGTSRSGDAANMGSQGVTSPYRPASVPMGYYALQGENVFPERHGQ  295

Query  927   PECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKF  1106
             PECQFYMKTGDCKFGAVC+FHHPRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKF
Sbjct  296   PECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKF  355

Query  1107  GPSCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlssEG  1247
             GPSCKFDHPM VFTY+IS SS+T+AP V+  LGSSSGT  LTL+SEG
Sbjct  356   GPSCKFDHPMTVFTYSISASSSTDAPAVQRLLGSSSGTSALTLTSEG  402



>ref|XP_009793876.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Nicotiana sylvestris]
Length=433

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/407 (81%), Positives = 357/407 (88%), Gaps = 5/407 (1%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS E++ESG YPVR+GEPDCSYY
Sbjct  1     MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRESIESGHYPVREGEPDCSYY  55

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP NRKLAIA ARMKGEYPER+GQPECQYYLKTG CKFGATCKFH
Sbjct  56    IRTGLCRFGSTCRFNHPPNRKLAIATARMKGEYPERMGQPECQYYLKTGTCKFGATCKFH  115

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGSTCKFHHPQPSNMMV LRGS
Sbjct  116   HPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGS  175

Query  567   PAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSV  746
             P YPPV S TTPGQLSYPLSR SFI   RWQ PSSYTPLI+PQ VVSVPGFAYSGQ+GS+
Sbjct  176   PTYPPVPSATTPGQLSYPLSRGSFIPGARWQAPSSYTPLIMPQAVVSVPGFAYSGQMGSI  235

Query  747   SSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQ  926
             SSPE QQ T GNSQ YG SRS +  N+GSQG+   YR  ++PMGYYALQ ENVFPERPGQ
Sbjct  236   SSPEGQQQTAGNSQVYGTSRSGDAVNMGSQGVTSPYRPASVPMGYYALQGENVFPERPGQ  295

Query  927   PECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKF  1106
             PECQFYMKTGDCKFGAVC+FHHPRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKF
Sbjct  296   PECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKF  355

Query  1107  GPSCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlssEG  1247
             GPSCKFDHPM VFTY+IS SS T+AP V+  LGSSSGT  LTL+SEG
Sbjct  356   GPSCKFDHPMTVFTYSISASSPTDAPAVQRLLGSSSGTSALTLTSEG  402



>ref|XP_009611379.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=437

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/411 (81%), Positives = 359/411 (87%), Gaps = 9/411 (2%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS E++ESG YPVR+GEPDCSYY
Sbjct  1     MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRESIESGHYPVREGEPDCSYY  55

Query  207   IRTGLCRFGASCRFNHPSNRKL----AIAAARMKGEYPERVGQPECQYYLKTGACKFGAT  374
             IRTGLCRFG++CRFNHP NRKL    AIA ARMKGEYPER+GQPECQYYLKTG CKFGAT
Sbjct  56    IRTGLCRFGSTCRFNHPPNRKLYLMQAIATARMKGEYPERMGQPECQYYLKTGTCKFGAT  115

Query  375   CKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  554
             CKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGSTCKFHHPQPSNMMV 
Sbjct  116   CKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVS  175

Query  555   LRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQ  734
             LRGSP YPPV S TTPGQLSYPLSR SFI   RWQ PSSYTPLI+PQGVVSVPGFAYSGQ
Sbjct  176   LRGSPVYPPVPSATTPGQLSYPLSRGSFIPGARWQAPSSYTPLIMPQGVVSVPGFAYSGQ  235

Query  735   LGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPE  914
             +GS+SSPE QQ T GNSQ YG SRS + AN+GSQG+   YR  ++PMGYYALQ ENVFPE
Sbjct  236   MGSISSPEGQQQTAGNSQVYGTSRSGDAANMGSQGVTSPYRPASVPMGYYALQGENVFPE  295

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             R GQPECQFYMKTGDCKFGAVC+FHHPRERLIPPPD +LSPIGLPLRPGEPLC FYSRYG
Sbjct  296   RHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYG  355

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlssEG  1247
             ICKFGPSCKFDHPM VFTY+IS SS+T+AP V+  LGSSSGT  LTL+SEG
Sbjct  356   ICKFGPSCKFDHPMTVFTYSISASSSTDAPAVQRLLGSSSGTSALTLTSEG  406



>ref|XP_006353234.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum tuberosum]
Length=433

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/407 (81%), Positives = 356/407 (87%), Gaps = 5/407 (1%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS +++ESG YPVR+GEPDCSYY
Sbjct  1     MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRDSIESGHYPVREGEPDCSYY  55

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP NRKLAIA ARMKGEYPER+GQPECQY+LKTG CKFGATCKFH
Sbjct  56    IRTGLCRFGSTCRFNHPPNRKLAIATARMKGEYPERIGQPECQYFLKTGTCKFGATCKFH  115

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGSTCKFHHPQPSNMMV LRGS
Sbjct  116   HPKDKAGIAGRVTLNVLGYPLRPNESECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGS  175

Query  567   PAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSV  746
             P YPPV S TTPGQLSYPLSR SFI   RWQGPS YTPLIVPQGVVSVPGFAYSGQ+GSV
Sbjct  176   PVYPPVPSATTPGQLSYPLSRGSFIPGARWQGPSGYTPLIVPQGVVSVPGFAYSGQMGSV  235

Query  747   SSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQ  926
             SSPE Q  T GN+Q YG SRSS+ A +GSQG+   YR  + PMGYYALQ ENVFPERPGQ
Sbjct  236   SSPEGQGQTAGNNQVYGTSRSSDPATMGSQGVTSPYRQASGPMGYYALQGENVFPERPGQ  295

Query  927   PECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKF  1106
              ECQFYMKTGDCKFGAVC+FHHPRERLIPPPD LLSPIGLPLR GEPLC FYSRYGICKF
Sbjct  296   AECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGLPLRTGEPLCIFYSRYGICKF  355

Query  1107  GPSCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlssEG  1247
             GPSCKFDHPM VFTY+I+ SSTT+APTV+  LGSSSGT  L ++SEG
Sbjct  356   GPSCKFDHPMTVFTYSIAASSTTDAPTVQRLLGSSSGTSALNMTSEG  402



>ref|XP_004250094.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum lycopersicum]
Length=433

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/407 (80%), Positives = 355/407 (87%), Gaps = 5/407 (1%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS +++ESG YPVR+GEPDCSYY
Sbjct  1     MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRDSIESGHYPVREGEPDCSYY  55

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP NRKLAIA ARMKGEYPER+GQPECQY+LKTG CKFGATCKFH
Sbjct  56    IRTGLCRFGSTCRFNHPPNRKLAIATARMKGEYPERIGQPECQYFLKTGTCKFGATCKFH  115

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HP+DKAGIAGRV LNV+GYPLRPN+ EC YYMRTGQCKFGSTCKFHHPQPSNMMV LRGS
Sbjct  116   HPKDKAGIAGRVTLNVMGYPLRPNESECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGS  175

Query  567   PAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSV  746
             P YPPV S TTPGQLSYPLSR SFI   RWQGPS YTPLIVPQGVVSVPGFAYSGQ+GSV
Sbjct  176   PVYPPVPSATTPGQLSYPLSRGSFIPGARWQGPSGYTPLIVPQGVVSVPGFAYSGQMGSV  235

Query  747   SSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQ  926
             SSPE Q  T GN+Q YG SRSS+   +GSQ +   YR  + PMGYYALQ ENVFPERPGQ
Sbjct  236   SSPEGQGQTAGNNQVYGTSRSSDPVAMGSQAVTSPYRQASGPMGYYALQEENVFPERPGQ  295

Query  927   PECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKF  1106
             PECQFYMKTGDCKFGAVC+FHHPRERLIPPPD LLSPIGLPLRPGEPLC FYSRYGICKF
Sbjct  296   PECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGLPLRPGEPLCIFYSRYGICKF  355

Query  1107  GPSCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlssEG  1247
             GPSCKFDHPM VFTY+I+ SS T+APTV+  LGSSSGT  L ++SEG
Sbjct  356   GPSCKFDHPMTVFTYSIAASSATDAPTVQRLLGSSSGTSALNMTSEG  402



>ref|XP_009611378.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=450

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/424 (78%), Positives = 359/424 (85%), Gaps = 22/424 (5%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS E++ESG YPVR+GEPDCSYY
Sbjct  1     MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRESIESGHYPVREGEPDCSYY  55

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQ-----------------  335
             IRTGLCRFG++CRFNHP NRKLAIA ARMKGEYPER+GQPECQ                 
Sbjct  56    IRTGLCRFGSTCRFNHPPNRKLAIATARMKGEYPERMGQPECQTTKFMYVQRSSMSINDQ  115

Query  336   YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  515
             YYLKTG CKFGATCKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGSTC
Sbjct  116   YYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGSTC  175

Query  516   KFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQ  695
             KFHHPQPSNMMV LRGSP YPPV S TTPGQLSYPLSR SFI   RWQ PSSYTPLI+PQ
Sbjct  176   KFHHPQPSNMMVSLRGSPVYPPVPSATTPGQLSYPLSRGSFIPGARWQAPSSYTPLIMPQ  235

Query  696   GVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPM  875
             GVVSVPGFAYSGQ+GS+SSPE QQ T GNSQ YG SRS + AN+GSQG+   YR  ++PM
Sbjct  236   GVVSVPGFAYSGQMGSISSPEGQQQTAGNSQVYGTSRSGDAANMGSQGVTSPYRPASVPM  295

Query  876   GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplR  1055
             GYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FHHPRERLIPPPD +LSPIGLPLR
Sbjct  296   GYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLR  355

Query  1056  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltl  1235
             PGEPLC FYSRYGICKFGPSCKFDHPM VFTY+IS SS+T+AP V+  LGSSSGT  LTL
Sbjct  356   PGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSSTDAPAVQRLLGSSSGTSALTL  415

Query  1236  ssEG  1247
             +SEG
Sbjct  416   TSEG  419



>ref|XP_009611374.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611375.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611377.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=454

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/428 (78%), Positives = 359/428 (84%), Gaps = 26/428 (6%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A  GIS S   VTEGPSSLSP L Q+TLWQ++LRS E++ESG YPVR+GEPDCSYY
Sbjct  1     MDFDA--GISLS---VTEGPSSLSPSLDQDTLWQMNLRSRESIESGHYPVREGEPDCSYY  55

Query  207   IRTGLCRFGASCRFNHPSNRKL----AIAAARMKGEYPERVGQPECQ-------------  335
             IRTGLCRFG++CRFNHP NRKL    AIA ARMKGEYPER+GQPECQ             
Sbjct  56    IRTGLCRFGSTCRFNHPPNRKLYLMQAIATARMKGEYPERMGQPECQTTKFMYVQRSSMS  115

Query  336   ----YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKF  503
                 YYLKTG CKFGATCKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKF
Sbjct  116   INDQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKF  175

Query  504   GSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPL  683
             GSTCKFHHPQPSNMMV LRGSP YPPV S TTPGQLSYPLSR SFI   RWQ PSSYTPL
Sbjct  176   GSTCKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQLSYPLSRGSFIPGARWQAPSSYTPL  235

Query  684   IVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAG  863
             I+PQGVVSVPGFAYSGQ+GS+SSPE QQ T GNSQ YG SRS + AN+GSQG+   YR  
Sbjct  236   IMPQGVVSVPGFAYSGQMGSISSPEGQQQTAGNSQVYGTSRSGDAANMGSQGVTSPYRPA  295

Query  864   TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspig  1043
             ++PMGYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FHHPRERLIPPPD +LSPIG
Sbjct  296   SVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIG  355

Query  1044  lplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtg  1223
             LPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY+IS SS+T+AP V+  LGSSSGT 
Sbjct  356   LPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSSTDAPAVQRLLGSSSGTS  415

Query  1224  tltlssEG  1247
              LTL+SEG
Sbjct  416   ALTLTSEG  423



>ref|XP_007205202.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
 gb|EMJ06401.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
Length=442

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/395 (78%), Positives = 340/395 (86%), Gaps = 7/395 (2%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A   +S + A VT+ PS LSP L Q+ +WQ++LRS ET+E G+YP R GEPDCSYY
Sbjct  1     MDFDAGIPMSRAAAPVTDAPS-LSPSLTQDAMWQMNLRSSETLEPGSYPERTGEPDCSYY  59

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIA ARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60    IRTGLCRFGATCRFNHPPNRKLAIATARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKFGSTCK+HHPQP+NMMV LRGS
Sbjct  120   HPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFGSTCKYHHPQPTNMMVSLRGS  179

Query  567   PAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYS  728
             P YP V SPTTPGQ SY       SRASFI +PRWQ PSSY PLIVPQGVVSVPG+ AYS
Sbjct  180   PVYPTVQSPTTPGQQSYAGGITNWSRASFIPSPRWQAPSSYAPLIVPQGVVSVPGWSAYS  239

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVF  908
             GQ+GSVSSPESQQ  VGNSQ YG SR  E  N GSQG   SYR+G++P+G+YALQRENVF
Sbjct  240   GQIGSVSSPESQQQPVGNSQIYGTSRQGEPENSGSQGTFSSYRSGSIPVGFYALQRENVF  299

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSR
Sbjct  300   PERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSR  359

Query  1089  YGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             YGICKFGPSCKFDHPMG+FTYN + SS+ +AP  R
Sbjct  360   YGICKFGPSCKFDHPMGIFTYNPNASSSADAPARR  394



>ref|XP_008218439.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Prunus mume]
Length=442

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/395 (78%), Positives = 339/395 (86%), Gaps = 7/395 (2%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A   +S + A VT+ PS LSP L Q+ +WQ++LRS ET+E G+YP R GEPDCSYY
Sbjct  1     MDFDAGIPMSRAAAPVTDAPS-LSPSLTQDAMWQMNLRSSETLEPGSYPERTGEPDCSYY  59

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIA ARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60    IRTGLCRFGATCRFNHPPNRKLAIATARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKFGSTCK+HHPQP+NMMV LRGS
Sbjct  120   HPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFGSTCKYHHPQPTNMMVSLRGS  179

Query  567   PAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYS  728
             P YP V SPTTPGQ SY       SRASFI +PRWQ PSSY PLIVPQGVVSVPG+ AYS
Sbjct  180   PVYPTVQSPTTPGQQSYAGGITNWSRASFIPSPRWQAPSSYAPLIVPQGVVSVPGWSAYS  239

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVF  908
             GQ+GSVSSPESQQ  VGNSQ YG SR  E  N GSQG    YR+G++P+G+YALQRENVF
Sbjct  240   GQIGSVSSPESQQQPVGNSQIYGTSRQGEPENSGSQGTFSPYRSGSIPVGFYALQRENVF  299

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSR
Sbjct  300   PERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPLRPGEPLCIFYSR  359

Query  1089  YGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             YGICKFGPSCKFDHPMG+FTYN + SS+ +AP  R
Sbjct  360   YGICKFGPSCKFDHPMGIFTYNPNASSSADAPARR  394



>ref|XP_011014133.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=447

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/401 (77%), Positives = 347/401 (87%), Gaps = 14/401 (3%)
 Frame = +3

Query  27    MDFEAAAGISAS-----MASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEP  191
             MDF+A   +S S     + +VTEG +S+S  L+++ +WQ++LRS ETME+G YP R GEP
Sbjct  1     MDFDAGIPMSRSGGGGGLPAVTEG-TSMSQSLSEDAMWQMNLRSSETMEAGPYPERSGEP  59

Query  192   DCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGA  371
             DCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGA
Sbjct  60    DCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGA  119

Query  372   TCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  551
             TCKFHHPRDKAGI+GRV+LN+LGYPL+PN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMV
Sbjct  120   TCKFHHPRDKAGISGRVSLNILGYPLQPNEIECAYYLRTGQCKFGSTCKFHHPQPTNMMV  179

Query  552   PLRGSPAYPPVHSPTTPGQLSYP------LSRASFITNPRWQGPSSYTPLIVPQGVVSVP  713
             PLRGSP YP V SPTTPGQ SYP       SRASFIT+PRWQ PSSYTPLI+PQGVVSVP
Sbjct  180   PLRGSPIYPTVSSPTTPGQQSYPGGLATTWSRASFITSPRWQAPSSYTPLILPQGVVSVP  239

Query  714   GF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYAL  890
             G+ AYSGQLGSVSSPE+QQ T GNSQ YG SR SE  N GSQG    YR+G+ P+GYYAL
Sbjct  240   GWNAYSGQLGSVSSPENQQQT-GNSQIYGTSRHSESVNAGSQGTFSPYRSGSAPLGYYAL  298

Query  891   QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPL  1070
             QRE+VFPERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPL
Sbjct  299   QRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPL  358

Query  1071  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             C FYSRYGICKFGPSCKFDHPMG+FTYN++ SS+ +AP  R
Sbjct  359   CIFYSRYGICKFGPSCKFDHPMGIFTYNLTASSSADAPVRR  399



>gb|KDP23293.1| hypothetical protein JCGZ_23126 [Jatropha curcas]
Length=442

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/396 (77%), Positives = 341/396 (86%), Gaps = 9/396 (2%)
 Frame = +3

Query  27    MDFEAAAGISASMA-SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSY  203
             MDF+A   +S +   SVT+GPS LSP + ++ +WQ++LRS E MESG YP R GEPDCSY
Sbjct  1     MDFDAGISMSRTAPPSVTDGPS-LSPSMNEDAMWQMNLRSGEPMESGPYPERPGEPDCSY  59

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKF
Sbjct  60    YIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKF  119

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG  563
             HHP+DKAGIAGRV+LN++GYPLRPN+IEC YY+RTGQCKFGSTCKFHHPQP+N+MVPLRG
Sbjct  120   HHPKDKAGIAGRVSLNIMGYPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPTNVMVPLRG  179

Query  564   SPAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AY  725
             SP YP V SPTTPGQ SY       SRASF+T+PRWQ PSSYTPLI+PQGVVSVPG+ AY
Sbjct  180   SPVYPNVQSPTTPGQQSYAGGLTNWSRASFMTSPRWQAPSSYTPLILPQGVVSVPGWNAY  239

Query  726   SGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENV  905
             SGQLGSVSSPE QQ T GN Q YG SR SE  N GSQG    YR+G++P+G+YALQ EN 
Sbjct  240   SGQLGSVSSPEGQQQT-GNGQIYGTSRQSESLNTGSQGALSPYRSGSVPVGFYALQTENA  298

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             FPERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYS
Sbjct  299   FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYS  358

Query  1086  RYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             RYG+CKFGPSCK+DHPMG+FTYN+S SS+T+ P  R
Sbjct  359   RYGVCKFGPSCKYDHPMGIFTYNLSASSSTDTPVRR  394



>ref|XP_009769498.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769499.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769500.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769502.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
Length=427

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/377 (80%), Positives = 328/377 (87%), Gaps = 0/377 (0%)
 Frame = +3

Query  69    SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  248
             SV+EGP SLSP L Q++LWQ++LRSME+MESG YPVR+GE DCSYYIRTGLCRFG++C+F
Sbjct  4     SVSEGPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQF  63

Query  249   NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  428
             NHP NRKLA+AAA M GEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAGIAGRV L
Sbjct  64    NHPPNRKLALAAASMNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTL  123

Query  429   NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  608
             NVLGYPLRPN+ EC YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  S TTPGQ
Sbjct  124   NVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQ  183

Query  609   LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQ  788
             +SYPLSRASFI+  RWQG SSY PL V QGVVS PGF Y+GQLGSVSS E QQ T GNSQ
Sbjct  184   MSYPLSRASFISGARWQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGNSQ  243

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              YG SRSS+ A +GS+GMN SYR  +LP+GYYALQ ENVFPER GQPECQFYMKTGDCKF
Sbjct  244   VYGSSRSSDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKF  303

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFT  1148
             GAVC+FHHPRERL+PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPSCKFDHPM VFT
Sbjct  304   GAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFT  363

Query  1149  YNISPSSTTNAPTVRHF  1199
             YNIS SS+T+ P+VR  
Sbjct  364   YNISASSSTDDPSVRRL  380



>ref|XP_002512627.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF50079.1| nucleic acid binding protein, putative [Ricinus communis]
Length=448

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/402 (76%), Positives = 339/402 (84%), Gaps = 15/402 (4%)
 Frame = +3

Query  27    MDFEAAAGISASMAS-------VTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDG  185
             MDF+A   +S +          VTE PS LS  L ++ +WQ++LRS ETM+SG YP   G
Sbjct  1     MDFDAGIPMSRTAPPPPPPPLPVTEDPS-LSASLNEDAMWQMNLRSSETMDSGPYPEHPG  59

Query  186   EPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKF  365
             EPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKF
Sbjct  60    EPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKF  119

Query  366   GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  545
             GATCKFHHP+DKAGIAGRV+LN+LGYPLRPN+IEC YY+RTGQCKFGSTCKFHHPQP+N+
Sbjct  120   GATCKFHHPKDKAGIAGRVSLNILGYPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPTNV  179

Query  546   MVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSV  710
             MVPLRGSP YP V SPTTPGQ SY       SRASFIT+PRWQ PSSYTPLI+PQGVVSV
Sbjct  180   MVPLRGSPVYPTVQSPTTPGQQSYTGGVTNWSRASFITSPRWQAPSSYTPLILPQGVVSV  239

Query  711   PGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYA  887
             PG+ AYSGQLGSVSSPE QQ T GNSQ YG SR SE  N GSQG     RAG++P+G+YA
Sbjct  240   PGWNAYSGQLGSVSSPEGQQQT-GNSQIYGTSRQSESVNTGSQGTLSPLRAGSMPVGFYA  298

Query  888   LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEP  1067
             LQR+NVFPERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEP
Sbjct  299   LQRDNVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEP  358

Query  1068  LCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             LC FYSRYG+CKFGPSCKFDHPMG+FTYN+S  S+ +AP  R
Sbjct  359   LCIFYSRYGVCKFGPSCKFDHPMGIFTYNLSAPSSADAPVRR  400



>ref|XP_011014371.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=445

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/399 (75%), Positives = 343/399 (86%), Gaps = 12/399 (3%)
 Frame = +3

Query  27    MDFEAAAGIS---ASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDC  197
             MDF+A   +S     + +VTE  +SLSP L+++ +WQ++LRS ETME+G YP R GEPDC
Sbjct  1     MDFDAGIPMSRGVGGLPAVTE-ETSLSPSLSEDAIWQMNLRSSETMEAGPYPERPGEPDC  59

Query  198   SYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATC  377
             SYYIRTGLCRFG +CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC
Sbjct  60    SYYIRTGLCRFGPTCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATC  119

Query  378   KFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  557
             KFHHPRDKAG++GRV+LN+LGYPLR N++EC YY+RTGQCKFGSTCKFHHPQP+N+MVPL
Sbjct  120   KFHHPRDKAGVSGRVSLNILGYPLRLNEMECAYYLRTGQCKFGSTCKFHHPQPTNVMVPL  179

Query  558   RGSPAYPPVHSPTTPGQLSYP------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF  719
             RGSP YP V+SPTTPGQ SYP       SRASFIT+PRWQ PS+YTPLI+PQGVVSVPG+
Sbjct  180   RGSPVYPTVNSPTTPGQQSYPGGLATNWSRASFITSPRWQAPSNYTPLILPQGVVSVPGW  239

Query  720   -AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQR  896
              AYSGQ+GSVSSPESQQ T GNSQ YG SR SE  N GSQG    YR+ ++PMG+YALQR
Sbjct  240   NAYSGQVGSVSSPESQQQT-GNSQIYGTSRQSESVNAGSQGTFSPYRSDSVPMGFYALQR  298

Query  897   ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCA  1076
             E+VFPERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LS IGLPLRPGEPLC 
Sbjct  299   ESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGLPLRPGEPLCI  358

Query  1077  FYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             FYSRYGICKFGPSCKF HPMG+FTYN++ SS+ +AP  R
Sbjct  359   FYSRYGICKFGPSCKFHHPMGIFTYNLTASSSADAPVRR  397



>ref|XP_006428579.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428580.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480413.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Citrus sinensis]
 gb|ESR41819.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41820.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=439

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/413 (76%), Positives = 353/413 (85%), Gaps = 9/413 (2%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             M FEA   +S   A+VTEGPS LSP L Q+ LWQ++LR+ E MESG+ P R GEPDCSYY
Sbjct  1     MQFEAGISLSRG-AAVTEGPS-LSPSLNQDALWQMNLRTNEAMESGSLPERPGEPDCSYY  58

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIA AR+KG+YPER+GQPECQYYLKTG CKFGATCKFH
Sbjct  59    IRTGLCRFGATCRFNHPPNRKLAIATARIKGDYPERLGQPECQYYLKTGTCKFGATCKFH  118

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAGRV+LNVLGYPLRPN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGS
Sbjct  119   HPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVSLRGS  178

Query  567   PAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYS  728
             P YP V SPTTP Q SY       SRASFI +PRWQGPSSY P+++PQG+VSVPG+  YS
Sbjct  179   PVYPTVQSPTTPSQQSYAGGITNWSRASFIPSPRWQGPSSYAPMLLPQGMVSVPGWNTYS  238

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVF  908
             GQLGSVSS E+ Q T GNSQ YG SR +E +N GSQG    +R+G++P+G+YALQRE+VF
Sbjct  239   GQLGSVSSSENLQQTSGNSQIYGASRQTEPSNSGSQGTMSPFRSGSIPVGFYALQRESVF  298

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERPGQPECQFYMKTGDCKFGAVC+FHHPRERL+P PD +LSPIGLPLRPGEPLC FYSR
Sbjct  299   PERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSR  358

Query  1089  YGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlssEG  1247
             YGICKFGPSCKFDHPMG+FTYN+S SS+ +AP VR FLGSSS TG L LSSEG
Sbjct  359   YGICKFGPSCKFDHPMGIFTYNLSASSSADAP-VRRFLGSSSATGALNLSSEG  410



>ref|XP_002325901.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF00283.2| zinc finger family protein [Populus trichocarpa]
Length=445

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/399 (75%), Positives = 343/399 (86%), Gaps = 12/399 (3%)
 Frame = +3

Query  27    MDFEAAAGIS---ASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDC  197
             MDF+A   +S     + +VTE  +SLSP L+++ +WQ++LRS ETME+G YP R GEPDC
Sbjct  1     MDFDAGIPMSRGGGGLPAVTE-ETSLSPSLSEDAMWQMNLRSSETMEAGPYPERPGEPDC  59

Query  198   SYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATC  377
             SYYIRTGLCRFG +CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC
Sbjct  60    SYYIRTGLCRFGPTCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATC  119

Query  378   KFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  557
             KFHHPRDKAG++GRV+LN+LGYPLR N++EC YY+RTGQCKFGSTCKFHHPQP+N+MVPL
Sbjct  120   KFHHPRDKAGVSGRVSLNILGYPLRLNEMECAYYLRTGQCKFGSTCKFHHPQPTNVMVPL  179

Query  558   RGSPAYPPVHSPTTPGQLSYP------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF  719
             RGSP YP V+SPTTPGQ SYP       SRASFIT+PRWQ PS+YTPLI+PQGVVSVPG+
Sbjct  180   RGSPVYPTVNSPTTPGQQSYPGGLATNWSRASFITSPRWQAPSNYTPLILPQGVVSVPGW  239

Query  720   -AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQR  896
              AYSGQ+GSVSSPESQQ T GNSQ YG SR +E  N GSQG    YR+ ++PMG+YALQR
Sbjct  240   NAYSGQVGSVSSPESQQQT-GNSQIYGTSRQNESVNAGSQGTFSPYRSDSVPMGFYALQR  298

Query  897   ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCA  1076
             E+VFPERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LS IGLPLRPGEPLC 
Sbjct  299   ESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGLPLRPGEPLCI  358

Query  1077  FYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             FYSRYGICKFGPSCKF HPMG+FTYN++ SS+ +AP  R
Sbjct  359   FYSRYGICKFGPSCKFHHPMGIFTYNLTASSSADAPVRR  397



>ref|XP_002278934.2| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Vitis vinifera]
Length=441

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/399 (77%), Positives = 338/399 (85%), Gaps = 13/399 (3%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             M+F+A  GI      VTEG SSLSP L Q+ +WQ++LRS ETMESG YP R GEPDCSYY
Sbjct  1     MEFDA--GIPMPRGQVTEG-SSLSPSLNQDAMWQMNLRSSETMESGPYPERPGEPDCSYY  57

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG +CRFNHP NRKLAIA ARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  58    IRTGLCRFGITCRFNHPPNRKLAIATARMKGEFPERMGQPECQYYLKTGTCKFGATCKFH  117

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAGRV+LN+LGYPLRP++I+C YY+RTGQCKFGSTCKFHHPQPS+MMV LRGS
Sbjct  118   HPRDKAGIAGRVSLNILGYPLRPDEIDCAYYLRTGQCKFGSTCKFHHPQPSSMMVSLRGS  177

Query  567   PAYPPVHSPTTPGQLSY-------PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-A  722
             P YP V SPTTPGQ SY       PLSRASFI +PRWQ PSSY PL++PQGVVSVPG+ A
Sbjct  178   PVYPSVPSPTTPGQQSYAGGITNWPLSRASFIPSPRWQAPSSYAPLMLPQGVVSVPGWNA  237

Query  723   YSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQREN  902
             YSGQLGS S  ESQQ T GN+Q YG SR SE  N GSQG    YR+G++P+G+YALQREN
Sbjct  238   YSGQLGSPS--ESQQQTGGNNQIYGTSRQSEQPNTGSQGTFSPYRSGSVPIGFYALQREN  295

Query  903   VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFY  1082
             VFPERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FY
Sbjct  296   VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPLRPGEPLCIFY  355

Query  1083  SRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             SRYGICKFGPSCKFDHPMG+F YN+S SS+ +AP VR  
Sbjct  356   SRYGICKFGPSCKFDHPMGIFAYNLSASSSADAPVVRRL  394



>ref|XP_011015459.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=412

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/365 (81%), Positives = 325/365 (89%), Gaps = 8/365 (2%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ++LRS ETME+G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKG
Sbjct  1     MWQMNLRSSETMEAGPYPERSGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG  60

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
             E+PER+GQPECQYYLKTG CKFGATCKFHHPRDKAGI+GRV+LN+LGYPL+PN+IEC YY
Sbjct  61    EFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPLQPNEIECAYY  120

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP------LSRASFI  641
             +RTGQCKFGSTCKFHHPQP+NMMVPLRGSP YP V SPTTPGQ SYP       SRASFI
Sbjct  121   LRTGQCKFGSTCKFHHPQPTNMMVPLRGSPIYPTVSSPTTPGQQSYPGGLATTWSRASFI  180

Query  642   TNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEV  818
             T+PRWQ PSSYTPLI+PQGVVSVPG+ AYSGQLGSVSSPE+QQ T GNSQ YG SR SE 
Sbjct  181   TSPRWQAPSSYTPLILPQGVVSVPGWNAYSGQLGSVSSPENQQQT-GNSQIYGTSRHSES  239

Query  819   ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPR  998
              N GSQG    YR+G+ P+GYYALQRE+VFPERPGQPECQFYMKTGDCKFGAVC+FHHPR
Sbjct  240   VNAGSQGTFSPYRSGSAPLGYYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPR  299

Query  999   ERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  1178
             ERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN++ SS+ +
Sbjct  300   ERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLTASSSAD  359

Query  1179  APTVR  1193
             AP  R
Sbjct  360   APVRR  364



>ref|XP_004302155.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Fragaria vesca subsp. vesca]
Length=442

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/397 (76%), Positives = 335/397 (84%), Gaps = 11/397 (3%)
 Frame = +3

Query  27    MDFEAAAGISASMAS--VTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCS  200
             MDF+A   +S + A+  VT+   SLSP   Q+ +WQ++LRS ETME G YP R GEPDCS
Sbjct  1     MDFDAGIPMSRASAAPPVTDEAPSLSP---QDAMWQMNLRSSETMEPGPYPERAGEPDCS  57

Query  201   YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  380
             YYIRTGLCRFGA+CRFNHP NRKLAIA ARMKGE+PERVGQPECQYYLKTG CKFGATCK
Sbjct  58    YYIRTGLCRFGATCRFNHPPNRKLAIATARMKGEFPERVGQPECQYYLKTGTCKFGATCK  117

Query  381   FHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLR  560
             FHHPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKF STCK+HHP P+NMMV L 
Sbjct  118   FHHPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFASTCKYHHPPPTNMMVSLS  177

Query  561   GSPAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-A  722
             GSP YP V SPTTPGQ SYP      SRASFI +PRWQGPSSY P+IVPQGVVSVPG+ A
Sbjct  178   GSPVYPTVQSPTTPGQQSYPGGVTNWSRASFIPSPRWQGPSSYAPVIVPQGVVSVPGWSA  237

Query  723   YSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQREN  902
             YSGQ+GS+S+ E QQ TVGNSQ YG SR  E  N+GSQG    YR+G++P+G+YAL REN
Sbjct  238   YSGQVGSISTSEGQQQTVGNSQVYGTSRQREPENLGSQGAYSPYRSGSIPVGFYALPREN  297

Query  903   VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFY  1082
             VFPERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FY
Sbjct  298   VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFY  357

Query  1083  SRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             SRYGICKFGPSCKFDHPMG+FTYN++ SS+  +P  R
Sbjct  358   SRYGICKFGPSCKFDHPMGIFTYNLAASSSAESPVRR  394



>ref|XP_008359920.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Malus domestica]
Length=443

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/383 (78%), Positives = 328/383 (86%), Gaps = 7/383 (2%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A   +S + A VT+ PS LSP L Q+ +W ++LRS ET+E+G YP R GEPDCSYY
Sbjct  1     MDFDAGIPMSRAAAPVTDAPS-LSPALTQDAMWPMNLRSSETLEAGGYPERTGEPDCSYY  59

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60    IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKFG TCKFHHPQP+NMMV +RGS
Sbjct  120   HPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFGGTCKFHHPQPTNMMVSVRGS  179

Query  567   PAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYS  728
             P YP V SPTTPGQ SY       SRASFI +PRWQ PS+Y PLIVPQGVVSVPG+ AYS
Sbjct  180   PVYPTVQSPTTPGQQSYAGGVTNWSRASFIPSPRWQAPSNYAPLIVPQGVVSVPGWNAYS  239

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVF  908
             GQLGSVSS ESQQ T GNSQ YG SR  E  N GSQG    YR+G++P+G+YALQRENVF
Sbjct  240   GQLGSVSSAESQQQTAGNSQMYGTSRQGEPENSGSQGGFSPYRSGSIPVGFYALQRENVF  299

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERPGQPECQFYMKTGDCKFGAVC+FHHP ERLIP PD +LSPIGLPLRPGEP+C FYSR
Sbjct  300   PERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPGEPMCIFYSR  359

Query  1089  YGICKFGPSCKFDHPMGVFTYNI  1157
             YGICKFGPSCKFDHPMG+FTY +
Sbjct  360   YGICKFGPSCKFDHPMGIFTYGL  382



>ref|XP_009626542.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=427

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/377 (80%), Positives = 332/377 (88%), Gaps = 0/377 (0%)
 Frame = +3

Query  69    SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  248
             S++EGP SLSP L Q++LWQ++LRSME+MESG YPVR+GEPDCSYYIRTGLCRFG++CRF
Sbjct  4     SMSEGPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRF  63

Query  249   NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  428
             NHP NRKLA+AAA M GEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAGIAGRV L
Sbjct  64    NHPPNRKLALAAASMNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTL  123

Query  429   NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  608
             NVLGYPLRPN+ EC YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  SPTTPGQ
Sbjct  124   NVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSPTTPGQ  183

Query  609   LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQ  788
             +SYPLSRASFI+  RWQG SSY PL V QGVVS PGF Y+GQLG+VSS E QQ T GN+Q
Sbjct  184   MSYPLSRASFISGARWQGSSSYAPLPVLQGVVSFPGFTYNGQLGAVSSAEDQQQTAGNNQ  243

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              YG SRSS+ A +GS+GMN SYRA +LP+GYYAL+ ENVFPER GQPECQFYMKTGDCKF
Sbjct  244   VYGSSRSSDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKF  303

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFT  1148
             GAVC+FHHPRERL+PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPSCKFDHPM VFT
Sbjct  304   GAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFT  363

Query  1149  YNISPSSTTNAPTVRHF  1199
             YNIS SS+T+ P+VR  
Sbjct  364   YNISASSSTDDPSVRRL  380



>ref|XP_009338000.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Pyrus x bretschneideri]
Length=442

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/383 (77%), Positives = 326/383 (85%), Gaps = 7/383 (2%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A   +S + A VT+   SLSP L Q+ +WQ++LRS ETME+G YP R GEPDCSYY
Sbjct  1     MDFDAGIPMSRAAAPVTDA-RSLSPSLTQDAMWQMNLRSSETMEAGAYPERTGEPDCSYY  59

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60    IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAG+AGRVALN+LGYPLRPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV +  S
Sbjct  120   HPRDKAGMAGRVALNILGYPLRPNEVECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVGAS  179

Query  567   PAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYS  728
             P YP V SPTTPGQ SY       SRASFI +PRWQ  SSY PLIVPQGVVSVPG+ AYS
Sbjct  180   PVYPTVQSPTTPGQQSYAGGITNWSRASFIPSPRWQAQSSYAPLIVPQGVVSVPGWNAYS  239

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVF  908
             GQLGSVSSPESQQ T GNSQ YG S   E  N GSQG    Y +G++P+G+YALQRENVF
Sbjct  240   GQLGSVSSPESQQQTAGNSQMYGTSHQGEPENSGSQGGFSPYSSGSIPVGFYALQRENVF  299

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSP+GLPLRPGEPLC FYSR
Sbjct  300   PERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFYSR  359

Query  1089  YGICKFGPSCKFDHPMGVFTYNI  1157
             YGICKFGPSCKF+HPMG+FT N+
Sbjct  360   YGICKFGPSCKFNHPMGIFTLNL  382



>ref|XP_008359919.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Malus domestica]
Length=444

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/384 (77%), Positives = 328/384 (85%), Gaps = 8/384 (2%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A   +S + A VT+ PS LSP L Q+ +W ++LRS ET+E+G YP R GEPDCSYY
Sbjct  1     MDFDAGIPMSRAAAPVTDAPS-LSPALTQDAMWPMNLRSSETLEAGGYPERTGEPDCSYY  59

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60    IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  387   HPRDKAGIAGRVALNVLGYPLRP-NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG  563
             HPRDKAGIAGRVALN+LGYPLRP N+IEC YY+RTGQCKFG TCKFHHPQP+NMMV +RG
Sbjct  120   HPRDKAGIAGRVALNILGYPLRPQNEIECAYYLRTGQCKFGGTCKFHHPQPTNMMVSVRG  179

Query  564   SPAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AY  725
             SP YP V SPTTPGQ SY       SRASFI +PRWQ PS+Y PLIVPQGVVSVPG+ AY
Sbjct  180   SPVYPTVQSPTTPGQQSYAGGVTNWSRASFIPSPRWQAPSNYAPLIVPQGVVSVPGWNAY  239

Query  726   SGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENV  905
             SGQLGSVSS ESQQ T GNSQ YG SR  E  N GSQG    YR+G++P+G+YALQRENV
Sbjct  240   SGQLGSVSSAESQQQTAGNSQMYGTSRQGEPENSGSQGGFSPYRSGSIPVGFYALQRENV  299

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             FPERPGQPECQFYMKTGDCKFGAVC+FHHP ERLIP PD +LSPIGLPLRPGEP+C FYS
Sbjct  300   FPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPGEPMCIFYS  359

Query  1086  RYGICKFGPSCKFDHPMGVFTYNI  1157
             RYGICKFGPSCKFDHPMG+FTY +
Sbjct  360   RYGICKFGPSCKFDHPMGIFTYGL  383



>ref|XP_009337999.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Pyrus x bretschneideri]
Length=443

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/384 (77%), Positives = 326/384 (85%), Gaps = 8/384 (2%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A   +S + A VT+   SLSP L Q+ +WQ++LRS ETME+G YP R GEPDCSYY
Sbjct  1     MDFDAGIPMSRAAAPVTDA-RSLSPSLTQDAMWQMNLRSSETMEAGAYPERTGEPDCSYY  59

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60    IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  387   HPRDKAGIAGRVALNVLGYPLRP-NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG  563
             HPRDKAG+AGRVALN+LGYPLRP N++EC YY+RTGQCKFGSTCKFHHPQP+NMMV +  
Sbjct  120   HPRDKAGMAGRVALNILGYPLRPQNEVECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVGA  179

Query  564   SPAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AY  725
             SP YP V SPTTPGQ SY       SRASFI +PRWQ  SSY PLIVPQGVVSVPG+ AY
Sbjct  180   SPVYPTVQSPTTPGQQSYAGGITNWSRASFIPSPRWQAQSSYAPLIVPQGVVSVPGWNAY  239

Query  726   SGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENV  905
             SGQLGSVSSPESQQ T GNSQ YG S   E  N GSQG    Y +G++P+G+YALQRENV
Sbjct  240   SGQLGSVSSPESQQQTAGNSQMYGTSHQGEPENSGSQGGFSPYSSGSIPVGFYALQRENV  299

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             FPERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSP+GLPLRPGEPLC FYS
Sbjct  300   FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFYS  359

Query  1086  RYGICKFGPSCKFDHPMGVFTYNI  1157
             RYGICKFGPSCKF+HPMG+FT N+
Sbjct  360   RYGICKFGPSCKFNHPMGIFTLNL  383



>ref|XP_008355849.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Malus domestica]
Length=442

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/383 (76%), Positives = 325/383 (85%), Gaps = 7/383 (2%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF+A   +S + A VT+   SLS  L Q+ +WQ+++RS ETME+G YP R GEPDCSYY
Sbjct  1     MDFDAGIPMSRAAAPVTDA-RSLSASLTQDAMWQMNMRSSETMEAGPYPERAGEPDCSYY  59

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATCKFH
Sbjct  60    IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFH  119

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAG VALN+LGYPLRPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV + GS
Sbjct  120   HPRDKAGIAGXVALNILGYPLRPNEVECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVGGS  179

Query  567   PAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYS  728
               YP V SPTTPGQ SY       SRASFI +PRWQ  SSYTPLIVPQGVVSVPG+ AYS
Sbjct  180   TVYPTVQSPTTPGQQSYAGGITNWSRASFIPSPRWQAQSSYTPLIVPQGVVSVPGWNAYS  239

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVF  908
             GQLGSVSSPE QQ T GNSQ YG S+  E  N GSQG    Y +G++P+G+YALQRENVF
Sbjct  240   GQLGSVSSPEGQQQTAGNSQMYGTSQQGEPENSGSQGGFSPYGSGSIPVGFYALQRENVF  299

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERPGQPECQFYMKTGDCKFG VC+FHHPRERLIP PD +LSP+GLPLRPGEPLC FYSR
Sbjct  300   PERPGQPECQFYMKTGDCKFGGVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFYSR  359

Query  1089  YGICKFGPSCKFDHPMGVFTYNI  1157
             YGICKFGPSCKF+HPMG+FTYN+
Sbjct  360   YGICKFGPSCKFNHPMGIFTYNL  382



>ref|XP_010038283.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Eucalyptus grandis]
 gb|KCW84569.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=429

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/396 (74%), Positives = 332/396 (84%), Gaps = 12/396 (3%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             M F+A  GI     SV +GPS LSP    + +WQ++LRS ET+ESG YP R GEPDCSYY
Sbjct  1     MAFDA--GIPMPRGSVADGPS-LSP---SDAMWQMTLRSNETIESGPYPERPGEPDCSYY  54

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHPS+RKLAIA ARMKGEYPERVGQPECQYYLKTG CKFGATCKFH
Sbjct  55    IRTGLCRFGATCRFNHPSDRKLAIANARMKGEYPERVGQPECQYYLKTGTCKFGATCKFH  114

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAG+VALN+LGYP RPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGS
Sbjct  115   HPRDKAGIAGKVALNILGYPFRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGS  174

Query  567   PAYPPVHSPTTPGQLSYP----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSG  731
             P YP V SPTTP Q SYP     SRASFI +PRWQGPSSYTPLIVPQG+VS+PG+ AYSG
Sbjct  175   PVYPSVQSPTTPTQQSYPGVTSWSRASFIPSPRWQGPSSYTPLIVPQGMVSIPGWNAYSG  234

Query  732   QLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFP  911
             QLGSVSS +SQ + +G SQ +G S  S+  N GS G   SY++G++P+G+YALQR+N+FP
Sbjct  235   QLGSVSSSDSQLIMMGQSQIFGSSGQSDSVNTGSPGAFSSYQSGSMPVGFYALQRDNIFP  294

Query  912   ERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRY  1091
             ERPGQPECQFYMKTGDCKFGAVC+FHHPRERL+P PD LLSPIGLPLRPGEPLC FYSRY
Sbjct  295   ERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPLRPGEPLCIFYSRY  354

Query  1092  GICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             GICKFGPSCKFDHPMG+   N+S SS + AP  R  
Sbjct  355   GICKFGPSCKFDHPMGILN-NLSASSPSGAPVRRML  389



>ref|XP_007029391.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
 gb|EOY09893.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
Length=451

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/405 (73%), Positives = 334/405 (82%), Gaps = 18/405 (4%)
 Frame = +3

Query  27    MDFEAAAGI----------SASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPV  176
             M+F   AGI          +A+  +VTEG +SLSP L Q+ +WQ++LRS ETMESG YP 
Sbjct  1     MEFSFDAGIPMPRTAAAVAAAAAVAVTEG-TSLSPSLNQDAMWQMNLRSSETMESGPYPE  59

Query  177   RDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGA  356
             R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER GQPECQYYLKTG 
Sbjct  60    RPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERAGQPECQYYLKTGT  119

Query  357   CKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP  536
             CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQP
Sbjct  120   CKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNEPECAYYLRTGQCKFGSTCKFHHPQP  179

Query  537   SNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGV  701
             +NMMV +RGSP Y  V SPTTPGQ SY       SRASFI +PRWQGPSSY PLI+PQGV
Sbjct  180   TNMMVSVRGSPIYQTVPSPTTPGQQSYAGGITNWSRASFIPSPRWQGPSSYAPLILPQGV  239

Query  702   VSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMG  878
             VSVPG+ AYSGQL SVSS E+   T GN+Q YG +  +E A  GSQ     +R+G++P+G
Sbjct  240   VSVPGWNAYSGQLASVSSSENLLQTNGNNQ-YGTTHQNESATAGSQASFSQFRSGSVPVG  298

Query  879   YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRP  1058
             +YALQRENVFPERPGQPECQFYMKTGDCKFG VC+FHHPRER++P PD +LSPIGLPLRP
Sbjct  299   FYALQRENVFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVLPAPDCVLSPIGLPLRP  358

Query  1059  GEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             GEPLC FYSRYGICKFGPSCKF+HPMG+FTYN S SS ++AP  R
Sbjct  359   GEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSTSSPSDAPVHR  403



>ref|XP_006428577.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428578.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480418.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X6 [Citrus sinensis]
 ref|XP_006480419.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X7 [Citrus sinensis]
 ref|XP_006480420.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X8 [Citrus sinensis]
 gb|ESR41817.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41818.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=407

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/379 (78%), Positives = 330/379 (87%), Gaps = 7/379 (2%)
 Frame = +3

Query  129   LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  308
             ++LR+ E MESG+ P R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA AR+KG+YP
Sbjct  1     MNLRTNEAMESGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARIKGDYP  60

Query  309   ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  488
             ER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRV+LNVLGYPLRPN+IEC YY+RT
Sbjct  61    ERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRT  120

Query  489   GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFITNPR  653
             GQCKFGSTCKFHHPQP+NMMV LRGSP YP V SPTTP Q SY       SRASFI +PR
Sbjct  121   GQCKFGSTCKFHHPQPNNMMVSLRGSPVYPTVQSPTTPSQQSYAGGITNWSRASFIPSPR  180

Query  654   WQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVG  830
             WQGPSSY P+++PQG+VSVPG+  YSGQLGSVSS E+ Q T GNSQ YG SR +E +N G
Sbjct  181   WQGPSSYAPMLLPQGMVSVPGWNTYSGQLGSVSSSENLQQTSGNSQIYGASRQTEPSNSG  240

Query  831   SQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERli  1010
             SQG    +R+G++P+G+YALQRE+VFPERPGQPECQFYMKTGDCKFGAVC+FHHPRERL+
Sbjct  241   SQGTMSPFRSGSIPVGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLL  300

Query  1011  pppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S SS+ +AP V
Sbjct  301   PVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSASSSADAP-V  359

Query  1191  RHFlgsssgtgtltlssEG  1247
             R FLGSSS TG L LSSEG
Sbjct  360   RRFLGSSSATGALNLSSEG  378



>ref|XP_011084651.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Sesamum indicum]
Length=425

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/385 (75%), Positives = 319/385 (83%), Gaps = 12/385 (3%)
 Frame = +3

Query  60    SMASVTEGPSSLSP----PLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCR  227
             S  SVT   SS S     P  Q+ LWQ++  + E ++SG YPVR+GEPDCSYYIRTGLCR
Sbjct  2     SRVSVTAVASSASSIHLQPHHQDALWQMNT-TREQIDSGPYPVREGEPDCSYYIRTGLCR  60

Query  228   FGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAG  407
             FG++CRFNHP NRKLAIA ARMKGEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAG
Sbjct  61    FGSTCRFNHPPNRKLAIATARMKGEYPERIGQSECQYYLKTGTCKFGATCKFHHPRDKAG  120

Query  408   IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  587
             IAGRVALNVLGYPLRPN+IEC YYMR GQCKFGSTCKFHHPQPSNMMV +RGS  YPP+H
Sbjct  121   IAGRVALNVLGYPLRPNEIECAYYMRNGQCKFGSTCKFHHPQPSNMMVSVRGSAVYPPIH  180

Query  588   SPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQ  764
             SPT  GQLS+PLSRASFI +PRWQ PSSY PL++PQGVVSVPG+  YSGQLGSV S E+Q
Sbjct  181   SPTA-GQLSFPLSRASFIPSPRWQSPSSYAPLVMPQGVVSVPGWNTYSGQLGSVLSSENQ  239

Query  765   QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  944
                 GNSQ  G S  +E  + G+Q     + +G+LPMGYYA QR+NVFPERPGQPECQFY
Sbjct  240   HPAAGNSQKDGGSLQNETGDAGTQ-----FHSGSLPMGYYAFQRDNVFPERPGQPECQFY  294

Query  945   MKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKF  1124
             MKTGDCKFGAVCKFHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKF
Sbjct  295   MKTGDCKFGAVCKFHHPRERLIPVPDCILSPIGLPLRPGEPLCVFYSRYGICKFGPSCKF  354

Query  1125  DHPMGVFTYNISPSSTTNAPTVRHF  1199
             DHPM VF YN   SS+T++P +R F
Sbjct  355   DHPMTVFGYNAGASSSTDSPAIRRF  379



>ref|XP_003534518.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoformX2 [Glycine max]
Length=426

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/395 (72%), Positives = 325/395 (82%), Gaps = 23/395 (6%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             M+F+AA  +S                L  + +WQ++LRS ETMESG YP   GEPDCSYY
Sbjct  1     MEFDAAIPVSREH-------------LPPDAMWQINLRSSETMESGPYPEHPGEPDCSYY  47

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC+FH
Sbjct  48    IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFH  107

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAGRVA+N+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQP+NM++ +R S
Sbjct  108   HPRDKAGIAGRVAMNILGYPLRPNEPECAYYLRTGQCKFGNTCKFHHPQPNNMVLSMRSS  167

Query  567   PAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYS  728
             P YP VHSPTTPGQ SY       S +S+I +PRWQGPSSY PLI+PQG+VSVPG+ AYS
Sbjct  168   PVYPTVHSPTTPGQQSYATGITNWSSSSYIPSPRWQGPSSYAPLILPQGMVSVPGWSAYS  227

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVF  908
             GQ+GS    +S Q T+GN Q+YG SR SE AN GSQG    +R+G++P+G+YALQREN+F
Sbjct  228   GQMGS----DSPQQTMGNGQSYGTSRQSEPANSGSQGAYSQFRSGSVPVGFYALQRENIF  283

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERP QPECQFYMKTGDCKFGAVC+FHHPRER+IP PD +LSPIGLPLRPGEPLC FYSR
Sbjct  284   PERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSR  343

Query  1089  YGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             YGICKFGPSCKFDHPMGVFTYNIS S + +AP  R
Sbjct  344   YGICKFGPSCKFDHPMGVFTYNISASPSADAPGRR  378



>emb|CDP04213.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/393 (74%), Positives = 317/393 (81%), Gaps = 38/393 (10%)
 Frame = +3

Query  27    MDFEAAAGISASMASVT-EGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSY  203
             MDF++  GI  S ASV  EG SSL     Q+ LWQ++LRS E ME+GTYPVR+GEPDCSY
Sbjct  1     MDFDS--GIPISRASVVAEGSSSLD----QDALWQINLRSREPMEAGTYPVREGEPDCSY  54

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCR+GA+CRFNHP NRKLAIA ARM+GEYPER+GQPECQYYLKTG CKFGATCKF
Sbjct  55    YIRTGLCRYGATCRFNHPPNRKLAIATARMRGEYPERMGQPECQYYLKTGTCKFGATCKF  114

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG  563
             HHPR+KAGIAGRV LN LGYPLRPN+IEC YY+RTG CKFGSTCKFHHPQP+NMMV +RG
Sbjct  115   HHPREKAGIAGRVTLNALGYPLRPNEIECAYYLRTGHCKFGSTCKFHHPQPANMMVSVRG  174

Query  564   SPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLG  740
             SP YP VHSPT PGQLSYPLSRASFI +PRWQGPSSY P++VPQ +VSV G+ AYSGQLG
Sbjct  175   SPVYPSVHSPTNPGQLSYPLSRASFIPSPRWQGPSSYAPVLVPQSMVSVSGWNAYSGQLG  234

Query  741   SVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERP  920
             S SS ESQQ T GN Q +G+                             LQRE VFPERP
Sbjct  235   SGSSAESQQQTAGNDQTHGM-----------------------------LQRETVFPERP  265

Query  921   GQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGIC  1100
             GQPECQFYMKTGDCKFGAVCKFHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGIC
Sbjct  266   GQPECQFYMKTGDCKFGAVCKFHHPRERILPAPDCVLSPIGLPLRPGEPLCIFYSRYGIC  325

Query  1101  KFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             KFGPSCKFDHPMGVFTYN+S SS+T  PTVR  
Sbjct  326   KFGPSCKFDHPMGVFTYNVS-SSSTEPPTVRRL  357



>ref|XP_008812314.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=457

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/380 (75%), Positives = 315/380 (83%), Gaps = 14/380 (4%)
 Frame = +3

Query  69    SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  248
             +VTEG SSL     +E +WQ++LR  E+MESG YP R GEPDC+YYIRTGLCRFG +C+F
Sbjct  18    AVTEGSSSLD----EEAMWQMNLRGSESMESGPYPERPGEPDCAYYIRTGLCRFGMTCKF  73

Query  249   NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  428
             NHP NRKLAIAAAR+KG YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGIAGRV L
Sbjct  74    NHPPNRKLAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQL  133

Query  429   NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  608
             N+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHSPTTPGQ
Sbjct  134   NILGYPLRPNEKECAYYLRTGQCKFGNTCKFHHPQPSNAMVDLRGSPVYPPVHSPTTPGQ  193

Query  609   LSYP-------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQ  764
              SYP       LSR SFI +PRWQ PSSY  LI+PQG+V VPG+  Y GQ+GS SSP+SQ
Sbjct  194   QSYPGGLTNWSLSRTSFIPSPRWQDPSSYAQLILPQGLVQVPGWNPYPGQMGS-SSPDSQ  252

Query  765   QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  944
             Q T G  Q YG SR SE    G+QG   SYR G++PMG YALQREN+FPERP QPECQFY
Sbjct  253   QQTPGAGQYYGTSRQSETG-AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFY  311

Query  945   MKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKF  1124
             MKTGDCKFGAVCKFHHPRERL+P P+  LSP+GLPLRPGEPLC FY+RYGICKFGP+CKF
Sbjct  312   MKTGDCKFGAVCKFHHPRERLVPVPNCSLSPLGLPLRPGEPLCVFYARYGICKFGPNCKF  371

Query  1125  DHPMGVFTYNISPSSTTNAP  1184
             DHPMG FTY IS SST +AP
Sbjct  372   DHPMGTFTYGISTSSTADAP  391



>ref|XP_010245962.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Nelumbo nucifera]
Length=457

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/391 (74%), Positives = 328/391 (84%), Gaps = 9/391 (2%)
 Frame = +3

Query  45    AGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  224
              GI  S A+VTE  SSLSP L ++TLWQ++LR  ETMESG YP R GE DC+YY+RTGLC
Sbjct  5     TGIQMSRAAVTE-ESSLSPSLDEDTLWQMNLRPSETMESGPYPERPGELDCAYYVRTGLC  63

Query  225   RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  404
             RFG +CRFNHP NRKLA+ AARM G YPER+GQPECQYYLKTG CKFGATCKFHHP+DKA
Sbjct  64    RFGMTCRFNHPPNRKLAVVAARMIGSYPERIGQPECQYYLKTGTCKFGATCKFHHPKDKA  123

Query  405   GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  584
             GIAGRV LN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN +V L GSP YP V
Sbjct  124   GIAGRVPLNILGYPLRPNERECAYYLRTGQCKFGNTCKFHHPQPSNTVVSLPGSPVYPSV  183

Query  585   HSPTTPGQLSY-------PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLG  740
             HSPTTPGQ SY       PLSRASFI +PRWQG SSY  LI+PQGVVSVP + AY+GQLG
Sbjct  184   HSPTTPGQQSYPGGMTNWPLSRASFIPSPRWQGLSSYAQLILPQGVVSVPNWNAYTGQLG  243

Query  741   SVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERP  920
             SVSS ESQQ TV +SQ YG SR S+  +VG QG  PSYR+G++P+G YALQRE+VFPERP
Sbjct  244   SVSSSESQQQTVVSSQFYGTSRQSDTTSVGVQGTFPSYRSGSVPVGLYALQRESVFPERP  303

Query  921   GQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGIC  1100
              QPECQFYMKTGDCKFGAVC+FHHPRERLIP P+ +LSP+GLPLRPGEPLC FYSRYGIC
Sbjct  304   DQPECQFYMKTGDCKFGAVCRFHHPRERLIPVPNCVLSPLGLPLRPGEPLCIFYSRYGIC  363

Query  1101  KFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             KFGP+CKFDHPMG FTY++S  S+T+ P +R
Sbjct  364   KFGPNCKFDHPMGPFTYSLSAFSSTDVPVIR  394



>ref|XP_007029392.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
 gb|EOY09894.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
Length=411

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/364 (77%), Positives = 312/364 (86%), Gaps = 7/364 (2%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ++LRS ETMESG YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKG
Sbjct  1     MWQMNLRSSETMESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG  60

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
             E+PER GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY
Sbjct  61    EFPERAGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNEPECAYY  120

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFIT  644
             +RTGQCKFGSTCKFHHPQP+NMMV +RGSP Y  V SPTTPGQ SY       SRASFI 
Sbjct  121   LRTGQCKFGSTCKFHHPQPTNMMVSVRGSPIYQTVPSPTTPGQQSYAGGITNWSRASFIP  180

Query  645   NPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVA  821
             +PRWQGPSSY PLI+PQGVVSVPG+ AYSGQL SVSS E+   T GN+Q YG +  +E A
Sbjct  181   SPRWQGPSSYAPLILPQGVVSVPGWNAYSGQLASVSSSENLLQTNGNNQ-YGTTHQNESA  239

Query  822   NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRE  1001
               GSQ     +R+G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFG VC+FHHPRE
Sbjct  240   TAGSQASFSQFRSGSVPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGTVCRFHHPRE  299

Query  1002  RlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  1181
             R++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FTYN S SS ++A
Sbjct  300   RVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSTSSPSDA  359

Query  1182  PTVR  1193
             P  R
Sbjct  360   PVHR  363



>gb|KCW84568.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=419

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/389 (74%), Positives = 320/389 (82%), Gaps = 18/389 (5%)
 Frame = +3

Query  45    AGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  224
             AGI     SV +GPS LSP    + +WQ++LRS ET+ESG YP R GEPDCSYYIRTGLC
Sbjct  5     AGIPMPRGSVADGPS-LSP---SDAMWQMTLRSNETIESGPYPERPGEPDCSYYIRTGLC  60

Query  225   RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  404
             RFGA+CRFNHPS+RKLAIA ARMKGEYPERVGQPECQYYLKTG CKFGATCKFHHPRDKA
Sbjct  61    RFGATCRFNHPSDRKLAIANARMKGEYPERVGQPECQYYLKTGTCKFGATCKFHHPRDKA  120

Query  405   GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  584
             GIAG+VALN+LGYP RPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGSP YP V
Sbjct  121   GIAGKVALNILGYPFRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPVYPSV  180

Query  585   HSPTTPGQLSYP----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSS  752
              SPTTP Q SYP     SRASFI +PRWQGPSSYTPLIVPQG+         GQLGSVSS
Sbjct  181   QSPTTPTQQSYPGVTSWSRASFIPSPRWQGPSSYTPLIVPQGM---------GQLGSVSS  231

Query  753   PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  932
              +SQ + +G SQ +G S  S+  N GS G   SY++G++P+G+YALQR+N+FPERPGQPE
Sbjct  232   SDSQLIMMGQSQIFGSSGQSDSVNTGSPGAFSSYQSGSMPVGFYALQRDNIFPERPGQPE  291

Query  933   CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGP  1112
             CQFYMKTGDCKFGAVC+FHHPRERL+P PD LLSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  292   CQFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGP  351

Query  1113  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             SCKFDHPMG+   N+S SS + AP  R  
Sbjct  352   SCKFDHPMGILN-NLSASSPSGAPVRRML  379



>ref|XP_006606433.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=430

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/392 (73%), Positives = 332/392 (85%), Gaps = 7/392 (2%)
 Frame = +3

Query  90    SLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  269
             +L  P  Q++LW ++LR+ ETM+SG+YP R GEPDCSYYIRTGLCRFGA+CRFNHP NR+
Sbjct  8     NLIVPNPQDSLWMMNLRTGETMDSGSYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRR  67

Query  270   LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  449
             LAIA ARM GE+PER+GQPECQYYLKTG CKFGATCKFHHP+D+AGIAGRVALN+LGYPL
Sbjct  68    LAIATARMIGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPL  127

Query  450   RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP---  620
             RPN+ EC YY+RTGQCKFG+TCKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ SY    
Sbjct  128   RPNEPECTYYLRTGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQESYAGGI  187

Query  621   --LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQA  791
                SR S+I +PRWQGPSSY PLI+PQGVVSVPG+ AYSGQ+GS+S+ +S Q  + N Q 
Sbjct  188   TNWSRGSYIPSPRWQGPSSYGPLILPQGVVSVPGWSAYSGQMGSISTSDSPQQAMRNGQT  247

Query  792   YGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFG  971
             Y  S   E+AN GSQG    +R+GT+P+G+Y LQREN+FPERPGQPECQFY+KTGDCKFG
Sbjct  248   YETSHQGELANAGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYVKTGDCKFG  307

Query  972   AVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTY  1151
             AVC+FHHPRERLIP PD +LSPIGLPLR GEPLC FYSRYGICKFGPSCKFDHPM +F+Y
Sbjct  308   AVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMEIFSY  367

Query  1152  NISPSSTTNAPTVRHFlgsssgtgtltlssEG  1247
             NI+ S + +AP+ RH LGSSSGT  L LSSEG
Sbjct  368   NITTSPSADAPS-RHLLGSSSGTAALNLSSEG  398



>ref|XP_007143976.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
 gb|ESW15970.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
Length=444

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/366 (74%), Positives = 313/366 (86%), Gaps = 6/366 (2%)
 Frame = +3

Query  108   AQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  287
              Q++LW ++LR+ ETM+SG YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA A
Sbjct  29    GQDSLWVMNLRTSETMDSGAYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATA  88

Query  288   RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
             RM GE+PER+GQPECQYYLKTG CKFGATCKFHHP+D+ GIAGRV+LN LGYPLRPN+ E
Sbjct  89    RMIGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDQTGIAGRVSLNTLGYPLRPNEPE  148

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRA  632
             C YY+RTGQCKFG+TCKFHHPQPSNMM+ L+ S  YP VHSPTTPGQ S+       +RA
Sbjct  149   CTYYLRTGQCKFGNTCKFHHPQPSNMMLSLQDSSLYPTVHSPTTPGQQSFAGGITNWARA  208

Query  633   SFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRS  809
             S+I +PRWQGPSSY PLI+PQGVVSVPG+ AYSGQ+GS+S+ +S Q  + N Q YG SR 
Sbjct  209   SYIPSPRWQGPSSYAPLILPQGVVSVPGWSAYSGQVGSISNSDSLQQAMRNGQTYGTSRQ  268

Query  810   SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  989
              E+AN G+ G    +R+GT+P+G+YALQREN+FPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  269   GELANTGTHGAYSQFRSGTVPVGFYALQRENIFPERPGQPECQFYMKTGDCKFGAVCRFH  328

Query  990   HPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  1169
             HP ERLIP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYNIS S 
Sbjct  329   HPHERLIPAPDCVLSPMGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNISASP  388

Query  1170  TTNAPT  1187
             + +AP+
Sbjct  389   SADAPS  394



>ref|XP_010929825.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Elaeis guineensis]
Length=460

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/386 (73%), Positives = 317/386 (82%), Gaps = 14/386 (4%)
 Frame = +3

Query  66    ASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  245
             A++TEG SSL     +E +WQ++LR  E+MESG YP R GE DC YYIRTGLCRFG +C+
Sbjct  17    AAMTEGSSSLD----EEAMWQMNLRGSESMESGPYPERPGEADCGYYIRTGLCRFGMTCK  72

Query  246   FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  425
             FNHP NR+LAIAAAR+KG YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGIAGRV 
Sbjct  73    FNHPPNRRLAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQ  132

Query  426   LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  605
             LN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHS TTPG
Sbjct  133   LNILGYPLRPNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSSTTPG  192

Query  606   QLSYP-------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPES  761
             Q SYP       LSR SFI +PRWQ PSSYT LI+PQG+V VPG+  Y GQ+GS SSP+S
Sbjct  193   QQSYPGGLTNWSLSRTSFIPSPRWQDPSSYTQLILPQGLVQVPGWNPYPGQMGS-SSPDS  251

Query  762   QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  941
             QQ T G +Q Y  +  SE +  G+QG   SYR G++PMG YALQREN+FPERP QPECQF
Sbjct  252   QQQTPGAAQYYSTTHQSETS-AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQF  310

Query  942   YMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCK  1121
             YMKTGDCKFGAVCKFHHPRERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP+CK
Sbjct  311   YMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCK  370

Query  1122  FDHPMGVFTYNISPSSTTNAPTVRHF  1199
             FDHPMG FTY IS SST + PTVR  
Sbjct  371   FDHPMGTFTYGISTSSTADVPTVRRL  396



>ref|XP_009769503.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana sylvestris]
Length=406

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/377 (75%), Positives = 310/377 (82%), Gaps = 21/377 (6%)
 Frame = +3

Query  69    SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  248
             SV+EGP SLSP L Q++LWQ++LRSME+MESG YPVR+GE DCSYYIRTGLCRFG++C+F
Sbjct  4     SVSEGPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQF  63

Query  249   NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  428
             NHP NRKL                     YYLKTG CKFGATCKFHHPRDKAGIAGRV L
Sbjct  64    NHPPNRKL---------------------YYLKTGTCKFGATCKFHHPRDKAGIAGRVTL  102

Query  429   NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  608
             NVLGYPLRPN+ EC YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  S TTPGQ
Sbjct  103   NVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQ  162

Query  609   LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQ  788
             +SYPLSRASFI+  RWQG SSY PL V QGVVS PGF Y+GQLGSVSS E QQ T GNSQ
Sbjct  163   MSYPLSRASFISGARWQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGNSQ  222

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              YG SRSS+ A +GS+GMN SYR  +LP+GYYALQ ENVFPER GQPECQFYMKTGDCKF
Sbjct  223   VYGSSRSSDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKF  282

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFT  1148
             GAVC+FHHPRERL+PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPSCKFDHPM VFT
Sbjct  283   GAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFT  342

Query  1149  YNISPSSTTNAPTVRHF  1199
             YNIS SS+T+ P+VR  
Sbjct  343   YNISASSSTDDPSVRRL  359



>ref|XP_007139732.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11726.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=426

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/395 (71%), Positives = 321/395 (81%), Gaps = 23/395 (6%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             M+F+AA  +S                L Q+ +WQ++LRS ETMESG YP   GEPDCSYY
Sbjct  1     MEFDAAIPVSREH-------------LPQDAMWQINLRSSETMESGPYPEHPGEPDCSYY  47

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC+FH
Sbjct  48    IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFH  107

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSNM++ +R S
Sbjct  108   HPRDKAGIAGRVALNILGYPLRPNEPECAYYLRTGQCKFGNTCKFHHPQPSNMVLSMRSS  167

Query  567   PAYPPVHSPTTPGQLSYPLS-----RASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYS  728
             P YP V SPTTPGQ SY         +S+I +PRWQ PSSY PLI+PQG+VSVPG+ AYS
Sbjct  168   PVYPTVQSPTTPGQQSYATGITNWPSSSYIPSPRWQSPSSYAPLILPQGMVSVPGWSAYS  227

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVF  908
             GQ+GS    +S Q T+GN Q+YG +R SE  N GSQG    +R+G++P+G+YAL REN+F
Sbjct  228   GQMGS----DSSQQTMGNGQSYGTNRQSEPTNAGSQGAYSQFRSGSVPVGFYALPRENIF  283

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERP QP+CQFYMKTGDCKFGAVC+FHHPRER+IP PD +LSPIGLPLRPGEPLC FYSR
Sbjct  284   PERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSR  343

Query  1089  YGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             YGICKFGPSCKFDHPMGVFTYNIS S + +AP  R
Sbjct  344   YGICKFGPSCKFDHPMGVFTYNISASPSADAPGRR  378



>ref|XP_003536159.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Glycine max]
Length=421

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/383 (74%), Positives = 331/383 (86%), Gaps = 6/383 (2%)
 Frame = +3

Query  102   PLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  281
             P  Q++LW ++LR+ ETM+SG+YP R GEPDCSYY+RTGLCRFGA+CRFNHP NRKLAIA
Sbjct  13    PNPQDSLWMMNLRTGETMDSGSYPERPGEPDCSYYMRTGLCRFGATCRFNHPPNRKLAIA  72

Query  282   AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
              ARM GE+PER+GQPECQYYLKTG CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+
Sbjct  73    TARMIGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNE  132

Query  462   IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFI  641
              EC YY+RTGQCKFG+TCKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ SY  +  ++I
Sbjct  133   PECTYYLRTGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQQSY--AGGTYI  190

Query  642   TNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEV  818
              +PRWQGPSSY PLI+PQGVVSVPG+ AYSGQ+GS+S+ +S Q  + N Q YG SR  E+
Sbjct  191   PSPRWQGPSSYAPLILPQGVVSVPGWSAYSGQMGSISTSDSPQQAMRNGQTYGTSRQGEL  250

Query  819   ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPR  998
             A  GSQG    +R+GT+P+G+Y LQREN+FPERPGQPECQFYMKTGDCKFGAVC+FHHP+
Sbjct  251   A--GSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPQ  308

Query  999   ERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  1178
             ERL+P P+ +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM +F++NIS S + +
Sbjct  309   ERLVPAPNCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMEIFSHNISASPSAD  368

Query  1179  APTVRHFlgsssgtgtltlssEG  1247
             AP+ RH LGSSSGT  L LSSEG
Sbjct  369   APS-RHLLGSSSGTAALNLSSEG  390



>ref|XP_006587810.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Glycine max]
Length=437

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/406 (70%), Positives = 325/406 (80%), Gaps = 34/406 (8%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             M+F+AA  +S                L  + +WQ++LRS ETMESG YP   GEPDCSYY
Sbjct  1     MEFDAAIPVSREH-------------LPPDAMWQINLRSSETMESGPYPEHPGEPDCSYY  47

Query  207   IRTGLCRFGASCRFNHPSNRKL-----------AIAAARMKGEYPERVGQPECQYYLKTG  353
             IRTGLCRFGA+CRFNHP NRKL           AIAAARMKGE+PER+GQPECQYYLKTG
Sbjct  48    IRTGLCRFGATCRFNHPPNRKLLPDSFFFENYQAIAAARMKGEFPERIGQPECQYYLKTG  107

Query  354   ACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  533
              CKFGATC+FHHPRDKAGIAGRVA+N+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQ
Sbjct  108   TCKFGATCRFHHPRDKAGIAGRVAMNILGYPLRPNEPECAYYLRTGQCKFGNTCKFHHPQ  167

Query  534   PSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQG  698
             P+NM++ +R SP YP VHSPTTPGQ SY       S +S+I +PRWQGPSSY PLI+PQG
Sbjct  168   PNNMVLSMRSSPVYPTVHSPTTPGQQSYATGITNWSSSSYIPSPRWQGPSSYAPLILPQG  227

Query  699   VVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPM  875
             +VSVPG+ AYSGQ+GS    +S Q T+GN Q+YG SR SE AN GSQG    +R+G++P+
Sbjct  228   MVSVPGWSAYSGQMGS----DSPQQTMGNGQSYGTSRQSEPANSGSQGAYSQFRSGSVPV  283

Query  876   GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplR  1055
             G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FHHPRER+IP PD +LSPIGLPLR
Sbjct  284   GFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLR  343

Query  1056  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             PGEPLC FYSRYGICKFGPSCKFDHPMGVFTYNIS S + +AP  R
Sbjct  344   PGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASPSADAPGRR  389



>ref|XP_006602842.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=426

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/395 (71%), Positives = 320/395 (81%), Gaps = 23/395 (6%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             M+F+AA  +S                L Q+ +WQ++LRS ETMES  YP   GEPDCSYY
Sbjct  1     MEFDAAIPVSREH-------------LPQDAMWQINLRSSETMESEPYPEHPGEPDCSYY  47

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC+FH
Sbjct  48    IRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFH  107

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQP+NM++ +R S
Sbjct  108   HPRDKAGIAGRVALNILGYPLRPNEPECGYYLRTGQCKFGNTCKFHHPQPNNMVLSMRSS  167

Query  567   PAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYS  728
             P YP VHSPTTPG  SY       S +S+I +PRWQGPSSY PLI+PQG+VSV G+ AYS
Sbjct  168   PVYPTVHSPTTPGHQSYATGITNWSSSSYIPSPRWQGPSSYAPLILPQGMVSVSGWSAYS  227

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVF  908
             GQ+GS    +S Q T+ N Q+YG SR SE AN GSQG    +R+G++P+G+YALQREN+F
Sbjct  228   GQMGS----DSPQQTMANGQSYGTSRQSEPANSGSQGAYSQFRSGSVPVGFYALQRENIF  283

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERP QPECQFYMKTGDCKFGAVC+FHHP ER+IP PD +LSPIGLPLRPGEPLC FYSR
Sbjct  284   PERPDQPECQFYMKTGDCKFGAVCRFHHPHERMIPAPDCVLSPIGLPLRPGEPLCVFYSR  343

Query  1089  YGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             YGICKFGPSCKFDHPMGVFTYN+S S   +AP  R
Sbjct  344   YGICKFGPSCKFDHPMGVFTYNMSASPLADAPGRR  378



>ref|XP_007139733.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11727.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=408

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/364 (75%), Positives = 310/364 (85%), Gaps = 10/364 (3%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ++LRS ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKG
Sbjct  1     MWQINLRSSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG  60

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
             E+PER+GQPECQYYLKTG CKFGATC+FHHPRDKAGIAGRVALN+LGYPLRPN+ EC YY
Sbjct  61    EFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPLRPNEPECAYY  120

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLS-----RASFIT  644
             +RTGQCKFG+TCKFHHPQPSNM++ +R SP YP V SPTTPGQ SY         +S+I 
Sbjct  121   LRTGQCKFGNTCKFHHPQPSNMVLSMRSSPVYPTVQSPTTPGQQSYATGITNWPSSSYIP  180

Query  645   NPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVA  821
             +PRWQ PSSY PLI+PQG+VSVPG+ AYSGQ+GS    +S Q T+GN Q+YG +R SE  
Sbjct  181   SPRWQSPSSYAPLILPQGMVSVPGWSAYSGQMGS----DSSQQTMGNGQSYGTNRQSEPT  236

Query  822   NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRE  1001
             N GSQG    +R+G++P+G+YAL REN+FPERP QP+CQFYMKTGDCKFGAVC+FHHPRE
Sbjct  237   NAGSQGAYSQFRSGSVPVGFYALPRENIFPERPDQPDCQFYMKTGDCKFGAVCRFHHPRE  296

Query  1002  RlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  1181
             R+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMGVFTYNIS S + +A
Sbjct  297   RMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASPSADA  356

Query  1182  PTVR  1193
             P  R
Sbjct  357   PGRR  360



>gb|EYU39704.1| hypothetical protein MIMGU_mgv1a0076882mg [Erythranthe guttata]
Length=398

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/358 (76%), Positives = 304/358 (85%), Gaps = 7/358 (2%)
 Frame = +3

Query  129   LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  308
             ++++S E M+SG YPVR+ EPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA A+MKGEYP
Sbjct  1     MNMKSSEPMDSGLYPVREDEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAKMKGEYP  60

Query  309   ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  488
             ER+GQ ECQYYLKTG CKFGATCKF HPR+KAGIAGRVALNVLGYP+R N++EC YYMR 
Sbjct  61    ERMGQSECQYYLKTGTCKFGATCKFDHPREKAGIAGRVALNVLGYPIRANEMECAYYMRN  120

Query  489   GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPS  668
             GQCKFGSTCKFHHPQPSNMMV LRGS  YPP+ SPTT  QLSYPLSRASFI +PRWQ PS
Sbjct  121   GQCKFGSTCKFHHPQPSNMMVSLRGSAVYPPIQSPTT-SQLSYPLSRASFIASPRWQSPS  179

Query  669   SYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMN  845
             SYT L++PQGVVSVPG+ AYSG +GSV S ESQQ T GN Q+ G S+     N GSQ   
Sbjct  180   SYTQLVMPQGVVSVPGWNAYSGHMGSVLSSESQQPTTGNGQSDGASQQGGSRNTGSQ---  236

Query  846   PSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppds  1025
               + +G++PMGYYA QR+NVFPERPGQPECQFYMKTGDCKFG VCKFHHPRERL+P PD 
Sbjct  237   --FHSGSVPMGYYAFQRDNVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRERLMPVPDC  294

Query  1026  llspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             +LSPIGLPLR GEPLC FYSRYGICKFGPSCKFDHPM VF YN + S +T++P +RHF
Sbjct  295   VLSPIGLPLRTGEPLCVFYSRYGICKFGPSCKFDHPMRVFAYNAAASPSTDSPAIRHF  352



>ref|XP_010929827.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Elaeis guineensis]
Length=430

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/368 (75%), Positives = 306/368 (83%), Gaps = 10/368 (3%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ++LR  E+MESG YP R GE DC YYIRTGLCRFG +C+FNHP NR+LAIAAAR+KG
Sbjct  1     MWQMNLRGSESMESGPYPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRLAIAAARIKG  60

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
              YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPLRPN+ EC YY
Sbjct  61    GYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYY  120

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-------LSRASF  638
             +RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHS TTPGQ SYP       LSR SF
Sbjct  121   IRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSSTTPGQQSYPGGLTNWSLSRTSF  180

Query  639   ITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSSE  815
             I +PRWQ PSSYT LI+PQG+V VPG+  Y GQ+GS SSP+SQQ T G +Q Y  +  SE
Sbjct  181   IPSPRWQDPSSYTQLILPQGLVQVPGWNPYPGQMGS-SSPDSQQQTPGAAQYYSTTHQSE  239

Query  816   VANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHP  995
              +  G+QG   SYR G++PMG YALQREN+FPERP QPECQFYMKTGDCKFGAVCKFHHP
Sbjct  240   TS-AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHP  298

Query  996   RERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTT  1175
             RERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG FTY IS SST 
Sbjct  299   RERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGTFTYGISTSSTA  358

Query  1176  NAPTVRHF  1199
             + PTVR  
Sbjct  359   DVPTVRRL  366



>ref|XP_003624157.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES80375.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=418

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/365 (73%), Positives = 306/365 (84%), Gaps = 10/365 (3%)
 Frame = +3

Query  105   LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  284
             + QE +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA 
Sbjct  6     IPQEAMWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAT  65

Query  285   ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
             ARMKGE+PER+GQPECQYYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ 
Sbjct  66    ARMKGEFPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNES  125

Query  465   ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSR  629
             EC YY+RTGQCKFG+TCKFHHPQPSNM++P+RGSP YP V SPTT GQ SY       S 
Sbjct  126   ECAYYLRTGQCKFGNTCKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQQSYAAGITNWST  185

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
             +S+I +PRWQGPSSY PLI+PQGVVSVPG++ Y+GQ+GS    +S Q T+ N Q YG S 
Sbjct  186   SSYIPSPRWQGPSSYAPLILPQGVVSVPGWSTYNGQMGS----DSPQQTMRNDQTYGTSH  241

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
               +  N G QG+   YR+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+F
Sbjct  242   QGDPENAGLQGVYSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRF  301

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPRER IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S S
Sbjct  302   HHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSAS  361

Query  1167  STTNA  1181
                 A
Sbjct  362   PLAEA  366



>ref|XP_008443710.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Cucumis melo]
Length=437

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/384 (73%), Positives = 315/384 (82%), Gaps = 8/384 (2%)
 Frame = +3

Query  69    SVTEGPSS-LSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  245
             SVTEG SS L+P L ++ LWQ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CR
Sbjct  10    SVTEGHSSALAPSLREDALWQMNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCR  69

Query  246   FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  425
             FNHP NR+LAIA ARMKGE+PER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRVA
Sbjct  70    FNHPPNRELAIATARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVA  129

Query  426   LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  605
             LN+LGYPLRP++ EC YY+RTGQCKFG+TCKFHHPQP+NMMV LRGSP YP V SP TPG
Sbjct  130   LNILGYPLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVSLRGSPIYPTVQSP-TPG  188

Query  606   QLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQ  767
             Q SYP      SRASFI +PRWQGPSSY  LI+PQGV+SVPG+ A++ QLGSVSS ES Q
Sbjct  189   QQSYPGGSTNWSRASFIPSPRWQGPSSYASLILPQGVLSVPGWNAFNDQLGSVSSSESPQ  248

Query  768   LTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYM  947
              TVG+SQ Y     SE  +  +     S        G+  LQRENVFPERPGQPECQFYM
Sbjct  249   QTVGHSQIYEAXYQSEXVDAAASVAVSSLICSNCSFGFLPLQRENVFPERPGQPECQFYM  308

Query  948   KTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFD  1127
             KTGDCKFGAVC+FHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFD
Sbjct  309   KTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFD  368

Query  1128  HPMGVFTYNISPSSTTNAPTVRHF  1199
             HPMG+FTYN+S +S+ NAP    F
Sbjct  369   HPMGIFTYNLSAASSANAPVQHLF  392



>ref|XP_010111067.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
 gb|EXC29929.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
Length=419

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/395 (72%), Positives = 319/395 (81%), Gaps = 31/395 (8%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             M+F+A  GI  S+A+VTE    LSP  +Q+ +WQ++LRS ETMESGTYP R GEPDCSYY
Sbjct  1     MEFDA--GIPMSLAAVTE-LRELSPSFSQDAIWQMNLRSSETMESGTYPERPGEPDCSYY  57

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHP NRKL                     YYLKTG CKFGATCKFH
Sbjct  58    IRTGLCRFGATCRFNHPPNRKL---------------------YYLKTGTCKFGATCKFH  96

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAGRV+LN+LGYPLRPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV +RGS
Sbjct  97    HPRDKAGIAGRVSLNILGYPLRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVSMRGS  156

Query  567   PAYPPVHSPTTPGQLSY-----PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYS  728
             P YP V SPTTPGQ SY       SRASFI +PRWQG SSY P+I+PQGVVSVPG+  YS
Sbjct  157   PVYPTVQSPTTPGQQSYIGGITNWSRASFIPSPRWQGSSSYAPMILPQGVVSVPGWNTYS  216

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVF  908
             GQLGSVSSPE QQ + G+SQ YG SR S+ AN GSQG    YR+G++P+G+YALQRENVF
Sbjct  217   GQLGSVSSPERQQPS-GSSQIYGTSRQSDPANTGSQGTLSPYRSGSIPVGFYALQRENVF  275

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PER GQPECQFYMKTGDCKFGAVCKFHHPRERLIP PD LLSP+GLPLRPGEPLC FYSR
Sbjct  276   PERTGQPECQFYMKTGDCKFGAVCKFHHPRERLIPAPDCLLSPMGLPLRPGEPLCIFYSR  335

Query  1089  YGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  1193
             YGICKFGPSCKFDHPMG+FT N+S +S+T+ P  R
Sbjct  336   YGICKFGPSCKFDHPMGIFTINLSATSSTDTPVRR  370



>ref|XP_009626543.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=406

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/377 (76%), Positives = 314/377 (83%), Gaps = 21/377 (6%)
 Frame = +3

Query  69    SVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  248
             S++EGP SLSP L Q++LWQ++LRSME+MESG YPVR+GEPDCSYYIRTGLCRFG++CRF
Sbjct  4     SMSEGPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRF  63

Query  249   NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  428
             NHP NRKL                     YYLKTG CKFGATCKFHHPRDKAGIAGRV L
Sbjct  64    NHPPNRKL---------------------YYLKTGTCKFGATCKFHHPRDKAGIAGRVTL  102

Query  429   NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  608
             NVLGYPLRPN+ EC YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  SPTTPGQ
Sbjct  103   NVLGYPLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSPTTPGQ  162

Query  609   LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQ  788
             +SYPLSRASFI+  RWQG SSY PL V QGVVS PGF Y+GQLG+VSS E QQ T GN+Q
Sbjct  163   MSYPLSRASFISGARWQGSSSYAPLPVLQGVVSFPGFTYNGQLGAVSSAEDQQQTAGNNQ  222

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              YG SRSS+ A +GS+GMN SYRA +LP+GYYAL+ ENVFPER GQPECQFYMKTGDCKF
Sbjct  223   VYGSSRSSDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKF  282

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFT  1148
             GAVC+FHHPRERL+PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPSCKFDHPM VFT
Sbjct  283   GAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFT  342

Query  1149  YNISPSSTTNAPTVRHF  1199
             YNIS SS+T+ P+VR  
Sbjct  343   YNISASSSTDDPSVRRL  359



>gb|ACC85690.1| zinc finger protein [Medicago sativa]
 gb|AFP86282.1| zinc finger protein [Medicago sativa]
Length=418

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/365 (73%), Positives = 305/365 (84%), Gaps = 10/365 (3%)
 Frame = +3

Query  105   LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  284
             + QE +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA 
Sbjct  6     IPQEAMWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAT  65

Query  285   ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
             ARMKGE+PER+GQPECQYYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ 
Sbjct  66    ARMKGEFPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNES  125

Query  465   ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSR  629
             EC YY+RTGQCKFG+TCKFHHPQPSNM++P+RGSP YP V SPTT GQ SY       S 
Sbjct  126   ECAYYLRTGQCKFGNTCKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQQSYAAGITNWST  185

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
             +S+I +PRWQGPSSY PLI+PQGVVSVPG++ Y+GQ+GS    +S Q T+ N Q YG S 
Sbjct  186   SSYIPSPRWQGPSSYAPLILPQGVVSVPGWSTYNGQMGS----DSPQQTMRNDQTYGTSH  241

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
               +  N G  G+   YR+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+F
Sbjct  242   QGDPENAGLPGVYSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRF  301

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPRER IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S S
Sbjct  302   HHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSAS  361

Query  1167  STTNA  1181
                 A
Sbjct  362   PLAEA  366



>gb|KEH23393.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=408

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/364 (73%), Positives = 304/364 (84%), Gaps = 10/364 (3%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA ARMKG
Sbjct  1     MWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKG  60

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
             E+PER+GQPECQYYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ EC YY
Sbjct  61    EFPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYY  120

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFIT  644
             +RTGQCKFG+TCKFHHPQPSNM++P+RGSP YP V SPTT GQ SY       S +S+I 
Sbjct  121   LRTGQCKFGNTCKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQQSYAAGITNWSTSSYIP  180

Query  645   NPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVA  821
             +PRWQGPSSY PLI+PQGVVSVPG++ Y+GQ+GS    +S Q T+ N Q YG S   +  
Sbjct  181   SPRWQGPSSYAPLILPQGVVSVPGWSTYNGQMGS----DSPQQTMRNDQTYGTSHQGDPE  236

Query  822   NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRE  1001
             N G QG+   YR+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FHHPRE
Sbjct  237   NAGLQGVYSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRE  296

Query  1002  RlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  1181
             R IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S S    A
Sbjct  297   RTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEA  356

Query  1182  PTVR  1193
                R
Sbjct  357   AGRR  360



>gb|KHN04981.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=428

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/392 (72%), Positives = 328/392 (84%), Gaps = 9/392 (2%)
 Frame = +3

Query  90    SLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  269
             +L  P  Q++LW ++LR+ ET++SG+YP R GEPDCSYYIRTGLCRFGA+CRFNHP NR+
Sbjct  8     NLIVPNPQDSLWMMNLRTGETVDSGSYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRR  67

Query  270   LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  449
             LAIA ARM GE+PER+GQPECQ   +T  CKFGATCKFHHP+D+AGIAGRVALN+LGYPL
Sbjct  68    LAIATARMIGEFPERIGQPECQ--ARTRTCKFGATCKFHHPKDQAGIAGRVALNILGYPL  125

Query  450   RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP---  620
             RPN+ EC YY+RTGQCKFG+TCKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ SY    
Sbjct  126   RPNEPECTYYLRTGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQESYAGGI  185

Query  621   --LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQA  791
                SR S+I +PRWQGPSSY PLI+PQGVVSVPG+ AYSGQ+GS+S+ +S Q  + N Q 
Sbjct  186   TNWSRGSYIPSPRWQGPSSYGPLILPQGVVSVPGWSAYSGQMGSISTSDSPQQAMRNGQT  245

Query  792   YGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFG  971
             Y  S   E+AN GSQG    +R+GT+P+G+Y LQREN+FPERPGQPECQFY+KTGDCKFG
Sbjct  246   YETSHQGELANAGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYVKTGDCKFG  305

Query  972   AVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTY  1151
             AVC+FHHPRERLIP PD +LSPIGLPLR GEPLC FYSRYGICKFGPSCKFDHPM +F+Y
Sbjct  306   AVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMEIFSY  365

Query  1152  NISPSSTTNAPTVRHFlgsssgtgtltlssEG  1247
             NI+ S + +AP+ RH LGSSSGT  L LSSEG
Sbjct  366   NITASPSADAPS-RHLLGSSSGTAALNLSSEG  396



>ref|XP_010525081.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/395 (71%), Positives = 312/395 (79%), Gaps = 10/395 (3%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S        G SSLSP L Q+ +W ++L S+ETME GTYP R GEPDCSYY
Sbjct  1     MDFNAGVPMSRE-----SGTSSLSPLLNQDAMWPMNLSSVETMEGGTYPERPGEPDCSYY  55

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R LAIAAARMKGEYPER+GQPECQYYLKTG CKFG TCKFH
Sbjct  56    IRTGLCRFGSTCRFNHPRDRNLAIAAARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFH  115

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPR+KAGIAGRV+LNVLGYP+RPN++EC YY+RTG CKFGSTCKF+HP P+N+MVPLRGS
Sbjct  116   HPRNKAGIAGRVSLNVLGYPIRPNEVECSYYLRTGHCKFGSTCKFNHPPPTNLMVPLRGS  175

Query  567   PAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGS  743
             P YP V SPT  GQ SY  SRASFI NPRWQ PSS+  LI+PQG+VSV G+  YSGQLGS
Sbjct  176   PVYPAVQSPTA-GQQSYSWSRASFIANPRWQDPSSFASLILPQGMVSVQGWNTYSGQLGS  234

Query  744   VSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPG  923
             VSS  S Q   GN   YG    +E  + GS G    + +G+  +G YAL RENVFPERPG
Sbjct  235   VSSSGSPQQVTGNDHNYGNLMQNEAKDTGSPGSFSGFHSGSAQLGIYALPRENVFPERPG  294

Query  924   QPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICK  1103
             QPECQFYMKTGDCKFGAVCKFHHPR+R IPPPD +LSPIGLPLRPGEPLC FYSRYGICK
Sbjct  295   QPECQFYMKTGDCKFGAVCKFHHPRDRQIPPPDCVLSPIGLPLRPGEPLCVFYSRYGICK  354

Query  1104  FGPSCKFDHPMGVFTYN--ISPSSTTNAPT-VRHF  1199
             FGPSCKFDHPM VFTYN   + SS+ N  T  RH 
Sbjct  355   FGPSCKFDHPMRVFTYNNINNASSSMNQETPFRHL  389



>sp|Q9SWF9.1|ZFNL_PEA RecName: Full=Zinc finger CCCH domain-containing protein ZFN-like 
[Pisum sativum]
 gb|AAD45720.1| zinc finger protein [Pisum sativum]
Length=417

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/358 (73%), Positives = 302/358 (84%), Gaps = 10/358 (3%)
 Frame = +3

Query  105   LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  284
             + QE +WQ++LRS ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA 
Sbjct  6     IPQEAMWQMNLRSSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAT  65

Query  285   ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
             ARMKGE+PER+GQPECQYYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ 
Sbjct  66    ARMKGEFPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNES  125

Query  465   ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSR  629
             E  YY+RTGQCKFG+TCKFHHPQPSNM++ +RGS  YP V SPTTPGQ SY       S 
Sbjct  126   ERAYYLRTGQCKFGNTCKFHHPQPSNMVLSMRGSTVYPTVQSPTTPGQQSYAAGITNWSS  185

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
             +S++ +PRWQGPSSY PLI+PQGVVSVPG++ Y GQ+GS    ES Q T+ N Q YG S 
Sbjct  186   SSYVPSPRWQGPSSYAPLILPQGVVSVPGWSTYGGQMGS----ESPQQTMRNDQTYGTSH  241

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
               E+ N G QG    YR+G++P+G+YALQR+N+FPERP QPECQFYMKTGDCKFGAVC+F
Sbjct  242   QGELENAGLQGAYSQYRSGSVPVGFYALQRDNIFPERPDQPECQFYMKTGDCKFGAVCRF  301

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNIS  1160
             HHPRER IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN++
Sbjct  302   HHPRERQIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVA  359



>gb|ABD28369.2| Zinc finger, CCCH-type; Sugar transporter superfamily [Medicago 
truncatula]
Length=428

 Score =   529 bits (1363),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 268/379 (71%), Positives = 307/379 (81%), Gaps = 20/379 (5%)
 Frame = +3

Query  105   LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  284
             + QE +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA 
Sbjct  6     IPQEAMWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAT  65

Query  285   ARMKGEYPERVGQPECQ----------YYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  434
             ARMKGE+PER+GQPECQ          YYLKTG CKFGATC+FHHP+DKAG+AGRVALN+
Sbjct  66    ARMKGEFPERLGQPECQASVNECCIMHYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNI  125

Query  435   LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLS  614
             LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSNM++P+RGSP YP V SPTT GQ S
Sbjct  126   LGYPLRPNESECAYYLRTGQCKFGNTCKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQQS  185

Query  615   YP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTV  776
             Y       S +S+I +PRWQGPSSY PLI+PQGVVSVPG++ Y+GQ+GS    +S Q T+
Sbjct  186   YAAGITNWSTSSYIPSPRWQGPSSYAPLILPQGVVSVPGWSTYNGQMGS----DSPQQTM  241

Query  777   GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  956
              N Q YG S   +  N G QG+   YR+G++P+G+YALQREN+FPERP QPECQFYMKTG
Sbjct  242   RNDQTYGTSHQGDPENAGLQGVYSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTG  301

Query  957   DCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPM  1136
             DCKFGAVC+FHHPRER IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPM
Sbjct  302   DCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPM  361

Query  1137  GVFTYNISPSSTTNAPTVR  1193
             G+FTYN+S S    A   R
Sbjct  362   GIFTYNVSASPLAEAAGRR  380



>gb|KHN14776.1| Zinc finger CCCH domain-containing protein ZFN-like, partial 
[Glycine soja]
Length=405

 Score =   528 bits (1359),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 277/379 (73%), Positives = 325/379 (86%), Gaps = 8/379 (2%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             ++LW ++LR+ ETM+SG+YP R GEPDCSYY+RTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  3     DSLWMMNLRTGETMDSGSYPERPGEPDCSYYMRTGLCRFGATCRFNHPPNRKLAIATARM  62

Query  294   KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  473
              GE+PER+GQPECQ   +T  CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+ EC 
Sbjct  63    IGEFPERIGQPECQACTRT--CKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECT  120

Query  474   YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPR  653
             YY+RTGQCKFG+TCKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ SY  +  ++I +PR
Sbjct  121   YYLRTGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQQSY--AGGTYIPSPR  178

Query  654   WQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVG  830
             WQGPSSY PLI+PQGVVSVPG+ AYSGQ+GS+S+ +S Q  + N Q YG SR  E+A  G
Sbjct  179   WQGPSSYAPLILPQGVVSVPGWSAYSGQMGSISTSDSPQQAMRNGQTYGTSRQGELA--G  236

Query  831   SQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERli  1010
             SQG    +R+GT+P+G+Y LQREN+FPERPGQPECQFYMKTGDCKFGAVC+FHHP+ERL+
Sbjct  237   SQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLV  296

Query  1011  pppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             P P+ +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM +F++NIS S + +AP+ 
Sbjct  297   PAPNCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMEIFSHNISASPSADAPS-  355

Query  1191  RHFlgsssgtgtltlssEG  1247
             RH LGSSSGT  L LSSEG
Sbjct  356   RHLLGSSSGTAALNLSSEG  374



>ref|XP_010673925.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=459

 Score =   528 bits (1359),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 273/394 (69%), Positives = 316/394 (80%), Gaps = 24/394 (6%)
 Frame = +3

Query  60    SMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYP-----VRDGEPDCSYYIRTGLC  224
             S  +V  G SSL   L ++++WQ+++RS E M++G YP      R+GE DCS+Y+RTGLC
Sbjct  30    SAVAVNSGSSSL---LDEDSMWQVNMRSTEAMDTGIYPPGPYPEREGEADCSFYLRTGLC  86

Query  225   RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  404
             RFG++CRFNHP NRKLA+A ARMKGE+PER GQPECQYYLKTG CKFGATCKF+HP+DKA
Sbjct  87    RFGSTCRFNHPPNRKLALATARMKGEFPERTGQPECQYYLKTGTCKFGATCKFNHPKDKA  146

Query  405   GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  584
             GIAGRV LNVLGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQPS      RGS  YPPV
Sbjct  147   GIAGRVPLNVLGYPLRPNEPECAYYLRTGQCKFGSTCKFHHPQPS---ASFRGSSVYPPV  203

Query  585   HSPTTPGQLSY--------PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQL  737
              SPTTPGQ SY        PLSRAS I +PRWQGPSSYTP+I+PQGVVSVPG+ AY GQ+
Sbjct  204   QSPTTPGQQSYPGGGLTNWPLSRASIIPSPRWQGPSSYTPMILPQGVVSVPGWNAYMGQM  263

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPER  917
             GS    + QQ T GNS  YG +R SE     SQG   SYR+G++P+GYYALQR+NVFPER
Sbjct  264   GS----DGQQQTPGNSPGYGTARQSESPVSASQGAYSSYRSGSVPVGYYALQRDNVFPER  319

Query  918   PGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGI  1097
             PGQPECQ+YMKTGDCKFGAVC+FHHPRERLIP PD LLS +GLPLRPGEPLC FYSRYGI
Sbjct  320   PGQPECQYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSALGLPLRPGEPLCIFYSRYGI  379

Query  1098  CKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             CKFGP+CKFDHPMG+F YN+SP++T  +   R+ 
Sbjct  380   CKFGPNCKFDHPMGIFAYNVSPTATDASAMRRYL  413



>ref|XP_006848460.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
 gb|ERN10041.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
Length=467

 Score =   522 bits (1345),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 269/370 (73%), Positives = 305/370 (82%), Gaps = 12/370 (3%)
 Frame = +3

Query  108   AQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  287
             +++ +W LSLRS ETMESG YP R GE DC+YYIRTGLCRFG +CRFNHP NRKLA+AAA
Sbjct  40    SEDAMWPLSLRSSETMESGPYPERPGEIDCAYYIRTGLCRFGMTCRFNHPPNRKLAVAAA  99

Query  288   RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
             R+KG YPERVGQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRV LN+LGYPLRPN+ E
Sbjct  100   RIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVLLNILGYPLRPNEKE  159

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLS-------YPLS  626
             C YY+RTGQCKFGSTCKFHHPQP N MV LRGSP YPPVHSPTTPGQ S       +P+S
Sbjct  160   CAYYLRTGQCKFGSTCKFHHPQP-NAMVSLRGSPVYPPVHSPTTPGQPSFHGGFPNWPMS  218

Query  627   RASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLS  803
             RASFI +PRWQGPSSY  LI+PQG+V VPG+  YSGQLGS SS ++QQ   G  Q+YG  
Sbjct  219   RASFIPSPRWQGPSSYAQLILPQGMVPVPGWNTYSGQLGSASSSDTQQ-PPGTGQSYGTP  277

Query  804   RSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCK  983
             R +E     S G  P +R+ ++PMG + LQRENVFPERP QPECQFYMKTGDCKFGA+CK
Sbjct  278   RQTETGGASSPGAFP-FRSSSVPMGLFPLQRENVFPERPDQPECQFYMKTGDCKFGAMCK  336

Query  984   FHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  1163
             FHHPRERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG F YN+S 
Sbjct  337   FHHPRERLLPVPNCMLSPMGLPLRPGEPLCIFYSRYGICKFGPTCKFDHPMGPFAYNLS-  395

Query  1164  SSTTNAPTVR  1193
             +S+ + P  R
Sbjct  396   TSSADVPVRR  405



>ref|XP_010673926.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 271/394 (69%), Positives = 314/394 (80%), Gaps = 26/394 (7%)
 Frame = +3

Query  60    SMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYP-----VRDGEPDCSYYIRTGLC  224
             S  +V  G SSL   L ++++WQ+++RS E M++G YP      R+GE DCS+Y+RTGLC
Sbjct  30    SAVAVNSGSSSL---LDEDSMWQVNMRSTEAMDTGIYPPGPYPEREGEADCSFYLRTGLC  86

Query  225   RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  404
             RFG++CRFNHP NRKLA+A ARMKGE+PER GQPECQYYLKTG CKFGATCKF+HP+DKA
Sbjct  87    RFGSTCRFNHPPNRKLALATARMKGEFPERTGQPECQYYLKTGTCKFGATCKFNHPKDKA  146

Query  405   GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  584
             GIAGRV LNVLGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQPS      RGS  YPPV
Sbjct  147   GIAGRVPLNVLGYPLRPNEPECAYYLRTGQCKFGSTCKFHHPQPS---ASFRGSSVYPPV  203

Query  585   HSPTTPGQLSY--------PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQL  737
              SPTTPGQ SY        PLSRAS I +PRWQGPSSYTP+I+PQGVVSVPG+ AY   +
Sbjct  204   QSPTTPGQQSYPGGGLTNWPLSRASIIPSPRWQGPSSYTPMILPQGVVSVPGWNAY--MM  261

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPER  917
             GS    + QQ T GNS  YG +R SE     SQG   SYR+G++P+GYYALQR+NVFPER
Sbjct  262   GS----DGQQQTPGNSPGYGTARQSESPVSASQGAYSSYRSGSVPVGYYALQRDNVFPER  317

Query  918   PGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGI  1097
             PGQPECQ+YMKTGDCKFGAVC+FHHPRERLIP PD LLS +GLPLRPGEPLC FYSRYGI
Sbjct  318   PGQPECQYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSALGLPLRPGEPLCIFYSRYGI  377

Query  1098  CKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             CKFGP+CKFDHPMG+F YN+SP++T  +   R+ 
Sbjct  378   CKFGPNCKFDHPMGIFAYNVSPTATDASAMRRYL  411



>gb|KHG12066.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=433

 Score =   518 bits (1334),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 283/404 (70%), Positives = 316/404 (78%), Gaps = 38/404 (9%)
 Frame = +3

Query  27    MDFEAAAGISASMAS-----VTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEP  191
             M+F   AGI  S  +     VTEG SSLSP L Q+ +WQ++LRS ETMES  YP R GEP
Sbjct  1     MEFSFDAGIPMSRTATAAVPVTEG-SSLSPSLNQDAMWQMNLRSSETMESTPYPERPGEP  59

Query  192   DCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQ------YYLKTG  353
             DCSYYIRTGLCRFGA+C FNHP NRKLAIAAARMKGE+PERVGQPECQ      YYLKTG
Sbjct  60    DCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARMKGEFPERVGQPECQACTYSSYYLKTG  119

Query  354   ACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  533
              CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGSTCKFHHPQ
Sbjct  120   TCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNETECAYYLRTGQCKFGSTCKFHHPQ  179

Query  534   PSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQG  698
             P+NMMV LRGSP Y  V SP TPGQ S+P      SRASFI +PRWQGPSSY  LI+PQG
Sbjct  180   PTNMMVSLRGSPIYQTVPSPATPGQQSHPGGITNWSRASFIPSPRWQGPSSYASLILPQG  239

Query  699   VVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPM  875
             +VSVPG+ AYS                     +G SR +E A  GSQ      R+G++P+
Sbjct  240   MVSVPGWNAYS--------------------IHGTSRQNESATAGSQASFSELRSGSVPV  279

Query  876   GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplR  1055
             G YALQRENVFPERPG+PECQFYMKTGDCKFGAVCKFHHPRER++P PD +LSPIGLPLR
Sbjct  280   GVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPIGLPLR  339

Query  1056  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPT  1187
             PGEPLC FYSRYGICKFGPSCKF+HPMG+FTY+ SPSS ++AP 
Sbjct  340   PGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYSYSPSSPSDAPV  383



>ref|XP_010525082.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Tarenaya hassleriana]
Length=429

 Score =   517 bits (1331),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 268/372 (72%), Positives = 303/372 (81%), Gaps = 7/372 (2%)
 Frame = +3

Query  102   PLAQET--LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  275
             P+++E+  +W ++L S+ETME GTYP R GEPDCSYYIRTGLCRFG++CRFNHP +R LA
Sbjct  8     PMSRESDAMWPMNLSSVETMEGGTYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRNLA  67

Query  276   IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  455
             IAAARMKGEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV+LNVLGYP+RP
Sbjct  68    IAAARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNVLGYPIRP  127

Query  456   NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRAS  635
             N++EC YY+RTG CKFGSTCKF+HP P+N+MVPLRGSP YP V SPT  GQ SY  SRAS
Sbjct  128   NEVECSYYLRTGHCKFGSTCKFNHPPPTNLMVPLRGSPVYPAVQSPTA-GQQSYSWSRAS  186

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
             FI NPRWQ PSS+  LI+PQG+VSV G+  YSGQLGSVSS  S Q   GN   YG    +
Sbjct  187   FIANPRWQDPSSFASLILPQGMVSVQGWNTYSGQLGSVSSSGSPQQVTGNDHNYGNLMQN  246

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
             E  + GS G    + +G+  +G YAL RENVFPERPGQPECQFYMKTGDCKFGAVCKFHH
Sbjct  247   EAKDTGSPGSFSGFHSGSAQLGIYALPRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  306

Query  993   PRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYN--ISPS  1166
             PR+R IPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTYN   + S
Sbjct  307   PRDRQIPPPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNINNAS  366

Query  1167  STTNAPT-VRHF  1199
             S+ N  T  RH 
Sbjct  367   SSMNQETPFRHL  378



>ref|XP_009420319.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=429

 Score =   506 bits (1303),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 273/412 (66%), Positives = 311/412 (75%), Gaps = 23/412 (6%)
 Frame = +3

Query  27    MDFEAAAGISASM---------ASVTEGPSSL--SPPLAQETLWQLSLRSMETMESGTYP  173
             MD++AA      M         A VTE  SSL   P +  ET+WQ+SLR +E+MESG YP
Sbjct  1     MDYDAATAAGVHMRGGARAGPSAPVTEAASSLPLRPTIDGETMWQMSLREIESMESGPYP  60

Query  174   VRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTG  353
              R GEPDC+YY+RTGLCRFG +CR+NHP NR++AIAAAR+KG +PERVGQPECQYYL+TG
Sbjct  61    ERPGEPDCTYYLRTGLCRFGMTCRYNHPPNRQMAIAAARIKGGFPERVGQPECQYYLRTG  120

Query  354   ACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  533
              CKFGATCKFHHPRDKAGIAGRV LN LGYP+R N+ EC YYMR G CKFGSTCKFHHPQ
Sbjct  121   TCKFGATCKFHHPRDKAGIAGRVQLNALGYPIRLNETECAYYMRNGVCKFGSTCKFHHPQ  180

Query  534   PSNMMVPLRGSPAYPPVHSPTTPGQLSY-----PLSRASFITNPRWQGPSSYTPLIVPQG  698
             PSN M  +RGS  YP VHSPT+  Q SY     PLSR SFI +PRWQG SSY  +IVPQG
Sbjct  181   PSNTMANVRGSTMYPGVHSPTS-SQQSYHGGLTPLSRPSFIPSPRWQGLSSYAQVIVPQG  239

Query  699   VVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPM  875
             +V VP +  YSGQLGSVSS ESQ      +Q YG SR +E    G QG  PSYR+  +P+
Sbjct  240   LVQVPSWNTYSGQLGSVSSSESQLHLPRTTQFYGTSRQNETI-AGVQGTIPSYRSSAIPL  298

Query  876   GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplR  1055
             G Y L RENVFPERP QPECQFYMKTGDCKFGA CKFHHPRERL+PPP+ LLSP+GLPLR
Sbjct  299   GQYVLARENVFPERPDQPECQFYMKTGDCKFGAACKFHHPRERLLPPPNCLLSPLGLPLR  358

Query  1056  PGEPLCAFYSRYGICKFGPSCKFDHPM----GVFTYNISPSSTTNAPTVRHF  1199
             PGEPLC FYSRYGICKFGP CKFDHPM    GV+ Y++  SS+ +A   R+ 
Sbjct  359   PGEPLCIFYSRYGICKFGPHCKFDHPMATPIGVYAYSLPTSSSADALVSRNL  410



>ref|XP_008792910.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792911.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792912.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
Length=473

 Score =   508 bits (1307),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 266/396 (67%), Positives = 314/396 (79%), Gaps = 13/396 (3%)
 Frame = +3

Query  48    GISASMASVTEGPSSL-SPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  224
             G  A+ ASVTE  SSL +P   +ETLWQ+++R  E+MESG+YP R GEPDC+YY+RTG C
Sbjct  12    GYRATAASVTEASSSLLAPAFDEETLWQMNMRGSESMESGSYPQRQGEPDCAYYLRTGHC  71

Query  225   RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  404
             R+G +CR+NHP NRKLAIAAAR+KG YPE VGQPECQYYLKTG CKFGATCKFHHP+DKA
Sbjct  72    RYGVTCRYNHPPNRKLAIAAARLKGGYPEIVGQPECQYYLKTGTCKFGATCKFHHPKDKA  131

Query  405   GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  584
             GI GR  LN+LGYP+RPN+ EC YY+RTGQCKFG+TCKFHHPQPSN+MV LRGSP YP V
Sbjct  132   GILGRAELNILGYPIRPNEEECAYYLRTGQCKFGNTCKFHHPQPSNVMVSLRGSPFYPSV  191

Query  585   HSPTTPGQ------LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGS  743
             HSPT+P Q       S+  SR SFI +PRWQGPSS   +++PQG+V VP + AY G LGS
Sbjct  192   HSPTSPSQSYADGLTSWSSSRTSFIPSPRWQGPSSCAQVVLPQGLVQVPSWNAYPGPLGS  251

Query  744   VSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPG  923
             VSS ESQQ   G  Q +G SR SE +  G+QG+  SYR+ ++ MG +ALQ++NVFPER  
Sbjct  252   VSSSESQQQAPGTVQIHGSSRPSETS-AGAQGIVSSYRSSSITMGQHALQKDNVFPERLD  310

Query  924   QPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICK  1103
             QPECQFYMKTGDCKFGA CKFHHP+ERLI  P+ LLSP GLPLRPGEPLC FYSRYGICK
Sbjct  311   QPECQFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICK  370

Query  1104  FGPSCKFDHP----MGVFTYNISPSSTTNAPTVRHF  1199
             FGP+CKFDHP    MG+F Y++S S++ + P VRH 
Sbjct  371   FGPNCKFDHPVVTSMGIFAYSLSTSASADIPIVRHL  406



>gb|KCW84570.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=345

 Score =   502 bits (1293),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 247/331 (75%), Positives = 280/331 (85%), Gaps = 11/331 (3%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             M F+A  GI     SV +GPS LSP    + +WQ++LRS ET+ESG YP R GEPDCSYY
Sbjct  1     MAFDA--GIPMPRGSVADGPS-LSP---SDAMWQMTLRSNETIESGPYPERPGEPDCSYY  54

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFGA+CRFNHPS+RKLAIA ARMKGEYPERVGQPECQYYLKTG CKFGATCKFH
Sbjct  55    IRTGLCRFGATCRFNHPSDRKLAIANARMKGEYPERVGQPECQYYLKTGTCKFGATCKFH  114

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPRDKAGIAG+VALN+LGYP RPN++EC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGS
Sbjct  115   HPRDKAGIAGKVALNILGYPFRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGS  174

Query  567   PAYPPVHSPTTPGQLSYP----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSG  731
             P YP V SPTTP Q SYP     SRASFI +PRWQGPSSYTPLIVPQG+VS+PG+ AYSG
Sbjct  175   PVYPSVQSPTTPTQQSYPGVTSWSRASFIPSPRWQGPSSYTPLIVPQGMVSIPGWNAYSG  234

Query  732   QLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFP  911
             QLGSVSS +SQ + +G SQ +G S  S+  N GS G   SY++G++P+G+YALQR+N+FP
Sbjct  235   QLGSVSSSDSQLIMMGQSQIFGSSGQSDSVNTGSPGAFSSYQSGSMPVGFYALQRDNIFP  294

Query  912   ERPGQPECQFYMKTGDCKFGAVCKFHHPRER  1004
             ERPGQPECQFYMKTGDCKFGAVC+FHHPRER
Sbjct  295   ERPGQPECQFYMKTGDCKFGAVCRFHHPRER  325


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             +PER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G P RP E  CA+Y 
Sbjct  87    YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYL  146

Query  1086  RYGICKFGPSCKFDHP  1133
             R G CKFG +CKF HP
Sbjct  147   RTGQCKFGSTCKFHHP  162


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  270  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  449
            +   A +    +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  282  VGFYALQRDNIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPL  341

Query  450  RP  455
            RP
Sbjct  342  RP  343



>ref|XP_009420318.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   505 bits (1301),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 275/416 (66%), Positives = 312/416 (75%), Gaps = 29/416 (7%)
 Frame = +3

Query  27    MDFEAAAGISASM---------ASVTEGPSSLSPPL------AQETLWQLSLRSMETMES  161
             MD++AA      M         A VTE  SSL  PL       QET+WQ+SLR +E+MES
Sbjct  1     MDYDAATAAGVHMRGGARAGPSAPVTEAASSL--PLRPTIDGGQETMWQMSLREIESMES  58

Query  162   GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYY  341
             G YP R GEPDC+YY+RTGLCRFG +CR+NHP NR++AIAAAR+KG +PERVGQPECQYY
Sbjct  59    GPYPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNRQMAIAAARIKGGFPERVGQPECQYY  118

Query  342   LKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKF  521
             L+TG CKFGATCKFHHPRDKAGIAGRV LN LGYP+R N+ EC YYMR G CKFGSTCKF
Sbjct  119   LRTGTCKFGATCKFHHPRDKAGIAGRVQLNALGYPIRLNETECAYYMRNGVCKFGSTCKF  178

Query  522   HHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-----PLSRASFITNPRWQGPSSYTPLI  686
             HHPQPSN M  +RGS  YP VHSPT+  Q SY     PLSR SFI +PRWQG SSY  +I
Sbjct  179   HHPQPSNTMANVRGSTMYPGVHSPTS-SQQSYHGGLTPLSRPSFIPSPRWQGLSSYAQVI  237

Query  687   VPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAG  863
             VPQG+V VP +  YSGQLGSVSS ESQ      +Q YG SR +E    G QG  PSYR+ 
Sbjct  238   VPQGLVQVPSWNTYSGQLGSVSSSESQLHLPRTTQFYGTSRQNETI-AGVQGTIPSYRSS  296

Query  864   TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspig  1043
              +P+G Y L RENVFPERP QPECQFYMKTGDCKFGA CKFHHPRERL+PPP+ LLSP+G
Sbjct  297   AIPLGQYVLARENVFPERPDQPECQFYMKTGDCKFGAACKFHHPRERLLPPPNCLLSPLG  356

Query  1044  lplRPGEPLCAFYSRYGICKFGPSCKFDHPM----GVFTYNISPSSTTNAPTVRHF  1199
             LPLRPGEPLC FYSRYGICKFGP CKFDHPM    GV+ Y++  SS+ +A   R+ 
Sbjct  357   LPLRPGEPLCIFYSRYGICKFGPHCKFDHPMATPIGVYAYSLPTSSSADALVSRNL  412



>ref|XP_010927660.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927662.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927663.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=467

 Score =   506 bits (1302),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 267/381 (70%), Positives = 307/381 (81%), Gaps = 14/381 (4%)
 Frame = +3

Query  93    LSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  272
             L+P L +ET+WQ++ R  E++ESG YP R GEPDC+YY+RTGLCR+G +CR+NHP +RKL
Sbjct  28    LAPALDEETMWQMNKRGSESVESGLYPERPGEPDCAYYLRTGLCRYGLTCRYNHPPDRKL  87

Query  273   AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  452
             AIAAAR++G YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGI GR  LN LGYP+R
Sbjct  88    AIAAARIRGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNNLGYPIR  147

Query  453   PNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-----  617
             PN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPV SP +PGQ SY     
Sbjct  148   PNEKECAYYLRTGQCKFGNTCKFHHPQPSNAMVSLRGSPVYPPV-SPASPGQQSYPGGLT  206

Query  618   --PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQ  788
               PLS  SFI +PRWQGPSSY  LI+PQG+V VP + AY G LGSVSS ESQQ T G  Q
Sbjct  207   SWPLSSTSFIPSPRWQGPSSYAQLILPQGLVQVPSWNAYPGHLGSVSSSESQQQTPGTVQ  266

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              YG SR SE + VG QG   SYR+ + PMG YALQR+NVFPERP QPECQFYMKTGDCKF
Sbjct  267   MYGSSRPSETS-VGVQGTMSSYRSSSTPMGQYALQRDNVFPERPDQPECQFYMKTGDCKF  325

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH----PM  1136
             GA CKFHHP+ERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDH    PM
Sbjct  326   GAACKFHHPKERLVPAPNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMATPM  385

Query  1137  GVFTYNISPSSTTNAPTVRHF  1199
             G+F Y++S S + +AP VR  
Sbjct  386   GIFAYSLSTSLSADAPVVRRL  406



>ref|XP_008794629.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794630.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794631.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
Length=467

 Score =   503 bits (1296),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 266/380 (70%), Positives = 308/380 (81%), Gaps = 14/380 (4%)
 Frame = +3

Query  96    SPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  275
             +P L +ET+WQ++ R  E++ESG YP R G PDC+YY+RTGLCR+G +CR+NHP +RKLA
Sbjct  29    APALDEETMWQMNQRGSESVESGLYPERPGVPDCAYYLRTGLCRYGLTCRYNHPPDRKLA  88

Query  276   IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  455
             IAAAR++G YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGI GR  LNVLGYP+RP
Sbjct  89    IAAARIRGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNVLGYPIRP  148

Query  456   NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY------  617
             N+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPV SP +PGQ SY      
Sbjct  149   NEKECAYYLRTGQCKFGNTCKFHHPQPSNAMVSLRGSPVYPPV-SPASPGQQSYPGGLTS  207

Query  618   -PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQA  791
              PLS ASFI +PRWQGPSSY  LI+PQG+V VP + AY G LGSVSS ESQQ T G  Q 
Sbjct  208   WPLSSASFIPSPRWQGPSSYAQLILPQGLVQVPSWNAYPGPLGSVSSSESQQQTPGTVQM  267

Query  792   YGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFG  971
             YG SR SE + +G QG   SYR+ + PMG YALQR++VFPERP QPECQFYMKTGDCKFG
Sbjct  268   YGSSRPSETS-MGVQGTISSYRSSSTPMGQYALQRDSVFPERPDQPECQFYMKTGDCKFG  326

Query  972   AVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH----PMG  1139
             A CKFHHP+ERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDH    PMG
Sbjct  327   AACKFHHPKERLVPAPNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMATPMG  386

Query  1140  VFTYNISPSSTTNAPTVRHF  1199
             +F Y++S SS+ +AP VR  
Sbjct  387   IFAYSLSTSSSADAPVVRRL  406



>ref|XP_011077184.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077185.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077186.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
Length=417

 Score =   501 bits (1291),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 263/365 (72%), Positives = 294/365 (81%), Gaps = 13/365 (4%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             Q+ L Q+++R ME MESG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NR LAIA AR
Sbjct  18    QDALLQMNMRPMEQMESGPYPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATAR  77

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             MK EYPER+GQPECQYYLKTG CKFGATCKFHHPRD+ GIAGRVALNVLGYPLRPN+I C
Sbjct  78    MKSEYPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINC  137

Query  471   PYYMRTGQCKFGSTCKFHHPQPS-NMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITN  647
              YY+R G CKFG TCKFHHPQPS NMMVPLR S  +PP+ SPTT GQLS+   RA  + N
Sbjct  138   AYYIRNGLCKFGRTCKFHHPQPSNNMMVPLRDSALHPPIQSPTT-GQLSF--HRAHLLPN  194

Query  648   PRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVAN  824
             P+WQ PSSY PL + QGV S PG+  YSGQ+  VS  E+QQ   GN Q  G S   E  N
Sbjct  195   PQWQTPSSYAPLFMSQGVASAPGWNTYSGQVEPVSPSENQQ---GNIQNDGTSYQVEGLN  251

Query  825   VGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRER  1004
             VGSQ     + + TLP+GYYA +R+NVFPERPGQP+CQFYMKTGDCKFGAVCKFHHPRER
Sbjct  252   VGSQ-----FGSNTLPIGYYAFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRER  306

Query  1005  lipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAP  1184
             LIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VF +N + S++T+  
Sbjct  307   LIPLPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFAHNAAASASTDGN  366

Query  1185  TVRHF  1199
              VR F
Sbjct  367   AVRDF  371



>ref|XP_009416573.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   502 bits (1292),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 267/392 (68%), Positives = 312/392 (80%), Gaps = 16/392 (4%)
 Frame = +3

Query  57    ASMASVTEGPS-SLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFG  233
             A   +VTEGPS S  P   +E +W+  +R  ++ME+G YP R GEPDC+YYIRTGLCRFG
Sbjct  10    APARTVTEGPSLSSQPGTDEEAMWK-RMRESDSMETGPYPERPGEPDCAYYIRTGLCRFG  68

Query  234   ASCRFNHPSNRKLAIAAA--RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAG  407
              +C+FNHP NR LA+AAA  R++G YPERVGQPECQYYLKTG CKFGA CKFHHP++KAG
Sbjct  69    RTCKFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAG  128

Query  408   IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  587
             IAGRV LN+LGYPLR N+ +C YY+RTG+CKFG TCKFHHPQPSN +V LRGSP YP VH
Sbjct  129   IAGRVQLNILGYPLRLNEKDCAYYIRTGECKFGGTCKFHHPQPSNAVVALRGSPVYPAVH  188

Query  588   SPTTPGQLSYP-------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGS  743
             SPTTPGQ +YP       LSR+SFI +PRWQ  SSY  LI+PQGVV VPG+ +YSGQLG 
Sbjct  189   SPTTPGQQTYPAEMTNWTLSRSSFIPSPRWQASSSYAQLILPQGVVQVPGWTSYSGQLG-  247

Query  744   VSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPG  923
              SSPESQ+ T G +Q YG S+  E + +G+QG  PSYR G+ PMG YA+  EN+FPERPG
Sbjct  248   -SSPESQR-TTGTAQFYGPSQQGETS-IGAQGKFPSYRPGSTPMGLYAVPGENIFPERPG  304

Query  924   QPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICK  1103
             QPECQFYMKTGDCKFGAVCKFHHP+ERL+P P+ +LSP+GLPLRPGEP+C FYSRYGICK
Sbjct  305   QPECQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICK  364

Query  1104  FGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             FGP+CKFDHPMG F Y +S SS T  PT  H 
Sbjct  365   FGPNCKFDHPMGTFAYGVSASSATGVPTAWHL  396



>ref|XP_009392477.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392478.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392479.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392480.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   500 bits (1287),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 300/368 (82%), Gaps = 12/368 (3%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +W+ ++R  + +ESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LAIAAAR++G
Sbjct  1     MWKTNMRGRDPVESGPYPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNRMLAIAAARIRG  60

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
              YPERVGQPECQYYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLRPN+ EC YY
Sbjct  61    GYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYY  120

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-------LSRASF  638
             +RTG+CKFGSTCK+HHPQPSN ++ LRGSP YP  HSPTTPGQ SYP       L R+S+
Sbjct  121   IRTGECKFGSTCKYHHPQPSNTILALRGSPIYPSAHSPTTPGQQSYPAGMTNWTLPRSSY  180

Query  639   ITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSE  815
             I++PRWQ  SSY  LI+PQGVV VPG+ +YSGQLG  SSP SQQ T G +Q Y  S+  E
Sbjct  181   ISSPRWQASSSYAQLILPQGVVQVPGWTSYSGQLG--SSPGSQQ-TAGVAQFYSPSQQGE  237

Query  816   VANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHP  995
               N+G+QG   SYR G++ MG YA+ REN+FPERPGQPECQFYMKTGDCKFGAVC+FHHP
Sbjct  238   T-NIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHP  296

Query  996   RERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTT  1175
             RERLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG  TY +S SS  
Sbjct  297   RERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVTYGLSESSMA  356

Query  1176  NAPTVRHF  1199
             + PTV+H 
Sbjct  357   DVPTVQHL  364



>ref|XP_008810537.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=472

 Score =   501 bits (1291),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 267/390 (68%), Positives = 310/390 (79%), Gaps = 18/390 (5%)
 Frame = +3

Query  66    ASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  245
             A+V EG SSL     +E +WQL+LR  E ME G YP R GEPDC+YY+RTGLCRFG +C+
Sbjct  17    AAVMEGSSSLH----EEAIWQLNLRGSELMEFGPYPERPGEPDCAYYMRTGLCRFGMTCK  72

Query  246   FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  425
             FNHP NRK+AIAAAR++G YPERVGQPECQYYLKTG+CKFGATCKFHHP+DKAGI GRV 
Sbjct  73    FNHPPNRKMAIAAARIRGAYPERVGQPECQYYLKTGSCKFGATCKFHHPKDKAGIVGRVK  132

Query  426   LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  605
             L++LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN M  L GSP Y P HS T PG
Sbjct  133   LSILGYPLRPNEKECAYYLRTGQCKFGNTCKFHHPQPSNAMDALCGSPVYAPAHSTTIPG  192

Query  606   QLSYP-------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPES  761
             Q SYP       LSRASFI +P+WQ PSSY  LI+PQG+V VPG+  Y GQ+GS SSP+S
Sbjct  193   QQSYPGGLTNWSLSRASFIRSPQWQSPSSYAQLILPQGLVQVPGWNPYPGQMGS-SSPKS  251

Query  762   QQLTVGNSQAYGLSRSSEVANVGSQGM----NPSYRAGTLPMGYYALQRENVFPERPGQP  929
             QQ  +G ++ Y  SR SE +  G+QG       SYR G++PMG YALQREN+FPERP QP
Sbjct  252   QQEILGVAEYYSTSRQSETS-AGAQGTLGDRFSSYRLGSIPMGVYALQRENIFPERPDQP  310

Query  930   ECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFG  1109
             ECQFYMKTGDCKFG  C+FHHPRERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFG
Sbjct  311   ECQFYMKTGDCKFGPACRFHHPRERLMPVPNCILSPLGLPLRPGEPLCIFYSRYGICKFG  370

Query  1110  PSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             P+CKFDHPMG F Y ++ SST + PT+RH 
Sbjct  371   PNCKFDHPMGTFAYGLATSSTADVPTIRHL  400



>ref|XP_011077187.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Sesamum indicum]
Length=407

 Score =   498 bits (1283),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 262/364 (72%), Positives = 293/364 (80%), Gaps = 13/364 (4%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             + L Q+++R ME MESG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NR LAIA ARM
Sbjct  9     DALLQMNMRPMEQMESGPYPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARM  68

Query  294   KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  473
             K EYPER+GQPECQYYLKTG CKFGATCKFHHPRD+ GIAGRVALNVLGYPLRPN+I C 
Sbjct  69    KSEYPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCA  128

Query  474   YYMRTGQCKFGSTCKFHHPQPS-NMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNP  650
             YY+R G CKFG TCKFHHPQPS NMMVPLR S  +PP+ SPTT GQLS+   RA  + NP
Sbjct  129   YYIRNGLCKFGRTCKFHHPQPSNNMMVPLRDSALHPPIQSPTT-GQLSF--HRAHLLPNP  185

Query  651   RWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANV  827
             +WQ PSSY PL + QGV S PG+  YSGQ+  VS  E+QQ   GN Q  G S   E  NV
Sbjct  186   QWQTPSSYAPLFMSQGVASAPGWNTYSGQVEPVSPSENQQ---GNIQNDGTSYQVEGLNV  242

Query  828   GSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERl  1007
             GSQ     + + TLP+GYYA +R+NVFPERPGQP+CQFYMKTGDCKFGAVCKFHHPRERL
Sbjct  243   GSQ-----FGSNTLPIGYYAFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERL  297

Query  1008  ipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPT  1187
             IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VF +N + S++T+   
Sbjct  298   IPLPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFAHNAAASASTDGNA  357

Query  1188  VRHF  1199
             VR F
Sbjct  358   VRDF  361



>ref|XP_010929826.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Elaeis guineensis]
Length=439

 Score =   498 bits (1281),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 264/386 (68%), Positives = 297/386 (77%), Gaps = 35/386 (9%)
 Frame = +3

Query  66    ASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  245
             A++TEG SSL     +E +WQ++LR  E+MESG YP R GE DC YYIRTGLCRFG +C+
Sbjct  17    AAMTEGSSSLD----EEAMWQMNLRGSESMESGPYPERPGEADCGYYIRTGLCRFGMTCK  72

Query  246   FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  425
             FNHP NR+L                     YYLKTG CKFGATCKFHHP+DKAGIAGRV 
Sbjct  73    FNHPPNRRL---------------------YYLKTGTCKFGATCKFHHPKDKAGIAGRVQ  111

Query  426   LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  605
             LN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHS TTPG
Sbjct  112   LNILGYPLRPNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSSTTPG  171

Query  606   QLSYP-------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPES  761
             Q SYP       LSR SFI +PRWQ PSSYT LI+PQG+V VPG+  Y GQ+GS SSP+S
Sbjct  172   QQSYPGGLTNWSLSRTSFIPSPRWQDPSSYTQLILPQGLVQVPGWNPYPGQMGS-SSPDS  230

Query  762   QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  941
             QQ T G +Q Y  +  SE +  G+QG   SYR G++PMG YALQREN+FPERP QPECQF
Sbjct  231   QQQTPGAAQYYSTTHQSETS-AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQF  289

Query  942   YMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCK  1121
             YMKTGDCKFGAVCKFHHPRERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP+CK
Sbjct  290   YMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCK  349

Query  1122  FDHPMGVFTYNISPSSTTNAPTVRHF  1199
             FDHPMG FTY IS SST + PTVR  
Sbjct  350   FDHPMGTFTYGISTSSTADVPTVRRL  375



>ref|XP_009416574.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=442

 Score =   493 bits (1269),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 264/391 (68%), Positives = 308/391 (79%), Gaps = 16/391 (4%)
 Frame = +3

Query  57    ASMASVTEGPS-SLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFG  233
             A   +VTEGPS S  P   +E +W+  +R  ++ME+G YP R GEPDC+YYIRTGLCRFG
Sbjct  10    APARTVTEGPSLSSQPGTDEEAMWK-RMRESDSMETGPYPERPGEPDCAYYIRTGLCRFG  68

Query  234   ASCRFNHPSNRKLAIAAA--RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAG  407
              +C+FNHP NR LA+AAA  R++G YPERVGQPECQYYLKTG CKFGA CKFHHP++KAG
Sbjct  69    RTCKFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAG  128

Query  408   IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  587
             IAGRV LN+LGYPLR N+ +C YY+RTG+CKFG TCKFHHPQPSN +V LRGSP YP VH
Sbjct  129   IAGRVQLNILGYPLRLNEKDCAYYIRTGECKFGGTCKFHHPQPSNAVVALRGSPVYPAVH  188

Query  588   SPTTPGQLSYP-------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSV  746
             SPTTPGQ +YP       LSR+SFI +PRWQ  SSY  LI+PQGVV VPG+  S  LG  
Sbjct  189   SPTTPGQQTYPAEMTNWTLSRSSFIPSPRWQASSSYAQLILPQGVVQVPGWT-SYSLG--  245

Query  747   SSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQ  926
             SSPESQ+ T G +Q YG S+  E + +G+QG  PSYR G+ PMG YA+  EN+FPERPGQ
Sbjct  246   SSPESQR-TTGTAQFYGPSQQGETS-IGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQ  303

Query  927   PECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKF  1106
             PECQFYMKTGDCKFGAVCKFHHP+ERL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKF
Sbjct  304   PECQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKF  363

Query  1107  GPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             GP+CKFDHPMG F Y +S SS T  PT  H 
Sbjct  364   GPNCKFDHPMGTFAYGVSASSATGVPTAWHL  394



>ref|XP_009406323.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   491 bits (1265),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 294/368 (80%), Gaps = 12/368 (3%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +W+ + R  ++MESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LA+AA  ++G
Sbjct  1     MWKRNWRGSDSMESGPYPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNRMLAVAATSIRG  60

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
              YPERVGQPECQYYLKTG CKFGATCKFHHPR+KAGI+ +V LN+LGYPLRPN+ EC YY
Sbjct  61    GYPERVGQPECQYYLKTGTCKFGATCKFHHPREKAGISEQVQLNILGYPLRPNEKECAYY  120

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-------LSRASF  638
             +RTG+CKFGSTCKFHHPQPSN ++ L GSP YP  HSPTTP Q +YP       LSR+SF
Sbjct  121   LRTGECKFGSTCKFHHPQPSNAVLALHGSPVYPSAHSPTTPSQQTYPAEMTNWTLSRSSF  180

Query  639   ITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSE  815
             I +P+WQ  SSY  LI+PQGVV VPG+ +YSGQLG  SSPESQQ T+G +Q Y   +  E
Sbjct  181   IPSPQWQASSSYAQLILPQGVVQVPGWTSYSGQLG--SSPESQQ-TIGTAQFYSAPQQGE  237

Query  816   VANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHP  995
              +  G+ G  PSYR G +P+G YA+ REN+FPERPGQPECQFYMKTGDCKFGAVCKFHHP
Sbjct  238   TS-TGAHGKFPSYRPGPVPVGMYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCKFHHP  296

Query  996   RERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTT  1175
             RERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CK+DHP+  +TY +S SS  
Sbjct  297   RERLVPVPNCVLSPLGLPLRPGEPLCDFYSRYGICKFGPNCKYDHPIRTYTYGLSASSMA  356

Query  1176  NAPTVRHF  1199
               PT  H 
Sbjct  357   EVPTAWHL  364



>ref|XP_004142565.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Cucumis sativus]
 gb|KGN66679.1| hypothetical protein Csa_1G659020 [Cucumis sativus]
Length=367

 Score =   486 bits (1252),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 257/363 (71%), Positives = 284/363 (78%), Gaps = 47/363 (13%)
 Frame = +3

Query  129   LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  308
             ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CRFNHP NR+LAIA ARMKGE+P
Sbjct  1     MNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMKGEFP  60

Query  309   ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  488
             ER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRP++ EC YY+RT
Sbjct  61    ERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLRT  120

Query  489   GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFITNPR  653
             GQCKFG+TCKFHHPQP+NMMV LRGSP YP V SP TPGQ SYP      SRASFI +PR
Sbjct  121   GQCKFGNTCKFHHPQPTNMMVSLRGSPIYPTVQSP-TPGQQSYPGGSTNWSRASFIPSPR  179

Query  654   WQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVG  830
             WQGPSSY  LI+PQGV+SVPG+ A++ QLGSVSS ES Q T                   
Sbjct  180   WQGPSSYASLILPQGVLSVPGWNAFNDQLGSVSSSESPQQT-------------------  220

Query  831   SQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERli  1010
                                  RENVFPERPGQPECQFYMKTGDCKFGAVC+FHHPRER++
Sbjct  221   ---------------------RENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVL  259

Query  1011  pppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S +S+ NAP  
Sbjct  260   PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSAASSANAPVQ  319

Query  1191  RHF  1199
               F
Sbjct  320   HLF  322



>gb|ADN33845.1| nucleic acid binding protein [Cucumis melo subsp. melo]
Length=367

 Score =   486 bits (1251),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 257/363 (71%), Positives = 284/363 (78%), Gaps = 47/363 (13%)
 Frame = +3

Query  129   LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  308
             ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CRFNHP NR+LAIA ARMKGE+P
Sbjct  1     MNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMKGEFP  60

Query  309   ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  488
             ER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRP++ EC YY+RT
Sbjct  61    ERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLRT  120

Query  489   GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFITNPR  653
             GQCKFG+TCKFHHPQP+NMMV LRGSP YP V SP TPGQ SYP      SRASFI +PR
Sbjct  121   GQCKFGNTCKFHHPQPTNMMVSLRGSPIYPTVQSP-TPGQQSYPGGSTNWSRASFIPSPR  179

Query  654   WQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVG  830
             WQGPSSY  LI+PQGV+SVPG+ A++ QLGSVSS ES Q T                   
Sbjct  180   WQGPSSYASLILPQGVLSVPGWNAFNDQLGSVSSSESPQQT-------------------  220

Query  831   SQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERli  1010
                                  RENVFPERPGQPECQFYMKTGDCKFGAVC+FHHPRER++
Sbjct  221   ---------------------RENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVL  259

Query  1011  pppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S +S+ NAP  
Sbjct  260   PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSAASSANAPVQ  319

Query  1191  RHF  1199
               F
Sbjct  320   HLF  322



>ref|XP_006662931.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Oryza brachyantha]
Length=407

 Score =   484 bits (1247),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 246/369 (67%), Positives = 292/369 (79%), Gaps = 13/369 (4%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARMKG
Sbjct  1     MWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARMKG  58

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
             EYP+R+GQPECQYYLKTGACKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ EC YY
Sbjct  59    EYPQRIGQPECQYYLKTGACKFGATCKFHHPREKAAMATRVQLNALGYPLRPNEKECAYY  118

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PLSR-AS  635
             +RTGQCKFGSTCKFHHPQPSN MV +RGS  Y P  S T+PGQ +Y       PLSR AS
Sbjct  119   LRTGQCKFGSTCKFHHPQPSNTMVAVRGS-VYSPGQSVTSPGQHTYPGAVTNWPLSRSAS  177

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
             FI +PRW G SSY  +IVP G+V VPG+  Y+ Q+GS SS + QQ T G +Q Y  SR S
Sbjct  178   FIASPRWPGHSSYAQVIVPPGLVQVPGWNPYAAQIGSSSS-DDQQRTAGGAQYYTSSRHS  236

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
             E   +G QGM  SY+AG++P+G Y +QRE++FPERP QPECQFYMKTGDCKFGAVCKFHH
Sbjct  237   ETPTMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHH  296

Query  993   PRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             P+ER++P P+  LS +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ S T
Sbjct  297   PKERIVPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPT  356

Query  1173  TNAPTVRHF  1199
              +  T R  
Sbjct  357   GDMSTARRM  365



>sp|Q2R4J4.2|C3H63_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 63; 
Short=OsC3H63 [Oryza sativa Japonica Group]
 gb|ABA93650.2| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|AGT38442.1| zinc finger protein [Oryza sativa Japonica Group]
Length=444

 Score =   484 bits (1246),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 247/372 (66%), Positives = 293/372 (79%), Gaps = 13/372 (3%)
 Frame = +3

Query  105   LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  284
             + +E +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AA
Sbjct  34    VDEEAMWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAA  91

Query  285   ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
             ARMKGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ 
Sbjct  92    ARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEK  151

Query  465   ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PL  623
             EC YY+RTGQCKFGSTCKFHHPQPSN MV +RGS  Y P  S T+P Q +Y       PL
Sbjct  152   ECAYYLRTGQCKFGSTCKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQHTYPGAVTNWPL  210

Query  624   SR-ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYG  797
             SR ASFI +PRW G SSY  +IVP G+V VPG+  Y+ Q+GS SS + QQ T G +Q Y 
Sbjct  211   SRSASFIASPRWPGHSSYAQVIVPPGLVQVPGWNPYAAQIGSSSS-DDQQRTAGGAQYYT  269

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
              SR SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPECQFYMKTGDCKFGAV
Sbjct  270   GSRHSETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAV  329

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  1157
             CKFHHP+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y +
Sbjct  330   CKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGL  389

Query  1158  SPSSTTNAPTVR  1193
             + S T +    R
Sbjct  390   ATSPTGDVSARR  401



>ref|NP_001067878.1| Os11g0472000 [Oryza sativa Japonica Group]
 dbj|BAF28241.1| Os11g0472000, partial [Oryza sativa Japonica Group]
Length=414

 Score =   483 bits (1243),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 247/369 (67%), Positives = 291/369 (79%), Gaps = 13/369 (4%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             E +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARM
Sbjct  7     EAMWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARM  64

Query  294   KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  473
             KGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ EC 
Sbjct  65    KGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKECA  124

Query  474   YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PLSR-  629
             YY+RTGQCKFGSTCKFHHPQPSN MV +RGS  Y P  S T+P Q +Y       PLSR 
Sbjct  125   YYLRTGQCKFGSTCKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQHTYPGAVTNWPLSRS  183

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
             ASFI +PRW G SSY  +IVP G+V VPG+  Y+ Q+GS SS + QQ T G +Q Y  SR
Sbjct  184   ASFIASPRWPGHSSYAQVIVPPGLVQVPGWNPYAAQIGSSSS-DDQQRTAGGAQYYTGSR  242

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPECQFYMKTGDCKFGAVCKF
Sbjct  243   HSETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKF  302

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHP+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ S
Sbjct  303   HHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATS  362

Query  1167  STTNAPTVR  1193
              T +    R
Sbjct  363   PTGDVSARR  371



>ref|XP_006480414.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Citrus sinensis]
 ref|XP_006480415.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Citrus sinensis]
 ref|XP_006480416.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Citrus sinensis]
 ref|XP_006480417.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X5 [Citrus sinensis]
Length=420

 Score =   483 bits (1242),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 258/335 (77%), Positives = 291/335 (87%), Gaps = 7/335 (2%)
 Frame = +3

Query  261   NRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG  440
             +++ AIA AR+KG+YPER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRV+LNVLG
Sbjct  58    SKQKAIATARIKGDYPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLG  117

Query  441   YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP  620
             YPLRPN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGSP YP V SPTTP Q SY 
Sbjct  118   YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVSLRGSPVYPTVQSPTTPSQQSYA  177

Query  621   -----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGN  782
                   SRASFI +PRWQGPSSY P+++PQG+VSVPG+  YSGQLGSVSS E+ Q T GN
Sbjct  178   GGITNWSRASFIPSPRWQGPSSYAPMLLPQGMVSVPGWNTYSGQLGSVSSSENLQQTSGN  237

Query  783   SQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDC  962
             SQ YG SR +E +N GSQG    +R+G++P+G+YALQRE+VFPERPGQPECQFYMKTGDC
Sbjct  238   SQIYGASRQTEPSNSGSQGTMSPFRSGSIPVGFYALQRESVFPERPGQPECQFYMKTGDC  297

Query  963   KFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  1142
             KFGAVC+FHHPRERL+P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+
Sbjct  298   KFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGI  357

Query  1143  FTYNISPSSTTNAPTVRHFlgsssgtgtltlssEG  1247
             FTYN+S SS+ +AP VR FLGSSS TG L LSSEG
Sbjct  358   FTYNLSASSSADAP-VRRFLGSSSATGALNLSSEG  391



>ref|XP_002450713.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
 gb|EES09701.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
Length=446

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 295/368 (80%), Gaps = 12/368 (3%)
 Frame = +3

Query  114   ETLWQLSL-RSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             E +WQ++L  +M  ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAAR
Sbjct  35    EAMWQMNLGETMAPMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAAR  94

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             MKGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLR N+ EC
Sbjct  95    MKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRANEKEC  154

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ-------LSYPLSR  629
              YY+RTGQCKFGSTCKFHHPQPS MMV +RGS  Y P  S T+PGQ        S+PLSR
Sbjct  155   AYYLRTGQCKFGSTCKFHHPQPSTMMVAVRGS-VYSPGQSATSPGQHAYQGAVTSWPLSR  213

Query  630   -ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLS  803
              ASFI +PRW G SSY  +IVP G+V VPG++ Y+ Q+GS SS + QQ T G +Q Y  S
Sbjct  214   SASFIASPRWPGHSSYAQVIVPPGLVQVPGWSPYTAQIGSSSS-DDQQRTPGAAQYYTGS  272

Query  804   RSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCK  983
             R S  A +G QGM  SY+AG++P+G YA+QRENVFPERP QPECQFYMKTGDCKFGAVCK
Sbjct  273   RQSGTAGIGDQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCK  332

Query  984   FHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  1163
             FHHPRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+CKFDHPMG   Y  + 
Sbjct  333   FHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGSAMYGHAS  392

Query  1164  SSTTNAPT  1187
             S T+ APT
Sbjct  393   SPTSEAPT  400



>gb|ABG22481.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EEC68139.1| hypothetical protein OsI_36059 [Oryza sativa Indica Group]
Length=406

 Score =   481 bits (1238),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 246/367 (67%), Positives = 290/367 (79%), Gaps = 13/367 (4%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARMKG
Sbjct  1     MWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARMKG  58

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
             EYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ EC YY
Sbjct  59    EYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKECAYY  118

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PLSR-AS  635
             +RTGQCKFGSTCKFHHPQPSN MV +RGS  Y P  S T+P Q +Y       PLSR AS
Sbjct  119   LRTGQCKFGSTCKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQHTYPGAVTNWPLSRSAS  177

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
             FI +PRW G SSY  +IVP G+V VPG+  Y+ Q+GS SS + QQ T G +Q Y  SR S
Sbjct  178   FIASPRWPGHSSYAQVIVPPGLVQVPGWNPYAAQIGSSSS-DDQQRTAGGAQYYTGSRHS  236

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
             E  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPECQFYMKTGDCKFGAVCKFHH
Sbjct  237   ETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHH  296

Query  993   PRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             P+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ S T
Sbjct  297   PKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPT  356

Query  1173  TNAPTVR  1193
              +    R
Sbjct  357   GDVSARR  363



>gb|EEE52080.1| hypothetical protein OsJ_33853 [Oryza sativa Japonica Group]
Length=529

 Score =   485 bits (1249),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 247/370 (67%), Positives = 292/370 (79%), Gaps = 13/370 (4%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAAR
Sbjct  121   EEAMWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAAR  178

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             MKGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ EC
Sbjct  179   MKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKEC  238

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PLSR  629
              YY+RTGQCKFGSTCKFHHPQPSN MV +RGS  Y P  S T+P Q +Y       PLSR
Sbjct  239   AYYLRTGQCKFGSTCKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQHTYPGAVTNWPLSR  297

Query  630   -ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLS  803
              ASFI +PRW G SSY  +IVP G+V VPG+  Y+ Q+GS SS + QQ T G +Q Y  S
Sbjct  298   SASFIASPRWPGHSSYAQVIVPPGLVQVPGWNPYAAQIGS-SSSDDQQRTAGGAQYYTGS  356

Query  804   RSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCK  983
             R SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPECQFYMKTGDCKFGAVCK
Sbjct  357   RHSETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCK  416

Query  984   FHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  1163
             FHHP+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ 
Sbjct  417   FHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLAT  476

Query  1164  SSTTNAPTVR  1193
             S T +    R
Sbjct  477   SPTGDVSARR  486



>ref|XP_008792915.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Phoenix dactylifera]
Length=434

 Score =   480 bits (1236),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 295/368 (80%), Gaps = 12/368 (3%)
 Frame = +3

Query  129   LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  308
             +++R  E+MESG+YP R GEPDC+YY+RTG CR+G +CR+NHP NRKLAIAAAR+KG YP
Sbjct  1     MNMRGSESMESGSYPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLKGGYP  60

Query  309   ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  488
             E VGQPECQYYLKTG CKFGATCKFHHP+DKAGI GR  LN+LGYP+RPN+ EC YY+RT
Sbjct  61    EIVGQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPIRPNEEECAYYLRT  120

Query  489   GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ------LSYPLSRASFITNP  650
             GQCKFG+TCKFHHPQPSN+MV LRGSP YP VHSPT+P Q       S+  SR SFI +P
Sbjct  121   GQCKFGNTCKFHHPQPSNVMVSLRGSPFYPSVHSPTSPSQSYADGLTSWSSSRTSFIPSP  180

Query  651   RWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANV  827
             RWQGPSS   +++PQG+V VP + AY G LGSVSS ESQQ   G  Q +G SR SE +  
Sbjct  181   RWQGPSSCAQVVLPQGLVQVPSWNAYPGPLGSVSSSESQQQAPGTVQIHGSSRPSETS-A  239

Query  828   GSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERl  1007
             G+QG+  SYR+ ++ MG +ALQ++NVFPER  QPECQFYMKTGDCKFGA CKFHHP+ERL
Sbjct  240   GAQGIVSSYRSSSITMGQHALQKDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERL  299

Query  1008  ipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHP----MGVFTYNISPSSTT  1175
             I  P+ LLSP GLPLRPGEPLC FYSRYGICKFGP+CKFDHP    MG+F Y++S S++ 
Sbjct  300   ITAPNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPVVTSMGIFAYSLSTSASA  359

Query  1176  NAPTVRHF  1199
             + P VRH 
Sbjct  360   DIPIVRHL  367



>ref|XP_009382899.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   481 bits (1238),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 255/414 (62%), Positives = 308/414 (74%), Gaps = 26/414 (6%)
 Frame = +3

Query  27    MDFEAAAGIS------ASMASVTEGPSSLSPPLA-----QETLWQLSLRSMETMESGTYP  173
             MD++ AA ++       +MAS  +   + SPPL      Q T+WQ+ +R +E++ESG +P
Sbjct  1     MDYDDAAAVTDGVDKRGAMASSADVMGAASPPLLRSPIDQVTMWQMRMREIESVESGPFP  60

Query  174   VRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTG  353
              R  EPDC+YY+RTGLCRFG +CR+NHP NR++AIAAAR+KG YPERVGQPEC++YL+TG
Sbjct  61    ERPREPDCTYYLRTGLCRFGITCRYNHPPNRQMAIAAARIKGGYPERVGQPECEFYLRTG  120

Query  354   ACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  533
              CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRP++ EC YYM+ G+CKFG+TCKFHHPQ
Sbjct  121   TCKFGATCKFHHPRDKAGIAGRVQLNVLGYPLRPDEAECAYYMKNGECKFGNTCKFHHPQ  180

Query  534   PSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PLSRASFITNPRWQGPSSYTPLIVP  692
             P N MV L GS  YP VHSPT+ GQ SY        LSRASFI +PRWQG SSY  +I P
Sbjct  181   P-NTMVSLCGSTVYPGVHSPTS-GQQSYTGGLTNLSLSRASFIASPRWQGLSSYAQVIFP  238

Query  693   QGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTL  869
             QG+V VP +  +SGQL SVSS ESQ      +  YG SR SE    G QGM  SYR+G +
Sbjct  239   QGLVQVPSWNTFSGQLRSVSSSESQLHMPQTTPFYGTSRQSET-TTGVQGMIHSYRSGAI  297

Query  870   PMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglp  1049
             P+G Y L R+NVFP RPGQPEC+FY+KTGDCK+GA CKFHHPRERLIP PD +LSP+GLP
Sbjct  298   PLGQYVLARDNVFPVRPGQPECEFYLKTGDCKYGAACKFHHPRERLIPIPDCVLSPLGLP  357

Query  1050  lRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNISPSSTTNAPTVRHF  1199
             LRP EP+C FYSRYGICKFG  CKFDH    PMG++ Y+++ SS  +    R+ 
Sbjct  358   LRPEEPICIFYSRYGICKFGTHCKFDHPMAAPMGIYAYSLATSSLADVAVARNL  411



>ref|XP_008676803.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28340.1| unknown [Zea mays]
 gb|AFW60816.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=441

 Score =   479 bits (1234),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 250/374 (67%), Positives = 296/374 (79%), Gaps = 14/374 (4%)
 Frame = +3

Query  105   LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  284
             + QE +WQ++L   E ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AA
Sbjct  30    VDQEAMWQMNLE--EAMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAA  87

Query  285   ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
             ARMKGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ 
Sbjct  88    ARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNEK  147

Query  465   ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ-------LSYPL  623
             EC YY+RTGQCKFGSTCKFHH QPS MMV +RGS  Y P  S T+PGQ        S+PL
Sbjct  148   ECAYYLRTGQCKFGSTCKFHHSQPSTMMVAVRGS-VYSPGQSATSPGQHAYQGAVTSWPL  206

Query  624   SR-ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYG  797
             SR ASFI +PRW G SSY  +IVP G+V VPG++ Y+ Q+GS SS E QQ T G +Q Y 
Sbjct  207   SRSASFIASPRWPGHSSYAQVIVPPGLVQVPGWSPYTAQIGSSSS-EDQQRTPGAAQYYT  265

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
              SR S  + +G QGM  SY+AG++P+G YA+QREN+FPERP QPECQFYMKTGDCKFGAV
Sbjct  266   GSRQSGTS-IGDQGMFSSYQAGSVPVGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAV  324

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  1157
             CKFHHPRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+CKFDHPMG   Y  
Sbjct  325   CKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGNAMYGQ  384

Query  1158  SPSSTTNAPTVRHF  1199
             +PS  + AP  R  
Sbjct  385   APSPASEAPAPRRM  398



>ref|NP_001066624.1| Os12g0405100 [Oryza sativa Japonica Group]
 sp|Q2QT65.1|C3H66_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 66; 
Short=OsC3H66 [Oryza sativa Japonica Group]
 gb|ABA97542.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29643.1| Os12g0405100 [Oryza sativa Japonica Group]
 dbj|BAG99287.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53085.1| hypothetical protein OsJ_35844 [Oryza sativa Japonica Group]
Length=454

 Score =   479 bits (1233),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 249/383 (65%), Positives = 293/383 (77%), Gaps = 14/383 (4%)
 Frame = +3

Query  45    AGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  224
              G+SA+  ++  GP  L    A+E +WQ++L   E+MES  YP R GEPDCSYY+RTGLC
Sbjct  24    GGVSAAAPAI--GPHHLGVAAAEEAMWQMTLGGGESMESTPYPERIGEPDCSYYMRTGLC  81

Query  225   RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  404
             RFG +C+FNHP NRKLA+AAARM GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA
Sbjct  82    RFGMTCKFNHPPNRKLAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKA  141

Query  405   GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  584
              +A RV LNVLGYP+RPN+ EC YY+RTGQCKF STCKFHHPQPSN MV +R S  Y P 
Sbjct  142   ALANRVQLNVLGYPMRPNEKECAYYLRTGQCKFASTCKFHHPQPSNTMVAVRNS-MYSPG  200

Query  585   HSPTTPGQLSYP-------LSR-ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQL  737
              S T+PGQ +YP       LSR ASFI +PRW G S Y  +IVPQG+V VPG+  Y+ Q+
Sbjct  201   QSATSPGQHTYPGAVTNWTLSRSASFIASPRWPGHSGYAQVIVPQGLVQVPGWNPYAAQM  260

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPER  917
             GS SSP+ QQ T   +Q YG SR SE   +G  GM  SY+ G++P+G Y +Q EN+FPER
Sbjct  261   GS-SSPDDQQRTPVTTQYYG-SRQSETGGMGDHGMYQSYQGGSVPVGVYTVQGENIFPER  318

Query  918   PGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGI  1097
             P QPECQFYMKTGDCKFGAVCKFHHP+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGI
Sbjct  319   PDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGI  378

Query  1098  CKFGPSCKFDHPMGVFTYNISPS  1166
             CKFGP+CKFDHPMG   Y  + S
Sbjct  379   CKFGPNCKFDHPMGTLMYGSATS  401



>ref|XP_010237293.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Brachypodium distachyon]
Length=445

 Score =   478 bits (1229),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 249/371 (67%), Positives = 290/371 (78%), Gaps = 12/371 (3%)
 Frame = +3

Query  114   ETLWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             ET+WQ+SL    E+ME G YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAAR
Sbjct  33    ETMWQMSLGGGGESMEPGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAAR  92

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             M GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA IA R  LNVLGYPLRPN+ EC
Sbjct  93    MNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPNEKEC  152

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-------LSR  629
              YY+RTGQCKF STCKFHHPQPS+ MV +RGS  Y P  S T+PGQ +YP       +SR
Sbjct  153   AYYLRTGQCKFASTCKFHHPQPSSTMVAVRGS-MYSPGQSATSPGQNTYPGAVTNWNMSR  211

Query  630   -ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLS  803
              ASFI +PRW G S Y  +IVPQ +V VPG+  Y+ Q+GS SSP+ QQ T G +  Y  S
Sbjct  212   SASFIASPRWPGHSGYAQVIVPQSIVQVPGWNPYAAQIGS-SSPDDQQRTPGTTHYYSGS  270

Query  804   RSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCK  983
             R SE   +G  GM PSY+AG++P+G YA+Q +NVFPERP QPECQFYMKTGDCKFGAVCK
Sbjct  271   RQSETTGMGDHGMFPSYQAGSVPLGVYAVQGDNVFPERPDQPECQFYMKTGDCKFGAVCK  330

Query  984   FHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  1163
             F+HP+ER+IP P+  LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y    
Sbjct  331   FNHPKERMIPAPNCALSPLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTVMYGSVT  390

Query  1164  SSTTNAPTVRH  1196
             S T++ PT+ +
Sbjct  391   SPTSDVPTLHY  401



>ref|XP_004979252.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X2 [Setaria italica]
Length=448

 Score =   478 bits (1229),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 247/374 (66%), Positives = 292/374 (78%), Gaps = 13/374 (3%)
 Frame = +3

Query  105   LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  284
             + QE +WQ++L   E +E G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AA
Sbjct  37    VDQEAMWQMNLG--EAVELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAA  94

Query  285   ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
             ARMKGEYP+R GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYP RPN+ 
Sbjct  95    ARMKGEYPQRSGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPFRPNEK  154

Query  465   ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ-------LSYPL  623
             EC YY+RTGQCKFGSTCKFHHPQPS MMV +RGS  Y P  S T+PGQ        S+PL
Sbjct  155   ECAYYLRTGQCKFGSTCKFHHPQPSTMMVAVRGS-GYSPGQSATSPGQHAYQGAVTSWPL  213

Query  624   SR-ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYG  797
             SR ASFI +PRW G SSY  +IVP G+V VPG++ Y+ Q+GS SS + QQ T G +Q Y 
Sbjct  214   SRSASFIASPRWPGHSSYAQVIVPPGLVQVPGWSPYTAQIGSSSS-DDQQQTPGAAQYYT  272

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
              SR S    +G QGM  SY+AG++P+G YA+QRENVFPERP QPECQFYMKTGDCKFGAV
Sbjct  273   GSRQSGTPGMGDQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAV  332

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  1157
             CKFHHPRER+IP P+  LS +GLPLRPGEP+C+FYSRYG+CKFGP+CKFDHP+G   +  
Sbjct  333   CKFHHPRERIIPTPNCALSSLGLPLRPGEPICSFYSRYGMCKFGPNCKFDHPLGTVMFGH  392

Query  1158  SPSSTTNAPTVRHF  1199
             + S T   PT R  
Sbjct  393   ASSPTGEVPTSRRM  406



>ref|NP_001141157.1| hypothetical protein [Zea mays]
 gb|ACF85576.1| unknown [Zea mays]
 gb|ACN34349.1| unknown [Zea mays]
 gb|AFT82654.1| C3H11 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW60815.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=443

 Score =   477 bits (1228),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 249/371 (67%), Positives = 294/371 (79%), Gaps = 14/371 (4%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             E +WQ++L   E ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  35    EAMWQMNLE--EAMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  92

Query  294   KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  473
             KGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ EC 
Sbjct  93    KGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNEKECA  152

Query  474   YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ-------LSYPLSR-  629
             YY+RTGQCKFGSTCKFHH QPS MMV +RGS  Y P  S T+PGQ        S+PLSR 
Sbjct  153   YYLRTGQCKFGSTCKFHHSQPSTMMVAVRGS-VYSPGQSATSPGQHAYQGAVTSWPLSRS  211

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
             ASFI +PRW G SSY  +IVP G+V VPG++ Y+ Q+GS SS E QQ T G +Q Y  SR
Sbjct  212   ASFIASPRWPGHSSYAQVIVPPGLVQVPGWSPYTAQIGSSSS-EDQQRTPGAAQYYTGSR  270

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              S   ++G QGM  SY+AG++P+G YA+QREN+FPERP QPECQFYMKTGDCKFGAVCKF
Sbjct  271   QSGT-SIGDQGMFSSYQAGSVPVGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKF  329

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+CKFDHPMG   Y  +PS
Sbjct  330   HHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGNAMYGQAPS  389

Query  1167  STTNAPTVRHF  1199
               + AP  R  
Sbjct  390   PASEAPAPRRM  400



>ref|XP_009769505.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana sylvestris]
Length=350

 Score =   474 bits (1219),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 244/303 (81%), Positives = 261/303 (86%), Gaps = 0/303 (0%)
 Frame = +3

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             M GEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC
Sbjct  1     MNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENEC  60

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNP  650
              YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  S TTPGQ+SYPLSRASFI+  
Sbjct  61    TYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQMSYPLSRASFISGA  120

Query  651   RWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVG  830
             RWQG SSY PL V QGVVS PGF Y+GQLGSVSS E QQ T GNSQ YG SRSS+ A +G
Sbjct  121   RWQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGNSQVYGSSRSSDKATMG  180

Query  831   SQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERli  1010
             S+GMN SYR  +LP+GYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FHHPRERL+
Sbjct  181   SEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLL  240

Query  1011  pppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS+T+ P+V
Sbjct  241   PPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSV  300

Query  1191  RHF  1199
             R  
Sbjct  301   RRL  303


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query  165  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  341
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  205  VFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFY  264

Query  342  LKTGACKFGATCKFHHP  392
             + G CKFG +CKF HP
Sbjct  265  SRYGICKFGPSCKFDHP  281



>ref|XP_003576637.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Brachypodium distachyon]
Length=442

 Score =   477 bits (1228),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 249/372 (67%), Positives = 291/372 (78%), Gaps = 12/372 (3%)
 Frame = +3

Query  111   QETLWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  287
             +ET+WQ+SL    E+ME G YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAA
Sbjct  29    EETMWQMSLGGGGESMEPGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAA  88

Query  288   RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
             RM GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA IA R  LNVLGYPLRPN+ E
Sbjct  89    RMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPNEKE  148

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-------LS  626
             C YY+RTGQCKF STCKFHHPQPS+ MV +RGS  Y P  S T+PGQ +YP       +S
Sbjct  149   CAYYLRTGQCKFASTCKFHHPQPSSTMVAVRGS-MYSPGQSATSPGQNTYPGAVTNWNMS  207

Query  627   R-ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGL  800
             R ASFI +PRW G S Y  +IVPQ +V VPG+  Y+ Q+GS SSP+ QQ T G +  Y  
Sbjct  208   RSASFIASPRWPGHSGYAQVIVPQSIVQVPGWNPYAAQIGS-SSPDDQQRTPGTTHYYSG  266

Query  801   SRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVC  980
             SR SE   +G  GM PSY+AG++P+G YA+Q +NVFPERP QPECQFYMKTGDCKFGAVC
Sbjct  267   SRQSETTGMGDHGMFPSYQAGSVPLGVYAVQGDNVFPERPDQPECQFYMKTGDCKFGAVC  326

Query  981   KFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNIS  1160
             KF+HP+ER+IP P+  LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y   
Sbjct  327   KFNHPKERMIPAPNCALSPLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTVMYGSV  386

Query  1161  PSSTTNAPTVRH  1196
              S T++ PT+ +
Sbjct  387   TSPTSDVPTLHY  398



>ref|XP_008676804.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|AFW60817.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=407

 Score =   474 bits (1221),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 248/369 (67%), Positives = 293/369 (79%), Gaps = 14/369 (4%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ++L   E ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARMKG
Sbjct  1     MWQMNLE--EAMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARMKG  58

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
             EYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ EC YY
Sbjct  59    EYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNEKECAYY  118

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ-------LSYPLSR-AS  635
             +RTGQCKFGSTCKFHH QPS MMV +RGS  Y P  S T+PGQ        S+PLSR AS
Sbjct  119   LRTGQCKFGSTCKFHHSQPSTMMVAVRGS-VYSPGQSATSPGQHAYQGAVTSWPLSRSAS  177

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
             FI +PRW G SSY  +IVP G+V VPG++ Y+ Q+GS SS E QQ T G +Q Y  SR S
Sbjct  178   FIASPRWPGHSSYAQVIVPPGLVQVPGWSPYTAQIGSSSS-EDQQRTPGAAQYYTGSRQS  236

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
               + +G QGM  SY+AG++P+G YA+QREN+FPERP QPECQFYMKTGDCKFGAVCKFHH
Sbjct  237   GTS-IGDQGMFSSYQAGSVPVGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKFHH  295

Query  993   PRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             PRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+CKFDHPMG   Y  +PS  
Sbjct  296   PRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGNAMYGQAPSPA  355

Query  1173  TNAPTVRHF  1199
             + AP  R  
Sbjct  356   SEAPAPRRM  364



>ref|XP_006663969.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Oryza brachyantha]
Length=448

 Score =   476 bits (1224),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 248/382 (65%), Positives = 292/382 (76%), Gaps = 13/382 (3%)
 Frame = +3

Query  81    GPSSLSPPLAQETLWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  257
             GP  L    A+E +WQ++L    E+MES  YP R GEPDCSYY+RTGLCRFG +C+FNHP
Sbjct  27    GPHHLGVAAAEEAMWQMTLGGGGESMESVPYPERIGEPDCSYYMRTGLCRFGMTCKFNHP  86

Query  258   SNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVL  437
              NRKLA+AAARM GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LNVL
Sbjct  87    PNRKLAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVL  146

Query  438   GYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY  617
             GYP+RPN+ EC YY+RTGQCKF STCKFHHPQPSN MV +RGS  Y P  S T+PGQ +Y
Sbjct  147   GYPMRPNEKECAYYLRTGQCKFASTCKFHHPQPSNTMVSMRGS-MYSPGQSATSPGQHTY  205

Query  618   P-------LSR-ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQL  770
             P       LSR ASFI +PRW G S Y  +IVPQG+V VPG+  Y+ Q+GS SSP+ QQ 
Sbjct  206   PGTVTNWTLSRSASFIASPRWPGHSGYAQVIVPQGLVQVPGWNPYAAQMGS-SSPDDQQR  264

Query  771   TVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMK  950
             T   +Q YG SR SE A +G  GM  SY+  ++P+G Y +Q EN+FPERP QPECQFYMK
Sbjct  265   TPVTTQYYG-SRQSETAGMGDHGMFQSYQGSSVPIGVYTVQGENIFPERPDQPECQFYMK  323

Query  951   TGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH  1130
             TGDCKFGAVCKFHHP+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP+CKFDH
Sbjct  324   TGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDH  383

Query  1131  PMGVFTYNISPSSTTNAPTVRH  1196
             PMG   Y  + S T +  ++ +
Sbjct  384   PMGTLMYGSATSPTGDVSSLHY  405



>ref|XP_009769504.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana sylvestris]
Length=381

 Score =   473 bits (1217),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 244/303 (81%), Positives = 261/303 (86%), Gaps = 0/303 (0%)
 Frame = +3

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             M GEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC
Sbjct  32    MNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENEC  91

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNP  650
              YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  S TTPGQ+SYPLSRASFI+  
Sbjct  92    TYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQMSYPLSRASFISGA  151

Query  651   RWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVG  830
             RWQG SSY PL V QGVVS PGF Y+GQLGSVSS E QQ T GNSQ YG SRSS+ A +G
Sbjct  152   RWQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGNSQVYGSSRSSDKATMG  211

Query  831   SQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERli  1010
             S+GMN SYR  +LP+GYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FHHPRERL+
Sbjct  212   SEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLL  271

Query  1011  pppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS+T+ P+V
Sbjct  272   PPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSV  331

Query  1191  RHF  1199
             R  
Sbjct  332   RRL  334


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query  165  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  341
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  236  VFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFY  295

Query  342  LKTGACKFGATCKFHHP  392
             + G CKFG +CKF HP
Sbjct  296  SRYGICKFGPSCKFDHP  312



>ref|XP_004979251.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X1 [Setaria italica]
Length=450

 Score =   475 bits (1223),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 246/371 (66%), Positives = 290/371 (78%), Gaps = 13/371 (4%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             E +WQ++L   E +E G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  42    EAMWQMNLG--EAVELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  99

Query  294   KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  473
             KGEYP+R GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYP RPN+ EC 
Sbjct  100   KGEYPQRSGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPFRPNEKECA  159

Query  474   YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ-------LSYPLSR-  629
             YY+RTGQCKFGSTCKFHHPQPS MMV +RGS  Y P  S T+PGQ        S+PLSR 
Sbjct  160   YYLRTGQCKFGSTCKFHHPQPSTMMVAVRGS-GYSPGQSATSPGQHAYQGAVTSWPLSRS  218

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
             ASFI +PRW G SSY  +IVP G+V VPG++ Y+ Q+GS SS + QQ T G +Q Y  SR
Sbjct  219   ASFIASPRWPGHSSYAQVIVPPGLVQVPGWSPYTAQIGSSSS-DDQQQTPGAAQYYTGSR  277

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              S    +G QGM  SY+AG++P+G YA+QRENVFPERP QPECQFYMKTGDCKFGAVCKF
Sbjct  278   QSGTPGMGDQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCKF  337

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPRER+IP P+  LS +GLPLRPGEP+C+FYSRYG+CKFGP+CKFDHP+G   +  + S
Sbjct  338   HHPRERIIPTPNCALSSLGLPLRPGEPICSFYSRYGMCKFGPNCKFDHPLGTVMFGHASS  397

Query  1167  STTNAPTVRHF  1199
              T   PT R  
Sbjct  398   PTGEVPTSRRM  408



>ref|XP_010558591.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
[Tarenaya hassleriana]
Length=397

 Score =   472 bits (1214),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 248/385 (64%), Positives = 284/385 (74%), Gaps = 26/385 (7%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MD +A  G+S S  S T    SL P L Q+ +WQ++L S ETME G YP R GEPDC+YY
Sbjct  1     MDLDA--GVSMSRISGT----SLLPLLNQDAMWQMNLSSDETMEGGAYPDRPGEPDCAYY  54

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R LAIA ARMKGEYPER+GQPECQYYLKTG CKFG TCKFH
Sbjct  55    IRTGLCRFGSTCRFNHPRDRNLAIATARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFH  114

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
             HPR+K GIAG V+LN LGYP+RPN+++C YY+RTG CKFGSTCKF+HP P+N+M PLRGS
Sbjct  115   HPRNKVGIAGNVSLNALGYPIRPNEVDCAYYLRTGHCKFGSTCKFNHPPPTNLMAPLRGS  174

Query  567   PAYPPVHSPTTPGQLSYPLSRASFITNPRWQGP--SSYTPLIVPQGVVSVPGF-AYSGQL  737
               YP V SP+  GQ SY  SRASFI NP WQ P  SS+  L++PQG+VSV G+  YSGQL
Sbjct  175   SVYPAVQSPSA-GQQSYSWSRASFIANPPWQDPSSSSFASLVLPQGMVSVQGWNTYSGQL  233

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPER  917
             GSV S  S+    GN   Y     +E                    G+YAL RENVFPE+
Sbjct  234   GSVYSSGSRNQVAGNDHNYRDLLQNEAKES----------------GFYALPRENVFPEK  277

Query  918   PGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGI  1097
             PGQPECQFYMKTGDCKFG+VCKFHHPR R  P PD +LSPIGLPLRPGEPLC FYSRYGI
Sbjct  278   PGQPECQFYMKTGDCKFGSVCKFHHPRNRQNPAPDCVLSPIGLPLRPGEPLCGFYSRYGI  337

Query  1098  CKFGPSCKFDHPMGVFTYNISPSST  1172
             CKFGPSCKFDHPM     +++P  T
Sbjct  338   CKFGPSCKFDHPMQRVFTSMNPEET  362



>ref|XP_003577562.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Brachypodium distachyon]
Length=445

 Score =   472 bits (1215),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 244/371 (66%), Positives = 288/371 (78%), Gaps = 13/371 (4%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             E +W +SL   E+ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARM
Sbjct  37    EAMWHMSLG--ESMEAGLYPERVGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARM  94

Query  294   KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  473
             KGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LNVLGYPLRPN+ EC 
Sbjct  95    KGEYPQRIGQPECQYYLKTGMCKFGATCKFHHPREKAAMATRVQLNVLGYPLRPNEKECS  154

Query  474   YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PLSR-  629
             YY+RTGQCKFGSTCKF+HPQPSN MV LRGS  + P  S T+P Q +Y       PLSR 
Sbjct  155   YYLRTGQCKFGSTCKFNHPQPSNTMVALRGS-VFSPGQSATSPSQHTYSGSVTNWPLSRS  213

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
             ASFI +PRW G SSY  +IVP G+V VPG++ Y+ QLGS SS + Q  + G +Q Y  SR
Sbjct  214   ASFIASPRWPGHSSYAQVIVPPGLVQVPGWSPYAAQLGSSSS-DDQGRSSGAAQYYTGSR  272

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              SE   +   GM  SY+ G++P G YA+QRE +FP+RP QPECQFYMKTGDCKFGAVCKF
Sbjct  273   QSETQGMSDHGMISSYQHGSVPAGLYAVQREYIFPDRPDQPECQFYMKTGDCKFGAVCKF  332

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHP+ER+IP P   LSP+GLPLR GEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ S
Sbjct  333   HHPKERIIPSPSCALSPLGLPLRSGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATS  392

Query  1167  STTNAPTVRHF  1199
              T   PT RH 
Sbjct  393   PTGEVPTGRHM  403



>ref|XP_010913061.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=381

 Score =   468 bits (1203),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 231/321 (72%), Positives = 260/321 (81%), Gaps = 14/321 (4%)
 Frame = +3

Query  66    ASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  245
             A VTEG SSL     +E +WQ++LR  E MESG YP R GEPDC+YYIRTGLCRFG +C+
Sbjct  17    ADVTEGSSSLE----EEAIWQMNLRGSELMESGPYPKRPGEPDCAYYIRTGLCRFGMTCK  72

Query  246   FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  425
             FNHP NRK+AIAAAR+KG YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGIAGRV 
Sbjct  73    FNHPPNRKMAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQ  132

Query  426   LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  605
             LN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGS  Y PVHSPT PG
Sbjct  133   LNILGYPLRPNEKECAYYLRTGQCKFGNTCKFHHPQPSNAMVALRGSSVYSPVHSPTIPG  192

Query  606   QLSYP-------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPES  761
             Q SYP       LSRASFI +PRWQGPSSY  LI+PQG+V VPG+  Y GQ+GS SSP+S
Sbjct  193   QQSYPGGLTNWSLSRASFIPSPRWQGPSSYAQLILPQGLVQVPGWNPYPGQMGS-SSPKS  251

Query  762   QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  941
             +Q T G ++ Y  SR SE +  G+QG   SYR G++PMG YALQREN+FP RP QPECQF
Sbjct  252   RQQTPGVAEYYSASRQSETSE-GAQGTFSSYRLGSIPMGVYALQRENIFPNRPDQPECQF  310

Query  942   YMKTGDCKFGAVCKFHHPRER  1004
             YMKTGDCKFGA C+FHHPRER
Sbjct  311   YMKTGDCKFGAACRFHHPRER  331


 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +3

Query  873   MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpl  1052
             M   A + +  +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PL
Sbjct  81    MAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  140

Query  1053  RPGEPLCAFYSRYGICKFGPSCKFDHP  1133
             RP E  CA+Y R G CKFG +CKF HP
Sbjct  141   RPNEKECAYYLRTGQCKFGNTCKFHHP  167


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  270  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  449
            + + A + +  +P R  QPECQ+Y+KTG CKFGA C+FHHPR++        L+ LG PL
Sbjct  288  MGVYALQRENIFPNRPDQPECQFYMKTGDCKFGAACRFHHPRERLMPVPDCVLSPLGLPL  347

Query  450  RP  455
            RP
Sbjct  348  RP  349


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  441  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  554
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   M VP
Sbjct  299  FPNRPDQPECQFYMKTGDCKFGAACRFHHPRERLMPVP  336



>ref|XP_006663970.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Oryza brachyantha]
Length=409

 Score =   467 bits (1201),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 243/369 (66%), Positives = 286/369 (78%), Gaps = 13/369 (4%)
 Frame = +3

Query  120   LWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  296
             +WQ++L    E+MES  YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAARM 
Sbjct  1     MWQMTLGGGGESMESVPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMN  60

Query  297   GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  476
             GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LNVLGYP+RPN+ EC Y
Sbjct  61    GEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVLGYPMRPNEKECAY  120

Query  477   YMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-------LSR-A  632
             Y+RTGQCKF STCKFHHPQPSN MV +RGS  Y P  S T+PGQ +YP       LSR A
Sbjct  121   YLRTGQCKFASTCKFHHPQPSNTMVSMRGS-MYSPGQSATSPGQHTYPGTVTNWTLSRSA  179

Query  633   SFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRS  809
             SFI +PRW G S Y  +IVPQG+V VPG+  Y+ Q+GS SSP+ QQ T   +Q YG SR 
Sbjct  180   SFIASPRWPGHSGYAQVIVPQGLVQVPGWNPYAAQMGS-SSPDDQQRTPVTTQYYG-SRQ  237

Query  810   SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  989
             SE A +G  GM  SY+  ++P+G Y +Q EN+FPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  238   SETAGMGDHGMFQSYQGSSVPIGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFH  297

Query  990   HPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  1169
             HP+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y  + S 
Sbjct  298   HPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLMYGSATSP  357

Query  1170  TTNAPTVRH  1196
             T +  ++ +
Sbjct  358   TGDVSSLHY  366



>gb|KFK37691.1| hypothetical protein AALP_AA3G016100 [Arabis alpina]
Length=389

 Score =   465 bits (1197),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 246/369 (67%), Positives = 283/369 (77%), Gaps = 28/369 (8%)
 Frame = +3

Query  87    SSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  266
             SSLSP + Q+ +WQ++L S ETME+G+YP R GEP+CSYYIRTGLCRFG++CRFNHP +R
Sbjct  10    SSLSPLMNQDAMWQMNLSSDETMETGSYPERQGEPNCSYYIRTGLCRFGSTCRFNHPRDR  69

Query  267   KLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYP  446
             +L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYP
Sbjct  70    ELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYP  129

Query  447   LRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP  620
             LRPN+++C Y++RTG CKFG TCKF+H  PQP+NMMVP              T  Q SY 
Sbjct  130   LRPNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVP--------------TSAQQSYS  175

Query  621   LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYG  797
               RASFI +PRWQ PSSY  LI+PQGVV V G+  YSGQLGSVS         GN Q Y 
Sbjct  176   WPRASFIASPRWQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSP-------SGNDQNYR  228

Query  798   LSRSSEVANVG--SQGMNPSYRAG-TLPM-GYYALQRENVFPERPGQPECQFYMKTGDCK  965
               + SE    G  SQG    Y AG ++P+ G+YAL RENVFPERPGQPECQFYMKTGDCK
Sbjct  229   NLQQSETNEPGSQSQGSYSGYNAGSSVPVGGFYALPRENVFPERPGQPECQFYMKTGDCK  288

Query  966   FGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVF  1145
             FG VCKFHHPR+R  P PD LLS IGLPLRPGEPLC FY+RYGICKFGPSCKFDHPM VF
Sbjct  289   FGTVCKFHHPRDRQAPSPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVF  348

Query  1146  TYNISPSST  1172
              Y+ + S T
Sbjct  349   AYDNTGSET  357



>ref|NP_566183.1| zinc finger protein 1 [Arabidopsis thaliana]
 sp|Q8GXX7.1|C3H33_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 33; 
Short=AtC3H33; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN1 [Arabidopsis thaliana]
 dbj|BAC42614.1| putative zinc finger protein 1 zfn1 [Arabidopsis thaliana]
 gb|ABG25055.1| At3g02830 [Arabidopsis thaliana]
 gb|AEE73864.1| zinc finger protein 1 [Arabidopsis thaliana]
Length=397

 Score =   464 bits (1195),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 253/389 (65%), Positives = 291/389 (75%), Gaps = 37/389 (10%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMNQDAMWQMNLSSDETMETGSYPERPGEPDCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  560
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVP--  167

Query  561   GSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQL  737
                         T GQ SYP SRASFI +PRWQ PSSY  LI+PQGVV V G+  YSGQL
Sbjct  168   ------------TSGQQSYPWSRASFIASPRWQDPSSYASLIMPQGVVPVQGWNPYSGQL  215

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVAN--VGSQGMNPSYRAG-TLPM-GYYALQRENV  905
             GSVS   +     GN Q Y   + +E       SQG    Y  G ++P+ GYYAL RENV
Sbjct  216   GSVSPSGT-----GNDQNYRNLQQNETIESGSQSQGSFSGYNPGSSVPLGGYYALPRENV  270

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             FPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+
Sbjct  271   FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  330

Query  1086  RYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             RYGICKFGPSCKFDHPM VFTY+ + S T
Sbjct  331   RYGICKFGPSCKFDHPMRVFTYDNTASET  359



>gb|EMS50271.1| Zinc finger CCCH domain-containing protein 12 [Triticum urartu]
Length=406

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 245/378 (65%), Positives = 288/378 (76%), Gaps = 14/378 (4%)
 Frame = +3

Query  105   LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  281
             +  E +WQ +++ S  TM+SG YPVR GEPDC+YY+RTGLCRFG SCRFNHP +R  AIA
Sbjct  19    MKVEGMWQQMAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIA  78

Query  282   AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
             +ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLRPN+
Sbjct  79    SARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNE  138

Query  462   IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLS-----  626
              EC YY++TGQCK+G+TCKF+HP+  N +   RGSP YPPVH+  + G  SY  +     
Sbjct  139   RECAYYLKTGQCKYGNTCKFNHPEIFNAVASSRGSPIYPPVHNSGSTGPHSYTGTMASWT  198

Query  627   --RASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYG  797
               R SFI +PRWQ PS+YTP+IVPQG+V VP + +Y GQ+  VSSPES+  + G  Q YG
Sbjct  199   YPRGSFIPSPRWQSPSNYTPMIVPQGLVQVPSWNSYPGQMVPVSSPESRLQSPGAQQYYG  258

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
              SR  E A+ G+QGM  SYR+ + P   YALQRENVFPERP QPEC +Y+KTGDCKFGAV
Sbjct  259   TSRQGE-ASAGNQGMQSSYRSSSFPAPQYALQRENVFPERPDQPECIYYIKTGDCKFGAV  317

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVF  1145
             CKFHHPR R  PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH    PMGV+
Sbjct  318   CKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNCKFDHPMAAPMGVY  377

Query  1146  TYNISPSSTTNAPTVRHF  1199
              Y  S S++ NAP  R  
Sbjct  378   AYGYSASASPNAPMARRL  395



>ref|XP_010501847.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=402

 Score =   464 bits (1193),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 249/388 (64%), Positives = 289/388 (74%), Gaps = 34/388 (9%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMNQDAMWQMNLGSEETMETGSYPERPGEPDCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  560
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVP--  167

Query  561   GSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQL  737
                         T GQ SYP SRASFI +PRWQ PS+Y  LI+PQGVV V G+  YSGQL
Sbjct  168   ------------TSGQQSYPWSRASFIASPRWQDPSTYPSLIMPQGVVPVQGWNPYSGQL  215

Query  738   GSVS-SPESQQLTVGNSQAYGLSRSSEVANVGS-QGMNPSYRAGTLPM-GYYALQRENVF  908
             GSVS S     L    S     ++ S   + GS  G NP     ++P+ G+YAL RENVF
Sbjct  216   GSVSPSGTGNDLNYNRSLQQSETKESGSPSQGSFSGFNP---GSSVPLGGFYALPRENVF  272

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+R
Sbjct  273   PERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTR  332

Query  1089  YGICKFGPSCKFDHPMGVFTYNISPSST  1172
             YGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  333   YGICKFGPSCKFDHPMRVFAYDNTASET  360



>ref|XP_010485612.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Camelina 
sativa]
Length=401

 Score =   462 bits (1190),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 244/386 (63%), Positives = 288/386 (75%), Gaps = 30/386 (8%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMNQDAMWQMNLGSEETMETGSYPERPGEPDCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  560
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVP--  167

Query  561   GSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQL  737
                         T GQ SYP SRASFI +PRWQ PS+Y  LI+PQGVV V G+  YSGQL
Sbjct  168   ------------TSGQQSYPWSRASFIASPRWQDPSTYPSLIMPQGVVPVQGWNPYSGQL  215

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPM-GYYALQRENVFPE  914
             GSV SP   +  + N ++   S + E  +      +      ++P+ G+YAL RENVFPE
Sbjct  216   GSV-SPSGTRNDLNNYRSLQQSETKESGSQSQGSFSGFNPGSSVPLGGFYALPRENVFPE  274

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+RYG
Sbjct  275   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYG  334

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSST  1172
             ICKFGPSCKFDHPM VF Y+ + S T
Sbjct  335   ICKFGPSCKFDHPMRVFAYDNTASET  360



>ref|XP_009626545.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=350

 Score =   461 bits (1185),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 244/303 (81%), Positives = 264/303 (87%), Gaps = 0/303 (0%)
 Frame = +3

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             M GEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC
Sbjct  1     MNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENEC  60

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNP  650
              YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  SPTTPGQ+SYPLSRASFI+  
Sbjct  61    TYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSPTTPGQMSYPLSRASFISGA  120

Query  651   RWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVG  830
             RWQG SSY PL V QGVVS PGF Y+GQLG+VSS E QQ T GN+Q YG SRSS+ A +G
Sbjct  121   RWQGSSSYAPLPVLQGVVSFPGFTYNGQLGAVSSAEDQQQTAGNNQVYGSSRSSDKATMG  180

Query  831   SQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERli  1010
             S+GMN SYRA +LP+GYYAL+ ENVFPER GQPECQFYMKTGDCKFGAVC+FHHPRERL+
Sbjct  181   SEGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLL  240

Query  1011  pppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS+T+ P+V
Sbjct  241   PPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSV  300

Query  1191  RHF  1199
             R  
Sbjct  301   RRL  303


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query  165  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  341
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  205  VFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFY  264

Query  342  LKTGACKFGATCKFHHP  392
             + G CKFG +CKF HP
Sbjct  265  SRYGICKFGPSCKFDHP  281



>ref|NP_001130819.1| uncharacterized protein LOC100191923 [Zea mays]
 gb|ACF79183.1| unknown [Zea mays]
 gb|ACG29102.1| zinc finger CCCH type domain-containing protein ZFN-like [Zea 
mays]
 gb|ACN25540.1| unknown [Zea mays]
 gb|ACN28916.1| unknown [Zea mays]
 gb|ACR36098.1| unknown [Zea mays]
 gb|AFT82657.1| C3H19 transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA38868.1| TPA: putative Zinc finger CCCH type domain-containing protein 
ZFN [Zea mays]
Length=443

 Score =   464 bits (1193),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 242/369 (66%), Positives = 290/369 (79%), Gaps = 13/369 (4%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             E +WQ++L   + ME G YP R G+PDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  35    EAMWQMNLG--DAMELGPYPERVGDPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  92

Query  294   KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  473
             KGEYP+R+GQPECQYYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLR N+ EC 
Sbjct  93    KGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRLNEKECA  152

Query  474   YYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ-------LSYPLSR-  629
             YY+RTGQCKFGSTCKFHHPQPS MMV +RGS  Y P  S T+PG         S+PLSR 
Sbjct  153   YYLRTGQCKFGSTCKFHHPQPSTMMVAVRGS-VYSPGQSATSPGHHAYQGAVTSWPLSRS  211

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
             ASFI +PRW G SSY  +IVP G+V VPG++ Y+ Q+GS SS + QQ T G +Q Y  SR
Sbjct  212   ASFIASPRWPGHSSYAQVIVPPGLVQVPGWSPYAAQIGSSSS-DDQQRTPGAAQYYTGSR  270

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              S    +G +GM  SY+AG++P+G YA+Q ENVFPERP QPECQFYMKTGDCKFG+VCKF
Sbjct  271   QSGTPGIGDRGMFSSYQAGSVPVGLYAVQTENVFPERPDQPECQFYMKTGDCKFGSVCKF  330

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+CKF HPMG   Y  + S
Sbjct  331   HHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFHHPMGNPMYGHASS  390

Query  1167  STTNAPTVR  1193
              T+ A T R
Sbjct  391   PTSEAQTSR  399



>ref|NP_001045201.2| Os01g0917400 [Oryza sativa Japonica Group]
 sp|Q5JLB5.2|C3H12_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 12; 
Short=OsC3H12; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 2 [Oryza sativa Japonica Group]
 dbj|BAD87735.1| putative zinc finger protein [Oryza sativa Japonica Group]
 dbj|BAG93826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07115.2| Os01g0917400 [Oryza sativa Japonica Group]
 gb|AEM43044.1| CCCH-type zinc finger protein [Oryza sativa Indica Group]
Length=439

 Score =   462 bits (1190),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 244/391 (62%), Positives = 290/391 (74%), Gaps = 17/391 (4%)
 Frame = +3

Query  66    ASVTEGPSSLSPPLAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASC  242
             A+ T+ PS     L  E +WQ +++     M+ G YP R GEPDC+YY+RTGLCRFG SC
Sbjct  42    AAATDEPSHDPAALYGEGMWQQMTMSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMSC  101

Query  243   RFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRV  422
             RFNHP +R LAIA+ARMKGEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV
Sbjct  102   RFNHPQDRNLAIASARMKGEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRV  161

Query  423   ALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  602
              LN LGYPLRP++ EC YY++TGQCK+G+TCKFHHP+  N M   RGSP YP VHS  T 
Sbjct  162   QLNTLGYPLRPSEKECAYYLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSATA  221

Query  603   G------QLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPES  761
             G        S+   R SFI +PRWQ PS+Y P+IVPQG+V VP + +Y+GQ+  VSS ES
Sbjct  222   GPPYTGTMASWAFPRGSFIPSPRWQNPSNYAPMIVPQGLVQVPSWNSYTGQMMPVSSSES  281

Query  762   QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  941
             +  + G  Q YG S+  + A+ G+QGM   YR+ + P+  YALQRENVFPERP QPECQ+
Sbjct  282   RLQSPGAQQTYGTSQQVD-ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQY  340

Query  942   YMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCK  1121
             YMKTGDCKFGAVCKFHHPR R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +CK
Sbjct  341   YMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCK  400

Query  1122  FDH-----PMGVFTYNISPSSTTNAPTVRHF  1199
             FDH     PMGV+ Y    S++TN P VR  
Sbjct  401   FDHPTMAPPMGVYAYG---SASTNVPMVRRL  428



>ref|XP_010929828.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Elaeis guineensis]
Length=380

 Score =   460 bits (1184),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 240/318 (75%), Positives = 265/318 (83%), Gaps = 10/318 (3%)
 Frame = +3

Query  270   LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  449
             +AIAAAR+KG YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPL
Sbjct  1     MAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  60

Query  450   RPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP---  620
             RPN+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHS TTPGQ SYP   
Sbjct  61    RPNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSSTTPGQQSYPGGL  120

Query  621   ----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNS  785
                 LSR SFI +PRWQ PSSYT LI+PQG+V VPG+  Y GQ+GS SSP+SQQ T G +
Sbjct  121   TNWSLSRTSFIPSPRWQDPSSYTQLILPQGLVQVPGWNPYPGQMGS-SSPDSQQQTPGAA  179

Query  786   QAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCK  965
             Q Y  +  SE +  G+QG   SYR G++PMG YALQREN+FPERP QPECQFYMKTGDCK
Sbjct  180   QYYSTTHQSETS-AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCK  238

Query  966   FGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVF  1145
             FGAVCKFHHPRERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG F
Sbjct  239   FGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGTF  298

Query  1146  TYNISPSSTTNAPTVRHF  1199
             TY IS SST + PTVR  
Sbjct  299   TYGISTSSTADVPTVRRL  316


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +3

Query  255  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  434
            P +  + + A + +  +PER  QPECQ+Y+KTG CKFGA CKFHHPR++        L+ 
Sbjct  203  PGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSP  262

Query  435  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  530
            LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  263  LGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  294


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +3

Query  168  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  344
            +P R  +P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  219  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYS  278

Query  345  KTGACKFGATCKFHHP  392
            + G CKFG  CKF HP
Sbjct  279  RYGICKFGPNCKFDHP  294



>ref|XP_002882253.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58512.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   461 bits (1185),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 250/395 (63%), Positives = 287/395 (73%), Gaps = 43/395 (11%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + Q+ +WQ++L S E ME+G+YP R GEPDCSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMNQDAMWQMNLSSDEIMETGSYPERPGEPDCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  560
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVP--  167

Query  561   GSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQL  737
                         T GQ SYP SRASFI +PRWQ PSSY  LI+PQGVV V G+  YSGQL
Sbjct  168   ------------TSGQQSYPWSRASFIASPRWQDPSSYASLIMPQGVVPVQGWNPYSGQL  215

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVAN------VGSQGMNPSYRAGTLPM-GYYALQR  896
             GSVS   +     GN Q Y   + +E             G NP     ++P+ GYYAL R
Sbjct  216   GSVSPSGT-----GNDQNYRNLQQNETIESGSQSQGSFSGFNP---GSSVPIGGYYALPR  267

Query  897   ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCA  1076
             ENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC 
Sbjct  268   ENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCV  327

Query  1077  FYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  1181
             FY+RYGICKFGPSCKFDHPM VF Y  + S T  A
Sbjct  328   FYTRYGICKFGPSCKFDHPMRVFAYENTASETDEA  362



>gb|EAY76977.1| hypothetical protein OsI_04935 [Oryza sativa Indica Group]
Length=440

 Score =   462 bits (1189),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 244/394 (62%), Positives = 291/394 (74%), Gaps = 18/394 (5%)
 Frame = +3

Query  60    SMASVTEGPSSLSPPLAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGA  236
             + A+ T+ PS     L  E +WQ +++     M+ G YP R GEPDC+YY+RTGLCRFG 
Sbjct  40    ATAAATDEPSHDPAALYGEGMWQQMTMSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGM  99

Query  237   SCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAG  416
             SCRFNHP +R LAIA+ARMKGEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAG
Sbjct  100   SCRFNHPQDRNLAIASARMKGEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAG  159

Query  417   RVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPT  596
             RV LN LGYPLRP++ EC YY++TGQCK+G+TCKFHHP+  N M   RGSP YP VHS  
Sbjct  160   RVQLNTLGYPLRPSEKECAYYLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSA  219

Query  597   TPG-------QLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSS  752
             T G         S+   R SFI +PRWQ PS+Y P+IVPQG+V VP + +Y+GQ+  VSS
Sbjct  220   TAGPPSYTGTMASWAFPRGSFIPSPRWQNPSNYAPMIVPQGLVQVPSWNSYTGQMMPVSS  279

Query  753   PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  932
              ES+  + G  Q YG S+  + A+ G+QGM   YR+ + P+  YALQRENVFPERP QPE
Sbjct  280   SESRLQSPGAQQTYGTSQQVD-ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPE  338

Query  933   CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGP  1112
             CQ+YMKTGDCKFGAVCKFHHPR R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG 
Sbjct  339   CQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGA  398

Query  1113  SCKFDH-----PMGVFTYNISPSSTTNAPTVRHF  1199
             +CKFDH     PMGV+ Y    S++TN P VR  
Sbjct  399   NCKFDHPTMAPPMGVYAYG---SASTNVPMVRRL  429



>gb|ACU21592.1| Zinc finger protein [Triticum aestivum]
 emb|CDM85631.1| unnamed protein product [Triticum aestivum]
Length=435

 Score =   462 bits (1188),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 244/378 (65%), Positives = 288/378 (76%), Gaps = 14/378 (4%)
 Frame = +3

Query  105   LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  281
             L +E +WQ +++ S  TM+SG YPVR GEPDC+YY+RTGLCRFG SCRFNHP +R  AIA
Sbjct  48    LYEEGMWQQMAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIA  107

Query  282   AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
             +ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLRPN+
Sbjct  108   SARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNE  167

Query  462   IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLS-----  626
              EC YY++TGQCK+G+TCKF+HP+  + +   RGSP YPPVH+  + G  SY  +     
Sbjct  168   RECAYYLKTGQCKYGNTCKFNHPEIFSAVASSRGSPIYPPVHNSGSTGPHSYTGTMASWT  227

Query  627   --RASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYG  797
               R SFI +PRWQ PS+YTP+IVPQG+V VP + +Y GQ+  VSSPES+  + G  Q YG
Sbjct  228   YPRGSFIPSPRWQSPSNYTPMIVPQGLVQVPNWNSYPGQMVPVSSPESRLQSPGAQQYYG  287

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
              SR  E A+ G+QGM   YR+ + P   YALQRENVFPERP QPEC +Y+KTGDCKFGAV
Sbjct  288   TSRQGE-ASAGNQGMQSPYRSSSFPAPQYALQRENVFPERPDQPECIYYIKTGDCKFGAV  346

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVF  1145
             CKFHHPR R  PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH    PMGV+
Sbjct  347   CKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNCKFDHPMAAPMGVY  406

Query  1146  TYNISPSSTTNAPTVRHF  1199
              Y  S S++ NAP  R  
Sbjct  407   AYGYSASASPNAPMARRL  424



>ref|XP_009626544.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=381

 Score =   459 bits (1182),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 244/303 (81%), Positives = 264/303 (87%), Gaps = 0/303 (0%)
 Frame = +3

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             M GEYPER+GQ ECQYYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC
Sbjct  32    MNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENEC  91

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNP  650
              YYMRT QCKFGSTCKFHHP+PSNMMV  RGSP YPP  SPTTPGQ+SYPLSRASFI+  
Sbjct  92    TYYMRTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSPTTPGQMSYPLSRASFISGA  151

Query  651   RWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVG  830
             RWQG SSY PL V QGVVS PGF Y+GQLG+VSS E QQ T GN+Q YG SRSS+ A +G
Sbjct  152   RWQGSSSYAPLPVLQGVVSFPGFTYNGQLGAVSSAEDQQQTAGNNQVYGSSRSSDKATMG  211

Query  831   SQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERli  1010
             S+GMN SYRA +LP+GYYAL+ ENVFPER GQPECQFYMKTGDCKFGAVC+FHHPRERL+
Sbjct  212   SEGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLL  271

Query  1011  pppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS+T+ P+V
Sbjct  272   PPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSV  331

Query  1191  RHF  1199
             R  
Sbjct  332   RRL  334


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query  165  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  341
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L      +     P R G+P C +Y
Sbjct  236  VFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFY  295

Query  342  LKTGACKFGATCKFHHP  392
             + G CKFG +CKF HP
Sbjct  296  SRYGICKFGPSCKFDHP  312



>gb|AAD33769.1|AF138743_1 zinc finger protein 1 [Arabidopsis thaliana]
Length=424

 Score =   460 bits (1184),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 251/389 (65%), Positives = 289/389 (74%), Gaps = 37/389 (10%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMNQDAMWQMNLSSDETMETGSYPERPGEPDCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CR NHP +R+L IA ARM+GEYPER+G PEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRVNHPRDRELVIATARMRGEYPERIGHPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  560
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVP--  167

Query  561   GSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQL  737
                         T GQ SYP SRASFI +PRWQ PSSY  LI+PQGVV V G+  YSGQL
Sbjct  168   ------------TSGQQSYPWSRASFIASPRWQDPSSYASLIMPQGVVPVQGWNPYSGQL  215

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVAN--VGSQGMNPSYRAG-TLPM-GYYALQRENV  905
             GSVS   +     GN Q Y   + +E       SQG    Y  G ++P+ GYYAL RENV
Sbjct  216   GSVSPSGT-----GNDQNYRNLQQNETIESGSQSQGSFSGYNPGSSVPLGGYYALPRENV  270

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             FPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+
Sbjct  271   FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYT  330

Query  1086  RYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             RYGICKFGPSCKFDHPM VFTY+ + S T
Sbjct  331   RYGICKFGPSCKFDHPMRVFTYDNTASET  359



>dbj|BAJ99149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   458 bits (1178),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 242/373 (65%), Positives = 285/373 (76%), Gaps = 14/373 (4%)
 Frame = +3

Query  120   LWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  296
             +WQ +++ S  TM+SG YPVR GEPDC+YY+RTGLCRFG SCRFNHP +R  AIA+ARMK
Sbjct  1     MWQQMTMNSGVTMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIASARMK  60

Query  297   GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  476
             GEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLRPN+ EC Y
Sbjct  61    GEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNALGYPLRPNERECAY  120

Query  477   YMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLS-------RAS  635
             Y++TGQCK+G+TCKF+HP+  N +   RGSP YPPVH+  + G  SY  +       R S
Sbjct  121   YLKTGQCKYGNTCKFNHPEIFNAVASSRGSPIYPPVHTSGSTGPHSYTGTMASWTYPRGS  180

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
             FI +PRWQ PS+YTP+IVPQG+V VP + +Y GQ+  VSSPES+  + G  Q YG SR  
Sbjct  181   FIPSPRWQSPSNYTPMIVPQGLVQVPSWNSYPGQMVPVSSPESRLQSPGAQQYYGTSRQG  240

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
             E  + G+QGM   YR+ + P+  YALQRENVFPERP QPEC +Y+KTGDCKFGAVCKFHH
Sbjct  241   E-GSAGNQGMQSPYRSSSFPVPQYALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHH  299

Query  993   PRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNIS  1160
             PR R  PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH    PMGV+ Y  S
Sbjct  300   PRVRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNCKFDHPMAAPMGVYAYGYS  359

Query  1161  PSSTTNAPTVRHF  1199
              S++ NAP  R  
Sbjct  360   ASASPNAPMARRL  372



>ref|XP_010463709.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=404

 Score =   458 bits (1178),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 243/389 (62%), Positives = 284/389 (73%), Gaps = 29/389 (7%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMNQDAMWQMNLGSEETMETGSYPERPGEPDCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  560
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFIRTGHCKFGGTCKFNHPQPQPTNMMVP--  167

Query  561   GSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQL  737
                         T GQ SYP SRASFI +PRWQ PS+Y  LI+PQGVV V G+  YSGQL
Sbjct  168   ------------TSGQQSYPWSRASFIASPRWQDPSTYPSLIMPQGVVPVQGWNPYSGQL  215

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPM-GYYALQRENVFPE  914
             GSVS   +      N      S + E  +      +      ++P+ G+YAL RENVFPE
Sbjct  216   GSVSPSGTGNDLNYNRSLQQQSETKESGSQSQGSFSGFNPGSSVPLGGFYALPRENVFPE  275

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+RYG
Sbjct  276   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYG  335

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSSTTNA  1181
             ICKFGPSCKFDHPM VF Y+ + S T   
Sbjct  336   ICKFGPSCKFDHPMRVFAYDNTASETDEV  364



>ref|XP_008792914.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Phoenix dactylifera]
Length=452

 Score =   459 bits (1182),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 248/396 (63%), Positives = 295/396 (74%), Gaps = 34/396 (9%)
 Frame = +3

Query  48    GISASMASVTEGPSSL-SPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLC  224
             G  A+ ASVTE  SSL +P   +ETLWQ+++R  E+MESG+YP R GEPDC+YY+RTG C
Sbjct  12    GYRATAASVTEASSSLLAPAFDEETLWQMNMRGSESMESGSYPQRQGEPDCAYYLRTGHC  71

Query  225   RFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKA  404
             R+G +CR+NHP NRKL                     YYLKTG CKFGATCKFHHP+DKA
Sbjct  72    RYGVTCRYNHPPNRKL---------------------YYLKTGTCKFGATCKFHHPKDKA  110

Query  405   GIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPV  584
             GI GR  LN+LGYP+RPN+ EC YY+RTGQCKFG+TCKFHHPQPSN+MV LRGSP YP V
Sbjct  111   GILGRAELNILGYPIRPNEEECAYYLRTGQCKFGNTCKFHHPQPSNVMVSLRGSPFYPSV  170

Query  585   HSPTTPGQ------LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGS  743
             HSPT+P Q       S+  SR SFI +PRWQGPSS   +++PQG+V VP + AY G LGS
Sbjct  171   HSPTSPSQSYADGLTSWSSSRTSFIPSPRWQGPSSCAQVVLPQGLVQVPSWNAYPGPLGS  230

Query  744   VSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPG  923
             VSS ESQQ   G  Q +G SR SE +  G+QG+  SYR+ ++ MG +ALQ++NVFPER  
Sbjct  231   VSSSESQQQAPGTVQIHGSSRPSETS-AGAQGIVSSYRSSSITMGQHALQKDNVFPERLD  289

Query  924   QPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICK  1103
             QPECQFYMKTGDCKFGA CKFHHP+ERLI  P+ LLSP GLPLRPGEPLC FYSRYGICK
Sbjct  290   QPECQFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICK  349

Query  1104  FGPSCKFDHP----MGVFTYNISPSSTTNAPTVRHF  1199
             FGP+CKFDHP    MG+F Y++S S++ + P VRH 
Sbjct  350   FGPNCKFDHPVVTSMGIFAYSLSTSASADIPIVRHL  385



>gb|EEE55890.1| hypothetical protein OsJ_04549 [Oryza sativa Japonica Group]
Length=380

 Score =   455 bits (1171),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 238/373 (64%), Positives = 282/373 (76%), Gaps = 17/373 (5%)
 Frame = +3

Query  120   LWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  296
             +WQ +++     M+ G YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMK
Sbjct  1     MWQQMTMSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAIASARMK  60

Query  297   GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  476
             GEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRP++ EC Y
Sbjct  61    GEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAY  120

Query  477   YMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG------QLSYPLSRASF  638
             Y++TGQCK+G+TCKFHHP+  N M   RGSP YP VHS  T G        S+   R SF
Sbjct  121   YLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSATAGPPYTGTMASWAFPRGSF  180

Query  639   ITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSE  815
             I +PRWQ PS+Y P+IVPQG+V VP + +Y+GQ+  VSS ES+  + G  Q YG S+  +
Sbjct  181   IPSPRWQNPSNYAPMIVPQGLVQVPSWNSYTGQMMPVSSSESRLQSPGAQQTYGTSQQVD  240

Query  816   VANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHP  995
              A+ G+QGM   YR+ + P+  YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFHHP
Sbjct  241   -ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHP  299

Query  996   RERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNIS  1160
             R R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y   
Sbjct  300   RVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG--  357

Query  1161  PSSTTNAPTVRHF  1199
              S++TN P VR  
Sbjct  358   -SASTNVPMVRRL  369



>ref|XP_006408379.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49832.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=389

 Score =   455 bits (1171),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 245/390 (63%), Positives = 289/390 (74%), Gaps = 38/390 (10%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEP+CSY+
Sbjct  1     MDFNAGVPMS-----------SLSPLMNQDAMWQMNLSSDETMETGSYPERPGEPNCSYF  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG +CKFH
Sbjct  50    IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVSCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVPL  557
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+HPQP   +NMMVP 
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTTNMMVP-  168

Query  558   RGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQ  734
                            GQ SYP SRASFI NPRWQ PSS+TPLI+PQGVV V G+  YSGQ
Sbjct  169   -------------ASGQQSYPWSRASFIANPRWQDPSSFTPLIMPQGVVPVQGWNPYSGQ  215

Query  735   LGSVSSPESQQLTVGNSQAY---GLSRSSEVANVGSQGMNPSYRAGTLPM-GYYALQREN  902
             LGSVS   +     GN   Y     + + E  +      +      ++P+ G+YAL REN
Sbjct  216   LGSVSPSGT-----GNDHNYRNLQQNETIESGSQSQGSFSGFNSGSSVPLRGFYALPREN  270

Query  903   VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFY  1082
             VFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R +PPPD LLSPIGLPLRPGEPLC FY
Sbjct  271   VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFY  330

Query  1083  SRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             +RYGICKFGPSCKFDHPM VFTY  + S T
Sbjct  331   TRYGICKFGPSCKFDHPMRVFTYENTASET  360



>ref|XP_010501886.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=400

 Score =   454 bits (1169),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 247/388 (64%), Positives = 287/388 (74%), Gaps = 36/388 (9%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMNQDAMWQMNLGSEETMETGSYPERPGEPDCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  560
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVP--  167

Query  561   GSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQL  737
                         T GQ SYP SRASFI +PRWQ PS+Y  LI+PQGVV V G+  YS  L
Sbjct  168   ------------TSGQQSYPWSRASFIASPRWQDPSTYPSLIMPQGVVPVQGWNPYS--L  213

Query  738   GSVS-SPESQQLTVGNSQAYGLSRSSEVANVGS-QGMNPSYRAGTLPM-GYYALQRENVF  908
             GSVS S     L    S     ++ S   + GS  G NP     ++P+ G+YAL RENVF
Sbjct  214   GSVSPSGTGNDLNYNRSLQQSETKESGSPSQGSFSGFNP---GSSVPLGGFYALPRENVF  270

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+R
Sbjct  271   PERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTR  330

Query  1089  YGICKFGPSCKFDHPMGVFTYNISPSST  1172
             YGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  331   YGICKFGPSCKFDHPMRVFAYDNTASET  358



>gb|AAF26977.1|AC018363_22 zinc finger protein 1 (zfn1) [Arabidopsis thaliana]
Length=377

 Score =   452 bits (1164),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 243/358 (68%), Positives = 278/358 (78%), Gaps = 26/358 (7%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM+G
Sbjct  1     MWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG  60

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
             EYPER+GQPEC+YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y+
Sbjct  61    EYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYF  120

Query  480   MRTGQCKFGSTCKFHH--PQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPR  653
             +RTG CKFG TCKF+H  PQP+NMMVP              T GQ SYP SRASFI +PR
Sbjct  121   LRTGHCKFGGTCKFNHPQPQPTNMMVP--------------TSGQQSYPWSRASFIASPR  166

Query  654   WQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVAN--  824
             WQ PSSY  LI+PQGVV V G+  YSGQLGSVS   +     GN Q Y   + +E     
Sbjct  167   WQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGT-----GNDQNYRNLQQNETIESG  221

Query  825   VGSQGMNPSYRAG-TLPM-GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPR  998
               SQG    Y  G ++P+ GYYAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR
Sbjct  222   SQSQGSFSGYNPGSSVPLGGYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPR  281

Query  999   ERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             +R  PPPD LLS IGLPLRPGEPLC FY+RYGICKFGPSCKFDHPM VFTY+ + S T
Sbjct  282   DRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASET  339



>ref|XP_006606434.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Glycine max]
Length=356

 Score =   449 bits (1154),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 241/325 (74%), Positives = 275/325 (85%), Gaps = 7/325 (2%)
 Frame = +3

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             M GE+PER+GQPECQYYLKTG CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+ EC
Sbjct  1     MIGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPEC  60

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRAS  635
              YY+RTGQCKFG+TCKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ SY       SR S
Sbjct  61    TYYLRTGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQESYAGGITNWSRGS  120

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
             +I +PRWQGPSSY PLI+PQGVVSVPG+ AYSGQ+GS+S+ +S Q  + N Q Y  S   
Sbjct  121   YIPSPRWQGPSSYGPLILPQGVVSVPGWSAYSGQMGSISTSDSPQQAMRNGQTYETSHQG  180

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
             E+AN GSQG    +R+GT+P+G+Y LQREN+FPERPGQPECQFY+KTGDCKFGAVC+FHH
Sbjct  181   ELANAGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYVKTGDCKFGAVCQFHH  240

Query  993   PRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             PRERLIP PD +LSPIGLPLR GEPLC FYSRYGICKFGPSCKFDHPM +F+YNI+ S +
Sbjct  241   PRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMEIFSYNITTSPS  300

Query  1173  TNAPTVRHFlgsssgtgtltlssEG  1247
              +AP+ RH LGSSSGT  L LSSEG
Sbjct  301   ADAPS-RHLLGSSSGTAALNLSSEG  324


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +3

Query  168  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  344
            +P R G+P+C +Y++TG C+FGA C+F+HP  R +      +     P R+G+P C +Y 
Sbjct  212  FPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYS  271

Query  345  KTGACKFGATCKFHHPRD  398
            + G CKFG +CKF HP +
Sbjct  272  RYGICKFGPSCKFDHPME  289



>emb|CDY51531.1| BnaA05g33310D [Brassica napus]
Length=395

 Score =   449 bits (1155),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 244/393 (62%), Positives = 289/393 (74%), Gaps = 40/393 (10%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + QE +WQ++L   ETME+G+YP R GEP+CSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMTQEAMWQMNLSPDETMETGSYPERPGEPNCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRFNHPPDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP-----SNMMV  551
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP     +N+MV
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPQPTTNLMV  169

Query  552   PLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YS  728
             P  G              Q SYP S ASFI +PRWQ PS YTPL++PQGVV V G+  Y+
Sbjct  170   PTSGQ-------------QQSYPWSSASFIPSPRWQDPSGYTPLLMPQGVVPVQGWNPYT  216

Query  729   GQLGSVSSPESQQLTVGNSQ-AYGLSRSSEVANVG--SQGMNPSYRAG-TLPM-GYYALQ  893
             GQLG+VS   +     GN Q +Y   + SE+   G  SQG       G ++P+ G+YAL 
Sbjct  217   GQLGAVSPSGT-----GNDQTSYRNMQQSEIKESGSHSQGSFSGLNTGSSVPLGGFYALP  271

Query  894   RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLC  1073
              E+VFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC
Sbjct  272   SESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSTIGLPLRPGEPLC  331

Query  1074  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
              FYSRYGICKFGPSCKF HPM VF Y+ + S T
Sbjct  332   VFYSRYGICKFGPSCKFHHPMEVFAYDNTASET  364



>ref|XP_010463710.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=402

 Score =   449 bits (1155),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 241/389 (62%), Positives = 282/389 (72%), Gaps = 31/389 (8%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEPDCSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMNQDAMWQMNLGSEETMETGSYPERPGEPDCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLR  560
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP  
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFIRTGHCKFGGTCKFNHPQPQPTNMMVP--  167

Query  561   GSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQL  737
                         T GQ SYP SRASFI +PRWQ PS+Y  LI+PQGVV V G+  YS  L
Sbjct  168   ------------TSGQQSYPWSRASFIASPRWQDPSTYPSLIMPQGVVPVQGWNPYS--L  213

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPM-GYYALQRENVFPE  914
             GSVS   +      N      S + E  +      +      ++P+ G+YAL RENVFPE
Sbjct  214   GSVSPSGTGNDLNYNRSLQQQSETKESGSQSQGSFSGFNPGSSVPLGGFYALPRENVFPE  273

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+RYG
Sbjct  274   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYG  333

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSSTTNA  1181
             ICKFGPSCKFDHPM VF Y+ + S T   
Sbjct  334   ICKFGPSCKFDHPMRVFAYDNTASETDEV  362



>ref|XP_006645228.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Oryza brachyantha]
Length=381

 Score =   445 bits (1144),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 236/374 (63%), Positives = 279/374 (75%), Gaps = 18/374 (5%)
 Frame = +3

Query  120   LWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  296
             +WQ +++     M+ G YP R  EPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMK
Sbjct  1     MWQQMTMSGSGAMQPGPYPERPEEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK  60

Query  297   GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  476
             GEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRP++ EC Y
Sbjct  61    GEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAY  120

Query  477   YMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PLSRAS  635
             Y++TGQCK+G+TCKFHHP+  N M   RGSP YP VHS  T G  SY          R S
Sbjct  121   YLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSATTGPPSYAGTLASWAFPRGS  180

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
             +I +PRWQ PS+Y P+IVPQG+V VP + +Y GQ+  VSS ES+  + G  Q YG S+ +
Sbjct  181   YIPSPRWQNPSNYAPVIVPQGLVQVPSWNSYPGQMLPVSSSESRLQSPGAQQTYGTSQQA  240

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
             + A+ G+QGM   YR+ + P   YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFHH
Sbjct  241   D-ASAGNQGMLSPYRSSSYPGPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHH  299

Query  993   PRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNI  1157
             PR R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y  
Sbjct  300   PRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPSMAPPMGVYAYG-  358

Query  1158  SPSSTTNAPTVRHF  1199
               S++ N P VR  
Sbjct  359   --SASANVPMVRRL  370



>emb|CDY28712.1| BnaCnng05980D [Brassica napus]
Length=390

 Score =   445 bits (1145),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 241/393 (61%), Positives = 287/393 (73%), Gaps = 45/393 (11%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + QE +WQ++L   ETME+G+YP R GEP+CSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMTQEAMWQMNLSHDETMEAGSYPERPGEPNCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRFNHPPDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVPL  557
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +++MVP 
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTSLMVPT  169

Query  558   RGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQ  734
              G              Q SYP S ASFI +PRWQ PS YTPL++PQGVV V G+  Y+GQ
Sbjct  170   SGQ-------------QQSYPWSSASFIPSPRWQDPSGYTPLLMPQGVVPVQGWNPYTGQ  216

Query  735   LGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQ------GMNPSYRAGTLPM-GYYALQ  893
             LGSVS         G    +   R+ +    GSQ      G+N    A ++P+ G++AL 
Sbjct  217   LGSVSP-------SGTGNDHTNYRNMQQNEAGSQSQGSVSGLN---TASSVPLGGFFALP  266

Query  894   RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLC  1073
              E+VFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLSPIGLPLRPGEPLC
Sbjct  267   SESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSPIGLPLRPGEPLC  326

Query  1074  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
              FYSRYGICKFGPSCKF HPM VF Y+ + S T
Sbjct  327   VFYSRYGICKFGPSCKFHHPMEVFAYDNTASET  359



>ref|XP_006408377.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49830.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=369

 Score =   444 bits (1142),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 235/359 (65%), Positives = 276/359 (77%), Gaps = 27/359 (8%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ++L S ETME+G+YP R GEP+CSY+IRTGLCRFG++CRFNHP +R+L IA ARM+G
Sbjct  1     MWQMNLSSDETMETGSYPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDRELVIATARMRG  60

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
             EYPER+GQPEC+YYLKTG CKFG +CKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y+
Sbjct  61    EYPERIGQPECEYYLKTGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYF  120

Query  480   MRTGQCKFGSTCKFHHPQP---SNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNP  650
             +RTG CKFG TCKF+HPQP   +NMMVP                GQ SYP SRASFI NP
Sbjct  121   LRTGHCKFGGTCKFNHPQPQPTTNMMVP--------------ASGQQSYPWSRASFIANP  166

Query  651   RWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAY---GLSRSSEV  818
             RWQ PSS+TPLI+PQGVV V G+  YSGQLGSVS   +     GN   Y     + + E 
Sbjct  167   RWQDPSSFTPLIMPQGVVPVQGWNPYSGQLGSVSPSGT-----GNDHNYRNLQQNETIES  221

Query  819   ANVGSQGMNPSYRAGTLPM-GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHP  995
              +      +      ++P+ G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHP
Sbjct  222   GSQSQGSFSGFNSGSSVPLRGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHP  281

Query  996   RERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             R+R +PPPD LLSPIGLPLRPGEPLC FY+RYGICKFGPSCKFDHPM VFTY  + S T
Sbjct  282   RDRQVPPPDCLLSPIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYENTASET  340



>ref|XP_009147316.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Brassica 
rapa]
Length=392

 Score =   444 bits (1143),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 241/395 (61%), Positives = 286/395 (72%), Gaps = 47/395 (12%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + QE +WQ++L   ETME+G+YP R GEP+CSYY
Sbjct  1     MDFNAGVPMS-----------SLSPLMTQEAMWQMNLSQDETMETGSYPERPGEPNCSYY  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFH
Sbjct  50    IRTGLCRFGSTCRFNHPPDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFH  109

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP-----SNMMV  551
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP     +N+MV
Sbjct  110   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPQPTTNLMV  169

Query  552   PLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YS  728
             P  G              Q SYP S ASFI +PRWQ PS YTPL++PQGVV V G+  Y+
Sbjct  170   PTSGQ-------------QQSYPWSSASFIPSPRWQDPSGYTPLLMPQGVVPVQGWNPYT  216

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQ------GMNPSYRAGTLPM-GYYA  887
             GQLG+VS         G    +   R+ +    GSQ      G+N    A ++P+ G+YA
Sbjct  217   GQLGAVSP-------SGTGNDHNSYRNMQQNEAGSQSQGSVSGLN---TASSVPLGGFYA  266

Query  888   LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEP  1067
             L  E+VFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLSPIGLPLRPGEP
Sbjct  267   LPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSPIGLPLRPGEP  326

Query  1068  LCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             LC FYSRY ICKFGPSCKF HPM VF Y+ + S T
Sbjct  327   LCVFYSRYRICKFGPSCKFHHPMEVFAYDNTASET  361



>gb|ACF82040.1| unknown [Zea mays]
 gb|AFT82648.1| C3H49 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW84180.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   443 bits (1139),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 241/391 (62%), Positives = 285/391 (73%), Gaps = 31/391 (8%)
 Frame = +3

Query  87    SSLSPP-LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  260
             SSL P  L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP 
Sbjct  37    SSLDPDALYEEGMWQQMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPP  96

Query  261   NRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG  440
             +R LAIA+ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LG
Sbjct  97    DRNLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLG  156

Query  441   YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-  617
             YPL PN+ EC YY++TGQCK+ +TCKFHHP+  N++   RGSP Y  VHS  + G  SY 
Sbjct  157   YPLLPNEKECAYYLKTGQCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAGPQSYT  216

Query  618   ------PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTV  776
                      RASFI +PRWQ PS+Y P++VP G+V VP + +Y GQL S           
Sbjct  217   GTMSSWTFPRASFIPSPRWQSPSNYAPMVVPHGLVQVPSWNSYPGQLQS----------P  266

Query  777   GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  956
             G  Q YG S+  E A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+YMKTG
Sbjct  267   GAQQTYGSSQQGE-ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQYYMKTG  325

Query  957   DCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH--  1130
             DCKFGAVCKFHHPR R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CKFDH  
Sbjct  326   DCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCKFDHPT  385

Query  1131  ---PMGVFTYNISPS-----STTNAPTVRHF  1199
                PMGV+ Y  S S     ++TNAP  RH 
Sbjct  386   MAAPMGVYAYGFSGSASVAPASTNAPMTRHL  416



>ref|XP_006408378.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49831.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=385

 Score =   441 bits (1135),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 241/390 (62%), Positives = 285/390 (73%), Gaps = 42/390 (11%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF A   +S           SLSP + Q+ +WQ++L S ETME+G+YP R GEP+CSY+
Sbjct  1     MDFNAGVPMS-----------SLSPLMNQDAMWQMNLSSDETMETGSYPERPGEPNCSYF  49

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+    TG CKFG +CKFH
Sbjct  50    IRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECE----TGTCKFGVSCKFH  105

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVPL  557
             HPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+HPQP   +NMMVP 
Sbjct  106   HPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTTNMMVPA  165

Query  558   RGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQ  734
                            GQ SYP SRASFI NPRWQ PSS+TPLI+PQGVV V G+  YSGQ
Sbjct  166   S--------------GQQSYPWSRASFIANPRWQDPSSFTPLIMPQGVVPVQGWNPYSGQ  211

Query  735   LGSVSSPESQQLTVGNSQAY---GLSRSSEVANVGSQGMNPSYRAGTLPM-GYYALQREN  902
             LGSVS   +     GN   Y     + + E  +      +      ++P+ G+YAL REN
Sbjct  212   LGSVSPSGT-----GNDHNYRNLQQNETIESGSQSQGSFSGFNSGSSVPLRGFYALPREN  266

Query  903   VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFY  1082
             VFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R +PPPD LLSPIGLPLRPGEPLC FY
Sbjct  267   VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFY  326

Query  1083  SRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             +RYGICKFGPSCKFDHPM VFTY  + S T
Sbjct  327   TRYGICKFGPSCKFDHPMRVFTYENTASET  356



>ref|NP_001150019.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
 gb|ACG37517.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   441 bits (1133),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 240/391 (61%), Positives = 284/391 (73%), Gaps = 31/391 (8%)
 Frame = +3

Query  87    SSLSPP-LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  260
             SSL P  L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP 
Sbjct  37    SSLDPDALYEEGMWQQMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPP  96

Query  261   NRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG  440
             +R LAIA+ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LG
Sbjct  97    DRNLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLG  156

Query  441   YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-  617
             YPL PN+ EC YY++TGQCK+ +TCKFHHP+  N++   RGSP Y  VHS  + G  SY 
Sbjct  157   YPLLPNEKECAYYLKTGQCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAGPQSYT  216

Query  618   ------PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTV  776
                      RASFI +PRWQ PS+Y P++VP G+V VP + +Y GQL S           
Sbjct  217   GTMSSWTFPRASFIPSPRWQSPSNYAPMVVPHGLVQVPSWNSYPGQLQS----------P  266

Query  777   GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  956
             G  Q YG S+  E A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+YMKTG
Sbjct  267   GAQQTYGSSQQGE-ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQYYMKTG  325

Query  957   DCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH--  1130
             DCKFGAVCKFHHPR R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CKFDH  
Sbjct  326   DCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCKFDHPT  385

Query  1131  ---PMGVFTYNISPS-----STTNAPTVRHF  1199
                PMGV+ Y  S S     ++T AP  RH 
Sbjct  386   MAAPMGVYAYGFSGSASVAPASTXAPMTRHL  416



>ref|XP_003564925.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Brachypodium distachyon]
Length=442

 Score =   441 bits (1133),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 237/376 (63%), Positives = 281/376 (75%), Gaps = 14/376 (4%)
 Frame = +3

Query  105   LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  281
             L  E +WQ +++ S   M+ G YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA
Sbjct  55    LYDEGMWQEMTMSSGAPMQPGPYPERPGEPDCTYYLRTGLCRFGISCRFNHPPDRNLAIA  114

Query  282   AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
             +ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLR N+
Sbjct  115   SARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRLNE  174

Query  462   IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLS-----  626
              EC YY++TGQCK+G+TCKF+HP+  N +   RGSP YP +H+  + G  SY  +     
Sbjct  175   KECAYYLKTGQCKYGNTCKFNHPELFNAVASSRGSPIYPSLHTSASAGPHSYAGTISNWT  234

Query  627   --RASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYG  797
               R SFI +PRWQ PS+Y P+IV QG+V VP + +Y GQ+  VSS ES+  + G  Q YG
Sbjct  235   YPRGSFIPSPRWQSPSNYAPMIVQQGLVQVPSWNSYPGQMLPVSSSESRLQSPGAQQNYG  294

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
               R  E A+ G+QGM   YR  + P+  YALQRENVFPERP QPEC +Y+KTGDCKFGAV
Sbjct  295   TYRQGE-ASSGNQGMLSPYRPSSFPVPQYALQRENVFPERPDQPECIYYIKTGDCKFGAV  353

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVF  1145
             CKFHHPR R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH    PMGV+
Sbjct  354   CKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGINCKFDHPMASPMGVY  413

Query  1146  TYNISPSSTTNAPTVR  1193
              Y  S S++TNAP  R
Sbjct  414   AYGFSASASTNAPMAR  429



>ref|XP_004971057.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Setaria italica]
Length=425

 Score =   439 bits (1130),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 247/415 (60%), Positives = 290/415 (70%), Gaps = 39/415 (9%)
 Frame = +3

Query  39    AAAGISASMA------SVTEGPSSLSPP----LAQETLWQ-LSLRSMETMESGTYPVRDG  185
             AA  +SA+ A      S T   +  S P    L  E +WQ +++ S  TM+ G YP R G
Sbjct  11    AAVTVSATSAPALPPPSATTAAADTSSPDPSALYGEGMWQQMAMNSGATMQPGPYPERPG  70

Query  186   EPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKF  365
             EPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMKGEYPERVGQPECQYYLKTG CKF
Sbjct  71    EPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMKGEYPERVGQPECQYYLKTGTCKF  130

Query  366   GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  545
             G TCKFHHPR+KAGIAGRV LN LGYPLRPN+ EC YY++TGQCK+ +TCKFHHP+  N 
Sbjct  131   GPTCKFHHPREKAGIAGRVQLNTLGYPLRPNEKECAYYLKTGQCKYANTCKFHHPELFNA  190

Query  546   MVPLRGSPAYPPVHSPTTPGQLSY-------PLSRASFITNPRWQGPSSYTPLIVPQGVV  704
             +   RGSP YP VHS  + G  SY          RAS+I +PRWQ PS+Y P+IVPQG+V
Sbjct  191   VPSSRGSPIYPSVHSSASAGPQSYTGTMASWAFPRASYIPSPRWQSPSNYAPMIVPQGLV  250

Query  705   SVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGY  881
              VP + +Y GQL S           G  Q YG S+  E  + G+QGM   YR+ + P+  
Sbjct  251   QVPSWNSYPGQLQS----------PGAQQTYGTSQQGE-PSAGNQGMLSPYRSSSFPVPQ  299

Query  882   YALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPG  1061
             YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFHHPR R +PPPD +LSP+GLP+RPG
Sbjct  300   YALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPIRPG  359

Query  1062  EPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNI-----SPSSTTNAPTVRHF  1199
             E LC FYSRYGICKFG +CKFDH    PMGV+ Y         S++TN P  R  
Sbjct  360   EELCKFYSRYGICKFGANCKFDHPMTAPMGVYAYGFSASASPASASTNVPMARRL  414


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 97/212 (46%), Gaps = 27/212 (13%)
 Frame = +3

Query  534   PSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVP  713
             P+ + V    +PA PP  + T     S P   A +       G   +  + +  G    P
Sbjct  10    PAAVTVSATSAPALPPPSATTAAADTSSPDPSALY-------GEGMWQQMAMNSGATMQP  62

Query  714   GFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQ  893
             G  Y  + G    P+           +G+S          +  +P  R     +   + +
Sbjct  63    G-PYPERPG---EPDCTYYLRTGLCRFGMS---------CRFNHPPDRN----LAIASAR  105

Query  894   RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLC  1073
              +  +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLRP E  C
Sbjct  106   MKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPNEKEC  165

Query  1074  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  1169
             A+Y + G CK+  +CKF HP     +N  PSS
Sbjct  166   AYYLKTGQCKYANTCKFHHPE---LFNAVPSS  194



>emb|CDY53749.1| BnaAnng12770D [Brassica napus]
Length=374

 Score =   436 bits (1120),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 237/386 (61%), Positives = 276/386 (72%), Gaps = 54/386 (14%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  203
             MDF A   +S           SLSP +  QE +WQ++L S ETME+G+YP R GEPDCSY
Sbjct  1     MDFNAGVPMS-----------SLSPLMINQEAMWQMNLSSDETMETGSYPERPGEPDCSY  49

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50    YIRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKF  109

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  554
             HHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  110   HHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  169

Query  555   LRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQ  734
               G              Q SYP SRASFI +PRWQ PS +TPL++PQGVV  P   YSGQ
Sbjct  170   TSGQ-------------QQSYPWSRASFIASPRWQDPSGFTPLMMPQGVVWNP---YSGQ  213

Query  735   LGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPE  914
             LGSVS         G    +   R+ +    GS  + PS               ENVFPE
Sbjct  214   LGSVSP-------SGTGNEHNNYRNMQQNESGS-SVQPS---------------ENVFPE  250

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD LLSPIGLPLRPGEP+C FYSRYG
Sbjct  251   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYSRYG  310

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSST  1172
             ICKFGPSCKF+HPM VF Y+ + S T
Sbjct  311   ICKFGPSCKFNHPMEVFAYDNTASET  336



>ref|XP_009118604.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=374

 Score =   435 bits (1119),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 236/386 (61%), Positives = 276/386 (72%), Gaps = 54/386 (14%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  203
             MDF A   +S           SLSP L  QE +WQ++L S ETME+G+YP R GEPDCSY
Sbjct  1     MDFNAGVPMS-----------SLSPLLINQEAMWQMNLSSDETMETGSYPERPGEPDCSY  49

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50    YIRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKF  109

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  554
             HHPR+KAG+AGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  110   HHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  169

Query  555   LRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQ  734
               G              Q SYP SRASFI +PRWQ PS +TPL++PQGVV  P   YSGQ
Sbjct  170   TSGQ-------------QQSYPWSRASFIASPRWQDPSGFTPLMMPQGVVWNP---YSGQ  213

Query  735   LGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPE  914
             LGSVS         G    +   R+ +    GS  + PS               ENVFPE
Sbjct  214   LGSVSP-------SGTGNEHNNYRNMQQNESGS-SVQPS---------------ENVFPE  250

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD LLSPIGLPLRPGEP+C FYSRYG
Sbjct  251   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYSRYG  310

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSST  1172
             ICKFGPSCKF+HPM +F Y+ + S T
Sbjct  311   ICKFGPSCKFNHPMEIFAYDNTASET  336



>gb|ACN33948.1| unknown [Zea mays]
 gb|AFW84182.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=377

 Score =   436 bits (1120),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 233/376 (62%), Positives = 276/376 (73%), Gaps = 29/376 (8%)
 Frame = +3

Query  126   QLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEY  305
             ++++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMKGEY
Sbjct  2     KMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMKGEY  61

Query  306   PERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMR  485
             PERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPL PN+ EC YY++
Sbjct  62    PERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYLK  121

Query  486   TGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PLSRASFIT  644
             TGQCK+ +TCKFHHP+  N++   RGSP Y  VHS  + G  SY          RASFI 
Sbjct  122   TGQCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAGPQSYTGTMSSWTFPRASFIP  181

Query  645   NPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVA  821
             +PRWQ PS+Y P++VP G+V VP + +Y GQL S           G  Q YG S+  E A
Sbjct  182   SPRWQSPSNYAPMVVPHGLVQVPSWNSYPGQLQS----------PGAQQTYGSSQQGE-A  230

Query  822   NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRE  1001
             + G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+YMKTGDCKFGAVCKFHHPR 
Sbjct  231   SAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRV  290

Query  1002  RlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISPS  1166
             R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y  S S
Sbjct  291   RSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCKFDHPTMAAPMGVYAYGFSGS  350

Query  1167  -----STTNAPTVRHF  1199
                  ++TNAP  RH 
Sbjct  351   ASVAPASTNAPMTRHL  366



>emb|CDY67901.1| BnaCnng56860D [Brassica napus]
Length=374

 Score =   435 bits (1118),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 236/386 (61%), Positives = 276/386 (72%), Gaps = 54/386 (14%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  203
             MDF A   +S           SLSP +  QE +WQ++L S ETME+G+YP R GEPDCSY
Sbjct  1     MDFNAGVPMS-----------SLSPLMINQEAMWQMNLSSDETMETGSYPERPGEPDCSY  49

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50    YIRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKF  109

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  554
             HHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  110   HHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  169

Query  555   LRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQ  734
               G              Q SYP SRASFI +PRWQ PS +TPL++PQGVV  P   YSGQ
Sbjct  170   TSGQ-------------QQSYPWSRASFIASPRWQDPSGFTPLMMPQGVVWNP---YSGQ  213

Query  735   LGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPE  914
             LGSVS         G    +   R+ +    GS  + PS               ENVFPE
Sbjct  214   LGSVSP-------SGTGNEHNNYRNMQQNESGS-SVQPS---------------ENVFPE  250

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD LLSPIGLPLRPGEP+C FYSRYG
Sbjct  251   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYSRYG  310

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSST  1172
             ICKFGPSCKF+HPM +F Y+ + S T
Sbjct  311   ICKFGPSCKFNHPMEIFAYDNTASET  336



>dbj|BAJ86320.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=442

 Score =   437 bits (1124),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 234/371 (63%), Positives = 277/371 (75%), Gaps = 13/371 (4%)
 Frame = +3

Query  114   ETLWQLSLR-SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             E  WQ++L     +ME G YP R GE DCSYY+RTG CRFG +C+FNHP++RKLA+AAAR
Sbjct  32    EATWQMTLGCGGLSMEPGPYPERIGERDCSYYMRTGFCRFGVTCKFNHPADRKLAVAAAR  91

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             MKGEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA IA    LNVLGYPLR N+ EC
Sbjct  92    MKGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIAISAQLNVLGYPLRLNEKEC  151

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PLSR  629
              YY+RTGQCKF STCKFHHPQPS+ MV +R S    P  S T+PGQ +Y        LSR
Sbjct  152   VYYLRTGQCKFASTCKFHHPQPSSTMVAIRSS-ICSPGQSTTSPGQNTYSGAVTNWSLSR  210

Query  630   -ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLS  803
              ASFI +PRW GPS Y  +IVPQG+V VPG+  Y+ Q+GS SS + QQ T G +  YG +
Sbjct  211   SASFIASPRWPGPSGYEQVIVPQGLVQVPGWNPYAAQMGS-SSLDGQQRTPGTAHYYG-T  268

Query  804   RSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCK  983
                E   +G  GM  S++AG+ P+G YA+Q EN FPERP QPECQFYMKTGDCKFGAVCK
Sbjct  269   HQRETTGMGEHGMFTSHKAGSAPLGVYAVQGENTFPERPEQPECQFYMKTGDCKFGAVCK  328

Query  984   FHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  1163
             F+HP++R++P P+  LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y    
Sbjct  329   FNHPKKRMVPAPNCALSPLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTILYGSPT  388

Query  1164  SSTTNAPTVRH  1196
             S T + P + +
Sbjct  389   SPTGDVPPLHY  399



>emb|CDX74233.1| BnaA03g28140D [Brassica napus]
Length=365

 Score =   433 bits (1113),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 230/359 (64%), Positives = 267/359 (74%), Gaps = 35/359 (10%)
 Frame = +3

Query  105   LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  284
             + QE +WQ+++ S ETME G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA 
Sbjct  2     INQEAMWQMNMTSDETMEPGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIAT  61

Query  285   ARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
             ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFHHPR+KAGIAG V+LN+LGYPLR N++
Sbjct  62    ARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEV  121

Query  465   ECPYYMRTGQCKFGSTCKFHHPQP---SNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRAS  635
             +C Y++RTG CKFG+TCKF+HPQP   +N+MVP  G              Q SYP SRAS
Sbjct  122   DCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQ-------------QQSYPWSRAS  168

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSE  815
             FI  PRWQ PS +TPL++PQGVV  P   Y+GQLGSVS       T  +   Y   + +E
Sbjct  169   FIPTPRWQDPSGFTPLMMPQGVVWNP---YTGQLGSVSP----SGTGNDHNNYRELQQNE  221

Query  816   VANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHP  995
               +   QG            G YAL  E+VFPERPGQPECQFYMKTGDCKFG VCKFHHP
Sbjct  222   SGSSVPQG------------GIYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHP  269

Query  996   RERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             R+R  PPPD LLSPIGLPLRPGEPLC FYSRY ICKFGPSCKF HPMGVFTY+ + S T
Sbjct  270   RDRQTPPPDCLLSPIGLPLRPGEPLCVFYSRYRICKFGPSCKFHHPMGVFTYDNTASET  328



>ref|XP_011077188.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Sesamum indicum]
Length=327

 Score =   431 bits (1108),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 215/300 (72%), Positives = 240/300 (80%), Gaps = 13/300 (4%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             Q+ L Q+++R ME MESG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NR LAIA AR
Sbjct  18    QDALLQMNMRPMEQMESGPYPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATAR  77

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             MK EYPER+GQPECQYYLKTG CKFGATCKFHHPRD+ GIAGRVALNVLGYPLRPN+I C
Sbjct  78    MKSEYPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINC  137

Query  471   PYYMRTGQCKFGSTCKFHHPQPS-NMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITN  647
              YY+R G CKFG TCKFHHPQPS NMMVPLR S  +PP+ SPTT GQLS+   RA  + N
Sbjct  138   AYYIRNGLCKFGRTCKFHHPQPSNNMMVPLRDSALHPPIQSPTT-GQLSF--HRAHLLPN  194

Query  648   PRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVAN  824
             P+WQ PSSY PL + QGV S PG+  YSGQ+  VS  E+QQ   GN Q  G S   E  N
Sbjct  195   PQWQTPSSYAPLFMSQGVASAPGWNTYSGQVEPVSPSENQQ---GNIQNDGTSYQVEGLN  251

Query  825   VGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRER  1004
             VGSQ     + + TLP+GYYA +R+NVFPERPGQP+CQFYMKTGDCKFGAVCKFHHPRER
Sbjct  252   VGSQ-----FGSNTLPIGYYAFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRER  306


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             +PER GQPECQ+Y+KTG CKFGA CKFHHPR+ L       L+ +G PLRP E  CA+Y 
Sbjct  82    YPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCAYYI  141

Query  1086  RYGICKFGPSCKFDHP  1133
             R G+CKFG +CKF HP
Sbjct  142   RNGLCKFGRTCKFHHP  157


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  282  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  455
            A +    +PER GQP+CQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP
Sbjct  267  AFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPLRP  324



>gb|ACN40302.1| unknown [Picea sitchensis]
Length=468

 Score =   432 bits (1112),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/364 (61%), Positives = 270/364 (74%), Gaps = 19/364 (5%)
 Frame = +3

Query  105   LAQETLWQLSLRSM-ETMES--GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  275
             + +E +WQ+SL+   E ME+  G +P R GEPDC+YY+RTGLC FG SCRFNHP NRK A
Sbjct  36    VVEEAMWQMSLQQQHENMEAEVGPFPERPGEPDCTYYMRTGLCGFGMSCRFNHPPNRKQA  95

Query  276   IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  455
              AAAR KGEYPER+GQPECQYYLKTG+CKFGATCKFHHPRDKAG  GR  +NV GYPLRP
Sbjct  96    AAAARNKGEYPERLGQPECQYYLKTGSCKFGATCKFHHPRDKAGSTGRAVINVYGYPLRP  155

Query  456   NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY------  617
             N+ EC YYMRTGQCK+G+TCKFHHPQP + +VP+RGS  + PVHSPTTPG   Y      
Sbjct  156   NEKECAYYMRTGQCKYGATCKFHHPQPVSTLVPVRGSSLFTPVHSPTTPGPQPYPGSLPT  215

Query  618   -PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAY--SGQLGSVSSPESQQLTVGNSQ  788
              P+ RA FI +PRWQGPSSY PLI+PQG++ VP ++    GQ+GS+SS + QQ  +G   
Sbjct  216   WPMQRAPFIQSPRWQGPSSYAPLILPQGIMPVPSWSTYPPGQVGSISSSDGQQQAMGAGL  275

Query  789   AYGLSRSSEVANVGSQGMNPSY-------RAGTLPMGYYALQRENVFPERPGQPECQFYM  947
              YG S  ++    G QG    +          TL +   + QRE++FPERPGQ ECQFYM
Sbjct  276   VYGPSSQTDPMASGIQGTLSHFPPGSPGMGPPTLQLPSSSAQRESMFPERPGQQECQFYM  335

Query  948   KTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFD  1127
             KTGDCKFG  C++HHP+ER+IP P+ +L+ +GLPLRPG P C F++RYGICKFG +CKFD
Sbjct  336   KTGDCKFGMTCRYHHPKERIIPVPNCVLNSLGLPLRPGAPACTFFTRYGICKFGATCKFD  395

Query  1128  HPMG  1139
             HPMG
Sbjct  396   HPMG  399



>ref|XP_009392482.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=362

 Score =   426 bits (1096),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 259/317 (82%), Gaps = 12/317 (4%)
 Frame = +3

Query  273   AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  452
             AIAAAR++G YPERVGQPECQYYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLR
Sbjct  3     AIAAARIRGGYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLR  62

Query  453   PNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP----  620
             PN+ EC YY+RTG+CKFGSTCK+HHPQPSN ++ LRGSP YP  HSPTTPGQ SYP    
Sbjct  63    PNEQECAYYIRTGECKFGSTCKYHHPQPSNTILALRGSPIYPSAHSPTTPGQQSYPAGMT  122

Query  621   ---LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQ  788
                L R+S+I++PRWQ  SSY  LI+PQGVV VPG+ +YSGQLG  SSP SQQ T G +Q
Sbjct  123   NWTLPRSSYISSPRWQASSSYAQLILPQGVVQVPGWTSYSGQLG--SSPGSQQ-TAGVAQ  179

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              Y  S+  E  N+G+QG   SYR G++ MG YA+ REN+FPERPGQPECQFYMKTGDCKF
Sbjct  180   FYSPSQQGET-NIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKF  238

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFT  1148
             GAVC+FHHPRERLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG  T
Sbjct  239   GAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVT  298

Query  1149  YNISPSSTTNAPTVRHF  1199
             Y +S SS  + PTV+H 
Sbjct  299   YGLSESSMADVPTVQHL  315


 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  RTGLCRFGASCRFN--HPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
            + G    GA  +F+   P +  + + A   +  +PER GQPECQ+Y+KTG CKFGA C+F
Sbjct  185  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRF  244

Query  384  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  530
            HHPR++        LN LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  245  HHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  293


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +3

Query  168  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  344
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  218  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYS  277

Query  345  KTGACKFGATCKFHHP  392
            + G CKFG  CKF HP
Sbjct  278  RYGICKFGPNCKFDHP  293



>ref|XP_009392481.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=371

 Score =   426 bits (1096),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 259/317 (82%), Gaps = 12/317 (4%)
 Frame = +3

Query  273   AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  452
             AIAAAR++G YPERVGQPECQYYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLR
Sbjct  12    AIAAARIRGGYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLR  71

Query  453   PNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP----  620
             PN+ EC YY+RTG+CKFGSTCK+HHPQPSN ++ LRGSP YP  HSPTTPGQ SYP    
Sbjct  72    PNEQECAYYIRTGECKFGSTCKYHHPQPSNTILALRGSPIYPSAHSPTTPGQQSYPAGMT  131

Query  621   ---LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQ  788
                L R+S+I++PRWQ  SSY  LI+PQGVV VPG+ +YSGQLG  SSP SQQ T G +Q
Sbjct  132   NWTLPRSSYISSPRWQASSSYAQLILPQGVVQVPGWTSYSGQLG--SSPGSQQ-TAGVAQ  188

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              Y  S+  E  N+G+QG   SYR G++ MG YA+ REN+FPERPGQPECQFYMKTGDCKF
Sbjct  189   FYSPSQQGET-NIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKF  247

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFT  1148
             GAVC+FHHPRERLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG  T
Sbjct  248   GAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVT  307

Query  1149  YNISPSSTTNAPTVRHF  1199
             Y +S SS  + PTV+H 
Sbjct  308   YGLSESSMADVPTVQHL  324


 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  RTGLCRFGASCRFN--HPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
            + G    GA  +F+   P +  + + A   +  +PER GQPECQ+Y+KTG CKFGA C+F
Sbjct  194  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRF  253

Query  384  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  530
            HHPR++        LN LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  254  HHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHP  302


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +3

Query  168  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  344
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  227  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYS  286

Query  345  KTGACKFGATCKFHHP  392
            + G CKFG  CKF HP
Sbjct  287  RYGICKFGPNCKFDHP  302



>ref|XP_009118612.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=372

 Score =   426 bits (1095),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 234/386 (61%), Positives = 274/386 (71%), Gaps = 56/386 (15%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  203
             MDF A   +S           SLSP L  QE +WQ++L S ETME+G+YP R GEPDCSY
Sbjct  1     MDFNAGVPMS-----------SLSPLLINQEAMWQMNLSSDETMETGSYPERPGEPDCSY  49

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCRFG++CRFNHP +R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50    YIRTGLCRFGSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKF  109

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  554
             HHPR+KAG+AGRV+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  110   HHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  169

Query  555   LRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQ  734
               G              Q SYP SRASFI +PRWQ PS +TPL++PQGVV  P   YS  
Sbjct  170   TSGQ-------------QQSYPWSRASFIASPRWQDPSGFTPLMMPQGVVWNP---YS--  211

Query  735   LGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPE  914
             LGSVS         G    +   R+ +    GS  + PS               ENVFPE
Sbjct  212   LGSVSP-------SGTGNEHNNYRNMQQNESGS-SVQPS---------------ENVFPE  248

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD LLSPIGLPLRPGEP+C FYSRYG
Sbjct  249   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYSRYG  308

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSST  1172
             ICKFGPSCKF+HPM +F Y+ + S T
Sbjct  309   ICKFGPSCKFNHPMEIFAYDNTASET  334



>ref|XP_009134712.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=379

 Score =   426 bits (1095),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 238/386 (62%), Positives = 275/386 (71%), Gaps = 48/386 (12%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  203
             MDF A   +S           SLSP +  QE +WQ++L S ETME G+YP R GEPDCSY
Sbjct  1     MDFNAGVPMS-----------SLSPLMINQEAMWQMNLSSDETMELGSYPERPGEPDCSY  49

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCRFG++CRFNHP +R+L IA A M+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50    YIRTGLCRFGSTCRFNHPRDRELVIATA-MRGEYPERIGQPECEYYLKTGTCKFGVTCKF  108

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  554
             HHPR+KAGIAG V+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  109   HHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  168

Query  555   LRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQ  734
               G              Q SYP SRASFI  PRWQ PS +TPL++PQGVV  P   Y+GQ
Sbjct  169   TSGQ-------------QQSYPWSRASFIPTPRWQDPSGFTPLMMPQGVVWNP---YTGQ  212

Query  735   LGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPE  914
             LGSVS       T  +   Y   + +E  +   QG            G YAL  E+VFPE
Sbjct  213   LGSVSP----SGTGNDHNNYRELQQNESGSSVPQG------------GIYALPSESVFPE  256

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLSPIGLPLRPGEPLC FYSRY 
Sbjct  257   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPLCVFYSRYR  316

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSST  1172
             ICKFGPSCKF  PMGVFTY+ + S T
Sbjct  317   ICKFGPSCKFHPPMGVFTYDNTASET  342



>ref|NP_001132883.1| uncharacterized protein LOC100194377 [Zea mays]
 gb|ACF81912.1| unknown [Zea mays]
Length=430

 Score =   428 bits (1100),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 227/355 (64%), Positives = 268/355 (75%), Gaps = 20/355 (6%)
 Frame = +3

Query  105   LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  281
             L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA
Sbjct  48    LYEEGMWQQMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIA  107

Query  282   AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
             +ARMKGEYPER GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRPN+
Sbjct  108   SARMKGEYPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNE  167

Query  462   IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------P  620
              EC YY++TG CK+ +TCKFHHP+  N++   RGSP Y  VHS  + G  SY        
Sbjct  168   KECAYYLKTGHCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAGPQSYTGTMPSWA  227

Query  621   LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYG  797
               RASFI +PRWQ PS+Y P+IVPQG+V +P + +Y+GQL S           G  Q YG
Sbjct  228   FPRASFIPSPRWQSPSNYAPMIVPQGLVQMPSWNSYTGQLQS----------PGAQQTYG  277

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
              S+  E A+ G+QGM   YR+ + P+  YALQRENVFPERP +PECQ+YMKTGDCKFGAV
Sbjct  278   SSQQGE-ASTGNQGMLSPYRSSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAV  336

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  1142
             CKFHHPR R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDHP  V
Sbjct  337   CKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCKFDHPTVV  391



>ref|XP_009416576.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=368

 Score =   426 bits (1094),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 221/312 (71%), Positives = 254/312 (81%), Gaps = 12/312 (4%)
 Frame = +3

Query  288   RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
             R++G YPERVGQPECQYYLKTG CKFGA CKFHHP++KAGIAGRV LN+LGYPLR N+ +
Sbjct  13    RIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKD  72

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-------LS  626
             C YY+RTG+CKFG TCKFHHPQPSN +V LRGSP YP VHSPTTPGQ +YP       LS
Sbjct  73    CAYYIRTGECKFGGTCKFHHPQPSNAVVALRGSPVYPAVHSPTTPGQQTYPAEMTNWTLS  132

Query  627   RASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLS  803
             R+SFI +PRWQ  SSY  LI+PQGVV VPG+ +YSGQLG  SSPESQ+ T G +Q YG S
Sbjct  133   RSSFIPSPRWQASSSYAQLILPQGVVQVPGWTSYSGQLG--SSPESQR-TTGTAQFYGPS  189

Query  804   RSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCK  983
             +  E + +G+QG  PSYR G+ PMG YA+  EN+FPERPGQPECQFYMKTGDCKFGAVCK
Sbjct  190   QQGETS-IGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCK  248

Query  984   FHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  1163
             FHHP+ERL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG F Y +S 
Sbjct  249   FHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHPMGTFAYGVSA  308

Query  1164  SSTTNAPTVRHF  1199
             SS T  PT  H 
Sbjct  309   SSATGVPTAWHL  320


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = +3

Query  210  RTGLCRFGASCRF--NHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
            + G    GA  +F    P +  + + A   +  +PER GQPECQ+Y+KTG CKFGA CKF
Sbjct  190  QQGETSIGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKF  249

Query  384  HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  530
            HHP+++        L+ LG PLRP +  C +Y R G CKFG  CKF HP
Sbjct  250  HHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHP  298


 Score = 77.0 bits (188),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  168  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  344
            +P R G+P+C +Y++TG C+FGA C+F+HP  R + +    +     P R G+P C +Y 
Sbjct  223  FPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYS  282

Query  345  KTGACKFGATCKFHHP  392
            + G CKFG  CKF HP
Sbjct  283  RYGICKFGPNCKFDHP  298



>emb|CDX92015.1| BnaC03g33170D [Brassica napus]
Length=371

 Score =   425 bits (1093),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 231/366 (63%), Positives = 270/366 (74%), Gaps = 37/366 (10%)
 Frame = +3

Query  87    SSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  263
             SSLSP +  QE +WQ+++ S ETME G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +
Sbjct  2     SSLSPLMINQEAMWQMNMTSDETMEPGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRD  61

Query  264   RKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGY  443
             R+L IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGY
Sbjct  62    RELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGY  121

Query  444   PLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVPLRGSPAYPPVHSPTTPGQLS  614
             PLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP  G              Q S
Sbjct  122   PLR-NEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQ-------------QQS  167

Query  615   YPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAY  794
             YP SRASFI  PRWQ  S +T L++PQGV+  P   Y+ QLGSVS       T  +   Y
Sbjct  168   YPWSRASFIPTPRWQDTSGFTALMMPQGVIWNP---YTSQLGSVSP----SGTGNDHNNY  220

Query  795   GLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGA  974
                + +E  +   QG            G YAL  E+VFPERPGQPECQFY+KTGDCKFG 
Sbjct  221   RKLQQNESGSSVPQG------------GIYALPSESVFPERPGQPECQFYVKTGDCKFGT  268

Query  975   VCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYN  1154
             VCKFHHPR+R  PPPD LLSPIGLPLRPGEP C FYSRYGICKFGPSCKF HPMGVFTY+
Sbjct  269   VCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPSCVFYSRYGICKFGPSCKFHHPMGVFTYD  328

Query  1155  ISPSST  1172
              + S T
Sbjct  329   NTASET  334



>emb|CBI17647.3| unnamed protein product [Vitis vinifera]
Length=304

 Score =   420 bits (1079),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 225/329 (68%), Positives = 252/329 (77%), Gaps = 38/329 (12%)
 Frame = +3

Query  333   QYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  512
              YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRP++I+C YY+RTGQCKFGST
Sbjct  13    HYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPDEIDCAYYLRTGQCKFGST  72

Query  513   CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVP  692
             CKFHHPQPS+MMV LRG                ++PLSRASFI +PRWQ PSSY PL++P
Sbjct  73    CKFHHPQPSSMMVSLRGI--------------TNWPLSRASFIPSPRWQAPSSYAPLMLP  118

Query  693   QGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTL  869
             QGVVSVPG+ AYSGQLGS S  ESQQ T GN+Q YG SR SE  N GSQG    YR+G++
Sbjct  119   QGVVSVPGWNAYSGQLGSPS--ESQQQTGGNNQIYGTSRQSEQPNTGSQGTFSPYRSGSV  176

Query  870   PMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglp  1049
             P+G+YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLP
Sbjct  177   PIGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLP  236

Query  1050  lRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtl  1229
             LRPGEPLC FYSRYGICKFGPSCKFDHPMG+F YN+S SS+ +AP VR            
Sbjct  237   LRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFAYNLSASSSADAPVVRRL----------  286

Query  1230  tlssEGAC*GKFHGAQVTVILKSETDAIW  1316
                         H AQ T   + +TDA W
Sbjct  287   -----------LHKAQATFTARDKTDASW  304


 Score =   100 bits (249),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +3

Query  270  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  449
            +   A + +  +PER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PL
Sbjct  178  IGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPL  237

Query  450  RPNDIECPYYMRTGQCKFGSTCKFHHP  530
            RP +  C +Y R G CKFG +CKF HP
Sbjct  238  RPGEPLCIFYSRYGICKFGPSCKFDHP  264


 Score = 76.6 bits (187),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query  165  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  341
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y
Sbjct  188  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPLRPGEPLCIFY  247

Query  342  LKTGACKFGATCKFHHP  392
             + G CKFG +CKF HP
Sbjct  248  SRYGICKFGPSCKFDHP  264



>tpg|DAA56151.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=430

 Score =   424 bits (1089),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 226/355 (64%), Positives = 266/355 (75%), Gaps = 20/355 (6%)
 Frame = +3

Query  105   LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  281
             L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA
Sbjct  48    LYEEGMWQQMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIA  107

Query  282   AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
             +ARMKGEYPER GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRPN+
Sbjct  108   SARMKGEYPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNE  167

Query  462   IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------P  620
              EC YY++TG CK+ +TCKFHHP+  N++   RGSP Y  VHS  + G  SY        
Sbjct  168   KECAYYLKTGHCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAGPQSYTGTMPSWA  227

Query  621   LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYG  797
               RASFI +PRWQ PS+Y P+IVPQG+V +  + +Y+GQL S           G  Q YG
Sbjct  228   FPRASFIPSPRWQSPSNYAPMIVPQGLVQMQSWNSYTGQLQS----------PGAQQTYG  277

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
              S+  E A+ G+QGM   YR  + P+  YALQRENVFPERP +PECQ+YMKTGDCKFGAV
Sbjct  278   SSQQGE-ASTGNQGMLSPYRPSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAV  336

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  1142
             CKFHHPR R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDHP  V
Sbjct  337   CKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCKFDHPTVV  391



>ref|XP_006400193.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
 gb|ESQ41646.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
Length=395

 Score =   418 bits (1075),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 222/350 (63%), Positives = 262/350 (75%), Gaps = 17/350 (5%)
 Frame = +3

Query  120   LWQLSLRSMETM--ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             +WQ++L S ETM  + G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +RKL IA  R+
Sbjct  1     MWQMNLGSDETMSGDDGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATERI  60

Query  294   KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECP  473
             KGE+PER+GQPEC++YLKTG CKFG TCKFHHPR+K   AGRV+ +VLGYPLRPN+ +C 
Sbjct  61    KGEFPERIGQPECEFYLKTGTCKFGVTCKFHHPRNK---AGRVSHSVLGYPLRPNEDDCS  117

Query  474   YYMRTGQCKFGSTCKFHHP--QPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITN  647
             Y++RTG CKFG TCKF+HP  Q +N+MV LRGSP Y  + SPT  GQ SY   R SF+ N
Sbjct  118   YFLRTGHCKFGGTCKFNHPQSQSTNLMVSLRGSPVYSALQSPT--GQQSYSWPRPSFVAN  175

Query  648   -PRWQGPSSYTPLIVPQ-GVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVA  821
              PRWQ PSS+  L++PQ GVVS  G+      GS+S   S Q    + Q+     S    
Sbjct  176   SPRWQDPSSFASLLLPQGGVVSAQGW---NTYGSLSPSGSDQAYRNHQQSDAKETSGSRG  232

Query  822   NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRE  1001
              + S G    +   ++P GYYAL RENVFPERPGQPEC+FYMKTGDCKFG VCKFHHPR+
Sbjct  233   GLFSSG---EHSGNSVPFGYYALPRENVFPERPGQPECEFYMKTGDCKFGTVCKFHHPRD  289

Query  1002  RlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTY  1151
             R  P PD LLSP+GLPLR GEPLC FYSRYGICKFGPSCKFDHPM +FTY
Sbjct  290   RQTPAPDCLLSPVGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMRIFTY  339



>ref|XP_004495537.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Cicer arietinum]
Length=389

 Score =   417 bits (1073),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 234/370 (63%), Positives = 270/370 (73%), Gaps = 56/370 (15%)
 Frame = +3

Query  111   QETLWQLSLRSMET-MESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  287
             + +LW + LRS +T M+S  YP R GEPDCSYYIRTGLCRFGA+CRFNHP N  LAI  A
Sbjct  17    EGSLWMMKLRSTQTFMDSQFYPHRPGEPDCSYYIRTGLCRFGATCRFNHPPNANLAIVTA  76

Query  288   RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
             RM GE+PER+GQPECQ+YLKTG CKFGATCKFHHPRD+AGI+GRVALN+LGYPLRP + E
Sbjct  77    RMIGEFPERIGQPECQFYLKTGTCKFGATCKFHHPRDQAGISGRVALNILGYPLRPTEAE  136

Query  468   CPYYMRTGQCKFGSTCKFHHPQPS-NMMVPLRGSPAY-PPVHSPT--TPGQLSYPLSRAS  635
             C YY+RTG+CKFG+TCKFHHPQPS NM +PL+GSP Y   VHSPT    G  ++P  RAS
Sbjct  137   CSYYLRTGECKFGNTCKFHHPQPSNNMTIPLKGSPIYLSTVHSPTPQVRGFANWP--RAS  194

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
             +       GPSSYTPL++PQGV+SVPG+ AYSGQ+GSV S                    
Sbjct  195   Y-------GPSSYTPLVMPQGVISVPGWSAYSGQMGSVIS--------------------  227

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
                                P G   LQREN+FP+RPGQPECQFYMKTGDCKFGAVC+FHH
Sbjct  228   ------------------TPPG-SPLQRENIFPDRPGQPECQFYMKTGDCKFGAVCRFHH  268

Query  993   PRERlipppds-llspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  1169
             P +RLIP P   LLS +GLPLR GEPLC FYSRYGICKFGPSCKFDHPMG+F+YN+S S 
Sbjct  269   PHQRLIPVPPDCLLSSLGLPLRHGEPLCVFYSRYGICKFGPSCKFDHPMGIFSYNLSASP  328

Query  1170  TTNAPTVRHF  1199
               ++ T RH 
Sbjct  329   LADS-TGRHL  337



>ref|XP_009134713.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=377

 Score =   417 bits (1072),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 236/386 (61%), Positives = 273/386 (71%), Gaps = 50/386 (13%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLA-QETLWQLSLRSMETMESGTYPVRDGEPDCSY  203
             MDF A   +S           SLSP +  QE +WQ++L S ETME G+YP R GEPDCSY
Sbjct  1     MDFNAGVPMS-----------SLSPLMINQEAMWQMNLSSDETMELGSYPERPGEPDCSY  49

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCRFG++CRFNHP +R+L IA A M+GEYPER+GQPEC+YYLKTG CKFG TCKF
Sbjct  50    YIRTGLCRFGSTCRFNHPRDRELVIATA-MRGEYPERIGQPECEYYLKTGTCKFGVTCKF  108

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP---SNMMVP  554
             HHPR+KAGIAG V+LN+LGYPLR N+++C Y++RTG CKFG+TCKF+HPQP   +N+MVP
Sbjct  109   HHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVP  168

Query  555   LRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQ  734
               G              Q SYP SRASFI  PRWQ PS +TPL++PQGVV  P   Y+  
Sbjct  169   TSGQ-------------QQSYPWSRASFIPTPRWQDPSGFTPLMMPQGVVWNP---YT--  210

Query  735   LGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPE  914
             LGSVS       T  +   Y   + +E  +   QG            G YAL  E+VFPE
Sbjct  211   LGSVSP----SGTGNDHNNYRELQQNESGSSVPQG------------GIYALPSESVFPE  254

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLSPIGLPLRPGEPLC FYSRY 
Sbjct  255   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPLCVFYSRYR  314

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSST  1172
             ICKFGPSCKF  PMGVFTY+ + S T
Sbjct  315   ICKFGPSCKFHPPMGVFTYDNTASET  340



>ref|XP_010453818.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 57-like [Camelina sativa]
Length=420

 Score =   418 bits (1074),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 230/387 (59%), Positives = 277/387 (72%), Gaps = 33/387 (9%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETME--SGTYPVRDGEPDCS  200
             MDF+       S   +T   +SLSP L Q T+WQ+++ S E M    G YP R GEPDCS
Sbjct  1     MDFD-------SRVPITRESTSLSPLLHQNTMWQMNMGSDEIMSGSDGFYPERQGEPDCS  53

Query  201   YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  380
             YYIRTGLCRFG++CRFNHP +RKL IA A  KGEYPER+GQPEC++Y+KTG CKFG TCK
Sbjct  54    YYIRTGLCRFGSTCRFNHPHDRKLVIATAMTKGEYPERIGQPECEFYMKTGTCKFGVTCK  113

Query  381   FHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVP  554
             FHHP +KAGI GRV++NVLGYPLRPN+ +C Y++RTG CKFG TCKF+HP  Q + +MV 
Sbjct  114   FHHPSNKAGIDGRVSINVLGYPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTKLMVS  173

Query  555   LRGSPAYPPVHSPTTPGQLSYPLSRASFI-TNPRWQGPSSYTPLIVPQ-GVVSVPGF-AY  725
             +RGSP Y  + S T  GQ SY   R S + T PR+Q PSS   L++PQ GVVSV G+ +Y
Sbjct  174   VRGSPVYSALQSFT--GQQSYSWPRTSCVATPPRFQDPSSIASLVLPQGGVVSVQGWNSY  231

Query  726   SGQLGSVSSPESQQLTVGNSQAYGLSRSSEV-ANVGSQG--MNPSYRAGT-LPMGYYALQ  893
              GQLGS+       L  G+ Q Y   + ++   + GSQG   +  + +G+ +P+G YA  
Sbjct  232   GGQLGSL-------LPXGSDQNYRNQQQNDAEESSGSQGGLFSSEFHSGSYVPLGLYA--  282

Query  894   RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLC  1073
                 FPERPGQ ECQFYMKTGDCKFG VCKFHHPR+R  P PD +LS +GLPLR GEPLC
Sbjct  283   ----FPERPGQLECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLC  338

Query  1074  AFYSRYGICKFGPSCKFDHPMGVFTYN  1154
              FYSRYGICKFGPSCKFDHPMGV TYN
Sbjct  339   VFYSRYGICKFGPSCKFDHPMGVLTYN  365



>ref|XP_006287837.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
 gb|EOA20735.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
Length=418

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 231/380 (61%), Positives = 267/380 (70%), Gaps = 22/380 (6%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETME-SGTYPVRDGEPDCSY  203
             MDF++   IS    S       LSP L Q  +WQ +L S ETM   G YP R GEPDCSY
Sbjct  1     MDFDSRVPISRESIS-------LSPLLHQNAMWQTNLGSDETMGGDGLYPERPGEPDCSY  53

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCRFG++CRFNHP +RKL IA AR KGEYPER+GQPEC++Y+KTG CKFG TCKF
Sbjct  54    YIRTGLCRFGSTCRFNHPYDRKLVIATARTKGEYPERIGQPECEFYIKTGTCKFGVTCKF  113

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVPL  557
             HHPR+KAGI  RV++NVLGYPLRPN+ +C Y++RTG CKFG +CKF+HP  Q + +MV L
Sbjct  114   HHPRNKAGIDERVSVNVLGYPLRPNEDDCSYFLRTGHCKFGGSCKFNHPQTQSTKLMVSL  173

Query  558   RGSPAYPPVHSPTTPGQLSYPLSRASFITN-PRWQGPSSYTPLIVPQGVVSVPGF-AYSG  731
             R SP Y  + S T  GQ SY   R S++ N PR+Q P SY  L    G+VSV G+ AY G
Sbjct  174   R-SPVYSALQSLT--GQQSYSWPRTSYVANPPRFQDP-SYASL---GGLVSVQGWNAYGG  226

Query  732   QLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFP  911
             QLGS+S   S Q      Q      S     V S G    +   ++P+G YAL  ENVFP
Sbjct  227   QLGSLSPSGSDQDYRNQQQNDAEESSGSQGGVFSSGF---HSGNSVPLGQYALPSENVFP  283

Query  912   ERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRY  1091
             ERPGQ EC+FYMKTGDCKFG VCKFHHPR R  P PD +LS +GLPLRPGEPLC FYSRY
Sbjct  284   ERPGQLECEFYMKTGDCKFGTVCKFHHPRNRQTPAPDCVLSTVGLPLRPGEPLCVFYSRY  343

Query  1092  GICKFGPSCKFDHPMGVFTY  1151
             GICKFGPSCKFDHPM VFTY
Sbjct  344   GICKFGPSCKFDHPMRVFTY  363



>ref|XP_008672228.1| PREDICTED: uncharacterized protein LOC100194377 isoform X1 [Zea 
mays]
Length=410

 Score =   414 bits (1065),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 212/355 (60%), Positives = 249/355 (70%), Gaps = 40/355 (11%)
 Frame = +3

Query  105   LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  281
             L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA
Sbjct  48    LYEEGMWQQMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIA  107

Query  282   AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
             +ARMKGEYPER GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRPN+
Sbjct  108   SARMKGEYPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNE  167

Query  462   IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------P  620
              EC YY++TG CK+ +TCKFHHP+  N++   RGSP Y  VHS  + G  SY        
Sbjct  168   KECAYYLKTGHCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAGPQSYTGTMPSWA  227

Query  621   LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYG  797
               RASFI +PRWQ PS+Y P+IVPQG+V +  + +Y+GQL S           G  Q YG
Sbjct  228   FPRASFIPSPRWQSPSNYAPMIVPQGLVQMQSWNSYTGQLQS----------PGAQQTYG  277

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
              S+  E A+ G+QGM   YR  + P+  YALQRENVFPERP +PECQ+YMKTGDCKFGAV
Sbjct  278   SSQQGE-ASTGNQGMLSPYRPSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAV  336

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  1142
             CKFHHPR                    GE LC FYSRYGICKFG +CKFDHP  V
Sbjct  337   CKFHHPR--------------------GEELCKFYSRYGICKFGANCKFDHPTVV  371



>gb|KHG30243.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=347

 Score =   410 bits (1054),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 217/295 (74%), Positives = 244/295 (83%), Gaps = 10/295 (3%)
 Frame = +3

Query  333   QYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  512
             +YYLKTG CKFGATCKFHHPR++AGIAGRV+LN+LGYP RPN+ EC YY+RTGQCKFGST
Sbjct  10    RYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNETECAYYLRTGQCKFGST  69

Query  513   CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYT  677
             CKFHHPQP+NMM+ LRGSP YP V SPTTPGQ SYP      SRASFI +PRWQGPSSY 
Sbjct  70    CKFHHPQPTNMMISLRGSPIYPTVASPTTPGQQSYPGGITNWSRASFIPSPRWQGPSSYA  129

Query  678   PLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSY  854
             PLI+PQG+VSVPG+ AYS    SVSS E+ Q T GN+Q YG S  +E    GSQ     +
Sbjct  130   PLILPQGMVSVPGWNAYS---ASVSSSENLQQTNGNNQIYGTSNQNESVTGGSQASFSQF  186

Query  855   RAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdslls  1034
             R+G++P+G+YAL RENVFPERPGQPECQFYMKTGDCKFGAVC+FHHPRER+ P PD LLS
Sbjct  187   RSGSVPIGFYALPRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLS  246

Query  1035  piglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             PIGLPLRPGEPLC FYSRYGICKFG SCKF+HPMG+FTYN S SS + AP V HF
Sbjct  247   PIGLPLRPGEPLCDFYSRYGICKFGSSCKFNHPMGIFTYNYSISSPSGAP-VHHF  300


 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +3

Query  303  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  482
            +PER GQPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y 
Sbjct  204  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFYS  263

Query  483  RTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  587
            R G CKFGS+CKF+HP           SP+  PVH
Sbjct  264  RYGICKFGSSCKFNHPMGIFTYNYSISSPSGAPVH  298


 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  165  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK-GEYPERVGQPECQYY  341
             +P R G+P+C +Y++TG C+FGA CRF+HP  R        +     P R G+P C +Y
Sbjct  203  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFY  262

Query  342  LKTGACKFGATCKFHHP  392
             + G CKFG++CKF+HP
Sbjct  263  SRYGICKFGSSCKFNHP  279



>ref|NP_851041.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 sp|Q8L7N8.2|C3H57_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 57; 
Short=AtC3H57; AltName: Full=Zinc finger type domain-containing 
protein ZFN3 [Arabidopsis thaliana]
 gb|AED92308.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=375

 Score =   409 bits (1051),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 263/385 (68%), Gaps = 62/385 (16%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETM-ESGTYPVRDGEPDCSY  203
             MDF+          S++   + LSP L Q  +WQ++L S +TM   G+YP R GEPDC+Y
Sbjct  1     MDFD----------SISRESTFLSPLLNQNAMWQMNLGSDDTMGVDGSYPERHGEPDCAY  50

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCRFG++CRFNHP +RKL IA AR+KGEYPER+GQPEC++YLKTG CKFG TCKF
Sbjct  51    YIRTGLCRFGSTCRFNHPHDRKLVIATARIKGEYPERIGQPECEFYLKTGTCKFGVTCKF  110

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVPL  557
             HHPR+KAGI G V++NVL YPLRPN+ +C Y++R GQCKFG TCKF+HP  Q +N+MV +
Sbjct  111   HHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSV  170

Query  558   RGSPAYPPVHSPTTPGQLSYPLSRASFITN-PRWQGPSSYTPLIVPQGVVSVPGFAYSGQ  734
             RGSP Y  + S T  GQ SY  SR SF+ N PR Q PS               GFA   Q
Sbjct  171   RGSPVYSALQSLT--GQPSYSWSRTSFVANPPRLQDPS---------------GFASGSQ  213

Query  735   LGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPE  914
              G  SS        GNS                           +P+G+YAL RENVFPE
Sbjct  214   GGLFSS----GFHSGNS---------------------------VPLGFYALPRENVFPE  242

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD +LS +GLPLRPGEPLC FYSRYG
Sbjct  243   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGEPLCVFYSRYG  302

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSS  1169
             ICKFGPSCKFDHPM VFTYN + +S
Sbjct  303   ICKFGPSCKFDHPMRVFTYNNNTAS  327



>gb|EEC69137.1| hypothetical protein OsI_38063 [Oryza sativa Indica Group]
Length=395

 Score =   406 bits (1044),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 216/383 (56%), Positives = 260/383 (68%), Gaps = 57/383 (15%)
 Frame = +3

Query  51    ISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRF  230
             +SA+ A++  GP  L    A+E +WQ++L   E+MES  YP R GEPDCSYY+RTGLCRF
Sbjct  26    VSAAAAAI--GPHHLGVAAAEEAMWQMTLGGGESMESTPYPERIGEPDCSYYMRTGLCRF  83

Query  231   GASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGI  410
             G +C+FNHP NRKLA+AAARM GEYP RVGQPECQYYLKTG CKFGATCKFHHPR+KA +
Sbjct  84    GMTCKFNHPPNRKLAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAL  143

Query  411   AGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHS  590
             A RV LNVLGYP+RPN+ EC YY+RTGQCKF STC                         
Sbjct  144   ANRVQLNVLGYPMRPNEKECAYYLRTGQCKFASTC-------------------------  178

Query  591   PTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQ  767
                                        Y  +IVPQG+V VPG+  Y+ Q+GS SSP+ QQ
Sbjct  179   ---------------------------YAQVIVPQGLVQVPGWNPYAAQMGS-SSPDDQQ  210

Query  768   LTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYM  947
              T   +Q YG SR SE   +G  GM  SY+ G++P+G Y +Q EN+FPERP QPECQFYM
Sbjct  211   RTPVTTQYYG-SRQSETGGMGDHGMYQSYQGGSVPVGVYTVQGENIFPERPDQPECQFYM  269

Query  948   KTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFD  1127
             KTGDCKFGAVCKFHHP+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP+CKFD
Sbjct  270   KTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFD  329

Query  1128  HPMGVFTYNISPSSTTNAPTVRH  1196
             HPMG   Y  + S T +  ++ +
Sbjct  330   HPMGTLMYGSATSPTGDVSSMHY  352



>gb|KFK25872.1| hypothetical protein AALP_AA8G173100 [Arabis alpina]
Length=410

 Score =   405 bits (1042),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 227/381 (60%), Positives = 267/381 (70%), Gaps = 33/381 (9%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF++   IS          +SLS  L Q  +             G YP R GEPDCSYY
Sbjct  1     MDFDSRVAISREA-------TSLSHLLNQNEI---------IGGVGLYPERPGEPDCSYY  44

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +RKL IA AR++GEYPER+ QP+CQ+YLKTG CKFG TCKFH
Sbjct  45    IRTGLCRFGSTCRFNHPRDRKLVIATARIRGEYPERIDQPDCQFYLKTGTCKFGVTCKFH  104

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVPLR  560
             HPR+ A IAG V++N LGYPLRP + +C Y++RTG CKFG TCKF+HP  Q SN+MV L 
Sbjct  105   HPRNNADIAGSVSVNALGYPLRPEEDDCSYFLRTGHCKFGGTCKFNHPQSQSSNLMVSLS  164

Query  561   GSPAYPPVHSPTTPGQLSYPLSRASFITN-PRWQGPSSYTPLIVPQ-GVVSVPGF-AYSG  731
             GSP Y  + SPT  GQ SY  SRASF+ N PR      +  LI+PQ G VSV G+ AY+G
Sbjct  165   GSPVYSALQSPT--GQQSYTWSRASFVANTPR------FASLILPQGGGVSVQGWNAYNG  216

Query  732   QLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYA-LQRENVF  908
             QLGS+S   S Q    N Q      SS   + G+   +  +   ++P+GYYA L RE++F
Sbjct  217   QLGSLSPSGSDQ-NYRNQQQNDAKESS--VSQGALFSSRFHSGNSVPLGYYASLAREDLF  273

Query  909   PERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSR  1088
             PERPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD +LSP+ LPLRPGEPLC FYSR
Sbjct  274   PERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPAPDCVLSPVDLPLRPGEPLCVFYSR  333

Query  1089  YGICKFGPSCKFDHPMGVFTY  1151
             YGICKFGPSCKFDHPM VFTY
Sbjct  334   YGICKFGPSCKFDHPMRVFTY  354



>ref|NP_568332.2| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAD27875.1|AF138872_1 zinc finger protein 3 [Arabidopsis thaliana]
 dbj|BAB09623.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92306.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=368

 Score =   400 bits (1029),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 219/385 (57%), Positives = 256/385 (66%), Gaps = 69/385 (18%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETM-ESGTYPVRDGEPDCSY  203
             MDF+          S++   + LSP L Q  +WQ++L S +TM   G+YP R GEPDC+Y
Sbjct  1     MDFD----------SISRESTFLSPLLNQNAMWQMNLGSDDTMGVDGSYPERHGEPDCAY  50

Query  204   YIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKF  383
             YIRTGLCRFG++CRFNHP +RKL IA AR+KGEYPER+GQPEC++YLKTG CKFG TCKF
Sbjct  51    YIRTGLCRFGSTCRFNHPHDRKLVIATARIKGEYPERIGQPECEFYLKTGTCKFGVTCKF  110

Query  384   HHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVPL  557
             HHPR+KAGI G V++NVL YPLRPN+ +C Y++R GQCKFG TCKF+HP  Q +N+MV +
Sbjct  111   HHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSV  170

Query  558   RGSPAYPPVHSPTTPGQLSYPLSRASFITN-PRWQGPSSYTPLIVPQGVVSVPGFAYSGQ  734
             RGSP Y  + S T  GQ SY  SR SF+ N PR Q PS               GFA   Q
Sbjct  171   RGSPVYSALQSLT--GQPSYSWSRTSFVANPPRLQDPS---------------GFASGSQ  213

Query  735   LGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPE  914
              G  SS        GNS                           +P+G+YAL RENVFPE
Sbjct  214   GGLFSS----GFHSGNS---------------------------VPLGFYALPRENVFPE  242

Query  915   RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYG  1094
             RPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD +LS        GEPLC FYSRYG
Sbjct  243   RPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSS-------GEPLCVFYSRYG  295

Query  1095  ICKFGPSCKFDHPMGVFTYNISPSS  1169
             ICKFGPSCKFDHPM VFTYN + +S
Sbjct  296   ICKFGPSCKFDHPMRVFTYNNNTAS  320



>ref|XP_009392483.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=359

 Score =   399 bits (1026),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 216/361 (60%), Positives = 259/361 (72%), Gaps = 50/361 (14%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +W+ ++R  + +ESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LAIAAAR++G
Sbjct  1     MWKTNMRGRDPVESGPYPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNRMLAIAAARIRG  60

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
              YPERVGQPECQYYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLR         
Sbjct  61    GYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLR---------  111

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQ  659
                                          P+YP        G  ++ L R+S+I++PRWQ
Sbjct  112   -----------------------------PSYP-------AGMTNWTLPRSSYISSPRWQ  135

Query  660   GPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQ  836
               SSY  LI+PQGVV VPG+ +YSGQLG  SSP SQQ T G +Q Y  S+  E  N+G+Q
Sbjct  136   ASSSYAQLILPQGVVQVPGWTSYSGQLG--SSPGSQQ-TAGVAQFYSPSQQGET-NIGAQ  191

Query  837   GMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipp  1016
             G   SYR G++ MG YA+ REN+FPERPGQPECQFYMKTGDCKFGAVC+FHHPRERLIP 
Sbjct  192   GKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPT  251

Query  1017  pdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRH  1196
             P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG  TY +S SS  + PTV+H
Sbjct  252   PNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVTYGLSESSMADVPTVQH  311

Query  1197  F  1199
              
Sbjct  312   L  312



>ref|NP_974790.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAM61197.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92307.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=354

 Score =   398 bits (1023),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 216/354 (61%), Positives = 250/354 (71%), Gaps = 52/354 (15%)
 Frame = +3

Query  120   LWQLSLRSMETM-ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  296
             +WQ++L S +TM   G+YP R GEPDC+YYIRTGLCRFG++CRFNHP +RKL IA AR+K
Sbjct  1     MWQMNLGSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIK  60

Query  297   GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  476
             GEYPER+GQPEC++YLKTG CKFG TCKFHHPR+KAGI G V++NVL YPLRPN+ +C Y
Sbjct  61    GEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSY  120

Query  477   YMRTGQCKFGSTCKFHHP--QPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITN-  647
             ++R GQCKFG TCKF+HP  Q +N+MV +RGSP Y  + S T  GQ SY  SR SF+ N 
Sbjct  121   FLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLT--GQPSYSWSRTSFVANP  178

Query  648   PRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANV  827
             PR Q PS               GFA   Q G  SS        GNS              
Sbjct  179   PRLQDPS---------------GFASGSQGGLFSS----GFHSGNS--------------  205

Query  828   GSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERl  1007
                          +P+G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R 
Sbjct  206   -------------VPLGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  252

Query  1008  ipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  1169
              PPPD +LS +GLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTYN + +S
Sbjct  253   TPPPDCVLSSVGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNTAS  306



>ref|XP_010492565.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
[Camelina sativa]
Length=418

 Score =   400 bits (1027),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 228/388 (59%), Positives = 272/388 (70%), Gaps = 38/388 (10%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETME--SGTYPVRDGEPDCS  200
             MDF+       S   +T   +SLSP L Q  +WQ++L S ETM    G YP R GEPDCS
Sbjct  1     MDFD-------SRVPITRESTSLSPLLHQNAMWQMNLGSDETMSGCDGFYPERQGEPDCS  53

Query  201   YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  380
             YYIRTGLCRFG++CRFNHP +RKL IA AR KGEYPER+GQPEC++Y+KTG CKFG TCK
Sbjct  54    YYIRTGLCRFGSTCRFNHPHDRKLVIATARAKGEYPERIGQPECEFYMKTGTCKFGVTCK  113

Query  381   FHHPRDKAGI-AGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMV  551
             FHHPR+ AG   GRV++    YPLRPN+ +C Y++RTG CKFG TCKF+HP  Q + +MV
Sbjct  114   FHHPRNNAGTDDGRVSV----YPLRPNEDDCSYFLRTGHCKFGGTCKFNHPPTQSTKLMV  169

Query  552   PLRGSPAYPPVHSPTTPGQLSYPLSRASFI-TNPRWQGPSSYTPLIVPQ-GVVSVPGF-A  722
              +RGSP Y  + S T  GQ SY   R S + T PR+Q PSS   L++PQ GVVSV G+  
Sbjct  170   SVRGSPVYSALQSLT--GQQSYSWPRTSCVATPPRFQDPSSIASLVLPQGGVVSVQGWNG  227

Query  723   YSGQLGSVSSPESQQLTVGNSQAYGLSRSSEV-ANVGSQG--MNPSYRAG-TLPMGYYAL  890
             Y GQLGS+S         G+ Q Y   R ++   + GSQG   +  + +G ++P+  YA 
Sbjct  228   YGGQLGSLSPS-------GSDQNYRNQRQNDAEESSGSQGGLFSSEFHSGSSVPLCLYA-  279

Query  891   QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPL  1070
                  FPERPGQ ECQFYMKTGDCKFG VCKFHHPR+R  P PD +LS +GLPLR GEPL
Sbjct  280   -----FPERPGQLECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPL  334

Query  1071  CAFYSRYGICKFGPSCKFDHPMGVFTYN  1154
             C FYSRYGICKFGPSCKFDHPMGVFTYN
Sbjct  335   CVFYSRYGICKFGPSCKFDHPMGVFTYN  362



>ref|XP_009416575.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=393

 Score =   399 bits (1024),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 271/385 (70%), Gaps = 53/385 (14%)
 Frame = +3

Query  57    ASMASVTEGPS-SLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFG  233
             A   +VTEGPS S  P   +E +W+  +R  ++ME+G YP R GEPDC+YYIRTGLCRFG
Sbjct  10    APARTVTEGPSLSSQPGTDEEAMWK-RMRESDSMETGPYPERPGEPDCAYYIRTGLCRFG  68

Query  234   ASCRFNHPSNRKLAIAAA--RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAG  407
              +C+FNHP NR LA+AAA  R++G YPERVGQPECQYYLKTG CKFGA CKFHHP++KAG
Sbjct  69    RTCKFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAG  128

Query  408   IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVH  587
             IAGRV LN+LGYPLR                                  L+  PA     
Sbjct  129   IAGRVQLNILGYPLR----------------------------------LQTYPAE----  150

Query  588   SPTTPGQLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQ  764
                     ++ LSR+SFI +PRWQ  SSY  LI+PQGVV VPG+ +YSGQLG  SSPESQ
Sbjct  151   ------MTNWTLSRSSFIPSPRWQASSSYAQLILPQGVVQVPGWTSYSGQLG--SSPESQ  202

Query  765   QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  944
             + T G +Q YG S+  E + +G+QG  PSYR G+ PMG YA+  EN+FPERPGQPECQFY
Sbjct  203   R-TTGTAQFYGPSQQGETS-IGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFY  260

Query  945   MKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKF  1124
             MKTGDCKFGAVCKFHHP+ERL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKFGP+CKF
Sbjct  261   MKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKF  320

Query  1125  DHPMGVFTYNISPSSTTNAPTVRHF  1199
             DHPMG F Y +S SS T  PT  H 
Sbjct  321   DHPMGTFAYGVSASSATGVPTAWHL  345



>ref|XP_010420349.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X1 [Camelina sativa]
Length=415

 Score =   399 bits (1025),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 225/387 (58%), Positives = 268/387 (69%), Gaps = 39/387 (10%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGT--YPVRDGEPDCS  200
             MDF+       S   +T   +SLSP L Q  +WQ++L S ETM  G   YP R GEPDCS
Sbjct  1     MDFD-------SRVPITRESTSLSPLLHQNAMWQMNLGSDETMSGGDGFYPERQGEPDCS  53

Query  201   YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  380
             YYIRTGLCRFG++CRFNHP +RKL IA AR KGEYPER+GQPEC++Y+KTG CKFG TCK
Sbjct  54    YYIRTGLCRFGSTCRFNHPHDRKLVIATARTKGEYPERIGQPECEFYMKTGTCKFGVTCK  113

Query  381   FHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVP  554
             FHHPR+  G  GRV+++VLGYPLRPN+ +C Y++RTG CKFG TCKF+HP  Q + +MV 
Sbjct  114   FHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTKLMVS  173

Query  555   LRGSPAYPPVHSPTTPGQLSYPLSRAS-FITNPRWQGPSSYTPLIVPQ-GVVSVPGF-AY  725
             LRGSP Y  + S T  GQ SY   R S   T PR+Q PSS   L++PQ GVVSV G+  +
Sbjct  174   LRGSPVYSALQSLT--GQQSYSWPRTSCLATPPRFQDPSSIASLVLPQGGVVSVQGWNGF  231

Query  726   SGQLGSVSSPESQQLTVGNSQAYGLSRSSEV-ANVGSQG---MNPSYRAGTLPMGYYALQ  893
              GQLGS+S         G+ Q Y   R ++   + GSQG    +  +   ++P+G YA  
Sbjct  232   GGQLGSLSPS-------GSDQNYRNQRQNDAEESSGSQGGVFSSGFHSGSSVPLGLYA--  282

Query  894   RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLC  1073
                 FPERPGQ ECQFYMKTGD      CKFHHPR+R  P PD +LS +GLPLR GEPLC
Sbjct  283   ----FPERPGQLECQFYMKTGD------CKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLC  332

Query  1074  AFYSRYGICKFGPSCKFDHPMGVFTYN  1154
              FYSRYGICKFGPSCKFDHPMGVFTYN
Sbjct  333   VFYSRYGICKFGPSCKFDHPMGVFTYN  359



>ref|XP_010420350.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X2 [Camelina sativa]
Length=413

 Score =   393 bits (1010),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 224/386 (58%), Positives = 266/386 (69%), Gaps = 39/386 (10%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGT--YPVRDGEPDCS  200
             MDF+       S   +T   +SLSP L Q  +WQ++L S ETM  G   YP R GEPDCS
Sbjct  1     MDFD-------SRVPITRESTSLSPLLHQNAMWQMNLGSDETMSGGDGFYPERQGEPDCS  53

Query  201   YYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCK  380
             YYIRTGLCRFG++CRFNHP +RKL IA AR KGEYPER+GQPEC++Y+KTG CKFG TCK
Sbjct  54    YYIRTGLCRFGSTCRFNHPHDRKLVIATARTKGEYPERIGQPECEFYMKTGTCKFGVTCK  113

Query  381   FHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVP  554
             FHHPR+  G  GRV+++VLGYPLRPN+ +C Y++RTG CKFG TCKF+HP  Q + +MV 
Sbjct  114   FHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTKLMVS  173

Query  555   LRGSPAYPPVHSPTTPGQLSYPLSRAS-FITNPRWQGPSSYTPLIVPQ-GVVSVPGFAYS  728
             LRGSP Y  + S T  GQ SY   R S   T PR+Q PSS   L++PQ GVVSV G+   
Sbjct  174   LRGSPVYSALQSLT--GQQSYSWPRTSCLATPPRFQDPSSIASLVLPQGGVVSVQGWNGF  231

Query  729   GQLGSVSSPESQQLTVGNSQAYGLSRSSEV-ANVGSQG---MNPSYRAGTLPMGYYALQR  896
             G LGS+S         G+ Q Y   R ++   + GSQG    +  +   ++P+G YA   
Sbjct  232   G-LGSLSPS-------GSDQNYRNQRQNDAEESSGSQGGVFSSGFHSGSSVPLGLYA---  280

Query  897   ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCA  1076
                FPERPGQ ECQFYMKTGD      CKFHHPR+R  P PD +LS +GLPLR GEPLC 
Sbjct  281   ---FPERPGQLECQFYMKTGD------CKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCV  331

Query  1077  FYSRYGICKFGPSCKFDHPMGVFTYN  1154
             FYSRYGICKFGPSCKFDHPMGVFTYN
Sbjct  332   FYSRYGICKFGPSCKFDHPMGVFTYN  357



>ref|XP_006376056.1| hypothetical protein POPTR_0013s08490g [Populus trichocarpa]
 gb|ERP53853.1| hypothetical protein POPTR_0013s08490g [Populus trichocarpa]
Length=255

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 213/244 (87%), Gaps = 11/244 (5%)
 Frame = +3

Query  27   MDFEAAAGISAS---MASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDC  197
            MDF+A   +S S   + +VTEG +S+SP L+++ +WQ++LRS ETME+G YP R GEPDC
Sbjct  1    MDFDAGIPMSRSGVGLPAVTEG-TSMSPSLSEDAMWQMNLRSSETMEAGPYPERPGEPDC  59

Query  198  SYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATC  377
            SYYIRTGLCRFGA+CRFNHP NRKLAIAAARMKGE+PER+GQPECQYYLKTG CKFGATC
Sbjct  60   SYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATC  119

Query  378  KFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  557
            KFHHPRDKAGI+GRV+LN+LGYPL+PN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMVPL
Sbjct  120  KFHHPRDKAGISGRVSLNILGYPLQPNEIECAYYLRTGQCKFGSTCKFHHPQPTNMMVPL  179

Query  558  RGSPAYPPVHSPTTPGQLSYP------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF  719
            RGSP YP V SPTTPGQ SYP       SRASFIT+PRWQ PSSYTPLI+PQGVVSVPG+
Sbjct  180  RGSPIYPTVSSPTTPGQQSYPGGLATTWSRASFITSPRWQAPSSYTPLILPQGVVSVPGW  239

Query  720  -AYS  728
             AYS
Sbjct  240  NAYS  243


 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +3

Query  873   MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpl  1052
             +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  84    LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPL  143

Query  1053  RPGEPLCAFYSRYGICKFGPSCKFDHP  1133
             +P E  CA+Y R G CKFG +CKF HP
Sbjct  144   QPNEIECAYYLRTGQCKFGSTCKFHHP  170


 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             +PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  50    YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  108

Query  1086  RYGICKFGPSCKFDHP  1133
             + G CKFG +CKF HP
Sbjct  109   KTGTCKFGATCKFHHP  124



>dbj|BAD87736.1| putative zinc finger protein [Oryza sativa Japonica Group]
Length=322

 Score =   377 bits (967),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 202/315 (64%), Positives = 237/315 (75%), Gaps = 16/315 (5%)
 Frame = +3

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             MKGEYPER+GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRP++ EC
Sbjct  1     MKGEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKEC  60

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG------QLSYPLSRA  632
              YY++TGQCK+G+TCKFHHP+  N M   RGSP YP VHS  T G        S+   R 
Sbjct  61    AYYLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSATAGPPYTGTMASWAFPRG  120

Query  633   SFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRS  809
             SFI +PRWQ PS+Y P+IVPQG+V VP + +Y+GQ+  VSS ES+  + G  Q YG S+ 
Sbjct  121   SFIPSPRWQNPSNYAPMIVPQGLVQVPSWNSYTGQMMPVSSSESRLQSPGAQQTYGTSQQ  180

Query  810   SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  989
              + A+ G+QGM   YR+ + P+  YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFH
Sbjct  181   VD-ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFH  239

Query  990   HPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYN  1154
             HPR R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y 
Sbjct  240   HPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG  299

Query  1155  ISPSSTTNAPTVRHF  1199
                S++TN P VR  
Sbjct  300   ---SASTNVPMVRRL  311


 Score =   100 bits (250),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +3

Query  282  AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
            A + +  +PER  QPECQYY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +
Sbjct  205  ALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGE  264

Query  462  IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAY  575
              C +Y R G CKFG+ CKF HP     M P  G  AY
Sbjct  265  ELCKFYSRYGICKFGANCKFDHP----TMAPPMGVYAY  298


 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +3

Query  165  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYY  341
             +P R  +P+C YY++TG C+FGA C+F+HP  R +      +     P R G+  C++Y
Sbjct  211  VFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFY  270

Query  342  LKTGACKFGATCKFHHP  392
             + G CKFGA CKF HP
Sbjct  271  SRYGICKFGANCKFDHP  287



>gb|KDO47609.1| hypothetical protein CISIN_1g0472481mg, partial [Citrus sinensis]
Length=238

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/236 (77%), Positives = 201/236 (85%), Gaps = 7/236 (3%)
 Frame = +3

Query  27   MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
            M FEA   +S   A+VTEGPS LSP L Q+ LWQ++LR+ E MESG+ P R GEPDCSYY
Sbjct  1    MQFEAGISLSRG-AAVTEGPS-LSPSLNQDALWQMNLRTNEAMESGSLPERPGEPDCSYY  58

Query  207  IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
            IRTGLCRFGA+CRFNHP NRKLAIA AR+KG+YPERVGQPECQYYLKTG CKFGATCKFH
Sbjct  59   IRTGLCRFGATCRFNHPPNRKLAIATARIKGDYPERVGQPECQYYLKTGTCKFGATCKFH  118

Query  387  HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS  566
            HPRDKAGIAGRV+LNVLGYPLRPN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGS
Sbjct  119  HPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVSLRGS  178

Query  567  PAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF  719
            P YP V SPTTP Q SY       SRASFI +PRWQGPSSY P+++PQG+VSVPG+
Sbjct  179  PVYPTVQSPTTPSQQSYAGGITNWSRASFIPSPRWQGPSSYAPMLLPQGMVSVPGW  234


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             +PER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  91    YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYL  150

Query  1086  RYGICKFGPSCKFDHP  1133
             R G CKFG +CKF HP
Sbjct  151   RTGQCKFGSTCKFHHP  166


 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
              PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  46    LPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARIKGDYPERVGQPECQYYL  104

Query  1086  RYGICKFGPSCKFDHP  1133
             + G CKFG +CKF HP
Sbjct  105   KTGTCKFGATCKFHHP  120


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  906  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  998
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  137  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ  167



>ref|XP_002871723.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47982.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   376 bits (965),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 206/340 (61%), Positives = 233/340 (69%), Gaps = 50/340 (15%)
 Frame = +3

Query  159   SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQY  338
              G+YP R GEPDC+YYIRTGLCRFG +CRFNHP +RKL IA AR+KGEYPER+GQPEC++
Sbjct  4     DGSYPERHGEPDCAYYIRTGLCRFGFTCRFNHPHDRKLVIATARIKGEYPERIGQPECEF  63

Query  339   YLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCK  518
             YLKTG CKFG TCKFHHPR+KAG  GRV++NVLGYPLRPN+ +C Y++RTG CKFG TCK
Sbjct  64    YLKTGTCKFGVTCKFHHPRNKAGNDGRVSVNVLGYPLRPNEDDCSYFLRTGHCKFGGTCK  123

Query  519   FHHPQP--SNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITN-PRWQGPSSYTPLIV  689
             F+HPQ   +N+MV LRGSP Y  +  PT  GQ SY   R SF+ N PRWQ PSS++    
Sbjct  124   FNHPQTQSTNLMVSLRGSPVYSALQPPTD-GQQSYSWPRTSFVANPPRWQDPSSFSSGSQ  182

Query  690   PQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTL  869
                  S  GF                   GNS   G                        
Sbjct  183   GGLFSS--GFH-----------------SGNSVPLG------------------------  199

Query  870   PMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglp  1049
                +YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD  LS +GLP
Sbjct  200   ---FYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCALSSVGLP  256

Query  1050  lRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  1169
             LR GEPLC FYSRYGICKFGPSCKFDHPM VFTYN + +S
Sbjct  257   LRQGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNDAS  296



>ref|XP_006296584.1| hypothetical protein CARUB_v100138730mg, partial [Capsella rubella]
 gb|EOA29482.1| hypothetical protein CARUB_v100138730mg, partial [Capsella rubella]
Length=329

 Score =   371 bits (953),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 229/305 (75%), Gaps = 22/305 (7%)
 Frame = +3

Query  273   AIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  452
              IA ARM+GEYPER+GQPEC+YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR
Sbjct  1     VIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLR  60

Query  453   PNDIECPYYMRTGQCKFGSTCKFHH--PQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLS  626
              N+++C Y++RTG CKFG TCKF+H  PQP+NMMVP              T GQ SYP S
Sbjct  61    SNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVP--------------TSGQQSYPWS  106

Query  627   RASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVS-SPESQQLTVGNSQAYGL  800
             RASFI +PRWQ PSSY  LI+PQGVV V G+  YSGQLGSVS S     L   + Q    
Sbjct  107   RASFIASPRWQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDLNYRSLQQSET  166

Query  801   SRSSEVANVGSQGMNPSYRAGTLPM-GYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
               SS  +     G NP     ++P+ G+YAL RENVFPERPGQPECQFYMKTGDCKFG V
Sbjct  167   KESSTQSQGSFSGFNP---GSSVPLGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTV  223

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  1157
             CKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+RYGICKFGPSCKFDHPM VFTY+ 
Sbjct  224   CKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDN  283

Query  1158  SPSST  1172
             + S +
Sbjct  284   TASES  288


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query  165  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  341
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+       +     P R G+P C +Y
Sbjct  199  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFY  258

Query  342  LKTGACKFGATCKFHHP  392
             + G CKFG +CKF HP
Sbjct  259  TRYGICKFGPSCKFDHP  275



>gb|KHN40466.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=347

 Score =   371 bits (953),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 208/364 (57%), Positives = 250/364 (69%), Gaps = 71/364 (20%)
 Frame = +3

Query  120   LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG  299
             +WQ++LRS ETMES        EP                                    
Sbjct  1     MWQINLRSSETMES--------EP------------------------------------  16

Query  300   EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYY  479
              YPE  G+P+C YY++TG C+FGATC+F+HP ++                + N+ EC YY
Sbjct  17    -YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR----------------KLNEPECGYY  59

Query  480   MRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFIT  644
             +RTGQCKFG+TCKFHHPQP+NM++ +R SP YP VHSPTTPG  SY       S +S+I 
Sbjct  60    LRTGQCKFGNTCKFHHPQPNNMVLSMRSSPVYPTVHSPTTPGHQSYATGITNWSSSSYIP  119

Query  645   NPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVA  821
             +PRWQGPSSY PLI+PQG+VSV G+ AYSGQ+GS    +S Q T+ N Q+YG SR SE A
Sbjct  120   SPRWQGPSSYAPLILPQGMVSVSGWSAYSGQMGS----DSPQQTMANGQSYGTSRQSEPA  175

Query  822   NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRE  1001
             N GSQG    +R+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FHHPRE
Sbjct  176   NSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRE  235

Query  1002  RlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  1181
             R+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMGVFTYN+S S   +A
Sbjct  236   RMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNMSASPLADA  295

Query  1182  PTVR  1193
             P  R
Sbjct  296   PGRR  299



>gb|AFW84181.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=375

 Score =   369 bits (948),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 214/384 (56%), Positives = 251/384 (65%), Gaps = 69/384 (18%)
 Frame = +3

Query  87    SSLSPP-LAQETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  260
             SSL P  L +E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP 
Sbjct  37    SSLDPDALYEEGMWQQMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPP  96

Query  261   NRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG  440
             +R LAIA+ARMKGEYPERVGQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN LG
Sbjct  97    DRNLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLG  156

Query  441   YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP  620
             YPL P+                                              T    S+ 
Sbjct  157   YPLLPS---------------------------------------------YTGTMSSWT  171

Query  621   LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYG  797
               RASFI +PRWQ PS+Y P++VP G+V VP + +Y GQL S           G  Q YG
Sbjct  172   FPRASFIPSPRWQSPSNYAPMVVPHGLVQVPSWNSYPGQLQS----------PGAQQTYG  221

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
              S+  E A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+YMKTGDCKFGAV
Sbjct  222   SSQQGE-ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQYYMKTGDCKFGAV  280

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGV  1142
             CKFHHPR R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CKFDH     PMGV
Sbjct  281   CKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCKFDHPTMAAPMGV  340

Query  1143  FTYNISPS-----STTNAPTVRHF  1199
             + Y  S S     ++TNAP  RH 
Sbjct  341   YAYGFSGSASVAPASTNAPMTRHL  364



>ref|XP_010929824.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=263

 Score =   344 bits (883),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 187/225 (83%), Gaps = 11/225 (5%)
 Frame = +3

Query  66   ASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCR  245
            A++TEG SSL     +E +WQ++LR  E+MESG YP R GEPDC+YYIRTGLCRFG +C+
Sbjct  8    AAMTEGSSSLD----EEAMWQMNLRGSESMESGPYPERPGEPDCAYYIRTGLCRFGMTCK  63

Query  246  FNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVA  425
            FNHP NR LAIAAAR+KG YPERVGQPECQYYLKTG CKFGATCKFHHP+DKAG+AGRV 
Sbjct  64   FNHPPNRSLAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGMAGRVQ  123

Query  426  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  605
            LN+LGYPLR N+ EC YY+RTGQCKFG+TCKFHHPQPSN MV LRGSP YPPVHS TTPG
Sbjct  124  LNILGYPLRLNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSLTTPG  183

Query  606  QLSYP-------LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF  719
            Q SYP       LSR SFI +PRWQ PSSYT LI+PQG+V VPG+
Sbjct  184  QQSYPGGLTNWSLSRTSFIPSPRWQDPSSYTQLILPQGLVQVPGW  228


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PLR  E  CA+Y 
Sbjct  83    YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGMAGRVQLNILGYPLRLNEKECAYYI  142

Query  1086  RYGICKFGPSCKFDHP  1133
             R G CKFG +CKF HP
Sbjct  143   RTGQCKFGNTCKFHHP  158


 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             +PERPG+P+C +Y++TG C+FG  CKF+HP  R      +     G P R G+P C +Y 
Sbjct  38    YPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNR-SLAIAAARIKGGYPERVGQPECQYYL  96

Query  1086  RYGICKFGPSCKFDHP  1133
             + G CKFG +CKF HP
Sbjct  97    KTGTCKFGATCKFHHP  112



>ref|XP_001768387.1| predicted protein [Physcomitrella patens]
 gb|EDQ66749.1| predicted protein [Physcomitrella patens]
Length=332

 Score =   345 bits (886),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 195/353 (55%), Positives = 237/353 (67%), Gaps = 33/353 (9%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGT--YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  287
             E  W ++++  E ++ G   YP R GEPDC YY+RTGLC FG +CR+NHP NRKLA AA 
Sbjct  1     EAGWAMAMQGQEGVDGGQGPYPERPGEPDCVYYMRTGLCGFGMTCRYNHPPNRKLAAAAT  60

Query  288   RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
             R KGEYPERVG PECQYYLKTG CKFGATCK+HHPR+KAG  GRV LNVLG PLR  + E
Sbjct  61    RGKGEYPERVGHPECQYYLKTGTCKFGATCKYHHPREKAGSTGRVHLNVLGLPLRLGEKE  120

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNM--MVPLRGSPAYPPVHSPTTPGQLSYPLSRASFI  641
             C YYMRTG CK+G TCKFHHPQP+ +  MVPL           P   G  S+PL+R+ F 
Sbjct  121   CAYYMRTGSCKYGVTCKFHHPQPATVGGMVPL-----------PFGSGVPSWPLTRSPFP  169

Query  642   TNPRWQGPSSYTPLI-VPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEV  818
               PR Q PSSY  ++ + QG++S+ G+ Y    G V   E      G+ Q Y    + + 
Sbjct  170   L-PRMQAPSSYGTMMPLQQGIMSMAGWNYQVSQGPVGPAE------GHQQGYVFGGAPQG  222

Query  819   ANVGSQGMNPSYRAGTLPMGYYALQ-------RENVFPERPGQPECQFYMKTGDCKFGAV  977
              +V   G    Y  G+  +G  A Q       +E VFPERPGQPECQ+YMKTGDCKFG+ 
Sbjct  223   EHVSGYG---PYMQGSSAVGLPAHQATQAVGGQETVFPERPGQPECQYYMKTGDCKFGST  279

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPM  1136
             C++HHP++R  P P   LSP+GLPLRPG P C+FYSRYGICKFGP+CKFDHP+
Sbjct  280   CRYHHPKDRATPSPTCHLSPMGLPLRPGNPPCSFYSRYGICKFGPTCKFDHPL  332



>gb|KFK25871.1| hypothetical protein AALP_AA8G173100 [Arabis alpina]
Length=325

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 225/335 (67%), Gaps = 39/335 (12%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYY  206
             MDF++   IS          +SLS  L Q  +             G YP R GEPDCSYY
Sbjct  1     MDFDSRVAISREA-------TSLSHLLNQNEI---------IGGVGLYPERPGEPDCSYY  44

Query  207   IRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFH  386
             IRTGLCRFG++CRFNHP +RKL IA AR++GEYPER+ QP+CQ+YLKTG CKFG TCKFH
Sbjct  45    IRTGLCRFGSTCRFNHPRDRKLVIATARIRGEYPERIDQPDCQFYLKTGTCKFGVTCKFH  104

Query  387   HPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP--QPSNMMVPLR  560
             HPR+ A IAG V++N LGYPLRP + +C Y++RTG CKFG TCKF+HP  Q SN+MV L 
Sbjct  105   HPRNNADIAGSVSVNALGYPLRPEEDDCSYFLRTGHCKFGGTCKFNHPQSQSSNLMVSLS  164

Query  561   GSPAYPPVHSPTTPGQLSYPLSRASFITN-PRWQGPSSYTPLIVPQ-GVVSVPGF-AYSG  731
             GSP Y  + SPT  GQ SY  SRASF+ N PR      +  LI+PQ G VSV G+ AY+G
Sbjct  165   GSPVYSALQSPT--GQQSYTWSRASFVANTPR------FASLILPQGGGVSVQGWNAYNG  216

Query  732   QLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYR---AGTLPMGYYA-LQRE  899
             QLGS+S   S Q    N Q      SS      SQG   S R     ++P+GYYA L RE
Sbjct  217   QLGSLSPSGSDQ-NYRNQQQNDAKESSV-----SQGALFSSRFHSGNSVPLGYYASLARE  270

Query  900   NVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRER  1004
             ++FPERPGQPECQFYMKTGDCKFG VCKFHHPR+R
Sbjct  271   DLFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDR  305


 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  237  SCRFNHPSNRKLAIAAARMKGE-YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIA  413
            S RF+  ++  L   A+  + + +PER GQPECQ+Y+KTG CKFG  CKFHHPRD+   A
Sbjct  250  SSRFHSGNSVPLGYYASLAREDLFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPA  309

Query  414  GRVALNVLGYPLRP  455
                L+ +  PLRP
Sbjct  310  PDCVLSPVDLPLRP  323



>gb|ACF80171.1| unknown [Zea mays]
 tpg|DAA56153.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=320

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 186/292 (64%), Positives = 215/292 (74%), Gaps = 19/292 (7%)
 Frame = +3

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
             MKGEYPER GQPECQYYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRPN+ EC
Sbjct  1     MKGEYPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKEC  60

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSY-------PLSR  629
              YY++TG CK+ +TCKFHHP+  N++   RGSP Y  VHS  + G  SY          R
Sbjct  61    AYYLKTGHCKYANTCKFHHPELFNVVPSSRGSPIYTSVHSSASAGPQSYTGTMPSWAFPR  120

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSR  806
             ASFI +PRWQ PS+Y P+IVPQG+V +  + +Y+GQL S           G  Q YG S+
Sbjct  121   ASFIPSPRWQSPSNYAPMIVPQGLVQMQSWNSYTGQLQS----------PGAQQTYGSSQ  170

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
               E A+ G+QGM   YR  + P+  YALQRENVFPERP +PECQ+YMKTGDCKFGAVCKF
Sbjct  171   QGE-ASTGNQGMLSPYRPSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKF  229

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  1142
             HHPR R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDHP  V
Sbjct  230   HHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCKFDHPTVV  281


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = +3

Query  255  PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  434
            PS+  +   A + +  +PER  +PECQYY+KTG CKFGA CKFHHPR ++       L+ 
Sbjct  187  PSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSP  246

Query  435  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  551
            +G PLRP +  C +Y R G CKFG+ CKF HP     MV
Sbjct  247  MGLPLRPGEELCKFYSRYGICKFGANCKFDHPTVVAPMV  285



>ref|XP_004172583.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like, 
partial [Cucumis sativus]
Length=205

 Score =   332 bits (852),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 177/202 (88%), Gaps = 6/202 (3%)
 Frame = +3

Query  129  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYP  308
            ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CRFNHP NR+LAIA ARMKGE+P
Sbjct  1    MNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMKGEFP  60

Query  309  ERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRT  488
            ER+GQPECQYYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRP++ EC YY+RT
Sbjct  61   ERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLRT  120

Query  489  GQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFITNPR  653
            GQCKFG+TCKFHHPQP+NMMV LRGSP YP V SP TPGQ SYP      SRASFI +PR
Sbjct  121  GQCKFGNTCKFHHPQPTNMMVSLRGSPIYPTVQSP-TPGQQSYPGGSTNWSRASFIPSPR  179

Query  654  WQGPSSYTPLIVPQGVVSVPGF  719
            WQGPSSY  LI+PQGV+SVPG+
Sbjct  180  WQGPSSYASLILPQGVLSVPGW  201


 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  59    FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYL  118

Query  1086  RYGICKFGPSCKFDHP  1133
             R G CKFG +CKF HP
Sbjct  119   RTGQCKFGNTCKFHHP  134


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 61/118 (52%), Gaps = 12/118 (10%)
 Frame = +3

Query  873   MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpl  1052
             +G   +     +P RPG+P+C +Y++TG C+FGA C+F+HP  R      +       P 
Sbjct  3     LGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNR-ELAIATARMKGEFPE  61

Query  1053  RPGEPLCAFYSRYGICKFGPSCKFDHP-----------MGVFTYNISPSSTTNAPTVR  1193
             R G+P C +Y + G CKFG +CKF HP           + +  Y + PS T  A  +R
Sbjct  62    RIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLR  119



>ref|XP_010523985.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523986.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523988.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523989.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
Length=475

 Score =   332 bits (852),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 182/365 (50%), Positives = 239/365 (65%), Gaps = 15/365 (4%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+L L + ET     YP R G PDC+YY+RTG+C +G+ CR+NHP +R +  AA R
Sbjct  31    EESMWRLGLSNSET-----YPERPGVPDCAYYMRTGICGYGSRCRYNHPRDRAMVEAAVR  85

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YPERVG+P CQ+YLKTG CKFGA+CKFHHP++  G   +V LN+ GYPLR  + EC
Sbjct  86    ATGDYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREGEKEC  145

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNP  650
              +Y++TGQCKFG TCKFHHPQP+    P      YP VHSP  P Q   P S       P
Sbjct  146   SHYLKTGQCKFGVTCKFHHPQPAGTTAPASAPQFYPSVHSP-IPDQYGGPSSSLRVARPP  204

Query  651   RWQGP---SSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR-SSE  815
                G     +Y P+++  GVV +PG++ YS  +  V SP +Q   VG +  YG+++ SS 
Sbjct  205   LLPGSYMQGAYGPMLLTPGVVPIPGWSPYSAPMSPVLSPGAQH-AVGATSLYGVTQLSSS  263

Query  816   VANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHP  995
               +V   G+  S  + T P      Q+E +FPERPG+PECQ+Y++TGDCKFG  CKFHHP
Sbjct  264   TPSVA--GVYQSLSSSTAPSA-AGNQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHP  320

Query  996   RERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTT  1175
             R+R+ P  + +LSPIGLPLRPG   C FY + G C+FG +CKFDHPMG  +YN S SS  
Sbjct  321   RDRVPPRANCILSPIGLPLRPGVQPCTFYLQNGFCRFGSTCKFDHPMGTLSYNPSASSLV  380

Query  1176  NAPTV  1190
             +AP  
Sbjct  381   DAPVA  385



>ref|XP_010545037.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X1 [Tarenaya hassleriana]
Length=469

 Score =   331 bits (848),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 182/364 (50%), Positives = 234/364 (64%), Gaps = 14/364 (4%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+L L S ET     YP R G PDC+YY+RTG+C +G+ CR+NHP +R +  AA R
Sbjct  31    EESMWRLGLSSSET-----YPERPGAPDCAYYMRTGICGYGSRCRYNHPRDRAVVEAAVR  85

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               GEYPERVG+P CQ+YLKTG CKFGA+CKFHHP++  G   +V LN+ GYPLR  + EC
Sbjct  86    ATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREAEKEC  145

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNP  650
              +Y++TGQCKFG TCKFHHPQP+    P      YP V SP  P Q S P S       P
Sbjct  146   SHYLKTGQCKFGVTCKFHHPQPAGTTTPASTPRFYPSVQSP-IPDQYSGPSSSLRVARPP  204

Query  651   RWQGP---SSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSSEV  818
                G     +Y P+++  GVV +PG+  YSG +  V SP +Q   VG +  YG+++ S  
Sbjct  205   LLPGSYMQGAYGPMLLTPGVVPIPGWNPYSGPVSPVLSPGAQH-AVGATSLYGVTQLSS-  262

Query  819   ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPR  998
             +     G  PS  + T P      Q+E +FPERPG+PECQ+Y++TGDCKFG  CKFHH R
Sbjct  263   STPSLAGAYPSLSSSTAPS--VGSQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHRR  320

Query  999   ERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  1178
             +R+    + +LSPIGLPLRPG   C FY + G C+FG +CKFDHPMG   YN S SS  +
Sbjct  321   DRIPQRANCILSPIGLPLRPGVQPCTFYLQNGFCRFGSTCKFDHPMGTLRYNPSASSLVD  380

Query  1179  APTV  1190
             AP  
Sbjct  381   APVA  384



>ref|XP_006855486.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
 gb|ERN16953.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
Length=458

 Score =   329 bits (843),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 240/358 (67%), Gaps = 32/358 (9%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+LSL      E   YP R GE DC +Y++TG CR+GA+CR+NHP +R  A    +
Sbjct  27    EESMWRLSLGRESGGE--YYPERPGEADCMFYMKTGFCRYGANCRYNHPHDRNPAADVLQ  84

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPERVGQP CQY++KTG CKFGATCK+HHPR   G+   V LN+LGYPLRP D E
Sbjct  85    TGGGEYPERVGQPTCQYFIKTGTCKFGATCKYHHPRYGGGLMSPVGLNILGYPLRPGDKE  144

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA-YPPVHSPTTP-------GQLSYPL  623
             C YY++TGQCKFG TCKFHHPQP N  +    +P  YP VHSP+ P       G  S+ +
Sbjct  145   CSYYVKTGQCKFGPTCKFHHPQPVNTSLQTTPAPQFYPTVHSPSQPSPQQYGGGMASWQV  204

Query  624   SRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGL  800
             +R+ F+     QGP  Y+P+I+  GVV +PG+ AY   +  V+SP +QQ  VG    YGL
Sbjct  205   ARSPFLPGSYVQGP--YSPVILHPGVVPLPGWSAYPPPVTPVASPGAQQ-PVGTGSLYGL  261

Query  801   SRSSE-----VANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCK  965
             S ++       + V S    PS   GT         +EN FPERPGQPECQFYM+TGDCK
Sbjct  262   SPTATPYPGFFSPVSSSVAGPS---GT---------KENTFPERPGQPECQFYMRTGDCK  309

Query  966   FGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMG  1139
             +G+ C++HHP +R++P  +  LSPIG PLRPG P C+FY+++G+CKFGP+CKFDHP+G
Sbjct  310   YGSTCRYHHPPDRIVPQTNCTLSPIGFPLRPGAPTCSFYAQHGVCKFGPTCKFDHPLG  367


 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             +PER GQP CQ+++KTG CKFGA CK+HHPR          L+ +G PLRPG+  C++Y 
Sbjct  90    YPERVGQPTCQYFIKTGTCKFGATCKYHHPRYGGGLMSPVGLNILGYPLRPGDKECSYYV  149

Query  1086  RYGICKFGPSCKFDHPMGVFT  1148
             + G CKFGP+CKF HP  V T
Sbjct  150   KTGQCKFGPTCKFHHPQPVNT  170



>gb|EPS74454.1| hypothetical protein M569_00301, partial [Genlisea aurea]
Length=205

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 172/206 (83%), Gaps = 2/206 (1%)
 Frame = +3

Query  117  TLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  296
             LW ++ R  E  +SG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA A+MK
Sbjct  1    VLWDMNSRLREPSDSGHYPVREGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAQMK  60

Query  297  GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPY  476
            GEYPER+GQPECQYY+KTG CKFGATCKFHHP DKAGIAGRV LNV GYPLRPN+IEC Y
Sbjct  61   GEYPERIGQPECQYYIKTGTCKFGATCKFHHPPDKAGIAGRVPLNVHGYPLRPNEIECAY  120

Query  477  YMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRW  656
            YMR G CKFGSTCKF+HPQ SN+MV LRGS  YP +HSPT  GQL YPLSR S+I +PRW
Sbjct  121  YMRHGFCKFGSTCKFNHPQLSNIMVSLRGSTVYPTIHSPTA-GQLPYPLSRPSYIPSPRW  179

Query  657  QGPS-SYTPLIVPQGVVSVPGFAYSG  731
            Q PS +Y PL++PQGV+S+P +   G
Sbjct  180  QNPSTTYGPLVMPQGVLSIPTWNSYG  205


 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = +3

Query  891   QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPL  1070
             Q +  +PER GQPECQ+Y+KTG CKFGA CKFHHP ++        L+  G PLRP E  
Sbjct  58    QMKGEYPERIGQPECQYYIKTGTCKFGATCKFHHPPDKAGIAGRVPLNVHGYPLRPNEIE  117

Query  1071  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             CA+Y R+G CKFG +CKF+HP  +    +S   +T  PT+
Sbjct  118   CAYYMRHGFCKFGSTCKFNHPQ-LSNIMVSLRGSTVYPTI  156


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 57/108 (53%), Gaps = 12/108 (11%)
 Frame = +3

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             +P R G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  18    YPVREGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATAQMKGEYPERIGQPECQYYI  76

Query  1086  RYGICKFGPSCKFDH-----------PMGVFTYNISPSSTTNAPTVRH  1196
             + G CKFG +CKF H           P+ V  Y + P+    A  +RH
Sbjct  77    KTGTCKFGATCKFHHPPDKAGIAGRVPLNVHGYPLRPNEIECAYYMRH  124



>ref|XP_010545038.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X2 [Tarenaya hassleriana]
Length=463

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 225/348 (65%), Gaps = 9/348 (3%)
 Frame = +3

Query  159   SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQY  338
             S TYP R G PDC+YY+RTG+C +G+ CR+NHP +R +  AA R  GEYPERVG+P CQ+
Sbjct  36    SETYPERPGAPDCAYYMRTGICGYGSRCRYNHPRDRAVVEAAVRATGEYPERVGEPPCQF  95

Query  339   YLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCK  518
             YLKTG CKFGA+CKFHHP++  G   +V LN+ GYPLR  + EC +Y++TGQCKFG TCK
Sbjct  96    YLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREAEKECSHYLKTGQCKFGVTCK  155

Query  519   FHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGP---SSYTPLIV  689
             FHHPQP+    P      YP V SP  P Q S P S       P   G     +Y P+++
Sbjct  156   FHHPQPAGTTTPASTPRFYPSVQSP-IPDQYSGPSSSLRVARPPLLPGSYMQGAYGPMLL  214

Query  690   PQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGT  866
               GVV +PG+  YSG +  V SP +Q   VG +  YG+++ S  +     G  PS  + T
Sbjct  215   TPGVVPIPGWNPYSGPVSPVLSPGAQH-AVGATSLYGVTQLSS-STPSLAGAYPSLSSST  272

Query  867   LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspigl  1046
              P      Q+E +FPERPG+PECQ+Y++TGDCKFG  CKFHH R+R+    + +LSPIGL
Sbjct  273   APS--VGSQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHRRDRIPQRANCILSPIGL  330

Query  1047  plRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             PLRPG   C FY + G C+FG +CKFDHPMG   YN S SS  +AP  
Sbjct  331   PLRPGVQPCTFYLQNGFCRFGSTCKFDHPMGTLRYNPSASSLVDAPVA  378


 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 10/119 (8%)
 Frame = +3

Query  777   GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  956
             G SQA   ++S +     S+G +          G   L     +PERPG P+C +YM+TG
Sbjct  5     GRSQAMSGAQSGQAPEWSSEGAD---------TGLEGLSSSETYPERPGAPDCAYYMRTG  55

Query  957   DCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHP  1133
              C +G+ C+++HPR+R      ++ +    P R GEP C FY + G CKFG SCKF HP
Sbjct  56    ICGYGSRCRYNHPRDR-AVVEAAVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHP  113


 Score = 77.4 bits (189),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 61/105 (58%), Gaps = 3/105 (3%)
 Frame = +3

Query  87   SSLSPPLAQE--TLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  260
            SS +P LA    +L   +  S+ + +   +P R GEP+C YY+RTG C+FG SC+F+H  
Sbjct  255  SSSTPSLAGAYPSLSSSTAPSVGSQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHRR  314

Query  261  NRKLAIAAARMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHP  392
            +R    A   +     P R G   C +YL+ G C+FG+TCKF HP
Sbjct  315  DRIPQRANCILSPIGLPLRPGVQPCTFYLQNGFCRFGSTCKFDHP  359



>ref|XP_006397979.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
 gb|ESQ39432.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
Length=525

 Score =   322 bits (826),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 182/366 (50%), Positives = 232/366 (63%), Gaps = 19/366 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
              E++WQL L S       TYP R G PDC+YY+RTG+C +G  CR+NHP +R    AA R
Sbjct  84    DESMWQLRLGSE------TYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRATVEAAVR  137

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YPER+G+P CQ+YLKTG CKFGA+CKFHHP++  G    V LN+ GYP+R  + +C
Sbjct  138   ATGQYPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGEKDC  197

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA---YPPVHSPTTPGQLSYPLS--RAS  635
              YY++TGQCKFG TCKFHHPQP+   VP   + A   YP V S   P Q   P S  R +
Sbjct  198   SYYLKTGQCKFGITCKFHHPQPAGTTVPPPPASAPQFYPSVQS-LMPDQYGGPSSSLRVA  256

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
                 P      +Y P+++  GVV +PG++ YS  +    SP +Q   VG +  YG+++ S
Sbjct  257   RTLLPGSYMQGAYGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQH-AVGATSLYGVTQLS  315

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
                     G+ PS  +   P G   LQ+E  FPERPG+PECQ+Y+KTGDCKFG  CKFHH
Sbjct  316   STTASLPPGVYPSLSS---PTG--ILQKEQTFPERPGEPECQYYLKTGDCKFGTSCKFHH  370

Query  993   PRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             PR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKFDHPMG   YN S SS 
Sbjct  371   PRDRIPPRANCVLSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSL  430

Query  1173  TNAPTV  1190
              +AP  
Sbjct  431   ADAPVA  436



>gb|KHG22563.1| hypothetical protein F383_29382 [Gossypium arboreum]
Length=475

 Score =   315 bits (808),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 238/368 (65%), Gaps = 19/368 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++WQLSLR  E+     YP R G PDC YY+RTGLC +G+ CR+NHP NR    AA R
Sbjct  31    EESMWQLSLRGAES-----YPERPGVPDCVYYMRTGLCGYGSRCRYNHPRNRAAVEAAVR  85

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+   G   +V LN+ GYPLRP + EC
Sbjct  86    ATGEYPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSQVPLNIYGYPLRPGEEEC  145

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP-------GQLSYPLSR  629
              YY++ GQCKFG TCKFHHPQP+   +P+     Y PV SP+ P          S  ++R
Sbjct  146   SYYLKMGQCKFGVTCKFHHPQPAGTSMPVSAPQFYQPVQSPSVPMPEQYGGASASVRVAR  205

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
                +     QG  +Y P++   GVV +PG++ YS  +  V SP +Q   VG +  YGL++
Sbjct  206   PPLLPGSYVQG--AYGPVLFSPGVVPIPGWSHYSAPVSPVLSPGAQP-AVGATSLYGLTQ  262

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              S  +     G  PS  + T P    + Q++  FPERPG+PECQ+Y++TGDCKFG+ C++
Sbjct  263   LSS-STPSLAGPYPSLPSSTGPSS--SNQKDQTFPERPGEPECQYYLRTGDCKFGSTCRY  319

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPR+R++P  + +LSP+GLPLRPG   C+FY + G CKFG +CKFDHP+G   YN S S
Sbjct  320   HHPRDRVVPRTNCILSPMGLPLRPGVQPCSFYLQNGHCKFGSTCKFDHPVGAMRYNPSAS  379

Query  1167  STTNAPTV  1190
             S  + P  
Sbjct  380   SFIDMPVA  387



>ref|XP_009378917.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 32 [Pyrus x bretschneideri]
Length=571

 Score =   318 bits (815),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 179/381 (47%), Positives = 233/381 (61%), Gaps = 42/381 (11%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L S E+     YP R G P+C YY+RTG C +G  CR++HP +R   +A  R
Sbjct  139   EEQMWQLGLTSSES-----YPERLGVPNCVYYMRTGFCGYGGRCRYSHPRDRAAVVATVR  193

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YPERVG+P CQYYLKTG CKFGA+CK+HHP+  AG   R  LN+ GYPLRP + EC
Sbjct  194   ATGDYPERVGEPVCQYYLKTGTCKFGASCKYHHPKHGAGSLNRAPLNIYGYPLRPGENEC  253

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ------LSYPLSRA  632
              YY++TGQCKFG TCKFHHP P+    P      YP V SP    +       S  ++R 
Sbjct  254   SYYLKTGQCKFGITCKFHHPHPAGTTSPASAPQFYPSVQSPVPLAEQYGGASTSLRVARP  313

Query  633   SFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR-  806
               +T    QG  +Y P+++P GVV + G++ YS  L  V SP +Q  TVG +  YG+++ 
Sbjct  314   PLLTGSYVQG--TYGPVLIPPGVVPIQGWSPYSAPLSPVPSPGAQP-TVGATSLYGVTQL  370

Query  807   -----------SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKT  953
                        +S  ++VG    NPS               E VFPERPG+ ECQ+Y+KT
Sbjct  371   SSPTHGLASPYTSIPSSVGPSSSNPS---------------EQVFPERPGELECQYYLKT  415

Query  954   GDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHP  1133
             GDCK+G  C++HHPR+R +P    LLSPIGLPLRPGEP C FY + G C FG +CKFDHP
Sbjct  416   GDCKYGPSCRYHHPRDRTVPGITCLLSPIGLPLRPGEPPCRFYLKNGQCMFGSTCKFDHP  475

Query  1134  MGVFTYNISPSSTTNAPTVRH  1196
             +    YN+S SS  + P V++
Sbjct  476   VQTMRYNLSASSLVDMPVVQY  496



>ref|NP_182306.2| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 ref|NP_001078078.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 sp|Q84W91.2|C3H32_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 32; 
Short=AtC3H32; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 1 [Arabidopsis thaliana]
 gb|ABO45694.1| At2g47850 [Arabidopsis thaliana]
 gb|AEC10897.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 gb|AEC10899.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
Length=468

 Score =   315 bits (806),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 231/366 (63%), Gaps = 20/366 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             QE++W+L L       S +YP R G PDC+YY+RTG+C +G  CR+NHP +R    A  R
Sbjct  29    QESMWRLGL------GSDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRASVEATVR  82

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YPER G+P CQ+YLKTG CKFGA+CKFHHP++  G    V LN+ GYP+R  D EC
Sbjct  83    ATGQYPERFGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGDNEC  142

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA---YPPVHSPTTPGQLSYPLS--RAS  635
              YY++TGQCKFG TCKFHHPQP+   VP   + A   YP V S   P Q   P S  R +
Sbjct  143   SYYLKTGQCKFGITCKFHHPQPAGTTVPPPPASAPQFYPSVQS-LMPDQYGGPSSSLRVA  201

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
                 P      +Y P+++  GVV +PG++ YS  +    SP +Q   VG +  YG+++ +
Sbjct  202   RTLLPGSYMQGAYGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQH-AVGATSLYGVTQLT  260

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
                     G+ PS  +   P G   +Q+E  FPERPG+PECQ+Y+KTGDCKFG  CKFHH
Sbjct  261   ST-TPSLPGVYPSLSS---PTG--VIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHH  314

Query  993   PRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             PR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKFDHPMG   YN S SS 
Sbjct  315   PRDRVPPRANCVLSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSL  374

Query  1173  TNAPTV  1190
              +AP  
Sbjct  375   ADAPVA  380



>ref|XP_006294141.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
 gb|EOA27039.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
Length=471

 Score =   314 bits (805),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 232/366 (63%), Gaps = 20/366 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+L L S       TYP R G PDC+YY+RTG+C +G  CR+NHP +R    A  R
Sbjct  31    EESMWRLGLGSE------TYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRASVEATVR  84

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YPER+G+P CQ+YLKTG CKFGA+CKFHHP++  G    V LN+ GYP+R  + EC
Sbjct  85    ATGQYPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGENEC  144

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA---YPPVHSPTTPGQLSYPLS--RAS  635
              YY++TGQCKFG TCKFHHPQP+   VP   + A   YP V S   P Q   P S  R +
Sbjct  145   SYYLKTGQCKFGITCKFHHPQPAGTTVPPPPASAPQFYPSVQS-LMPDQYGGPSSSLRVA  203

Query  636   FITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSS  812
                 P      +Y P+++  GVV +PG++ YS  +    SP +Q   VG +  YG+++ S
Sbjct  204   RTLLPGSYMQGAYGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQH-AVGATSLYGVTQLS  262

Query  813   EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHH  992
                     G+ PS  +   P G   +Q+E  FPERPG+PECQ+Y+KTGDCKFG  CKFHH
Sbjct  263   ST-TPSLPGVYPSLSS---PTG--VIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHH  316

Query  993   PRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  1172
             PR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKFDHPMG   YN S SS 
Sbjct  317   PRDRVPPRANCILSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGNIRYNPSASSL  376

Query  1173  TNAPTV  1190
              +AP  
Sbjct  377   ADAPVA  382



>ref|XP_011090931.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Sesamum 
indicum]
Length=496

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 186/378 (49%), Positives = 238/378 (63%), Gaps = 28/378 (7%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L         +YP R  EPDC YY+RTG C +G  CRFNHP +R +A+ A R
Sbjct  41    EEPMWQLGLGGGPE----SYPERPDEPDCIYYLRTGFCGYGNRCRFNHPRDRSMAMGALR  96

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPER GQP CQYY++TG CKFGA+CK+HHP+   G +  V LNV GYPLRP + E
Sbjct  97    AGGGEYPERAGQPVCQYYMRTGMCKFGASCKYHHPKHGVGSSAPVTLNVYGYPLRPGEKE  156

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMV---------PLRGSPAYPPVHSPTTPG-----  605
             C YY++TGQCKFG TCKFHHPQP+ + V         PL     YP V SP+        
Sbjct  157   CSYYVKTGQCKFGVTCKFHHPQPAGIQVPAPPGPGAGPLAAPAGYPSVQSPSGQSSQQYG  216

Query  606   --QLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTV  776
               Q ++P++R + +  P    P SY P++ P GVV VPG+  Y   +  V+S  S Q TV
Sbjct  217   VIQGNWPVARPAML--PGSYVPGSYGPMLFPPGVVPVPGWTPYPAPVSPVAS-SSAQPTV  273

Query  777   GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  956
             G    YGL++ S  A   +    P     +      + Q+E+ FPERPGQPECQ+Y+KTG
Sbjct  274   GPGPIYGLTQLSPSATAYT---GPFLSVTSSAGPSSSSQKEHPFPERPGQPECQYYLKTG  330

Query  957   DCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPM  1136
             DCKFGA CK+HHP E   P  + +LSP+GLPLRPG PLC+ Y++ G+CKFGPSCKFDHPM
Sbjct  331   DCKFGATCKYHHPPEWSAPKINFVLSPMGLPLRPGAPLCSHYAQNGVCKFGPSCKFDHPM  390

Query  1137  GVFTYNISPSSTTNAPTV  1190
              + +Y+ S SS T+ P  
Sbjct  391   RILSYSPSASSLTDMPVA  408



>ref|XP_010243539.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Nelumbo 
nucifera]
Length=471

 Score =   313 bits (803),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 233/356 (65%), Gaps = 29/356 (8%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L S ++     YP R  EPDC Y++RTG C +GA CRFNHP +R   + +AR
Sbjct  31    EEPMWQLGLGSRDS-----YPERPNEPDCVYFMRTGFCGYGARCRFNHPRDRSAVLGSAR  85

Query  291   -MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
                GEYPERVGQP CQY+LKTG CKFGA+CK+HHPR   G A  V+LN  GYPLRP + E
Sbjct  86    PGAGEYPERVGQPVCQYFLKTGTCKFGASCKYHHPRHGGGSAIPVSLNYHGYPLRPGEKE  145

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ------LSYPLSR  629
             C YY++TG CKFG TCKFHHPQP+ + VP      YP V SP+ P Q       S+ ++R
Sbjct  146   CAYYVKTGHCKFGVTCKFHHPQPAGVSVPAPAPQFYPTVQSPSVPSQQYGGMSASWQVAR  205

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
             +  +     QG  +Y  +++  GVV +PG++ Y   +  V+SP +Q  TVG    YG+++
Sbjct  206   SPLLPGSYVQG--AYGHVLLSPGVVPIPGWSPYPAPVSPVASPGAQP-TVGGGPIYGVTQ  262

Query  807   SSEVANVGSQGMNPSYRAGTLPM-----GYYALQRENVFPERPGQPECQFYMKTGDCKFG  971
              S           P+Y     P+        + Q+E+V+PERPGQPECQ+YM+TG+CKFG
Sbjct  263   LSP--------STPAYAGPYPPLPSSAGPSGSSQKEHVYPERPGQPECQYYMRTGECKFG  314

Query  972   AVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMG  1139
             + CK+HHP E + P  + +LSP+GLPLRPG   C FY+++G+CKFGP+CKFDHPMG
Sbjct  315   SSCKYHHPLEWITPKTNCVLSPMGLPLRPGAQPCTFYTQHGVCKFGPTCKFDHPMG  370



>ref|XP_010921758.1| PREDICTED: zinc finger CCCH domain-containing protein 6 [Elaeis 
guineensis]
Length=466

 Score =   313 bits (801),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 223/358 (62%), Gaps = 25/358 (7%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+L            YP R GEPDC+YY+RTG C +G  CR+NHP +R     A R
Sbjct  22    EESMWRLG--LGGGGGDSPYPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGAGR  79

Query  291   MK-GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
                GEYPERVGQP C+YY++TG CKFG+TCK+HHPR   G    V LN  GYPLRP + E
Sbjct  80    TAAGEYPERVGQPVCEYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLLNYSGYPLRPGEKE  139

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP------LSR  629
             C YYM+TGQCKFGSTCKFHHPQP    VP      YP V  PT P    YP      + R
Sbjct  140   CSYYMKTGQCKFGSTCKFHHPQPGGASVPSPAPTFYPTVQPPTVPSPHPYPPLASWQVGR  199

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
              S +  P    P SY P+++  GVV V G+  Y   +  V SP  QQ TV     YGLS 
Sbjct  200   PSVL--PGSYMPGSYGPMLLSPGVVPVQGWGPYPAPVSPVVSPGGQQ-TVQAGHLYGLS-  255

Query  807   SSEVANVGSQGMNPSYRAGTLPM-----GYYALQRENVFPERPGQPECQFYMKTGDCKFG  971
             S   A+V      PSY+    P+          QRE+ FPERPGQPECQFYM+TGDCKFG
Sbjct  256   SQVTASV------PSYQGPYTPVSSSAGPSSGSQREHTFPERPGQPECQFYMRTGDCKFG  309

Query  972   AVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVF  1145
             + C++HHPR+  +P  +  LSP+GLPLRPG   CA+Y+++G+CKFGP+CKFDHPMG  
Sbjct  310   STCRYHHPRDWSMPKTNCALSPLGLPLRPGAQPCAYYAQHGVCKFGPTCKFDHPMGTL  367



>ref|XP_010241841.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Nelumbo nucifera]
Length=475

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 175/351 (50%), Positives = 231/351 (66%), Gaps = 19/351 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQ+ L S ++     YP R  EPDC YY+RTG C +GA CR+NHP +R   + +AR
Sbjct  31    EEPMWQMGLVSRDS-----YPERPNEPDCVYYMRTGFCGYGARCRYNHPRDRSAVLGSAR  85

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPERVGQP CQY++KTG CKFGA+CK+HHPR   G    V+LN  GYPLRP + E
Sbjct  86    PGGVEYPERVGQPVCQYFMKTGTCKFGASCKYHHPRHGGGSVSPVSLNYHGYPLRPGEKE  145

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ------LSYPLSR  629
             C YY++TGQCKFG TCKFHHPQP+   VP   S  YP V SP+ P Q       ++ ++R
Sbjct  146   CSYYVKTGQCKFGVTCKFHHPQPAGSSVPAPASSFYPMVQSPSVPSQQYGGVAANWQVAR  205

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
                +     QG  +Y  +++  G+VSVPG++ Y   +  V+SP +Q  TVG    YG+++
Sbjct  206   PPLLPGSYVQG--AYGHVLLSPGMVSVPGWSPYPAPVSPVASPGTQP-TVGGGPLYGVTQ  262

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              S  A   +    P     +      + Q+E+V+PERPG PECQ+YM+TG+CKFG+ CK+
Sbjct  263   LSPSAPAYA---GPYPPLPSSAGPSSSSQKEHVYPERPGHPECQYYMRTGECKFGSSCKY  319

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMG  1139
             HHP E + P  + +LSPIGLPLR G   CAFY++YGICKFGP+CKFDHPMG
Sbjct  320   HHPPEWITPKTNCILSPIGLPLRSGASPCAFYTQYGICKFGPTCKFDHPMG  370



>ref|XP_007050814.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
 gb|EOX94971.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
Length=476

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 234/368 (64%), Gaps = 19/368 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++WQLSLR  E+     YP R G PDC YY+RTG C +G  CR+NHP NR    AA R
Sbjct  31    EESMWQLSLRGTES-----YPERPGVPDCVYYMRTGFCGYGNRCRYNHPRNRAAVEAAVR  85

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC
Sbjct  86    ATGEYPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSHVPLNIYGYPLRPGEKEC  145

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP-------GQLSYPLSR  629
              YY++TGQCKFG TCKFHHPQP+   +P      Y PV SP+ P          S  ++R
Sbjct  146   SYYLKTGQCKFGITCKFHHPQPAGTSMPASAPQFYQPVQSPSVPMPEQYGGASTSVRVAR  205

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
                +     QG  +Y P++   GVV +PG++ YS  +  V SP +Q   VG +  YGL++
Sbjct  206   PPLLPGSYVQG--AYGPVLFSPGVVPIPGWSHYSAPVSPVLSPGAQP-AVGATSLYGLTQ  262

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              S  +     G   S  + T P    + Q+E  FPERPG+PECQ+Y++TGDCKFG+ C++
Sbjct  263   LSS-STPSLAGPYSSVPSSTGPAS--SNQKEQTFPERPGEPECQYYLRTGDCKFGSSCRY  319

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPR+R++P  + +LSP+GLPLRPG   C+FY + G CKFG +CKFDHPMG   Y+ S S
Sbjct  320   HHPRDRVVPRTNCVLSPMGLPLRPGVQPCSFYLQNGHCKFGSTCKFDHPMGTMRYSPSAS  379

Query  1167  STTNAPTV  1190
             S  + P  
Sbjct  380   SLIDMPVA  387



>ref|XP_011013662.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=476

 Score =   311 bits (797),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 175/375 (47%), Positives = 234/375 (62%), Gaps = 26/375 (7%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L   E+     YP R  E DC YY+RTG C +GA CR+NHP +R  A+ A R
Sbjct  29    EEGVWQLGLGETES----EYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAALEAGR  84

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G E+PERVGQP CQYY++TG CKFGA+CK++HP+        V+LN  GYPLRP D E
Sbjct  85    TGGGEFPERVGQPLCQYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNFYGYPLRPGDKE  144

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVP-------LRGSPA---YPPVHSPTTPGQLSY  617
             C YY++TGQCKFG+TCKFHHPQP+NM +P       +   PA   YP + SP+ P    Y
Sbjct  145   CTYYIKTGQCKFGATCKFHHPQPANMQIPAQSLAPQVASVPAPTLYPTMQSPSVPSSQQY  204

Query  618   P--LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQ  788
                ++R   +     QGP  Y P+++  G+V  P ++ Y   +  ++SP +Q      S 
Sbjct  205   GVMVARPPLLPGSYVQGP--YGPMLLSPGLVPYPSWSPYPAPVSPIASPNAQPAVCSGS-  261

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMG-YYALQRENVFPERPGQPECQFYMKTGDCK  965
              YG+S  S  A         +Y++ T   G   + Q+E+VFPERPGQPECQ+YMKTGDCK
Sbjct  262   VYGISPLSPSAPA----YTGAYQSVTSAKGPSSSSQKEHVFPERPGQPECQYYMKTGDCK  317

Query  966   FGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVF  1145
             F + C++HHP E +    + +LSP+G PLRPG P C  Y+++G CKFGP+CKFDHPMG  
Sbjct  318   FESSCRYHHPPELVASKTNVVLSPMGFPLRPGAPTCTHYTQHGQCKFGPACKFDHPMGTL  377

Query  1146  TYNISPSSTTNAPTV  1190
             +Y+ S SS  + P  
Sbjct  378   SYSPSASSLADMPVA  392



>ref|XP_010270053.1| PREDICTED: zinc finger CCCH domain-containing protein 12 isoform 
X1 [Nelumbo nucifera]
Length=450

 Score =   310 bits (795),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 178/381 (47%), Positives = 244/381 (64%), Gaps = 43/381 (11%)
 Frame = +3

Query  111   QETLWQLSLRSMETME-----SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  275
             ++++W+L ++  +  E     S  YP R GEPDC YY+RTGLC +G++CRFNHP+    A
Sbjct  25    EDSMWRLKIQPHDNQEGVAANSSPYPDRPGEPDCIYYLRTGLCGYGSNCRFNHPA---YA  81

Query  276   IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  455
               A + +GE PERVGQP+CQY+LKTG CKFGATCK+HHPRD+   A  V LN+LG P+R 
Sbjct  82    GRAVQYRGELPERVGQPDCQYFLKTGTCKFGATCKYHHPRDRHDTA-HVLLNILGLPMRQ  140

Query  456   NDIECPYYMRTGQCKFGSTCKFHHPQPSN--MMVPLRGSPAY--------PPVHSPTTPG  605
              +  CPYYMRTG CKFG  CKFHHPQP+   ++ P+ G  AY        PP   P   G
Sbjct  141   EEKSCPYYMRTGSCKFGMACKFHHPQPATLGLVSPITGPTAYGSTGSSVAPPSGVPYISG  200

Query  606   QLSYPLSRASFITNPRWQGPSSYTPLIV--PQGVV-SVPGF-AYSGQLGSVSSPESQQLT  773
               ++ L RA +I++PR QGP +Y P+++   QG++ +  G+  Y+G L    SP S    
Sbjct  201   IPAWSLPRAPYISSPRMQGPQAYMPVVLSPSQGIIPAQQGWNTYTGTL----SPISSTSV  256

Query  774   VGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKT  953
             +G++ AY      E  + G   +     + ++P           FPERP QPECQ+YMKT
Sbjct  257   LGSNIAYNSKPQGESGSSGQVQL----LSTSVPH----------FPERPDQPECQYYMKT  302

Query  954   GDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHP  1133
             G CKFG  CK+HHP+ER+ P   S L P+GLPLRPG+ +C FY+ YGICK+GP+CK+DHP
Sbjct  303   GSCKFGPTCKYHHPKERIAPLATSTLGPLGLPLRPGQAVCTFYTLYGICKYGPTCKYDHP  362

Query  1134  MGV-FTYNIS-PSSTTNAPTV  1190
             +G  F+Y++S P+ +   PT+
Sbjct  363   LGAYFSYSMSLPALSMPDPTL  383



>ref|XP_002314462.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
 gb|EEF00633.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
Length=456

 Score =   309 bits (792),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 174/376 (46%), Positives = 236/376 (63%), Gaps = 28/376 (7%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL +   E+     YP R  E DC YY+RTG C +GA CR+NHP +R   + AAR
Sbjct  29    EEGVWQLEIGETES----EYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAVLGAAR  84

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G E+PERVGQP CQYY++TG CKFGA+CK++HP+        V+LN  GYPLRP + E
Sbjct  85    AGGGEFPERVGQPLCQYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNYYGYPLRPGERE  144

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVP-------LRGSPA---YPPVHSPTTPGQLSY  617
             C YY++TGQCKFG+TCKFHHPQP+NM +P       +   PA   YP + SP+ P    Y
Sbjct  145   CTYYIKTGQCKFGATCKFHHPQPANMQIPAQSLAPQVASVPAHTLYPTMQSPSVPSSQQY  204

Query  618   P--LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQ  788
                ++R   +     QGP  Y P+++   +V  P ++ Y   +  V+SP +Q   VG+  
Sbjct  205   GVMVARPPLLPGSYVQGP--YGPVLLSPSLVPYPSWSPYPAPVSPVASPNAQP-AVGSGS  261

Query  789   AYGLS--RSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDC  962
              YG+S    S  A  G+    P+ +  +      + Q+E+VFPERPGQPECQ+YMKTGDC
Sbjct  262   VYGISPLSPSAPAYTGAYQSIPTAKGPSS-----SSQKEHVFPERPGQPECQYYMKTGDC  316

Query  963   KFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  1142
             KF + C++HHP E +    + +LSP+GLPLRPG P C  Y+++G CKFGP+CKFDHPMG 
Sbjct  317   KFESSCRYHHPPELVTSKTNVVLSPMGLPLRPGAPTCTHYTQHGQCKFGPACKFDHPMGT  376

Query  1143  FTYNISPSSTTNAPTV  1190
              +Y+ S SS  + P  
Sbjct  377   LSYSPSASSLADMPVA  392



>ref|XP_007200997.1| hypothetical protein PRUPE_ppa005229mg [Prunus persica]
 gb|EMJ02196.1| hypothetical protein PRUPE_ppa005229mg [Prunus persica]
Length=471

 Score =   309 bits (792),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 179/368 (49%), Positives = 231/368 (63%), Gaps = 20/368 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L S E+     YP R G P+C YY+RTG C +G  CR+NHP +R   +AA R
Sbjct  27    EEQMWQLGLTSSES-----YPERPGVPNCVYYMRTGFCGYGIRCRYNHPRDRAAVVAAVR  81

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YPERVG+P CQYYLKTG CKFGA+CKFHHP+   G   R  LN+ G PLRP + EC
Sbjct  82    ATGDYPERVGEPICQYYLKTGTCKFGASCKFHHPKHGGGSLSRAPLNIYGLPLRPGENEC  141

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP-------GQLSYPLSR  629
              YY++TGQCKFG TCKFHHPQP+   +P      YP V SP+ P             + R
Sbjct  142   SYYLKTGQCKFGITCKFHHPQPAGTTIPASAPQFYPSVQSPSVPMAEQFGGASTGLRVPR  201

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRS  809
                +     QG  +Y P+++P GVV + G++YS  L  V SP +Q  TVG +  YG+++ 
Sbjct  202   PPLLPGSYVQG--AYGPVLIPPGVVPIQGWSYSAPLSPVLSPGAQP-TVGATSLYGVTQL  258

Query  810   SEVANVGSQGMNPSYRAGTLPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
             S      + G+   Y +    +G   +   E VFPERPG+PECQ+Y+KTGDCK+G  C++
Sbjct  259   SSP----THGLARPYTSVPSAVGPSSSSPSEQVFPERPGEPECQYYLKTGDCKYGPSCRY  314

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPR+R+IP  + LLSPIGLPLRPG   C FY + G CKFG +CKFDHP+G   YN S S
Sbjct  315   HHPRDRVIPRTNCLLSPIGLPLRPGVQPCTFYLQNGHCKFGSTCKFDHPIGTMRYNPSAS  374

Query  1167  STTNAPTV  1190
             S  + P  
Sbjct  375   SLVDMPVT  382



>ref|XP_002276435.1| PREDICTED: zinc finger CCCH domain-containing protein 34 isoform 
X1 [Vitis vinifera]
 emb|CBI26091.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 180/374 (48%), Positives = 230/374 (61%), Gaps = 24/374 (6%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E LWQL L          YP R  E DC YY++TG C +GA CRFNHP +R       R
Sbjct  31    EEPLWQLGLGGGGE----AYPERPDEADCIYYLKTGFCGYGARCRFNHPRDRGGVGGTVR  86

Query  291   -MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
                GE+PERVGQP CQ+Y+KTG CKFGA+CK+HHPR   G    V LN  GYPLRP + E
Sbjct  87    PGGGEFPERVGQPVCQFYMKTGTCKFGASCKYHHPRQGGGTVSPVTLNYFGYPLRPGEKE  146

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA----------YPPVHSPTTPGQLSY  617
             C YY++TG CKFG TCKFHHPQP ++ +   G  A          YP V SP+ P    Y
Sbjct  147   CSYYVKTGLCKFGETCKFHHPQPDSIQLSTPGPAALPAPVPAHTLYPTVQSPSVPSSQQY  206

Query  618   PL--SRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQ  788
              L  +R   + +  + GP  Y+P+++P G+V  PG++ Y   +  V+SP S Q TVG+ Q
Sbjct  207   GLVVARPPLLPSSYFHGP--YSPVLIPPGMVPFPGWSHYPAPVSPVASP-STQPTVGSGQ  263

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              YGL+  S  A   +    P     +      + Q+E +FPERPGQPECQ+YM+TGDCKF
Sbjct  264   MYGLTPLSPSAPAYT---GPYTPLPSSVGPSSSSQKEQIFPERPGQPECQYYMRTGDCKF  320

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFT  1148
             G+ CK+HHP E   P  + +LSP+GLPLRPG P C  Y++ GICKFGP+CKFDHPMG  +
Sbjct  321   GSSCKYHHPPEWDTPKTNCVLSPMGLPLRPGAPQCTHYAQRGICKFGPTCKFDHPMGTLS  380

Query  1149  YNISPSSTTNAPTV  1190
             Y+ S SS  + P  
Sbjct  381   YSPSASSLADMPVA  394



>ref|XP_010652064.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Vitis 
vinifera]
 emb|CBI32253.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 172/368 (47%), Positives = 229/368 (62%), Gaps = 20/368 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+L L S E+     YP R G  DC YY++TG C FG+ CR+NHP +R        
Sbjct  31    EESMWRLGLSSRES-----YPERPGVADCVYYMKTGFCGFGSRCRYNHPRDRSSVSTLRS  85

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               GEYPER+G+P CQ+YLKTG CKFGA+C+FHHPR+  G    V+LN+ GYPLR  + EC
Sbjct  86    GGGEYPERIGEPACQFYLKTGTCKFGASCRFHHPRNGGGSMSHVSLNIYGYPLRLGEKEC  145

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP-------GQLSYPLSR  629
              YY++TGQCKFG TCKFHHPQP+   +P      YP V SP+ P          S+ + R
Sbjct  146   SYYLKTGQCKFGITCKFHHPQPAGTSLPASAPTFYPTVQSPSVPTPTQYGGTSTSWRVPR  205

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
                +     QGP  Y P++ P GVV +PG++ YS  +  V SP +Q  TVG    YG+++
Sbjct  206   PPVLPGSYVQGP--YGPVLFPPGVVPIPGWSPYSTPVSPVLSPGAQP-TVGAGSVYGVTQ  262

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
                   +     +    AG       + Q+E VFPERPGQ ECQ+Y++TGDCKFG+ C++
Sbjct  263   LPSTHTLAGPYASLPSSAGP----SSSNQKEQVFPERPGQQECQYYLRTGDCKFGSSCRY  318

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPRE ++P  + +LSP+GLPLRPG   C FY + G CKFG +CKFDHP+G   Y+ S S
Sbjct  319   HHPREWVVPKTNCVLSPLGLPLRPGVQPCTFYLQNGYCKFGSTCKFDHPLGNMRYSPSAS  378

Query  1167  STTNAPTV  1190
             S T+ P  
Sbjct  379   SLTDMPVA  386



>ref|XP_008802110.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
[Phoenix dactylifera]
Length=466

 Score =   308 bits (788),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 225/359 (63%), Gaps = 25/359 (7%)
 Frame = +3

Query  108   AQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  287
              +E++W+L L      +   YP R GEPDC+YY+RTG C +G  CR+NHP +R       
Sbjct  21    VEESMWRLGLGGGGGGDM-PYPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGGG  79

Query  288   RMK-GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
             R   GEYPERVGQP C+YY++TG CKFG+TCK+HHPR   G    V  N  G+PLRP + 
Sbjct  80    RTGVGEYPERVGQPVCEYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLFNYYGFPLRPGEK  139

Query  465   ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP------LS  626
             EC YYM+TGQCKFGSTCKFHHPQP+   VP      YP V SPT P    Y       + 
Sbjct  140   ECSYYMKTGQCKFGSTCKFHHPQPAGASVPSPAPTFYPTVQSPTVPSPHPYSSLGGWQVG  199

Query  627   RASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLS  803
             R S +  P    P SY P+++  GVV V G+  Y   +  V SP  QQ TV     YGL 
Sbjct  200   RPSVL--PGSYMPGSYGPMLLSPGVVPVQGWGPYPAPVSPVVSPGGQQ-TVQAGHLYGL-  255

Query  804   RSSEVANVGSQGMNPSYRAGTLPM-----GYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              SS+ A+V      P+Y     P+        + QRE+ FPERPGQPECQFYM+TGDCKF
Sbjct  256   -SSQTASV------PAYPGPYTPVSSSAGPSSSSQREHTFPERPGQPECQFYMRTGDCKF  308

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVF  1145
             GA C++HHPR+  IP  +  LSP+GLPLRPG   CA+Y+++G+CKFGP+CKFDHPMG  
Sbjct  309   GATCRYHHPRDWSIPKTNCALSPLGLPLRPGAQPCAYYAQHGVCKFGPTCKFDHPMGTL  367



>ref|XP_011018690.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=479

 Score =   308 bits (789),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 236/377 (63%), Gaps = 24/377 (6%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L   E++    YP R  E DC YY+RTG C +GA CR+NHP +R   + A R
Sbjct  29    EEGVWQLGLGETESV----YPERPNEQDCMYYLRTGWCGYGARCRYNHPRDRSAVLGAPR  84

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPERVGQP CQYY++TG CKFGA+CK+HHP+   G A  V+LN  GYPLRP + E
Sbjct  85    AGGAEYPERVGQPLCQYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYYGYPLRPGERE  144

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG-SPAYPPVHSPT-----------TPGQL  611
             C YY++TGQCKFG+TCKFHHPQP N+ +P +  +P   PV SPT           +  Q 
Sbjct  145   CTYYIKTGQCKFGATCKFHHPQPGNIQIPAQSLAPQIAPVPSPTLYPSVQSPSVPSSQQY  204

Query  612   SYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQ  788
                ++R   +     QGP  Y P+++   VV  P +  Y   +  V+SP +Q   VG+  
Sbjct  205   GVMVARPPLLPGSYVQGP--YGPVLLSPSVVPYPSWNPYPAPVSPVASPNTQP-AVGSGS  261

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              YGLS  S  A   + G   S    T P    + Q+E++FPERPGQPECQ+Y+KTGDCKF
Sbjct  262   VYGLSALSPSAPAYT-GAFQSIPPATGPSS--STQKEHLFPERPGQPECQYYIKTGDCKF  318

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFT  1148
              + C++HHP E ++   + +LSPIGLPLRPG P C+ Y++ G CKFGP+CKFDHPMG  +
Sbjct  319   RSSCRYHHPPELVVSKTNVVLSPIGLPLRPGAPTCSHYTQRGQCKFGPACKFDHPMGTLS  378

Query  1149  YNISPSSTTNAPTVRHF  1199
             Y+ S SS  + P   + 
Sbjct  379   YSPSASSLADMPVAPYL  395



>gb|EYU22370.1| hypothetical protein MIMGU_mgv1a005385mg [Erythranthe guttata]
Length=485

 Score =   307 bits (787),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 175/381 (46%), Positives = 229/381 (60%), Gaps = 31/381 (8%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L         +YP R  EPD  YY+R G CR+G  CRFNHP  R + + A R
Sbjct  31    EEPMWQLGLGGGPE----SYPERPDEPDRMYYLRIGFCRYGNRCRFNHPRVRSMVMGALR  86

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPERVGQP CQYY++TG CKFG +CK+ HP+   G +    LN  GYPLRP + E
Sbjct  87    AGGGEYPERVGQPICQYYMRTGMCKFGTSCKYDHPKHGLGSSAPAGLNFYGYPLRPGEKE  146

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG-------------SPAYPPVHSPTTPG-  605
             C YY +TGQCKFG TCK+HHPQPS + +P                 P YP   SP+    
Sbjct  147   CSYYAKTGQCKFGVTCKYHHPQPSGIQMPQAPQPPGPGGPFAGPTQPVYPTGPSPSIQSS  206

Query  606   ------QLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQ  767
                   Q ++P++R + +  P    P +Y P+++P GVV VPG+       S  +  S Q
Sbjct  207   QQYSVIQGNWPIARPAML--PGSYVPGNYGPMLLPPGVVHVPGWTPYQTPASPLASSSNQ  264

Query  768   LTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYM  947
               VG +Q YG+++ S  A   +    P   AG       + Q+E+ FPERPGQPECQ+Y+
Sbjct  265   PPVGGAQIYGITQLSSSATAYAGPYMPITSAGQS----SSSQKEHAFPERPGQPECQYYL  320

Query  948   KTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFD  1127
             +TGDCKFGA CK+HHP E  +P  + +LS +GLPLRPG PLC+ Y++ G+CKFGPSCKFD
Sbjct  321   RTGDCKFGATCKYHHPSEWSVPRGNFVLSAMGLPLRPGAPLCSHYAQNGMCKFGPSCKFD  380

Query  1128  HPMGVFTYNISPSSTTNAPTV  1190
             HPM   +Y+ S SS T+ P  
Sbjct  381   HPMKTLSYSPSASSLTDMPVA  401



>ref|XP_002516892.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF45506.1| nucleic acid binding protein, putative [Ricinus communis]
Length=481

 Score =   307 bits (786),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 230/365 (63%), Gaps = 37/365 (10%)
 Frame = +3

Query  105   LAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  284
             + +E  WQL L  +E      YP R  E DC YY+RTG C +G+ CRFNHP +R   + A
Sbjct  27    VLEEGDWQLGLGEVEP----GYPERPEEADCIYYLRTGFCGYGSRCRFNHPRDRGAVLGA  82

Query  285   ARM-KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
             AR    E+PERVGQP CQYY++TG CKFGA+CK+HHP+   G A  V+LN  GYPLRP +
Sbjct  83    ARAGAAEFPERVGQPVCQYYMRTGTCKFGASCKYHHPKQGGGSANPVSLNYYGYPLRPGE  142

Query  462   IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA---------------YPPVHSPT  596
              EC YY++TGQCKFG TCKFHHPQP+N+ +  + SPA               YP V SP+
Sbjct  143   KECTYYVKTGQCKFGVTCKFHHPQPANLQIQAQ-SPALQVAPVPAPVPASALYPNVQSPS  201

Query  597   TPGQLSYPL--SRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQ  767
              P    Y L  +R   +     QGP  Y P++V  GVV  P ++ Y G +  V+SP S Q
Sbjct  202   VPSTQQYGLVVARPPLLPGSYVQGP--YGPMLVSPGVVPYPSWSPYPGPISPVASP-STQ  258

Query  768   LTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQREN-VFPERPGQPECQFY  944
             L VG S  YG+++ S  A        P+Y  G   M   + Q+E   FPERPGQPECQ+Y
Sbjct  259   LGVG-SGVYGITQLSPSA--------PAYTGGYQAMPSSSNQKEQPSFPERPGQPECQYY  309

Query  945   MKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKF  1124
             MKTGDCKFG+ CK+HHP E + P  + +LSP+GLPLRPG P C  Y++ G CKFGP+CKF
Sbjct  310   MKTGDCKFGSSCKYHHPPELIAPKTNVVLSPMGLPLRPGAPHCTHYTQRGQCKFGPACKF  369

Query  1125  DHPMG  1139
             DHPMG
Sbjct  370   DHPMG  374



>ref|XP_008438828.1| PREDICTED: zinc finger CCCH domain-containing protein 34 [Cucumis 
melo]
Length=481

 Score =   306 bits (785),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 174/376 (46%), Positives = 235/376 (63%), Gaps = 29/376 (8%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             ++LW L  R  ++     YP R  E DC YY+RTG C +G+ CRFNHP  R  A+  +R+
Sbjct  31    DSLWPLGSRDRDS-----YPERPDEADCIYYLRTGFCGYGSRCRFNHPRERSPALGGSRL  85

Query  294   KG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
              G EYPER+GQP CQYY++TG CKFGA+CK+HHP+ + G    V+LN  GYPLRP + EC
Sbjct  86    GGREYPERIGQPVCQYYMRTGMCKFGASCKYHHPQQERGSLSPVSLNFYGYPLRPGEKEC  145

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNM---------MVPLRGS-PA---YPPVHSPTTPGQL  611
              YY++ GQCKFG+TCKFHHP+P+ +         + P+ G  PA   YPPV SP+     
Sbjct  146   SYYLKNGQCKFGATCKFHHPEPAGLQFPAPSPVQVTPIAGQVPAPSVYPPVQSPSAHSSQ  205

Query  612   SYP--LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGN  782
              Y   L+R S +++P   GP  Y P++V  GVV  P ++ Y   +  V+SP S Q +VG+
Sbjct  206   QYGVILARPSLLSSPYVPGP--YGPMLVSPGVVQFPSWSPYPAPMSPVASP-SAQPSVGS  262

Query  783   SQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDC  962
                YG++  S  A+  +    P   AG         Q+E+ FPERPGQPECQ+YM+TGDC
Sbjct  263   GPLYGMAHVSPSASAFAGSYQPMPSAGPSSTS----QKEHSFPERPGQPECQYYMRTGDC  318

Query  963   KFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  1142
             KFG+ C++HHP E +   P  +LS +GLPLRPG P C  + + G+CKFGP+CKFDH M  
Sbjct  319   KFGSSCRYHHPPELVTSRPSVVLSQLGLPLRPGAPPCTHFMQRGMCKFGPACKFDHSMDR  378

Query  1143  FTYNISPSSTTNAPTV  1190
              +Y+ S SS  + P  
Sbjct  379   LSYSPSASSLADMPVA  394



>ref|XP_006380188.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
 gb|ERP57985.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
Length=477

 Score =   306 bits (784),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 234/377 (62%), Gaps = 24/377 (6%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L   E+     YP R  E DC YY+RTG C +GA CR+NHP +R   + AAR
Sbjct  29    EEGVWQLGLGETES----EYPERSNEQDCMYYLRTGFCGYGARCRYNHPRDRNAVLGAAR  84

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPER GQP CQYY++TG CKFGA+CK+HHP+   G A  V+LN  GYPLRP + E
Sbjct  85    AGGAEYPERAGQPLCQYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYYGYPLRPGERE  144

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG-SPAYPPVHSPT-----------TPGQL  611
             C YY++TGQCKFG+TCKFHHPQP N+ +P +  +P   PV  PT           +  Q 
Sbjct  145   CTYYIKTGQCKFGATCKFHHPQPGNIQIPAQSLAPQIAPVPGPTLYPSVQSPSVPSSQQY  204

Query  612   SYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQ  788
                ++R   +     QGP  Y P+++   VV  P +  Y   +  V+SP +Q   VG+  
Sbjct  205   GVMVARPPLLPGSYVQGP--YGPVLLSPSVVPYPSWNPYPAPVSPVASPNTQP-AVGSGS  261

Query  789   AYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKF  968
              YG+S  S  A   + G   S    T P    + Q+E++FPERPGQPECQ+Y+KTGDCKF
Sbjct  262   VYGMSALSPSAPAYT-GAFQSIPPATGPSS--STQKEHLFPERPGQPECQYYIKTGDCKF  318

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFT  1148
              + C++HHP E ++   + +LSPIGLPLRPG P C+ Y++ G CKFGP+CKFDHPMG  +
Sbjct  319   RSSCRYHHPPELVVSKSNVVLSPIGLPLRPGAPTCSHYTQRGQCKFGPACKFDHPMGTLS  378

Query  1149  YNISPSSTTNAPTVRHF  1199
             Y+ S SS  + P   + 
Sbjct  379   YSPSASSLADMPVAPYL  395



>ref|XP_010507840.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Camelina sativa]
 ref|XP_010507841.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Camelina sativa]
Length=475

 Score =   305 bits (782),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 183/401 (46%), Positives = 243/401 (61%), Gaps = 27/401 (7%)
 Frame = +3

Query  27    MDFEAAAGISASMASVTEGPSSLSPPLA----QETLWQLSLRSMETMESGTYPVRDGEPD  194
             MD  A   I+ S ++  + P   +P  A    +E++W+L L S ET     YP R G PD
Sbjct  1     MDMYARNPINGSQSA--QAPPDWTPADADSGLEESMWRLGLGSSET-----YPERLGAPD  53

Query  195   CSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGAT  374
             C+YY+RTG+C +G  CR+NHP +R    A  R  G+YPER+G+  CQ+YLKTG CKFGA+
Sbjct  54    CAYYMRTGVCGYGNRCRYNHPRDRASVEATVRATGQYPERIGELPCQFYLKTGTCKFGAS  113

Query  375   CKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  554
             CKFHHP++  G    V LN+ GYP+R  + EC YY++TGQCKFG TCKFHHPQP+   VP
Sbjct  114   CKFHHPKNAGGSMSHVPLNIYGYPVREGENECSYYLKTGQCKFGITCKFHHPQPAGTSVP  173

Query  555   LR-----GSPAYPPVHSPTTPGQLSYPLS--RASFITNPRWQGPSSYTPLIVPQGVVSVP  713
                     +P + P      P Q   P S  R +    P      +Y P+++  GVV +P
Sbjct  174   PPPPPPASAPQFYPSVQSLMPDQYGGPSSSLRVARTLLPGSYMQGAYGPMLLTPGVVPIP  233

Query  714   GFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYAL  890
             G++ YS  +    SP +Q   VG +  YG+++ S      S  +   Y + + P G   +
Sbjct  234   GWSPYSAPVSPALSPGAQH-AVGATSLYGVTQLSST----SPSLPGVYPSLSSPTG--VI  286

Query  891   QREN-VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEP  1067
             Q+E   FPERPG+PECQ+Y+KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG  
Sbjct  287   QKEQAAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGVQ  346

Query  1068  LCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
              C FY + G CKFG +CKFDHP+G   YN S SS  +AP  
Sbjct  347   RCTFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLADAPVA  387



>ref|XP_002520668.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF41630.1| nucleic acid binding protein, putative [Ricinus communis]
Length=478

 Score =   305 bits (781),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 179/368 (49%), Positives = 230/368 (63%), Gaps = 13/368 (4%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+L L +    ES  YP R G PDC YY+RTG C +G  CR+NHP NR    AA R
Sbjct  31    EESMWRLGLNNSGGGES--YPERPGVPDCVYYMRTGFCGYGNRCRYNHPRNRAAVEAAVR  88

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               GEYPER+G+P C++YLKTG CKFGA+CKFHHP+   G    V LN  GYPLRP + EC
Sbjct  89    ATGEYPERIGEPSCEFYLKTGTCKFGASCKFHHPKHGGGSLSHVPLNTHGYPLRPGENEC  148

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNP  650
              YY++TGQCKFG TCKFHHPQP+   +P      Y PV SP+ P    Y  + AS    P
Sbjct  149   SYYLKTGQCKFGITCKFHHPQPAGSSLPESAPQFYQPVQSPSIPIPDQYGGASASLRVRP  208

Query  651   RW------QGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR-  806
                     QG  +Y P++   GVV +PG++ YS  +  V SP S Q  VG +  YG+++ 
Sbjct  209   PLLPGSYVQG--AYGPVLFSPGVVPIPGWSPYSAPVSPVLSP-SAQPAVGATSLYGVTQL  265

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
             SS    +     +PS  A          Q+E  FPERPG+PECQ+Y++TGDCKFG+ C++
Sbjct  266   SSSTPALAGPYPSPSSAAAAAAAPLSGTQKEQTFPERPGEPECQYYLRTGDCKFGSSCRY  325

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPR+R++P  + +LSP+GLPLRPG   C FY R G CKFG +CKFDHPM    Y+ S S
Sbjct  326   HHPRDRVVPRTNCVLSPLGLPLRPGAQHCTFYLRNGHCKFGSTCKFDHPMETMRYSPSAS  385

Query  1167  STTNAPTV  1190
             S  + P  
Sbjct  386   SLIDMPVA  393



>ref|XP_008796231.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X1 [Phoenix dactylifera]
Length=464

 Score =   304 bits (779),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 224/354 (63%), Gaps = 19/354 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             + ++W+L L   ++     YP R GEPDC+YYIRTG C +G  CR+NHP +   A+A A 
Sbjct  22    EASMWRLGLGGGDS----PYPERPGEPDCAYYIRTGSCGYGERCRYNHPRDHG-ALAGAG  76

Query  291   MKG--EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
               G  EYP+ VGQP C+YY+KTG CKFG+TCK+HHPR   G    V LN  GYPLRP + 
Sbjct  77    RTGVVEYPQHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYYGYPLRPGEK  136

Query  465   ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP------LS  626
             EC YYM+TGQCKFG TCKFHHPQP    +PL     YP V  P+ P    YP      + 
Sbjct  137   ECSYYMKTGQCKFGLTCKFHHPQPDGASMPLPAPIFYPTVQPPSVPSPHQYPPLASWQVG  196

Query  627   RASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLS  803
             R S +  P    P SY P+++  GVV V G+  Y   +  V SP  QQ TV     YGLS
Sbjct  197   RPSVL--PGSYMPGSYGPMLLSPGVVPVQGWGPYPAPISPVVSPGGQQ-TVQTGPLYGLS  253

Query  804   RSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCK  983
                  +    Q   P   A +L     + +RE +FPERPGQPECQFYM+TGDCKFGA CK
Sbjct  254   DQVTTSVPAYQ--VPYTSASSLARPSSSSEREQMFPERPGQPECQFYMRTGDCKFGATCK  311

Query  984   FHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVF  1145
             +HHPR+  IP  + +LSP+GLPLRPG  +C++Y+++G+CKFGP+CKFDHP+G  
Sbjct  312   YHHPRDWSIPKTNCVLSPLGLPLRPGAQICSYYAQHGVCKFGPTCKFDHPVGTL  365



>ref|XP_002880326.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56585.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score =   304 bits (779),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 179/367 (49%), Positives = 231/367 (63%), Gaps = 21/367 (6%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+L L         +YP R G PDC+YY+RTG+C +G  CR+NHP +R    AA R
Sbjct  31    EESMWRLGLGCE------SYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRASVEAAVR  84

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YPER+G+P CQ+YLKTG CKFGA+CKFHHP++  G    V LN+ GYP+R  D EC
Sbjct  85    ATGQYPERLGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMTHVPLNIYGYPVREGDNEC  144

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA----YPPVHSPTTPGQLSYPLS--RA  632
              YY++TGQCKFG TCKFHHPQP+   VP     +    YP V S   P Q   P S  R 
Sbjct  145   SYYLKTGQCKFGITCKFHHPQPAGTTVPPPPPASAPQFYPSVQS-LMPDQYGGPSSSLRV  203

Query  633   SFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRS  809
             +    P      +Y P+++  GVV +PG++ YS  +    SP +Q   VG +  YG+++ 
Sbjct  204   ARTLLPGSYMQGAYGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQH-AVGATSLYGVTQL  262

Query  810   SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  989
             S        G+ PS  +   P G   +Q+E  FPERPG+PECQ+Y+KTGDCKFG  CKFH
Sbjct  263   SST-TPSLPGVYPSLSS---PTG--VIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFH  316

Query  990   HPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  1169
             HPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKFDHPMG   YN S SS
Sbjct  317   HPRDRVPPRANCILSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASS  376

Query  1170  TTNAPTV  1190
               +AP  
Sbjct  377   LADAPVA  383



>emb|CAN78551.1| hypothetical protein VITISV_003243 [Vitis vinifera]
Length=518

 Score =   306 bits (783),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 228/377 (60%), Gaps = 20/377 (5%)
 Frame = +3

Query  102   PLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  281
             P+A+  L +             YP R  E DC YY++TG C +GA CRFNHP +R     
Sbjct  64    PVAETGLEEPLWXLGLGGGGEAYPERPDEADCIYYLKTGFCGYGARCRFNHPRDRGGVGG  123

Query  282   AAR-MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  458
               R   GE+PERVGQP CQ+Y+KTG CKFGA+CK+HHPR   G    V LN  GYPLRP 
Sbjct  124   TVRPGGGEFPERVGQPVCQFYMKTGTCKFGASCKYHHPRQGGGTVSPVTLNYFGYPLRPG  183

Query  459   DIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA----------YPPVHSPTTPGQ  608
             + EC YY++TG CKFG TCKFHHPQP ++ +   G  A          YP V SP+ P  
Sbjct  184   EKECSYYVKTGLCKFGETCKFHHPQPDSIQLSTPGPAALPAPVPAHTLYPXVQSPSVPSS  243

Query  609   LSYPL--SRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVG  779
               Y L  +R   + +    GP  Y+P+++P G+V  PG++ Y   +  V+SP S Q TVG
Sbjct  244   QQYGLVVARPPLLPSSYIHGP--YSPVLIPPGMVPFPGWSHYPAPVSPVASP-STQPTVG  300

Query  780   NSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGD  959
             + Q YGL+  S  A   +    P     +      + Q+E +FPERPGQPECQ+YM+TGD
Sbjct  301   SGQMYGLTPLSPSAPAYT---GPYTPLPSSVGPSSSSQKEQIFPERPGQPECQYYMRTGD  357

Query  960   CKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMG  1139
             CKFG+ CK+HHP E   P  + +LSP+GLPLRPG P C  Y++ GICKFGP+CKFDHPMG
Sbjct  358   CKFGSSCKYHHPPEWDTPKTNCVLSPMGLPLRPGAPQCTHYAQRGICKFGPTCKFDHPMG  417

Query  1140  VFTYNISPSSTTNAPTV  1190
               +Y+ S SS  + P  
Sbjct  418   TLSYSPSASSLADMPVA  434



>ref|XP_004134198.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Cucumis sativus]
Length=481

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 175/376 (47%), Positives = 234/376 (62%), Gaps = 29/376 (8%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             ++LW L  R  ++     YP R  E DC YY+RTG C +G+ CRFNHP  R  A+  +R 
Sbjct  31    DSLWPLGSRDRDS-----YPERPDEADCIYYLRTGFCGYGSRCRFNHPRERTPALGGSRP  85

Query  294   KG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
              G EYPER+GQP CQYY++TG CKFGA+CK+HHP+ + G    V+LN  GYPLRP + EC
Sbjct  86    GGREYPERIGQPVCQYYMRTGMCKFGASCKYHHPQQERGSLSPVSLNFYGYPLRPGEKEC  145

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNM---------MVPLRGS-PA---YPPVHSPTTPGQL  611
              YY++ GQCKFG+TCKFHHP+P+ +         + P+ G  PA   YPPV SP+     
Sbjct  146   SYYLKNGQCKFGATCKFHHPEPAGLQFPAPSPVQVAPIAGQVPAPSVYPPVQSPSAHSSQ  205

Query  612   SYP--LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGN  782
              Y   L+R S ++NP   GP  Y P++V  GVV  P ++ Y   +  V+SP S Q +VG+
Sbjct  206   QYGVILARPSLLSNPYVPGP--YGPMLVSPGVVQFPSWSPYPAPMSPVASP-SAQPSVGS  262

Query  783   SQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDC  962
                YG++  S  A+    G   SY+           Q+E+ FPERPGQPECQ+YM+TGDC
Sbjct  263   GPLYGMAHVSPSAS----GFAGSYQPMPSTGPSSTSQKEHSFPERPGQPECQYYMRTGDC  318

Query  963   KFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  1142
             KFG+ C++HHP E +   P  +LS +GLPLRPG P C  + + G+CKFGP+CKFDH M  
Sbjct  319   KFGSSCRYHHPPELVTSRPSVVLSQLGLPLRPGAPPCTHFMQRGMCKFGPACKFDHSMDR  378

Query  1143  FTYNISPSSTTNAPTV  1190
              +Y+ S SS  + P  
Sbjct  379   LSYSPSASSLADMPVA  394



>ref|XP_007222805.1| hypothetical protein PRUPE_ppa005056mg [Prunus persica]
 gb|EMJ24004.1| hypothetical protein PRUPE_ppa005056mg [Prunus persica]
Length=479

 Score =   304 bits (778),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 231/378 (61%), Gaps = 32/378 (8%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++WQL L   E+     YP R  E DCSYY+RTG+C +G+ CR+NHP +R     AAR
Sbjct  29    EESMWQLGLGPGES-----YPERPNETDCSYYLRTGICGYGSRCRYNHPRDRSAVTGAAR  83

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPER GQP CQYY++TG CKFGA+CK+HHP+        V+LN  GYPLR  + E
Sbjct  84    PGGLEYPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSGSPVSLNYYGYPLRQGERE  143

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNM----------MVPLRGSPAYPPVHSPTTPGQ---  608
             C YY++TGQCKFG+TCKFHHPQP+ +          + P+  +P Y  V SP+   Q   
Sbjct  144   CSYYVKTGQCKFGATCKFHHPQPAGIPLPVPSPAPQVSPVPAAPLYQTVQSPSVSSQQYG  203

Query  609   ---LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTV  776
                   PL   S++ +P  Q       +++  G +  PG++ Y     ++ SP S Q  V
Sbjct  204   VVFARPPLLPGSYVQSPYGQ-------VLLSPGTIPFPGWSPYQAPASALPSP-STQPGV  255

Query  777   GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  956
             G+   YG+S+ S  A   +    P     +L +   + Q+E++FPERPGQPECQ+YM+TG
Sbjct  256   GSGTLYGMSQLSPSAAAYTGMYQPIPLPSSLGLPTTS-QKEHLFPERPGQPECQYYMRTG  314

Query  957   DCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPM  1136
             DCKFG+ C++HHP E + P     LSP GLP RPG PLC  Y++ G+CKFGP+CKFDHPM
Sbjct  315   DCKFGSSCRYHHPPEVVGPKTTVALSPSGLPSRPGAPLCTHYAQRGVCKFGPACKFDHPM  374

Query  1137  GVFTYNISPSSTTNAPTV  1190
             G  +Y+ S SS  + P  
Sbjct  375   GTLSYSPSASSLADMPVA  392



>ref|XP_008223126.1| PREDICTED: zinc finger CCCH domain-containing protein 58 [Prunus 
mume]
Length=479

 Score =   304 bits (778),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 231/378 (61%), Gaps = 32/378 (8%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +ET+WQL L   E+     YP R  E DCSYY+RTG+C +G+ CR+NHP +R      AR
Sbjct  29    EETMWQLGLGPGES-----YPERPNETDCSYYLRTGICGYGSRCRYNHPRDRSAVTGGAR  83

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPER GQP CQYY++TG CKFGA+CK+HHP+     +  V+LN  GYPLR  + E
Sbjct  84    PGGLEYPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSSSPVSLNYYGYPLRQGERE  143

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNM----------MVPLRGSPAYPPVHSPTTPGQ---  608
             C YY++TGQCKFG+TCKFHHPQP+ +          + P+  +P Y  V SP+   Q   
Sbjct  144   CSYYVKTGQCKFGATCKFHHPQPAGIPLPVPSPAPQVSPVPAAPLYQTVQSPSVSSQQYG  203

Query  609   ---LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTV  776
                   PL   S++ +P  Q       +++  G +  PG++ Y     ++ SP S Q  V
Sbjct  204   VVFARPPLLPGSYVQSPYGQ-------VLLSPGTIPFPGWSPYQAPASALPSP-STQPGV  255

Query  777   GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  956
             G+   YG+S+ S  A   +    P     +L +   + Q+E++FPERPGQPECQ+YM+TG
Sbjct  256   GSGTLYGMSQLSPSAAAYTGMYQPIPLPSSLGLPTTS-QKEHLFPERPGQPECQYYMRTG  314

Query  957   DCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPM  1136
             DCKFG+ C++HHP E + P     L+P GLP RPG PLC  Y++ G+CKFGP+CKFDHPM
Sbjct  315   DCKFGSSCRYHHPPEVVGPKTTVALNPSGLPSRPGAPLCTHYAQRGVCKFGPACKFDHPM  374

Query  1137  GVFTYNISPSSTTNAPTV  1190
             G  +Y+ S SS  + P  
Sbjct  375   GTLSYSPSASSLADMPVA  392



>ref|XP_010684493.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Beta vulgaris subsp. vulgaris]
Length=462

 Score =   303 bits (775),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 230/374 (61%), Gaps = 25/374 (7%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+L L   ET     YP R G  DC YY+RTG C FG  CR+NHP +R  A+AAAR
Sbjct  24    EESMWRLGLSGRET-----YPERPGVSDCVYYMRTGFCGFGTRCRYNHPHDRAAAVAAAR  78

Query  291   M-KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
             +  GEYPER G+P CQY+LKTG CKFG TCKF+HPR+  G      LN+ G+PLRP + E
Sbjct  79    LVGGEYPERPGEPVCQYFLKTGTCKFGTTCKFNHPRNAGGSLTNAPLNIQGFPLRPGEKE  138

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP-------GQLSYPLS  626
             C YY++TGQCKFG TCKFHHPQP+ M +P    P YP V SP+ P          +Y ++
Sbjct  139   CSYYLKTGQCKFGITCKFHHPQPAGMSMPAAAPPFYPTVQSPSVPIPETAAGSSPNYRVA  198

Query  627   RASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLS  803
             R   +  P    P SY P+++  GVV +PG+ +YSG L  V SP  Q    G+   YG+S
Sbjct  199   RPPLV--PGSYVPGSYGPVLLSPGVVPLPGWGSYSGPLSPVLSPGGQPTAGGS--VYGVS  254

Query  804   RSSEVANVGSQGMNPSYRA--GTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
               S  +  G  G  PS  +  G    G      E+ FPERPG+PECQ+++KTG+CKFG  
Sbjct  255   SLSP-STPGLAGSYPSLLSSDGQSITG----TTEHKFPERPGEPECQYFLKTGNCKFGGS  309

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  1157
             C++HHP +         L P+GLPLRPG   C FY ++G CKFGP+CKFDHP+G+  Y+ 
Sbjct  310   CRYHHPPDGGASAAACFLGPLGLPLRPGTQPCTFYMQHGYCKFGPTCKFDHPVGMMKYSP  369

Query  1158  SPSSTTNAPTVRHF  1199
             S SS T  P   + 
Sbjct  370   SASSLTETPVAPYL  383



>ref|XP_010558473.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Tarenaya hassleriana]
Length=481

 Score =   303 bits (775),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 168/382 (44%), Positives = 239/382 (63%), Gaps = 37/382 (10%)
 Frame = +3

Query  108   AQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  287
              + ++W+L LRS       +YP R  EPDC YY+RTG+C +G+ CRFNHP +R   + AA
Sbjct  29    VEASMWRLGLRSGGE----SYPERPDEPDCIYYLRTGVCGYGSRCRFNHPRDRGAVMGAA  84

Query  288   RMK-GEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
             R   GE+PERVGQP CQ++++TG CKFGA+CK+HHPR  +     V LN +GYPLRP + 
Sbjct  85    RGDAGEFPERVGQPVCQHFMRTGTCKFGASCKYHHPRQGSSSGAPVMLNYMGYPLRPGEK  144

Query  465   ECPYYMRTGQCKFGSTCKFHH------------PQPSNMMVPLRGSPAYPPVHSPTTPGQ  608
             EC YYMRTGQCKFG+TC+FHH            P P+  + P+     YP V SP+ P  
Sbjct  145   ECSYYMRTGQCKFGATCRFHHPVLPGVQVPSPPPLPAAQVSPVAAQAIYPAVQSPSVPSS  204

Query  609   LSY-------PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQ  764
               Y       PL   S++ +P       Y P+++P G+V   G+  Y+  + ++ SP +Q
Sbjct  205   QQYGVVMARPPLLPGSYVQSP-------YGPMVLPPGMVPYSGWNPYAATVSAIPSPGTQ  257

Query  765   QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  944
               ++G+S  YG++  S  A          Y++G   +G  + Q+E +FP+RPGQPECQ++
Sbjct  258   P-SIGSSSIYGITPLSPSAPA----YTGQYQSGPSNLGPSSTQKEQLFPQRPGQPECQYF  312

Query  945   MKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKF  1124
             M+TGDCKFG+ C++HHP + + P    +LSPI LP+RPG PLC  ++++GICKFGP C+F
Sbjct  313   MRTGDCKFGSSCRYHHPLDAVPPSSSLILSPISLPIRPGAPLCTHFAQHGICKFGPVCRF  372

Query  1125  DHPMGVFTYNISPSSTTNAPTV  1190
             DH +G  +Y+ S SS T+ P  
Sbjct  373   DHSVGSLSYSPSASSLTDMPVA  394



>ref|XP_004309682.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Fragaria vesca subsp. vesca]
Length=462

 Score =   301 bits (771),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/361 (49%), Positives = 227/361 (63%), Gaps = 19/361 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L S E+     YP R G P+C YY+RTG C +G  CR+NHP +R   +AA R
Sbjct  27    EEQMWQLGLTSTES-----YPERPGVPNCVYYMRTGFCGYGVRCRYNHPRDRAAVVAAVR  81

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YPERVG+P CQYYLKTG CKFGA+CKFHHP+   G   R  LN+ GYPLRP + EC
Sbjct  82    ATGDYPERVGEPVCQYYLKTGTCKFGASCKFHHPKHGGGSLTRAPLNIYGYPLRPGESEC  141

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP------GQLS-YPLSR  629
              YY++TGQCKFG TCKFHHPQP+   VP      Y  V SP+ P      GQ +   ++R
Sbjct  142   SYYLKTGQCKFGLTCKFHHPQPAGTTVPASAPQFYQSVQSPSVPMPEQFGGQSTGLRVAR  201

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
                +     QG  +Y P+++P GVV +P +  YS  L    SP +Q  TVG +  YGL++
Sbjct  202   PPLLPGSYVQG--AYGPVLIPPGVVPIPSWNPYSAPLSPALSPGAQP-TVGATSLYGLTQ  258

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              S   +  ++   P     +      +   E  FPERPG+PECQ+Y++TGDCKFG  C++
Sbjct  259   LSSPPHALAR---PYTSVPSSVGPSSSSPNEQTFPERPGEPECQYYLRTGDCKFGPSCRY  315

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHPR+R+ P  + LLSP+GLPLRPG   C FY + G CKFG SCKFDHPMG   Y+ S S
Sbjct  316   HHPRDRIAPRTNCLLSPVGLPLRPGVQPCTFYLQNGHCKFGSSCKFDHPMGTMRYSPSAS  375

Query  1167  S  1169
             S
Sbjct  376   S  376


 Score =   102 bits (255),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = +3

Query  303  YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYM  482
            +PER G+PECQYYL+TG CKFG +C++HHPRD+        L+ +G PLRP    C +Y+
Sbjct  289  FPERPGEPECQYYLRTGDCKFGPSCRYHHPRDRIAPRTNCLLSPVGLPLRPGVQPCTFYL  348

Query  483  RTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  602
            + G CKFGS+CKF HP     M  +R SP+   +  P  P
Sbjct  349  QNGHCKFGSSCKFDHP-----MGTMRYSPSASSLDMPVAP  383



>ref|XP_010938478.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
[Elaeis guineensis]
Length=463

 Score =   301 bits (771),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 220/353 (62%), Gaps = 18/353 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR-KLAIAAA  287
             +E++W+L L   +      YP R GEPDC+YYIRTG C +G  CR+NHP +R  LA +  
Sbjct  22    EESMWRLGLAGGDL----PYPERPGEPDCAYYIRTGSCGYGERCRYNHPPDRGALARSGR  77

Query  288   RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
                 EYPE VGQP C+YY+KTG CKFG+TCK+HHPR   G    V LN  GYPLRP + E
Sbjct  78    TGVVEYPEHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYCGYPLRPGEKE  137

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP------LSR  629
             C YYM+TGQCKFGSTCKFHHPQ     +P   S  YP V  P+ P    YP      + R
Sbjct  138   CSYYMKTGQCKFGSTCKFHHPQLGGASMP-PASMFYPTVQPPSIPSPHQYPPLASWEVGR  196

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
              S +  P    P SY P+++  GVV V G+  Y   L SV SP  QQ TV     YG S 
Sbjct  197   PSVL--PGTYMPGSYGPMLLSPGVVPVQGWGPYPAPLSSVVSPGGQQ-TVQTGPLYGPSN  253

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
                 +    Q   P     +      + +RE +FPERPGQPECQFYM+TGDCK+G  CK+
Sbjct  254   QVNTSVPAYQ--VPYTSFSSSAGPSSSSEREQMFPERPGQPECQFYMRTGDCKYGVTCKY  311

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVF  1145
             HHPR+  IP  + +LSP+GLPLRPG  +CAFY+++G+CKFGP+CKFDHP+G  
Sbjct  312   HHPRDWSIPKTNCVLSPLGLPLRPGAQICAFYAQHGVCKFGPTCKFDHPVGTL  364



>ref|XP_009802826.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
isoform X2 [Nicotiana sylvestris]
Length=492

 Score =   302 bits (774),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 238/391 (61%), Gaps = 45/391 (12%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQLS+ S       +YP R  E DC YY+RTG C +G+ CRFNHP +R L + AAR
Sbjct  28    EEAMWQLSVGSGPE----SYPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAAR  83

Query  291   M------KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  452
                    +GEYPERVGQP CQYY++TG CKFGA+CK+HHPR   G    +  N+ GYPLR
Sbjct  84    AIGGGGGEGEYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLR  143

Query  453   PNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG-------------------SPAY  575
             P + EC +YM+TGQCKFG TCKFHHPQP+ + VP                      +   
Sbjct  144   PGEKECLFYMKTGQCKFGITCKFHHPQPAGVQVPASAARPGAFPLPAAVPPPATYPTVQS  203

Query  576   PPVHSPTTPGQLS--YPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF----AYSGQL  737
             P V S    G ++  +P+ R + +  P    P +Y P++ P G+V VPG+    A + QL
Sbjct  204   PSVQSAQQYGVIAGNWPVVRPTLL--PGSYLPGTYGPMLFPPGMVPVPGWTPYPASASQL  261

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPER  917
              S+++    Q   G    YGL++ S  A     G + S  A   P G  ++Q+E+ FPER
Sbjct  262   PSLTT----QPAAGAGPVYGLTQLSASAP-SYMGPHTSLTASIGPSG--SIQKEHAFPER  314

Query  918   PGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGI  1097
             PGQPECQ+YMK GDCKFG+ C++HHP E   P    +LS +GLPLRPG P+C+ YS+ G+
Sbjct  315   PGQPECQYYMKYGDCKFGSSCRYHHPPEWSGPKLGFILSAMGLPLRPGAPICSHYSQNGV  374

Query  1098  CKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             CKFGPSCKFDHPMG+ +Y+ S SS  + P  
Sbjct  375   CKFGPSCKFDHPMGI-SYSPSASSLVDMPVA  404



>ref|XP_008235007.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Prunus 
mume]
Length=472

 Score =   301 bits (771),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 177/369 (48%), Positives = 230/369 (62%), Gaps = 21/369 (6%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L S E+     YP R G P+C YY+RTG C +G  CR+NHP +R   +AA R
Sbjct  27    EEQMWQLGLTSSES-----YPERPGVPNCVYYMRTGFCGYGIRCRYNHPRDRAAVVAAVR  81

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YPERVG+P CQYYLKTG CKFGA+CKFHHP+   G   R  LN+ G PLRP + EC
Sbjct  82    ATGDYPERVGEPICQYYLKTGTCKFGASCKFHHPKHGGGSLSRAPLNIYGLPLRPGENEC  141

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP-------GQLSYPLSR  629
              YY++TGQCKFG TCKFHHPQP+   +P      YP V SP+ P             + R
Sbjct  142   SYYLKTGQCKFGITCKFHHPQPAGTTIPSSAPQFYPSVQSPSVPMAEQFGGASTGLRVPR  201

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
                +     QG  +Y P+++  GVV + G++ YS  L  V SP +Q  TVG +  YG+++
Sbjct  202   PPLLPGSYVQG--TYGPVLISPGVVPIQGWSPYSAPLSPVLSPGAQP-TVGATSLYGVTQ  258

Query  807   SSEVANVGSQGMNPSYRAGTLPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCK  983
              S      + G+   Y +    +G   +   E VFPERPG+PECQ+Y+KTGDCK+G  C+
Sbjct  259   LSSP----THGLARPYTSVPSAVGPSSSSPSEQVFPERPGEPECQYYLKTGDCKYGPSCR  314

Query  984   FHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  1163
             +HHPR+R++P  + LLSPIGLPLRPG   C FY + G CKFG +CKFDHP+G   YN S 
Sbjct  315   YHHPRDRVVPRTNCLLSPIGLPLRPGVQPCTFYLQNGHCKFGSTCKFDHPIGTMRYNPSA  374

Query  1164  SSTTNAPTV  1190
             SS  + P  
Sbjct  375   SSLVDMPVT  383



>ref|XP_006419655.1| hypothetical protein CICLE_v10004882mg [Citrus clementina]
 ref|XP_006489144.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Citrus sinensis]
 gb|ESR32895.1| hypothetical protein CICLE_v10004882mg [Citrus clementina]
Length=476

 Score =   301 bits (772),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/367 (48%), Positives = 230/367 (63%), Gaps = 36/367 (10%)
 Frame = +3

Query  165   TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYY  341
             +YP R  E DC +Y+RTG C +G+ CRFNHP +R   + AAR  G E+PERVGQP CQYY
Sbjct  37    SYPERPDEADCIHYVRTGFCAYGSRCRFNHPRDRGSVMGAARAGGGEFPERVGQPVCQYY  96

Query  342   LKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKF  521
             ++TG CK+GA+CK+HHPR  AG    V+LN  GYPLRP + EC YYM+T QCKFG+TCKF
Sbjct  97    MRTGTCKYGASCKYHHPRQGAGSVSNVSLNYYGYPLRPGEKECSYYMKTRQCKFGATCKF  156

Query  522   HHPQPSNMMVPLRGSPA---------------YPPVHSPTTPGQLSY--PLSRASFITNP  650
             HHPQP+ +  P   SPA               YPP+ SP+ P    Y   ++R   +   
Sbjct  157   HHPQPAGVPAPTP-SPAPQVAAVPTPVPAPALYPPLQSPSVPSAQQYGVVVARPPLLHGS  215

Query  651   RWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPES-QQLTVGNSQAYGLSRSSEVAN  824
               QGP  Y P++V   + S+ G++ Y+  L  +SSP +  Q +VG+S  YG+++ S  A 
Sbjct  216   YVQGP--YGPVLVSPSMFSLQGWSPYATSLNPISSPGTGTQSSVGSSSIYGITQLSASA-  272

Query  825   VGSQGMNPSYRA-----GTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  989
                    P+Y        +      + Q+E+ FPERPGQ ECQ+YMKTGDCKFG+ C+FH
Sbjct  273   -------PAYTGTYQSLPSSVGPSSSSQKEHPFPERPGQQECQYYMKTGDCKFGSSCRFH  325

Query  990   HPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  1169
             HPRE ++P  D  LSP GLPLRPG   C  Y + G+CKFGP+CKFDHPMG+ +Y+ S SS
Sbjct  326   HPRELIVPKMDVTLSPFGLPLRPGAAPCTHYVQRGVCKFGPACKFDHPMGMLSYSPSASS  385

Query  1170  TTNAPTV  1190
               + P  
Sbjct  386   LADMPVA  392



>ref|XP_009339837.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Pyrus x bretschneideri]
Length=473

 Score =   301 bits (771),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 171/371 (46%), Positives = 218/371 (59%), Gaps = 22/371 (6%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L   E+     YP R  E DCSYY+RTG+C +G+ CR+NHP +R + I AAR
Sbjct  29    EEAMWQLGLGPGES-----YPERSDEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAAR  83

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPERVGQP CQYY++TG CKFGA+CK+HHP+        V+LN  GYPLRP + +
Sbjct  84    TGGLEYPERVGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPGERD  143

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRAS----  635
             C YY++TGQCKFG+TCKFHHPQP+ + +P    P+  P  SP    Q  Y   ++S    
Sbjct  144   CSYYVKTGQCKFGATCKFHHPQPAGIQLP---GPSPAPQVSPVPATQTLYQNVQSSSVSS  200

Query  636   ------FITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYG  797
                   F   P    PS Y  +++ QG +  PG+     L S     S Q  VG    Y 
Sbjct  201   QQYGVVFARPPLTYVPSPYGQVLLSQGTIPFPGWNPYQALASQLPSPSTQSGVGARTLYT  260

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
                 S  A  G     P   +  LP      Q+E +FPERPGQPECQ+YM+TGDCKFG+ 
Sbjct  261   QLSPSAPAFPGMYQPMPLASSLGLPT---TSQKEQIFPERPGQPECQYYMRTGDCKFGSS  317

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  1157
             C++HHP E +      LLS  GLP RPG PLC  Y + G CKFG +CKFDHP+G  +Y+ 
Sbjct  318   CRYHHPPEVVQSKTTVLLSSSGLPSRPGAPLCTHYQQRGACKFGSACKFDHPIGTLSYSP  377

Query  1158  SPSSTTNAPTV  1190
             S SS  + P  
Sbjct  378   SASSLADMPVA  388



>ref|XP_009417930.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=467

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 220/359 (61%), Gaps = 27/359 (8%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+L            YP R GEPDC+YY+RTG C +G  CR+NHP +R     A R
Sbjct  22    EESMWRLGFGGGGDAH---YPERPGEPDCAYYMRTGTCSYGEKCRYNHPRDRGSLTGAGR  78

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
                 EYPERVGQP C+YY++TG+CKFG++CK+ HPR   G A  V+LN  GYPLRP + E
Sbjct  79    TGAVEYPERVGQPVCEYYMRTGSCKFGSSCKYDHPRQGGGSAQPVSLNYYGYPLRPGEKE  138

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA-YPPVHSPTTPGQLSYP------LS  626
             C YYM+TGQCKFGSTCKFHHPQP    VP   +PA YP V  P+ P    YP      ++
Sbjct  139   CGYYMKTGQCKFGSTCKFHHPQPGGASVPSASAPAFYPSVQHPSVPSSHQYPPYAGWQVA  198

Query  627   RASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLS  803
             R S +     QG  SY P+++  GVV V  ++ Y   +  V SP  QQ T+     YGL 
Sbjct  199   RPSVMPGSYLQG--SYAPMLLSHGVVPVQSWSPYPASVNPVLSPAGQQ-TIQAEPIYGLE  255

Query  804   RSSEVANVGSQGMNPSYRAGTLPMGYYA-----LQRENVFPERPGQPECQFYMKTGDCKF  968
               +         +NP+     +P    A      QR N+FPERPGQPECQF+MKTGDCKF
Sbjct  256   NQAS-------SINPALPVPQMPSLSPAGPSSTNQRGNIFPERPGQPECQFFMKTGDCKF  308

Query  969   GAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVF  1145
             GA CK+HHP  R +P  + +L+ +GLPLRPG   C +Y ++G+CKFG +CKFDHP+   
Sbjct  309   GAKCKYHHPPGRRMPMTNVVLNVLGLPLRPGAQPCTYYMQHGLCKFGQTCKFDHPVATI  367



>ref|XP_010112757.1| Zinc finger CCCH domain-containing protein 32 [Morus notabilis]
 gb|EXC34715.1| Zinc finger CCCH domain-containing protein 32 [Morus notabilis]
Length=466

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 176/369 (48%), Positives = 229/369 (62%), Gaps = 21/369 (6%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++WQL L   E+     YP R G P+C YY+RTG C +G  CR+NHP +R    AA R
Sbjct  28    EESMWQLGLTGGES-----YPERPGVPNCVYYMRTGYCGYGVRCRYNHPRDRAAVAAAVR  82

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               GEYPERVG+P CQYYLKTG CKFGA+CKFHHP+   G   +  LN+ GYPLRP + EC
Sbjct  83    ATGEYPERVGEPVCQYYLKTGTCKFGASCKFHHPKHGGGSLSQAPLNIYGYPLRPGETEC  142

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP-------GQLSYPLSR  629
              YY++TGQCKFG TCKFHHP P+   V       YPPV SP+ P          S  ++R
Sbjct  143   SYYLKTGQCKFGITCKFHHPHPAGTSVTASAPQFYPPVQSPSVPIPEQFGGPSTSLRVAR  202

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
                +     QG  +Y P++ P GVV +PG+  YS  +  V SP +Q  TVG +  YG++ 
Sbjct  203   PPLLPGSYVQG--AYGPVLFPPGVVPIPGWNPYSAPVSPVLSPGAQP-TVGAASMYGVTH  259

Query  807   -SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCK  983
              SS  A +      P     +      +  +E VFPER G+PECQ+Y++TGDCKFG+ C+
Sbjct  260   LSSSTAALA----RPYPSLPSSIGASSSSPKEQVFPERHGEPECQYYLRTGDCKFGSSCR  315

Query  984   FHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  1163
             +HHPR+R++P  + LLSP+GLPLRPG   C FY + G CKFG +CKFDHP+G   Y+ S 
Sbjct  316   YHHPRDRVMPRTNCLLSPVGLPLRPGVQPCTFYLQNGHCKFGSTCKFDHPIGTMRYSPSA  375

Query  1164  SSTTNAPTV  1190
             SS  + P  
Sbjct  376   SSLIDMPVA  384



>gb|AAC63639.1| unknown protein [Arabidopsis thaliana]
Length=553

 Score =   303 bits (775),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 175/361 (48%), Positives = 222/361 (61%), Gaps = 21/361 (6%)
 Frame = +3

Query  153   MESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPEC  332
             + S +YP R G PDC+YY+RTG+C +G  CR+NHP +R    A  R  G+YPER G+P C
Sbjct  111   LGSDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRASVEATVRATGQYPERFGEPPC  170

Query  333   QYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  512
             Q+YLKTG CKFGA+CKFHHP++  G    V LN+ GYP+R  D EC YY++TGQCKFG T
Sbjct  171   QFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGDNECSYYLKTGQCKFGIT  230

Query  513   CKFHHPQPSNMMVPLRGSPA---YPPVHSPTTPGQLSYPLS--RASFITNPRWQGPSSYT  677
             CKFHHPQP+   VP   + A   YP V S   P Q   P S  R +    P      +Y 
Sbjct  231   CKFHHPQPAGTTVPPPPASAPQFYPSVQS-LMPDQYGGPSSSLRVARTLLPGSYMQGAYG  289

Query  678   PLIVPQGVVSVPGFA-----YSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQ--  836
             P+++  GVV +PG++         L  + +P S  L+ G   A G +    V  + S   
Sbjct  290   PMLLTPGVVPIPGWSPYSSLTVSLLLLLQAPVSPALSPGAQHAVGATSLYGVTQLTSTTP  349

Query  837   ---GMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERl  1007
                G+ PS  +   P G   +Q+E  FPERPG+PECQ+Y+KTGDCKFG  CKFHHPR+R+
Sbjct  350   SLPGVYPSLSS---PTG--VIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRV  404

Query  1008  ipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPT  1187
              P  + +LSPIGLPLRPG   C FY + G CKFG +CKFDHPMG   YN S SS  +AP 
Sbjct  405   PPRANCVLSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPV  464

Query  1188  V  1190
              
Sbjct  465   A  465



>gb|KCW58527.1| hypothetical protein EUGRSUZ_H01196 [Eucalyptus grandis]
Length=424

 Score =   298 bits (764),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 169/352 (48%), Positives = 223/352 (63%), Gaps = 18/352 (5%)
 Frame = +3

Query  165   TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYL  344
             +YP R G PDC+YY+RTG C FG+ CR+NHP +R   +AA R  G+YPER G+P CQ+YL
Sbjct  55    SYPERSGMPDCAYYMRTGFCGFGSRCRYNHPRDRAAVVAAVRATGDYPERPGEPACQFYL  114

Query  345   KTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFH  524
             KTG CKFGA+CKFHHP++  G   RV LN+ GYPLR  + EC YY++TGQCKFG+TCKFH
Sbjct  115   KTGTCKFGASCKFHHPKNGGGSLNRVPLNMYGYPLRLGEQECSYYLKTGQCKFGTTCKFH  174

Query  525   HPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTP-----LIV  689
             HPQP+   +P      Y PV SP+ P    Y  +  S         P SY P     +++
Sbjct  175   HPQPAGASIPASAPQFYSPVQSPSVPTPDQYRGASTSLRVARPPLVPGSYVPGAYGHVLI  234

Query  690   PQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQ-----GMNPSY  854
               GVV VPG++        S+P S  L+ G   A G +   +VA + S      G  PS 
Sbjct  235   SPGVVPVPGWS------PYSAPVSPALSPGARPAMGATSLYDVAQLTSSTPAIAGSYPSI  288

Query  855   RAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdslls  1034
              +   P G  + Q+E +FP+R G+P+CQ+YM+TGDCKFG+ C++HHPR+R++     LL+
Sbjct  289   PSSAGPWG--SSQKEQIFPQRAGEPDCQYYMRTGDCKFGSSCRYHHPRDRMVQGTSFLLN  346

Query  1035  piglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             P+GLPLRPG   CAFY + G CK+G +CKFDHPMG   Y+ S SS T+ P  
Sbjct  347   PLGLPLRPGVLPCAFYVQNGHCKYGSTCKFDHPMGAMRYSPSASSLTDMPVA  398



>ref|XP_011071464.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Sesamum indicum]
 ref|XP_011071465.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Sesamum indicum]
Length=488

 Score =   300 bits (768),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 173/390 (44%), Positives = 230/390 (59%), Gaps = 45/390 (12%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L S        YP R  EPDC YY+RTG C +G  CRFNHP +R  A+ A R
Sbjct  31    EEPMWQLGLES--------YPERPDEPDCIYYLRTGSCGYGTRCRFNHPRDRGAAVGALR  82

Query  291   MKGE-YPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G  YPER+ QP CQYY++TG CKFGA+CK+HHP+   G +  + LN  GYPLRP + E
Sbjct  83    ASGGGYPERISQPVCQYYMRTGMCKFGASCKYHHPKQGIGSSAPIMLNFYGYPLRPGEKE  142

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL------------  611
             C YY++TGQCKFG TCKFHHPQP+ + VP       P +     PG L            
Sbjct  143   CSYYVKTGQCKFGVTCKFHHPQPTGVRVPGPAVAPGPTLAPVPVPGPLAAPAVAAAVYPT  202

Query  612   -----------------SYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLG  740
                              ++P++R + +    +  P SY P+++P GVV VPG+       
Sbjct  203   VQSPSVQSSQQYGVIPGNWPVARPAMLPGSYF--PGSYGPMLLPPGVVPVPGWTPYPAPV  260

Query  741   SVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERP  920
             S  +P + Q + G +  YG+++ S  A   +    P     +      + Q+E+ FPERP
Sbjct  261   SPVAPATTQTSGGPN--YGITQLSPSAAAYT---GPYISITSSAGPSSSSQKESPFPERP  315

Query  921   GQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGIC  1100
             G+PECQ+Y+KTGDCKFG+ CK+HHP E   P  + LLSP+GLPLRPG PLC+ Y++ G+C
Sbjct  316   GEPECQYYLKTGDCKFGSTCKYHHPPEWSAPKSNFLLSPMGLPLRPGAPLCSHYAQNGVC  375

Query  1101  KFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             KFGPSCKFDHPM   +Y+ S SS T+ P  
Sbjct  376   KFGPSCKFDHPMRTLSYSPSASSLTDMPVA  405



>ref|XP_006444253.1| hypothetical protein CICLE_v10019968mg [Citrus clementina]
 ref|XP_006479891.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Citrus sinensis]
 gb|ESR57493.1| hypothetical protein CICLE_v10019968mg [Citrus clementina]
 gb|KDO87366.1| hypothetical protein CISIN_1g011776mg [Citrus sinensis]
Length=477

 Score =   300 bits (767),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 176/370 (48%), Positives = 228/370 (62%), Gaps = 23/370 (6%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++WQ  L+  E+     YP R G PDC +Y+RTG+C +G  CR+NHP NR    AA R
Sbjct  32    EESMWQSDLKVNES-----YPQRHGVPDCVFYMRTGVCGYGDRCRYNHPRNRAAVEAAVR  86

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YP+R G+P CQ+YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC
Sbjct  87    ATGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKEC  146

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP-------GQLSYPLSR  629
              YY++TGQCKFG TCKFHHPQP+   +P      YPPV SPT P          S  ++R
Sbjct  147   SYYLKTGQCKFGITCKFHHPQPAGTSLPASAPQFYPPVQSPTVPMAEQYGGASTSLRVAR  206

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
                + +   QG  +Y P++   GVV   G+  YS  +  V SP +Q   VG +  YG+++
Sbjct  207   PPLLASSYVQG--AYGPVLFSPGVVPFSGWNPYSASVSPVLSPGAQP-AVGATSLYGVTQ  263

Query  807   --SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVC  980
               SS  A  G     PS    +      + Q E  FPERPG+PECQ+++KTGDCKFG+ C
Sbjct  264   ISSSMPALAGLYPSLPSSAGPSS-----SGQMEQSFPERPGEPECQYFLKTGDCKFGSSC  318

Query  981   KFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNIS  1160
             +FHHPR+R++P  +  LSP+GLPLRPG   C FY + G CKFG +CKFDHPMG   Y+ S
Sbjct  319   RFHHPRDRVVPRTNCALSPLGLPLRPGAQPCTFYLQNGRCKFGATCKFDHPMGAMRYSPS  378

Query  1161  PSSTTNAPTV  1190
              SS    P  
Sbjct  379   ASSLIETPVA  388


 Score =   109 bits (273),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = +3

Query  288  RMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
            +M+  +PER G+PECQY+LKTG CKFG++C+FHHPRD+       AL+ LG PLRP    
Sbjct  289  QMEQSFPERPGEPECQYFLKTGDCKFGSSCRFHHPRDRVVPRTNCALSPLGLPLRPGAQP  348

Query  468  CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITN  647
            C +Y++ G+CKFG+TCKF HP  +    P   S    PV +P   G L   L+ AS  ++
Sbjct  349  CTFYLQNGRCKFGATCKFDHPMGAMRYSPSASSLIETPV-APYPVGSLLSTLAPASSSSD  407

Query  648  PR  653
             R
Sbjct  408  LR  409



>ref|XP_008386632.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 32-like [Malus domestica]
Length=472

 Score =   300 bits (767),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 176/380 (46%), Positives = 227/380 (60%), Gaps = 43/380 (11%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +W L L S E+     YP R G P+C YY+RTG C +G  CR+NHP +R   +AA R
Sbjct  27    EEQMWHLGLTSSES-----YPERPGVPNCVYYMRTGFCGYGGRCRYNHPRDRAAVVAAVR  81

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YPER G+P CQYYLKT  CKFGA+CK+HHP+  AG   R  LN+ GYPLRP + EC
Sbjct  82    ATGDYPERXGEPICQYYLKTATCKFGASCKYHHPKHGAGSLSRAPLNIYGYPLRPGENEC  141

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTP-------GQLSYPLSR  629
              YY++TGQCKFG TCKFHHPQP+   +P      YP V SP+ P          S  ++R
Sbjct  142   SYYLKTGQCKFGITCKFHHPQPAGTAIPASAPQFYPSVQSPSVPLAEQYGGASTSLRVAR  201

Query  630   ASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
                +     QG  +Y P+++  GVV + G++ YS  L  V SP +Q  TVG +  YG+++
Sbjct  202   PPLLPGSYVQG--AYGPVLIQPGVVPIQGWSPYSAPLSPVLSPGAQH-TVGATSLYGVTQ  258

Query  807   ------------SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMK  950
                         +S  ++VG    NPS               E VFPERPG+ ECQ+Y+K
Sbjct  259   LSSPTHGLARPYTSIPSSVGPSSSNPS---------------EQVFPERPGELECQYYLK  303

Query  951   TGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH  1130
             TGDCK+GA C++HHPR+R  P    LLSP+GLPLRPG   C FY + G CKFG +CKFDH
Sbjct  304   TGDCKYGASCRYHHPRDRTAPRITCLLSPMGLPLRPGVQPCTFYLQNGQCKFGSTCKFDH  363

Query  1131  PMGVFTYNISPSSTTNAPTV  1190
             P+    YN S SS  + P  
Sbjct  364   PVQTMRYNPSVSSLVDMPVA  383



>emb|CDP03533.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 174/376 (46%), Positives = 232/376 (62%), Gaps = 29/376 (8%)
 Frame = +3

Query  102   PLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR-----  266
             P A+E     S   +   +   YP R G  +C+YY+RTG+C +GA CR+NHP +R     
Sbjct  23    PAAREAGLTESTGRLGLWDGEAYPERPGMLECAYYMRTGVCGYGAKCRYNHPRDRASVGG  82

Query  267   KLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYP  446
              +++AAA    +YPERVG+P+CQYYL+TG CKFGA+CKFHHPR+  G    V+LN+ GYP
Sbjct  83    SVSLAAA----DYPERVGEPDCQYYLRTGTCKFGASCKFHHPRNAGGSLISVSLNIYGYP  138

Query  447   LRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ------  608
             LR  + EC YY++TGQCKFG+TCKFHHPQP+ M +P    P YP V SP+   +      
Sbjct  139   LRLGEKECSYYLKTGQCKFGNTCKFHHPQPAGMSMPATAHPFYPTVQSPSALSEQYCCAS  198

Query  609   LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNS  785
              +Y +SR   +T      P +Y P ++  GVV VP +  Y+G +    SP +Q  +VG +
Sbjct  199   TNYRVSRPPILTGSYV--PGAYGPFLLHTGVVPVPNWGPYTGPITPGFSPGTQA-SVGAT  255

Query  786   QAYGLSRSSEVANVGSQGMNPSYRAGTLP-MGYYALQRENVFPERPGQPECQFYMKTGDC  962
               YG+S+ +  A            AGT P +   + Q++  FPERPGQPECQ+YM+ GDC
Sbjct  256   SLYGVSQLNSSATA---------FAGTYPTLLSDSNQKKQKFPERPGQPECQYYMRYGDC  306

Query  963   KFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  1142
             KFG  C+FHHP   ++    S LSP+GLPLRPG   C FY + G CKFG +CKFDHPMG 
Sbjct  307   KFGPSCRFHHPPNLVVAKAYSALSPLGLPLRPGMQSCPFYLQKGHCKFGRNCKFDHPMGT  366

Query  1143  FTYNISPSSTTNAPTV  1190
               Y+ S SS T+ P  
Sbjct  367   VEYSPSASSLTDVPVT  382



>ref|XP_010069978.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Eucalyptus 
grandis]
 gb|KCW58526.1| hypothetical protein EUGRSUZ_H01196 [Eucalyptus grandis]
Length=485

 Score =   300 bits (767),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 169/352 (48%), Positives = 223/352 (63%), Gaps = 18/352 (5%)
 Frame = +3

Query  165   TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYL  344
             +YP R G PDC+YY+RTG C FG+ CR+NHP +R   +AA R  G+YPER G+P CQ+YL
Sbjct  55    SYPERSGMPDCAYYMRTGFCGFGSRCRYNHPRDRAAVVAAVRATGDYPERPGEPACQFYL  114

Query  345   KTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFH  524
             KTG CKFGA+CKFHHP++  G   RV LN+ GYPLR  + EC YY++TGQCKFG+TCKFH
Sbjct  115   KTGTCKFGASCKFHHPKNGGGSLNRVPLNMYGYPLRLGEQECSYYLKTGQCKFGTTCKFH  174

Query  525   HPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNPRWQGPSSYTP-----LIV  689
             HPQP+   +P      Y PV SP+ P    Y  +  S         P SY P     +++
Sbjct  175   HPQPAGASIPASAPQFYSPVQSPSVPTPDQYRGASTSLRVARPPLVPGSYVPGAYGHVLI  234

Query  690   PQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQ-----GMNPSY  854
               GVV VPG++        S+P S  L+ G   A G +   +VA + S      G  PS 
Sbjct  235   SPGVVPVPGWS------PYSAPVSPALSPGARPAMGATSLYDVAQLTSSTPAIAGSYPSI  288

Query  855   RAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdslls  1034
              +   P G  + Q+E +FP+R G+P+CQ+YM+TGDCKFG+ C++HHPR+R++     LL+
Sbjct  289   PSSAGPWG--SSQKEQIFPQRAGEPDCQYYMRTGDCKFGSSCRYHHPRDRMVQGTSFLLN  346

Query  1035  piglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             P+GLPLRPG   CAFY + G CK+G +CKFDHPMG   Y+ S SS T+ P  
Sbjct  347   PLGLPLRPGVLPCAFYVQNGHCKYGSTCKFDHPMGAMRYSPSASSLTDMPVA  398



>gb|KDP28101.1| hypothetical protein JCGZ_13872 [Jatropha curcas]
Length=468

 Score =   299 bits (765),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 176/367 (48%), Positives = 224/367 (61%), Gaps = 24/367 (7%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++W+L L S E+     YP R G PDC YY+RTG C +GA CR+NHP NR    AA R
Sbjct  31    EESMWRLGLASSES-----YPERSGVPDCVYYMRTGCCGYGARCRYNHPRNRAAVEAAVR  85

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               GEYPER G+P CQ+YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC
Sbjct  86    ATGEYPERAGEPLCQFYLKTGTCKFGASCKFHHPKHGGGSLSHVPLNIHGYPLRPGEKEC  145

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFITNP  650
              YY++TGQCKFG TCKFHHP P+   +P      Y PV SP+ P    Y  +  S    P
Sbjct  146   SYYLKTGQCKFGITCKFHHPPPAGTSMPESAPQFYQPVQSPSIPIPEPYGGASTSLRVRP  205

Query  651   RW------QGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSRS  809
             +       QG  +Y P++   GVV +PG++ YS  +  V SP +Q    G S     S  
Sbjct  206   QLLPGSYVQG--AYGPVLFSPGVVPIPGWSHYSAPVSPVMSPGAQPAVGGTSLYVSSSTP  263

Query  810   SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  989
             + V    S        +GT        Q+E  FPERPG+PECQ+Y++TGDCKFG+ C++H
Sbjct  264   ALVGTYPSPSSVAGLSSGT--------QKELTFPERPGEPECQYYLRTGDCKFGSSCRYH  315

Query  990   HPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  1169
             HPR+R++P  + +LSP+GLPLRPG   C FY R G CKFG +CKFDHPM    Y+ S SS
Sbjct  316   HPRDRIVPRTNCVLSPLGLPLRPGVQHCTFYMRNGHCKFGSTCKFDHPM--MRYSPSASS  373

Query  1170  TTNAPTV  1190
               + P  
Sbjct  374   LIDMPVA  380



>ref|XP_009631342.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana tomentosiformis]
Length=488

 Score =   300 bits (767),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 176/389 (45%), Positives = 234/389 (60%), Gaps = 45/389 (12%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQLS+ S     S +YP R  E DC YY+RTG C +G+ CRFNHP +R L + AAR
Sbjct  28    EEAMWQLSVGS----GSESYPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAAR  83

Query  291   MKG----EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  458
               G    +YPERVGQP CQYY++TG CKFGA+CK+HHPR   G    +  N+ GYPLRP 
Sbjct  84    AIGGGEEKYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPG  143

Query  459   DIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGS-------------------PAYPP  581
             + EC +YM+TGQCKFG TCKFHHPQP+ + VP   +                      P 
Sbjct  144   EKECLFYMKTGQCKFGITCKFHHPQPAGVQVPTSAARPGAFPLPAAVPPPATYPAVQSPY  203

Query  582   VHSPTTPGQLS--YPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF----AYSGQLGS  743
             V S    G ++  +P  R + +         +Y P++ P G+V VPG+    A + Q+ S
Sbjct  204   VQSAQQYGVVAGNWPFVRPTLLPGSY----GTYGPMLFPPGMVPVPGWTPYPASASQVPS  259

Query  744   VSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPG  923
             +++    Q   G    YGL++ S  A     G   S  A   P G  ++Q+E+ FPERPG
Sbjct  260   LTT----QPAAGAGPVYGLTQLSASAPA-YMGPYTSLTASIGPSG--SIQKEHAFPERPG  312

Query  924   QPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICK  1103
             QPECQ+Y+K GDCKFG+ C++HHP E   P    +LS +GLPLRPG P+C+ YS+ G+CK
Sbjct  313   QPECQYYIKYGDCKFGSSCRYHHPPEWSGPKSGFILSAMGLPLRPGAPICSHYSQNGVCK  372

Query  1104  FGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             FGPSCKFDHPMG+ +Y+ S SS  + P  
Sbjct  373   FGPSCKFDHPMGI-SYSPSASSLVDMPVA  400



>ref|XP_009391577.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 6 [Musa acuminata subsp. malaccensis]
Length=468

 Score =   299 bits (765),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 222/353 (63%), Gaps = 18/353 (5%)
 Frame = +3

Query  111   QETLWQLSLRSMETME-SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  287
             +E++W+L L S      +  YP R GE DC+YY+RTG C +G  CR+NHP +R     A 
Sbjct  22    EESMWRLGLGSGGGSGGTLQYPERPGELDCAYYMRTGTCSYGEKCRYNHPRDRGAMTGAG  81

Query  288   RMKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  464
             R    EYPERV QP C++Y++TG CKFG+TCK+HHPR   G A  V+LN  GYPLRP + 
Sbjct  82    RTGAMEYPERVDQPVCEFYMRTGNCKFGSTCKYHHPRQGGGSAQPVSLNYCGYPLRPGEK  141

Query  465   ECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYP------LS  626
             EC YYM+TGQCKFG TCKFHHPQP    VP   S  YP V  P+ P    YP      ++
Sbjct  142   ECAYYMKTGQCKFGFTCKFHHPQPGGSSVPSPASAFYPTVQHPSVPPPHQYPPYAGWQVA  201

Query  627   RASFITNPRWQGPSSYTPLIVPQGVVSVPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLS  803
             R S +     QG  SY P+++  GVV V G+  Y+G + S  SP  QQ TV     YG+ 
Sbjct  202   RPSVLPGSYLQG--SYAPMLLSPGVVPVQGWNPYTGPVNSSVSPAGQQ-TVQPGPIYGVQ  258

Query  804   RSSEVANVGSQG-MNPSYR-AGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
               +   N    G   P+   AGTL       QREN FPERPGQPECQFYMKTGDCK+GA+
Sbjct  259   NQASSTNPALAGAQTPTLSPAGTLTTS----QRENKFPERPGQPECQFYMKTGDCKYGAM  314

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPM  1136
             CK+HHP +  IP  + +LS +GLPLRPG   C +Y ++G+CKFG +CKFDHP+
Sbjct  315   CKYHHPPDWRIPRMNVVLSALGLPLRPGAQPCTYYMQHGLCKFGQTCKFDHPI  367



>ref|XP_010252578.1| PREDICTED: zinc finger CCCH domain-containing protein 3 [Nelumbo 
nucifera]
 ref|XP_010252579.1| PREDICTED: zinc finger CCCH domain-containing protein 3 [Nelumbo 
nucifera]
Length=452

 Score =   298 bits (763),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 176/384 (46%), Positives = 232/384 (60%), Gaps = 39/384 (10%)
 Frame = +3

Query  111   QETLWQLSLRSMETME-----SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  275
             ++ + +L ++  +  E     S  YP R GEPDC YY+RTGLC +G++CRFNHP+    A
Sbjct  24    EDAMRRLKIQPHDNQEVVAAHSNPYPDRPGEPDCIYYLRTGLCGYGSNCRFNHPA---YA  80

Query  276   IAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  455
               A + +GE PERVGQP+CQY+LKTG CKFGATCK+HHPRD+   A +V LNVLG P+R 
Sbjct  81    GQAVQYRGELPERVGQPDCQYFLKTGTCKFGATCKYHHPRDRHD-ADQVLLNVLGLPMRQ  139

Query  456   NDIECPYYMRTGQCKFGSTCKFHHPQPSNM--MVPLRGSPAY--------PPVHSPTTPG  605
              +  CPYYMRTG CKFG  CKFHHPQP  +   +P  GS AY        PP   P   G
Sbjct  140   EEKSCPYYMRTGSCKFGVACKFHHPQPVTLGPALPGTGSAAYGSTGSSVAPPSGVPYVSG  199

Query  606   QLSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNS  785
               ++ L RA +I+ PR +GP +Y P+++      VP         S  SP S    +G++
Sbjct  200   LPAWSLPRAPYISGPRMEGPQAYMPVVLSPSQGIVPAQQGWNTYTSTMSPISSSSVLGSN  259

Query  786   QAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCK  965
               Y         N   Q    S  +G + +   ++     FPERP QPECQ+YMKTG CK
Sbjct  260   LVY---------NSKPQAQGESGSSGQVHLVSTSVTN---FPERPDQPECQYYMKTGSCK  307

Query  966   FGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHP----  1133
             FG+ CK+HHPRER+ P   S + P+GLPLRPG+ +C FY+ YGICKFGP+CK+DHP    
Sbjct  308   FGSTCKYHHPRERIAPLATSTIGPLGLPLRPGQAICTFYNLYGICKFGPTCKYDHPLAGY  367

Query  1134  ----MGVFTYNISPSSTTNAPTVR  1193
                 MG+ T +I+ +  T+ P  R
Sbjct  368   YNYGMGLPTLSIAAADPTSFPYQR  391



>gb|KDP40004.1| hypothetical protein JCGZ_02002 [Jatropha curcas]
Length=473

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 232/375 (62%), Gaps = 29/375 (8%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +W L L   E+     YP R  E +C YY+RTG C +GA CRFNHP +R   I AAR
Sbjct  29    EEGVWPLGLGEGES----GYPERPDEANCIYYLRTGFCGYGARCRFNHPRDRGAVIGAAR  84

Query  291   M-KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
                GE+PERVGQP CQYY++TG CKFGA+CK+HHP+ + G    V+LN  GYPLRP + E
Sbjct  85    AGAGEFPERVGQPVCQYYMRTGTCKFGASCKYHHPKQEGGSVSPVSLNYYGYPLRPGEKE  144

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNM-MVPLRGSPAYP------------PVHSPTTPGQ  608
             C YY++TGQCKFG+TCKFHHPQP+N+ +VP   +P               P   P+T  Q
Sbjct  145   CTYYVKTGQCKFGATCKFHHPQPANLQIVPQSPAPQVAPVPAPIPAPALYPSSVPST-QQ  203

Query  609   LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNS  785
                 ++R S + +   QGP  Y P+++  GVV  P ++ Y   +  V+SP S Q  VG+ 
Sbjct  204   YGLVVARPSLLPSSYVQGP--YGPMLLSPGVVPYPSWSPYPAPVSPVASP-STQPGVGSG  260

Query  786   QAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCK  965
               Y LS S+       Q M  S    +      + Q+E  FPERP QPECQ+YMKTG+CK
Sbjct  261   SLYQLSPSAPAYTGAYQSMLSSVGPSS------SSQKEPFFPERPDQPECQYYMKTGNCK  314

Query  966   FGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVF  1145
             FG+ C++HHP E + P  + +LSPIGLPLRPG P C  Y++ G CKFGP+CKFDHPMG  
Sbjct  315   FGSSCRYHHPPELIAPKTNVVLSPIGLPLRPGAPPCTHYTQRGQCKFGPACKFDHPMGTL  374

Query  1146  TYNISPSSTTNAPTV  1190
             +Y+ S SS  + P  
Sbjct  375   SYSPSASSLADMPVA  389



>ref|XP_008389189.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Malus domestica]
Length=579

 Score =   301 bits (772),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 177/382 (46%), Positives = 233/382 (61%), Gaps = 43/382 (11%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQL L   E+     YP R G P+C YY+RTG C +G  CR+NHP +R   +AA R
Sbjct  134   EEQMWQLGLTGGES-----YPERPGVPNCVYYMRTGFCGYGGRCRYNHPRDRAAVVAAVR  188

Query  291   MKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
               G+YP+RVG+P CQYYLKTG CKFGA+CKFHHP+  AG   R  LN+ GYPLRP + EC
Sbjct  189   ATGDYPDRVGEPVCQYYLKTGTCKFGASCKFHHPKHGAGSLNRAPLNIYGYPLRPGENEC  248

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ------LSYPLSRA  632
              YY++TGQCKFG TCKFHHPQP+   +P      YP V SP    +       S  ++R 
Sbjct  249   SYYLKTGQCKFGITCKFHHPQPAGTTIPASAPQFYPSVQSPVPLAEQYGGASTSLRVARP  308

Query  633   SFITNPRWQGPSSYTPLIVPQ-GVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
               +T    QG  +Y P+++P  GVV + G++ YS  L  V SP +Q  TVG +  YG+++
Sbjct  309   PLLTGSYVQG--TYGPVLIPSPGVVPIQGWSPYSAPLSPVPSPGAQP-TVGATSLYGVTQ  365

Query  807   ------------SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMK  950
                         +S  ++VG    NP                E VFPERPG+ ECQ+Y+K
Sbjct  366   LPSPTHGLASPYTSIPSSVGPSSSNPI---------------EQVFPERPGELECQYYLK  410

Query  951   TGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDH  1130
             TGDCK+G  C++HHPR+R +P    LLSP+GLPLRPG   C FY + G CKFG +CKFDH
Sbjct  411   TGDCKYGPSCRYHHPRDRTVPRITCLLSPMGLPLRPGVQPCTFYLQNGQCKFGSTCKFDH  470

Query  1131  PMGVFTYNISPSSTTNAPTVRH  1196
             P+    Y++S SS  + P V++
Sbjct  471   PVQTMRYDLSASSLVDMPVVQY  492



>ref|XP_009588295.1| PREDICTED: zinc finger CCCH domain-containing protein 58 [Nicotiana 
tomentosiformis]
Length=494

 Score =   298 bits (764),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 227/378 (60%), Gaps = 32/378 (8%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQLSL +       +YP R  EPDC YY+RTG C +GA CRFNHP +R   + A R
Sbjct  32    EEPMWQLSLNTGPE----SYPERPNEPDCIYYLRTGFCGYGARCRFNHPRDRNSVLGAMR  87

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPERVGQP CQYY++TG CKFGA+CK+HHPR   G    V +N+ GYPLRP + E
Sbjct  88    ATGGEYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNIYGYPLRPGEKE  147

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLR-------GSPA-------YPPVHSPTTPG  605
             C YY++TGQCKFG TCKFHHP P+   VP           PA       YP V SP+   
Sbjct  148   CSYYVKTGQCKFGVTCKFHHPHPAGAQVPAPPAGPGPLAVPAAVPAPHIYPTVQSPSVQS  207

Query  606   QLSY-------PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQ  764
                Y       P++R + +  P    P +Y  +++P G+V +PG+       S +   S 
Sbjct  208   AQQYGVVSGNWPVARPTLL--PGSYIPGTYGSMLLPPGMVPLPGWTPYPAPASPAPSPST  265

Query  765   QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  944
             Q        YGLS+ S  A      M P     +      + Q+E+ FPERPGQPECQ+Y
Sbjct  266   QPPAAAGPIYGLSQLSPSAPA---YMGPYLSVASASGPSSSSQKEHAFPERPGQPECQYY  322

Query  945   MKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKF  1124
             MK GDCK+G+ C++HHP E   P    +LS +GLPLRPG P+C+ Y++ G+CKFGPSCKF
Sbjct  323   MKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMGLPLRPGAPICSHYAQNGVCKFGPSCKF  382

Query  1125  DHPMGVFTYNISPSSTTN  1178
             DHPMG+ +Y+ S SS T+
Sbjct  383   DHPMGM-SYSPSASSLTD  399



>ref|XP_002528968.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF33442.1| zinc finger protein, putative [Ricinus communis]
Length=456

 Score =   297 bits (760),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 166/375 (44%), Positives = 224/375 (60%), Gaps = 39/375 (10%)
 Frame = +3

Query  87    SSLSPPLAQETLWQLSLRSMETM----ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNH  254
             S+ SP   +E +W+L +   +       S  YP R GEPDC YY+RTGLC +G +CRFNH
Sbjct  20    SNQSPDNIEEAIWRLKIHDNQEQGGMAPSSPYPDRPGEPDCVYYLRTGLCGYGNNCRFNH  79

Query  255   PSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNV  434
             P     A    + K E PERVGQP+C YYLKTG CK+G+TCK+HHPRD+ G AG V+ N+
Sbjct  80    P---PYAAQGNQFKEELPERVGQPDCGYYLKTGTCKYGSTCKYHHPRDRNG-AGPVSFNI  135

Query  435   LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM--MVPLRGSPAYPPVHSPTTP--  602
             +G P+R ++  CPYYMRTG CKFG  CKFHHPQP+ +   +P  G  A  P+ S   P  
Sbjct  136   VGLPMRQDEKSCPYYMRTGSCKFGVACKFHHPQPAPLGTGLPFTGPAASGPMASSNLPSS  195

Query  603   ------GQLSYPLSRASFITNPRWQGPSSYTPLIV--PQGVVSVPGF-AYSGQLGSVSSP  755
                   G  ++ L RA +++ PR QGP +Y P ++   QGVV+  G+  Y G L    SP
Sbjct  196   GLPYVGGLPTWSLPRAPYVSGPRLQGPQTYMPAVLSPSQGVVAAQGWNTYVGNL----SP  251

Query  756   ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  935
              S    +G+S  Y     SE  + G   M  +  +                PERP QPEC
Sbjct  252   MSSGSVLGSSIVYNSRNQSESGSSGQVHMLSTTSSN--------------LPERPDQPEC  297

Query  936   QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPS  1115
             +++M TG CK+G+ CK+HHP+ER+     + + P+GLP RPG+P+C+ YS YG+CKFGP+
Sbjct  298   RYFMNTGTCKYGSDCKYHHPKERIAQLATNSIGPVGLPSRPGQPICSNYSMYGLCKFGPT  357

Query  1116  CKFDHPMGVFTYNIS  1160
             C+FDHP   + Y  S
Sbjct  358   CRFDHPFTGYPYGYS  372



>gb|ABR16930.1| unknown [Picea sitchensis]
Length=554

 Score =   300 bits (767),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 171/381 (45%), Positives = 235/381 (62%), Gaps = 23/381 (6%)
 Frame = +3

Query  57    ASMASVTEGPSSLSPPLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGA  236
             A + S      S+   + + TL     RS     S +YP R G+ DCS+Y+RTG C +G 
Sbjct  37    AGLNSTKSAAESMKESMRRMTLQPQDSRSRMNGYSESYPERFGQADCSHYMRTGYCGYGM  96

Query  237   SCRFNHPSNRKLAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAG  416
             +CRFNHP+N KL   AAR KGE PERVG   CQ+Y+KTG CKFGATCK+HHPRD+ G AG
Sbjct  97    NCRFNHPTNMKLQ--AARNKGELPERVGHNACQFYMKTGTCKFGATCKYHHPRDRLG-AG  153

Query  417   RVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM--MVPLRGSPAYPPVHS  590
             +V LN++G P+R  + EC YY+RTG CK+G++CK+ HPQP+ +  +VP+ GSP Y  +  
Sbjct  154   QVQLNMIGLPMRMGEKECTYYIRTGYCKYGASCKYDHPQPAALGTLVPVSGSPLYATIRP  213

Query  591   PT--------TPGQLSYPLSRASFITNPRWQGPSSYTPLIVP--QGVVSVPGF-AYSGQL  737
             P         +PG  ++P  R  +  +P   G   Y P++    QG+++  G+  Y    
Sbjct  214   PIAPASATQYSPGLPTWPSPRTPYRQSPHMPGALPYMPVMYSPHQGMLAASGWGTYQSPA  273

Query  738   GSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPM-----GYYALQREN  902
               ++SPESQQ     +  Y  ++ + ++  G QG+   +  G+        G++   R  
Sbjct  274   SPLTSPESQQQLRRMNIMYNSTQPNGLSVGGVQGLITPFAQGSSAAVGHQPGHFQPNRTQ  333

Query  903   --VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCA  1076
                +PERPGQPECQ+Y+KTGDCKFG  C++HHP ER+      +LSPIGLPLRP +P C 
Sbjct  334   TETYPERPGQPECQYYIKTGDCKFGFACRYHHPHERVSQSSTCVLSPIGLPLRPTQPTCT  393

Query  1077  FYSRYGICKFGPSCKFDHPMG  1139
             +YS YGICKFGP+CKFDHPM 
Sbjct  394   YYSHYGICKFGPTCKFDHPMA  414



>ref|XP_009776613.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana sylvestris]
Length=434

 Score =   295 bits (756),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 163/368 (44%), Positives = 225/368 (61%), Gaps = 9/368 (2%)
 Frame = +3

Query  102   PLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  281
             P+ QET    S++ +       YP R G PDCSYY+RTG C +GA+CR+NHP +R     
Sbjct  23    PVEQETGLDESMQRLGLWGREIYPERPGVPDCSYYMRTGSCGYGANCRYNHPRDRAYGGK  82

Query  282   AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
                 + E+PER+G+P CQYYL+TG CKFGA+CKFHHP++  G    + LN  GYP+RP +
Sbjct  83    MQLERVEFPERLGEPMCQYYLRTGTCKFGASCKFHHPKNLGGSLSNIPLNTHGYPVRPGE  142

Query  462   IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHS-PTTPGQLSYPLSRASF  638
             IEC YY++TG CKFG TCK+HHPQ + + VP    P YP V S P  P + +   +    
Sbjct  143   IECSYYLKTGHCKFGITCKYHHPQTAGISVPAPARPFYPTVQSLPAPPEEYNSASTGLRV  202

Query  639   ITNPRWQG---PSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
                P   G   PS+Y P+++  GVV++  ++ YSG +    SP +Q  + G +  YG+S+
Sbjct  203   ARPPLLPGSYVPSAYGPVLLHPGVVTIQNWSPYSGPVSPALSPGAQP-SAGVTSIYGISQ  261

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              +   +  +   +P + A +        Q+E  FPERPGQP CQ+YMKTGDCKFG+ C++
Sbjct  262   LASSTHAFAGTYSPLHSAASPSS---KTQKEKSFPERPGQPTCQYYMKTGDCKFGSSCRY  318

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHP + +    +  +SP+GLPLRPG   C+FY   G CKFG +CKFDHPMG   Y+ S S
Sbjct  319   HHPPDWIASKTNCAISPLGLPLRPGVQPCSFYLLKGFCKFGRACKFDHPMGTVQYSSSAS  378

Query  1167  STTNAPTV  1190
             S  + P  
Sbjct  379   SLPDLPIA  386



>ref|XP_004296815.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Fragaria vesca subsp. vesca]
Length=475

 Score =   297 bits (760),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 170/384 (44%), Positives = 228/384 (59%), Gaps = 46/384 (12%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E++WQL+L   E+     YP R  E DCSYY+RTG+C +G+ CR+NHP +R     A R
Sbjct  29    EESMWQLALGPGES-----YPERPDEADCSYYLRTGICGYGSRCRYNHPRDRSAVTGALR  83

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
                 EYPERVGQP CQYY++TG CKFGATCK+HHP+   G A  V+LN  GYPLRP + E
Sbjct  84    AGSVEYPERVGQPVCQYYMRTGTCKFGATCKYHHPKQGGGSATPVSLNYYGYPLRPGERE  143

Query  468   CPYYMRTGQCKFGSTCKFHHP--------QPSNMMVPLRGSPA-YPPVHSPTTPGQ----  608
             C YY++TGQCKFG+TCKFHHP         PS     +  +P  Y  V SP+   Q    
Sbjct  144   CSYYVKTGQCKFGATCKFHHPPLTSTQPQVPSQAQASIVPTPTLYQTVQSPSVSSQPYGT  203

Query  609   ---LSYPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTV  776
                   PL  +S++ +P       Y P+++P G+V   G++ Y      ++SP S Q  V
Sbjct  204   VMVARPPLLPSSYVQSP-------YGPMLIPPGMVPFSGWSPYPAGASPLASP-STQTAV  255

Query  777   GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYAL------QRENVFPERPGQPECQ  938
             G+   YG+++ S  A        P+Y  G  P   ++L      Q+E   PERPGQ ECQ
Sbjct  256   GSGALYGINQISPSA--------PAY-TGIFPTAPFSLGPPTTSQKEQSHPERPGQAECQ  306

Query  939   FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSC  1118
             +Y++TG+CKFG+ C++HHP E +       LS  GLP RPG PLC  Y++ G CKFG +C
Sbjct  307   YYLRTGECKFGSSCRYHHPAEVVPLKTPVALSSTGLPSRPGAPLCTHYAQRGACKFGSAC  366

Query  1119  KFDHPMGVFTYNISPSSTTNAPTV  1190
             KFDHP+G  +Y+ S SS T+ P  
Sbjct  367   KFDHPVGTLSYSPSASSLTDVPVA  390



>ref|XP_009774842.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Nicotiana sylvestris]
Length=492

 Score =   297 bits (761),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 227/378 (60%), Gaps = 32/378 (8%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQLSL +       +YP R  EPDC YY+RTG C +GA CRFNHP +R   + A R
Sbjct  32    EEPMWQLSLNTGPE----SYPERPNEPDCIYYLRTGFCGYGARCRFNHPRDRNSVLGAMR  87

Query  291   MKG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  467
               G EYPERVGQP CQYY++TG CKFGA+CK+HHPR   G    V +N+ GYPLRP + E
Sbjct  88    ATGGEYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNIYGYPLRPGEKE  147

Query  468   CPYYMRTGQCKFGSTCKFHHPQPSNMMVPLR-------GSPA-------YPPVHSPTTPG  605
             C YY++TGQCKFG TCKFHHP P+   VP           PA       YP V SP+   
Sbjct  148   CSYYVKTGQCKFGVTCKFHHPHPAGAQVPAPPAGPGPLAVPAAVPAPHIYPTVQSPSVQS  207

Query  606   QLSY-------PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQ  764
                Y       P++R + +  P    P +Y  +++P G+V +PG++      S +   S 
Sbjct  208   AQQYGVVSGNWPVARPTLL--PGSYIPGTYGSMLLPPGMVPLPGWSPYPAPASPAPSPST  265

Query  765   QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  944
             Q        YGLS+ S  A      M P     +      + Q+E+ FPERPGQPECQ+Y
Sbjct  266   QPPPAAGPIYGLSQLSPSAPA---YMGPYLSVASASGPSSSSQKEHAFPERPGQPECQYY  322

Query  945   MKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKF  1124
             MK GDCK+G+ C++HHP E   P    +LS +GLPLRPG P+C+ Y++ G+CKFGPSCKF
Sbjct  323   MKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMGLPLRPGAPICSHYAQNGVCKFGPSCKF  382

Query  1125  DHPMGVFTYNISPSSTTN  1178
             DHPMG+ +Y+ S SS  +
Sbjct  383   DHPMGM-SYSPSASSLAD  399



>gb|KHN29278.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=267

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 183/225 (81%), Gaps = 10/225 (4%)
 Frame = +3

Query  543   MMVPLRGSPAYPPVHSPTTPGQLSYP-----LSRASFITNPRWQGPSSYTPLIVPQGVVS  707
             M++ +R SP YP VHSPTTPGQ SY       S +S+I +PRWQGPSSY PLI+PQG+VS
Sbjct  1     MVLSMRSSPVYPTVHSPTTPGQQSYATGITNWSSSSYIPSPRWQGPSSYAPLILPQGMVS  60

Query  708   VPGF-AYSGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYY  884
             VPG+ AYSGQ+GS    +S Q T+GN Q+YG SR SE AN GSQG    +R+G++P+G+Y
Sbjct  61    VPGWSAYSGQMGS----DSPQQTMGNGQSYGTSRQSEPANSGSQGAYSQFRSGSVPVGFY  116

Query  885   ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGE  1064
             ALQREN+FPERP QPECQFYMKTGDCKFGAVC+FHHPRER+IP PD +LSPIGLPLRPGE
Sbjct  117   ALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGE  176

Query  1065  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  1199
             PLC FYSRYGICKFGPSCKFDHPMGVFTYNIS S + +AP  R  
Sbjct  177   PLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASPSADAPGRRML  221


 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +3

Query  270  LAIAAARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPL  449
            +   A + +  +PER  QPECQ+Y+KTG CKFGA C+FHHPR++   A    L+ +G PL
Sbjct  113  VGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPL  172

Query  450  RPNDIECPYYMRTGQCKFGSTCKFHHP  530
            RP +  C +Y R G CKFG +CKF HP
Sbjct  173  RPGEPLCVFYSRYGICKFGPSCKFDHP  199


 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +3

Query  168  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKG-EYPERVGQPECQYYL  344
            +P R  +P+C +Y++TG C+FGA CRF+HP  R +      +     P R G+P C +Y 
Sbjct  124  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYS  183

Query  345  KTGACKFGATCKFHHP  392
            + G CKFG +CKF HP
Sbjct  184  RYGICKFGPSCKFDHP  199


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +3

Query  441  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  608
            +P RP+  EC +YM+TG CKFG+ C+FHHP+    M+P        P+  P  PG+
Sbjct  124  FPERPDQPECQFYMKTGDCKFGAVCRFHHPR--ERMIPAPDC-VLSPIGLPLRPGE  176



>gb|KGN57087.1| hypothetical protein Csa_3G152140 [Cucumis sativus]
Length=476

 Score =   296 bits (758),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 174/376 (46%), Positives = 232/376 (62%), Gaps = 34/376 (9%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             ++LW L  R  ++     YP R  E DC YY+RTG C +G+ CRFNHP  R      +R 
Sbjct  31    DSLWPLGSRDRDS-----YPERPDEADCIYYLRTGFCGYGSRCRFNHPRER-----GSRP  80

Query  294   KG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
              G EYPER+GQP CQYY++TG CKFGA+CK+HHP+ + G    V+LN  GYPLRP + EC
Sbjct  81    GGREYPERIGQPVCQYYMRTGMCKFGASCKYHHPQQERGSLSPVSLNFYGYPLRPGEKEC  140

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNM---------MVPLRGS-PA---YPPVHSPTTPGQL  611
              YY++ GQCKFG+TCKFHHP+P+ +         + P+ G  PA   YPPV SP+     
Sbjct  141   SYYLKNGQCKFGATCKFHHPEPAGLQFPAPSPVQVAPIAGQVPAPSVYPPVQSPSAHSSQ  200

Query  612   SYP--LSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGN  782
              Y   L+R S ++NP   GP  Y P++V  GVV  P ++ Y   +  V+SP S Q +VG+
Sbjct  201   QYGVILARPSLLSNPYVPGP--YGPMLVSPGVVQFPSWSPYPAPMSPVASP-SAQPSVGS  257

Query  783   SQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDC  962
                YG++  S  A+    G   SY+           Q+E+ FPERPGQPECQ+YM+TGDC
Sbjct  258   GPLYGMAHVSPSAS----GFAGSYQPMPSTGPSSTSQKEHSFPERPGQPECQYYMRTGDC  313

Query  963   KFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  1142
             KFG+ C++HHP E +   P  +LS +GLPLRPG P C  + + G+CKFGP+CKFDH M  
Sbjct  314   KFGSSCRYHHPPELVTSRPSVVLSQLGLPLRPGAPPCTHFMQRGMCKFGPACKFDHSMDR  373

Query  1143  FTYNISPSSTTNAPTV  1190
              +Y+ S SS  + P  
Sbjct  374   LSYSPSASSLADMPVA  389



>ref|XP_009369128.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Pyrus x bretschneideri]
Length=473

 Score =   296 bits (758),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 169/371 (46%), Positives = 217/371 (58%), Gaps = 19/371 (5%)
 Frame = +3

Query  114   ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  293
             ET  + S+R +      +YP R  E DCSYY+RTG+C +G+ CR+NHP +R + I AAR 
Sbjct  25    ETGLEGSMRQLGLGTGESYPERSNEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAART  84

Query  294   KG-EYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIEC  470
              G EYPER GQP CQYY++TG CKFGA+CK+HHP+        V+LN  GYPLRP++ +C
Sbjct  85    GGLEYPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPSERDC  144

Query  471   PYYMRTGQCKFGSTCKFHHPQPSNMMVP-------LRGSPA----YPPVHSPTTPGQLSY  617
              YY++TGQCKFGSTCKFHHPQP+ + +P       +   PA    Y  V SP+   Q   
Sbjct  145   SYYVKTGQCKFGSTCKFHHPQPAGIQLPGPSPAPQVSPVPATHTLYQNVQSPSVSSQ---  201

Query  618   PLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGFAYSGQLGSVSSPESQQLTVGNSQAYG  797
                   F   P    PS Y  +++ QG +  PG+     L S     S Q  VG    Y 
Sbjct  202   -QYGVVFARPPLTYVPSPYDQVLLSQGPIPFPGWNPYQALASQLPSPSTQSGVGARTLYT  260

Query  798   LSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAV  977
                 S  A  G     P   +  LP      Q+E +FPERPGQPECQ++M+TGDCKFG+ 
Sbjct  261   QLSPSAPAFTGMYQPMPLASSLGLPT---TSQKEQIFPERPGQPECQYFMRTGDCKFGSS  317

Query  978   CKFHHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  1157
             C++HHP E +      LLS  GLPLRPG PLC  Y + G CKFG +CKFDHP+G  +Y+ 
Sbjct  318   CRYHHPPEVVQSKTTVLLSSSGLPLRPGAPLCTHYQQRGACKFGSACKFDHPIGTLSYSP  377

Query  1158  SPSSTTNAPTV  1190
             S SS  + P  
Sbjct  378   SASSLADMPVA  388



>ref|XP_009802825.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana sylvestris]
Length=496

 Score =   296 bits (759),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 180/395 (46%), Positives = 238/395 (60%), Gaps = 49/395 (12%)
 Frame = +3

Query  111   QETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  290
             +E +WQLS+ S       +YP R  E DC YY+RTG C +G+ CRFNHP +R L + AAR
Sbjct  28    EEAMWQLSVGSGPE----SYPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAAR  83

Query  291   M------KGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  452
                    +GEYPERVGQP CQYY++TG CKFGA+CK+HHPR   G    +  N+ GYPLR
Sbjct  84    AIGGGGGEGEYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLR  143

Query  453   P----NDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRG-------------------  563
             P     + EC +YM+TGQCKFG TCKFHHPQP+ + VP                      
Sbjct  144   PFLAQGEKECLFYMKTGQCKFGITCKFHHPQPAGVQVPASAARPGAFPLPAAVPPPATYP  203

Query  564   SPAYPPVHSPTTPGQLS--YPLSRASFITNPRWQGPSSYTPLIVPQGVVSVPGF----AY  725
             +   P V S    G ++  +P+ R + +  P    P +Y P++ P G+V VPG+    A 
Sbjct  204   TVQSPSVQSAQQYGVIAGNWPVVRPTLL--PGSYLPGTYGPMLFPPGMVPVPGWTPYPAS  261

Query  726   SGQLGSVSSPESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENV  905
             + QL S+++    Q   G    YGL++ S  A     G + S  A   P G  ++Q+E+ 
Sbjct  262   ASQLPSLTT----QPAAGAGPVYGLTQLSASAP-SYMGPHTSLTASIGPSG--SIQKEHA  314

Query  906   FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglplRPGEPLCAFYS  1085
             FPERPGQPECQ+YMK GDCKFG+ C++HHP E   P    +LS +GLPLRPG P+C+ YS
Sbjct  315   FPERPGQPECQYYMKYGDCKFGSSCRYHHPPEWSGPKLGFILSAMGLPLRPGAPICSHYS  374

Query  1086  RYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  1190
             + G+CKFGPSCKFDHPMG+ +Y+ S SS  + P  
Sbjct  375   QNGVCKFGPSCKFDHPMGI-SYSPSASSLVDMPVA  408



>ref|XP_006366677.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Solanum tuberosum]
Length=397

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/368 (44%), Positives = 220/368 (60%), Gaps = 9/368 (2%)
 Frame = +3

Query  102   PLAQETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  281
             P+  ET  + S+R +       YP R G  +CS+Y+RTG C +GA CR+NHP +R    A
Sbjct  17    PVGPETGLEESMRRLGLWSREAYPERSGTSNCSFYMRTGSCGYGAKCRYNHPPDRSSVGA  76

Query  282   AARMKGEYPERVGQPECQYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  461
                 + EYPER+G+P CQYYL+T  CKFGA+CKFHHPR+  G    ++LNV GYPL P +
Sbjct  77    VLLERSEYPERIGEPTCQYYLRTATCKFGASCKFHHPRNLGGSLSNISLNVYGYPLHPEE  136

Query  462   IECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQLSYPLSRASFI  641
              EC YY++TGQCKFG TCKFHHP  + +  P    P YP   S  TP +     S +S +
Sbjct  137   RECSYYLKTGQCKFGITCKFHHPDHTEVSAPATARPFYPTASSLPTPPEEYNSASTSSRV  196

Query  642   TNPRWQG----PSSYTPLIVPQGVVSVPGFA-YSGQLGSVSSPESQQLTVGNSQAYGLSR  806
               P+       P +Y P+++  GVV++  ++ YSG +    SP +Q  + G +  YG+ +
Sbjct  197   ARPQLLSGPYVPGTYGPVLLHPGVVTIQNWSTYSGPVSPALSPGAQP-SAGMASIYGMPQ  255

Query  807   SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKF  986
              +      +   +P + A        +  +EN FPERPGQP CQ+Y+KTGDCKFG+ CKF
Sbjct  256   LASSTAAFAAPYSPLHSAAGPSS---SALKENRFPERPGQPVCQYYIKTGDCKFGSSCKF  312

Query  987   HHPRERlipppdsllspiglplRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  1166
             HHP + +    D   SP+GLPLRPG   C+FY + G CKFG +CKFDHPMG   Y+ S S
Sbjct  313   HHPADWIASKTDCAFSPLGLPLRPGVQPCSFYMQRGFCKFGGTCKFDHPMGTVRYSPSAS  372

Query  1167  STTNAPTV  1190
             S  + P  
Sbjct  373   SLPDIPNA  380



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5050657640886