BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25113_g1_i3 len=886 path=[2741:0-109 11646:110-124 5992:125-165
15753:166-182 937:183-229 984:230-268 1023:269-272 15957:273-334
15992:335-345 4418:346-363 1118:364-419 4212:420-455 1210:456-538
1293:539-542 1297:543-543 1298:544-578 16089:579-589 1344:590-612
1367:613-765 1520:766-788 1543:789-885]

Length=886
                                                                      Score     E

emb|CDX73583.1|  BnaC08g24200D                                        55.1    4e-06   
ref|XP_006657567.1|  PREDICTED: 60S ribosomal protein L24-like is...  54.3    1e-05   
ref|NP_001059209.2|  Os07g0224000                                     54.3    1e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC06922.1|  putative 60S ribosomal protein L24                   53.9    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ39157.1|  hypothetical protein OsJ_23584                        54.3    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81749.1|  hypothetical protein OsI_25404                        54.7    2e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_002305219.1|  60S ribosomal protein L24                        53.5    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008442779.1|  PREDICTED: 60S ribosomal protein L24-like        53.1    2e-05   
ref|XP_011002195.1|  PREDICTED: 60S ribosomal protein L24-like        53.1    3e-05   
ref|XP_004961704.1|  PREDICTED: 60S ribosomal protein L24-like        52.8    3e-05   
ref|XP_004970361.1|  PREDICTED: 60S ribosomal protein L24-like        52.8    3e-05   
ref|XP_006644899.1|  PREDICTED: 60S ribosomal protein L24-like        52.8    4e-05   
ref|XP_002441285.1|  hypothetical protein SORBIDRAFT_09g023800        52.8    4e-05   Sorghum bicolor [broomcorn]
ref|NP_001044615.1|  Os01g0815800                                     52.8    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ACN31402.1|  unknown                                               51.2    4e-05   Zea mays [maize]
ref|NP_001055880.1|  Os05g0486700                                     52.8    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564475.1|  PREDICTED: 60S ribosomal protein L24             52.4    4e-05   
ref|XP_003574678.1|  PREDICTED: 60S ribosomal protein L24-like        52.4    4e-05   
ref|XP_011081017.1|  PREDICTED: 60S ribosomal protein L24-like        52.4    4e-05   
gb|EMT31808.1|  60S ribosomal protein L24                             52.4    4e-05   
sp|P50888.1|RL24_HORVU  RecName: Full=60S ribosomal protein L24       52.4    4e-05   Hordeum vulgare [barley]
ref|XP_008812942.1|  PREDICTED: 60S ribosomal protein L24-like is...  52.4    4e-05   
ref|XP_008812941.1|  PREDICTED: 60S ribosomal protein L24-like is...  52.4    4e-05   
ref|XP_009391645.1|  PREDICTED: 60S ribosomal protein L24-like        52.4    5e-05   
ref|XP_008800796.1|  PREDICTED: 60S ribosomal protein L24-like        52.4    5e-05   
ref|XP_009408373.1|  PREDICTED: 60S ribosomal protein L24             52.4    5e-05   
ref|XP_004246582.1|  PREDICTED: 60S ribosomal protein L24             52.4    5e-05   
ref|XP_006857869.1|  hypothetical protein AMTR_s00069p00095150        52.8    5e-05   
ref|XP_011072223.1|  PREDICTED: 60S ribosomal protein L24             52.4    5e-05   
gb|KHN18715.1|  60S ribosomal protein L24                             51.6    6e-05   
ref|XP_009125247.1|  PREDICTED: 60S ribosomal protein L24-2           52.0    7e-05   
ref|XP_009143573.1|  PREDICTED: 60S ribosomal protein L24-1           52.0    7e-05   
emb|CDX78144.1|  BnaA09g33390D                                        52.0    7e-05   
ref|XP_009148759.1|  PREDICTED: 60S ribosomal protein L24-2 isofo...  51.6    7e-05   
emb|CDY33169.1|  BnaC04g08700D                                        51.6    8e-05   
emb|CDX67555.1|  BnaA07g15950D                                        52.0    8e-05   
gb|ACF82615.1|  unknown                                               50.8    8e-05   Zea mays [maize]
gb|ACG32676.1|  60S ribosomal protein L24                             50.8    8e-05   Zea mays [maize]
gb|EMS54414.1|  60S ribosomal protein L24                             51.2    8e-05   
gb|KFK34555.1|  hypothetical protein AALP_AA5G161200                  51.6    8e-05   
ref|XP_008812940.1|  PREDICTED: 60S ribosomal protein L24-like is...  51.2    8e-05   
gb|AFW68254.1|  60S ribosomal protein L24                             50.8    8e-05   
ref|NP_001235119.1|  uncharacterized protein LOC100499979             51.6    8e-05   
ref|XP_007145271.1|  hypothetical protein PHAVU_007G224900g           51.6    9e-05   
ref|XP_006403736.1|  hypothetical protein EUTSA_v10010779mg           51.6    9e-05   
gb|KHG20192.1|  60S ribosomal L24                                     52.0    9e-05   
gb|KFK36539.1|  hypothetical protein AALP_AA4G137000                  51.6    9e-05   
gb|KHN45681.1|  60S ribosomal protein L24                             51.6    9e-05   
ref|NP_001276283.1|  60S ribosomal protein L24-like                   51.6    9e-05   
ref|XP_006291963.1|  hypothetical protein CARUB_v10018151mg           50.8    9e-05   
emb|CDP05234.1|  unnamed protein product                              51.6    1e-04   
ref|XP_004137862.1|  PREDICTED: 60S ribosomal protein L24-like        51.6    1e-04   
ref|XP_006829792.1|  hypothetical protein AMTR_s00119p00055300        51.2    1e-04   
ref|XP_010934466.1|  PREDICTED: 60S ribosomal protein L24-like        51.2    1e-04   
ref|XP_007202682.1|  hypothetical protein PRUPE_ppa012563mg           51.2    1e-04   
gb|ACG40357.1|  60S ribosomal protein L24                             51.2    1e-04   Zea mays [maize]
ref|XP_008812939.1|  PREDICTED: 60S ribosomal protein L24-like is...  50.8    1e-04   
ref|XP_002321904.1|  hypothetical protein POPTR_0015s13330g           51.2    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006654559.1|  PREDICTED: 60S ribosomal protein L24-like is...  50.8    1e-04   
ref|NP_001132205.1|  uncharacterized protein LOC100193634             50.8    1e-04   Zea mays [maize]
ref|NP_001150133.1|  60S ribosomal protein L24                        50.8    2e-04   Zea mays [maize]
ref|NP_001150101.1|  60S ribosomal protein L24                        50.8    2e-04   Zea mays [maize]
emb|CDX79691.1|  BnaC03g20270D                                        50.8    2e-04   
ref|XP_004305372.1|  PREDICTED: 60S ribosomal protein L24-like        52.4    2e-04   
ref|XP_004955822.1|  PREDICTED: 60S ribosomal protein L24-like        50.8    2e-04   
gb|KHG15438.1|  60S ribosomal L24                                     50.8    2e-04   
ref|NP_190870.1|  60S ribosomal protein L24-2                         50.8    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877898.1|  hypothetical protein ARALYDRAFT_485677           50.8    2e-04   
ref|XP_010515785.1|  PREDICTED: 60S ribosomal protein L24-2           50.8    2e-04   
ref|XP_006291962.1|  hypothetical protein CARUB_v10018151mg           50.8    2e-04   
ref|XP_010255502.1|  PREDICTED: 60S ribosomal protein L24             50.8    2e-04   
ref|NP_001235068.1|  uncharacterized protein LOC100499720             50.4    2e-04   
ref|XP_010278576.1|  PREDICTED: 60S ribosomal protein L24-like        50.4    2e-04   
ref|XP_007010133.1|  60S ribosomal protein L24-1 isoform 2            50.4    2e-04   
ref|XP_008241331.1|  PREDICTED: 60S ribosomal protein L24             50.4    2e-04   
ref|XP_008792518.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...  50.4    2e-04   
gb|AEC11017.1|  60S ribosomal protein L24                             50.8    2e-04   
ref|XP_010516886.1|  PREDICTED: 60S ribosomal protein L24-1           50.4    2e-04   
gb|KDP22312.1|  hypothetical protein JCGZ_26143                       50.4    2e-04   
ref|NP_565851.1|  60S ribosomal protein L24-1                         50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881455.1|  RPL24A                                           50.4    2e-04   
ref|XP_007038620.1|  60S ribosomal protein L24-1                      50.4    2e-04   
ref|XP_007202683.1|  hypothetical protein PRUPE_ppa012563mg           50.4    2e-04   
ref|XP_010509453.1|  PREDICTED: 60S ribosomal protein L24-1-like      50.4    2e-04   
ref|XP_007010132.1|  60S ribosomal protein L24-1 isoform 1            50.8    2e-04   
gb|EYU22234.1|  hypothetical protein MIMGU_mgv1a015282mg              50.4    2e-04   
gb|EYU35878.1|  hypothetical protein MIMGU_mgv1a015278mg              50.4    2e-04   
ref|XP_010922879.1|  PREDICTED: 60S ribosomal protein L24-like        50.4    2e-04   
ref|XP_002528634.1|  60S ribosomal protein L24, putative              50.8    2e-04   Ricinus communis
ref|XP_010505209.1|  PREDICTED: 60S ribosomal protein L24-1-like      50.4    2e-04   
ref|XP_007027572.1|  Ribosomal protein L24                            50.4    2e-04   
gb|AFA36497.1|  L24 ribosomal protein                                 49.3    2e-04   
ref|XP_010931447.1|  PREDICTED: 60S ribosomal protein L24             50.1    3e-04   
gb|EEC71698.1|  hypothetical protein OsI_04199                        52.8    3e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006410833.1|  hypothetical protein EUTSA_v10017341mg           50.1    3e-04   
ref|XP_004498085.1|  PREDICTED: 60S ribosomal protein L24-like        50.1    3e-04   
sp|Q9FUL4.1|RL24_PRUAV  RecName: Full=60S ribosomal protein L24       50.4    3e-04   Prunus avium [gean]
ref|XP_008462521.1|  PREDICTED: 60S ribosomal protein L24             50.1    3e-04   
ref|XP_004143295.1|  PREDICTED: 60S ribosomal protein L24-like        50.1    3e-04   
gb|KHG04496.1|  60S ribosomal L24                                     50.1    3e-04   
gb|EMT26743.1|  60S ribosomal protein L24                             50.8    3e-04   
gb|EMS67681.1|  Zinc finger protein VAR3, chloroplastic               52.4    3e-04   
ref|XP_003590400.1|  60S ribosomal protein L24                        50.1    3e-04   
ref|XP_010065496.1|  PREDICTED: 60S ribosomal protein L24-like        50.1    3e-04   
emb|CDP09795.1|  unnamed protein product                              50.1    3e-04   
ref|XP_003563859.1|  PREDICTED: 60S ribosomal protein L24-like        49.7    3e-04   
ref|XP_010553352.1|  PREDICTED: 60S ribosomal protein L24             49.7    4e-04   
ref|NP_001266018.1|  60S ribosomal protein L24                        49.7    4e-04   
ref|XP_007162832.1|  hypothetical protein PHAVU_001G184700g           49.7    4e-04   
ref|NP_001237396.1|  uncharacterized protein LOC100499884             49.7    4e-04   
gb|ACJ86193.1|  unknown                                               49.7    4e-04   Medicago truncatula
gb|AFK43072.1|  unknown                                               49.7    4e-04   
gb|AFK40850.1|  unknown                                               49.7    4e-04   
ref|XP_004298778.1|  PREDICTED: 60S ribosomal protein L24-like is...  49.3    4e-04   
gb|KHN48187.1|  60S ribosomal protein L24                             49.7    4e-04   
ref|XP_010558971.1|  PREDICTED: 60S ribosomal protein L24-like        49.7    4e-04   
ref|XP_010558216.1|  PREDICTED: 60S ribosomal protein L24-like        49.3    5e-04   
ref|XP_001763745.1|  predicted protein                                49.3    5e-04   
ref|XP_008345349.1|  PREDICTED: 60S ribosomal protein L24-like        48.9    5e-04   
ref|NP_001275204.1|  ribosomal protein L24-like protein               49.7    5e-04   
ref|XP_006341189.1|  PREDICTED: 60S ribosomal protein L24             49.3    5e-04   
gb|KHN02273.1|  60S ribosomal protein L24                             51.6    5e-04   
ref|XP_004308109.1|  PREDICTED: 60S ribosomal protein L24-like        49.3    5e-04   
ref|XP_002318822.1|  hypothetical protein POPTR_0012s13380g           49.3    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010662508.1|  PREDICTED: 60S ribosomal protein L24 isoform X2  49.3    6e-04   
gb|KDO63542.1|  hypothetical protein CISIN_1g031225mg                 48.5    6e-04   
ref|XP_011012371.1|  PREDICTED: 60S ribosomal protein L24-like        49.3    6e-04   
ref|XP_002279048.2|  PREDICTED: 60S ribosomal protein L24 isoform X1  49.3    6e-04   Vitis vinifera
gb|ABR17906.1|  unknown                                               49.3    6e-04   Picea sitchensis
gb|KHN18810.1|  60S ribosomal protein L24                             51.2    6e-04   
emb|CBI31821.3|  unnamed protein product                              49.7    7e-04   
ref|XP_004249675.1|  PREDICTED: 60S ribosomal protein L24             48.9    8e-04   
ref|NP_001275450.1|  60S ribosomal protein L24-like                   48.9    8e-04   
ref|XP_006339101.1|  PREDICTED: 60S ribosomal protein L24-like        48.9    8e-04   
ref|XP_004298777.1|  PREDICTED: 60S ribosomal protein L24-like is...  48.9    8e-04   
ref|XP_010504057.1|  PREDICTED: 60S ribosomal protein L24-2-like      48.5    9e-04   
ref|XP_004249467.1|  PREDICTED: 60S ribosomal protein L24-like        48.5    9e-04   
gb|KDP29235.1|  hypothetical protein JCGZ_16624                       48.5    9e-04   
ref|XP_010654022.1|  PREDICTED: 60S ribosomal protein L24             48.5    9e-04   
ref|XP_009386977.1|  PREDICTED: 60S ribosomal protein L24-like        48.5    9e-04   
gb|KDO63541.1|  hypothetical protein CISIN_1g031225mg                 48.1    9e-04   
ref|XP_009345440.1|  PREDICTED: 60S ribosomal protein L24-1           48.5    0.001   
ref|XP_010527858.1|  PREDICTED: 60S ribosomal protein L24-like        48.5    0.001   
ref|XP_009598682.1|  PREDICTED: 60S ribosomal protein L24             48.5    0.001   
ref|XP_008369466.1|  PREDICTED: 60S ribosomal protein L24-1-like      48.5    0.001   
ref|XP_009369027.1|  PREDICTED: 60S ribosomal protein L24-1-like      48.5    0.001   
ref|XP_009803776.1|  PREDICTED: 60S ribosomal protein L24             48.5    0.001   
ref|XP_009612803.1|  PREDICTED: 60S ribosomal protein L24-like        48.5    0.001   
ref|XP_008387472.1|  PREDICTED: 60S ribosomal protein L24             48.5    0.001   
ref|XP_009612827.1|  PREDICTED: 60S ribosomal protein L24-like        48.5    0.001   



>emb|CDX73583.1| BnaC08g24200D [Brassica napus]
Length=130

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            D+ +  ++VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  30   DLDAAQEAVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  68



>ref|XP_006657567.1| PREDICTED: 60S ribosomal protein L24-like isoform X1 [Oryza brachyantha]
 ref|XP_006657568.1| PREDICTED: 60S ribosomal protein L24-like isoform X2 [Oryza brachyantha]
Length=161

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  100



>ref|NP_001059209.2| Os07g0224000 [Oryza sativa Japonica Group]
 dbj|BAF21123.2| Os07g0224000 [Oryza sativa Japonica Group]
Length=161

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  100



>dbj|BAC06922.1| putative 60S ribosomal protein L24 [Oryza sativa Japonica Group]
 dbj|BAD30738.1| putative 60S ribosomal protein L24 [Oryza sativa Japonica Group]
Length=160

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  63   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  99



>gb|EAZ39157.1| hypothetical protein OsJ_23584 [Oryza sativa Japonica Group]
Length=187

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  90   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  126



>gb|EEC81749.1| hypothetical protein OsI_25404 [Oryza sativa Indica Group]
Length=227

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  130  DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  166



>ref|XP_002305219.1| 60S ribosomal protein L24 [Populus trichocarpa]
 gb|ABK95811.1| unknown [Populus trichocarpa]
 gb|EEE85730.1| 60S ribosomal protein L24 [Populus trichocarpa]
Length=163

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   TVKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_008442779.1| PREDICTED: 60S ribosomal protein L24-like [Cucumis melo]
Length=164

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_011002195.1| PREDICTED: 60S ribosomal protein L24-like [Populus euphratica]
Length=163

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++KKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   TIKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_004961704.1| PREDICTED: 60S ribosomal protein L24-like [Setaria italica]
Length=161

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGA+LEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGASLEVIQKKRAEK  100



>ref|XP_004970361.1| PREDICTED: 60S ribosomal protein L24-like [Setaria italica]
Length=162

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKR+EK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRSEK  100



>ref|XP_006644899.1| PREDICTED: 60S ribosomal protein L24-like [Oryza brachyantha]
Length=162

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKR+EK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRSEK  100



>ref|XP_002441285.1| hypothetical protein SORBIDRAFT_09g023800 [Sorghum bicolor]
 gb|EES19715.1| hypothetical protein SORBIDRAFT_09g023800 [Sorghum bicolor]
Length=161

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGA+LEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGASLEVIQKKRAEK  100



>ref|NP_001044615.1| Os01g0815800 [Oryza sativa Japonica Group]
 pdb|3J61|W Chain W, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD82702.1| putative 60S ribosomal protein L24 [Oryza sativa Japonica Group]
 dbj|BAF06529.1| Os01g0815800 [Oryza sativa Japonica Group]
 dbj|BAG95298.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86753.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55577.1| hypothetical protein OsJ_03860 [Oryza sativa Japonica Group]
Length=162

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKR+EK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRSEK  100



>gb|ACN31402.1| unknown [Zea mays]
Length=61

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR   + PYSRSIVGA+LEVIQKKRAEK
Sbjct  9    DIHA--EAVKKRRRATKKPYSRSIVGASLEVIQKKRAEK  45



>ref|NP_001055880.1| Os05g0486700 [Oryza sativa Japonica Group]
 gb|AAT01333.1| putative 60S ribosomal protein L24 [Oryza sativa Japonica Group]
 dbj|BAF17794.1| Os05g0486700 [Oryza sativa Japonica Group]
 gb|EAY98488.1| hypothetical protein OsI_20403 [Oryza sativa Indica Group]
 dbj|BAG86991.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64162.1| hypothetical protein OsJ_18994 [Oryza sativa Japonica Group]
Length=161

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGA+LEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGASLEVIQKKRAEK  100



>ref|XP_003564475.1| PREDICTED: 60S ribosomal protein L24 [Brachypodium distachyon]
Length=161

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++ KKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  64   DIHA--EAAKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_003574678.1| PREDICTED: 60S ribosomal protein L24-like [Brachypodium distachyon]
Length=161

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++ KKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  64   DIHA--EAAKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_011081017.1| PREDICTED: 60S ribosomal protein L24-like [Sesamum indicum]
Length=162

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T + PYSRSIVGATLEVIQK+RAEK
Sbjct  69   AVKKRRRTTKKPYSRSIVGATLEVIQKRRAEK  100



>gb|EMT31808.1| 60S ribosomal protein L24 [Aegilops tauschii]
Length=162

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++ KKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  64   DIHA--EAAKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  100



>sp|P50888.1|RL24_HORVU RecName: Full=60S ribosomal protein L24 [Hordeum vulgare]
 emb|CAA63960.1| L24 ribosomal protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86506.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=162

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++ KKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  64   DIHA--EAAKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_008812942.1| PREDICTED: 60S ribosomal protein L24-like isoform X2 [Phoenix 
dactylifera]
Length=160

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKR EK
Sbjct  61   DIHA--ETVKKRRRTTKKPYSRSIVGATLEVIQKKRTEK  97



>ref|XP_008812941.1| PREDICTED: 60S ribosomal protein L24-like isoform X1 [Phoenix 
dactylifera]
Length=163

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKR EK
Sbjct  64   DIHA--ETVKKRRRTTKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_009391645.1| PREDICTED: 60S ribosomal protein L24-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKR EK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_008800796.1| PREDICTED: 60S ribosomal protein L24-like [Phoenix dactylifera]
Length=163

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKR EK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_009408373.1| PREDICTED: 60S ribosomal protein L24 [Musa acuminata subsp. malaccensis]
Length=162

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKR EK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_004246582.1| PREDICTED: 60S ribosomal protein L24 [Solanum lycopersicum]
Length=162

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQKKRAE+
Sbjct  68   EAVKKRRRTTKKPYSRSIVGATLEVIQKKRAER  100



>ref|XP_006857869.1| hypothetical protein AMTR_s00069p00095150 [Amborella trichopoda]
 gb|ERN19336.1| hypothetical protein AMTR_s00069p00095150 [Amborella trichopoda]
Length=185

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKR EK
Sbjct  85   DIHA--ETVKKRRRTTKKPYSRSIVGATLEVIQKKRTEK  121



>ref|XP_011072223.1| PREDICTED: 60S ribosomal protein L24 [Sesamum indicum]
Length=163

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQK+RAEK
Sbjct  68   EAVKKRRRTTKKPYSRSIVGATLEVIQKRRAEK  100



>gb|KHN18715.1| 60S ribosomal protein L24 [Glycine soja]
Length=150

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  68   EAVKKRRRAAKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_009125247.1| PREDICTED: 60S ribosomal protein L24-2 [Brassica rapa]
 ref|XP_009148760.1| PREDICTED: 60S ribosomal protein L24-2 isoform X2 [Brassica rapa]
 emb|CDY58288.1| BnaCnng32900D [Brassica napus]
 emb|CDY13320.1| BnaC06g14370D [Brassica napus]
 emb|CDX76241.1| BnaA04g05050D [Brassica napus]
 emb|CDX73581.1| BnaC08g24220D [Brassica napus]
Length=162

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_009143573.1| PREDICTED: 60S ribosomal protein L24-1 [Brassica rapa]
 emb|CDX75028.1| BnaA05g07740D [Brassica napus]
Length=162

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>emb|CDX78144.1| BnaA09g33390D [Brassica napus]
Length=171

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  77   EAVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  109



>ref|XP_009148759.1| PREDICTED: 60S ribosomal protein L24-2 isoform X1 [Brassica rapa]
Length=162

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>emb|CDY33169.1| BnaC04g08700D [Brassica napus]
Length=162

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>emb|CDX67555.1| BnaA07g15950D [Brassica napus]
Length=177

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  83   EAVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  115



>gb|ACF82615.1| unknown [Zea mays]
Length=106

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR   + PYSRSIVGA+LEVIQKKRAEK
Sbjct  9    DIHA--EAVKKRRRATKKPYSRSIVGASLEVIQKKRAEK  45



>gb|ACG32676.1| 60S ribosomal protein L24 [Zea mays]
Length=107

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR   + PYSRSIVGA+LEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRATKKPYSRSIVGASLEVIQKKRAEK  100



>gb|EMS54414.1| 60S ribosomal protein L24 [Triticum urartu]
Length=115

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++ KKRR T + PYSRSIVGA+LEVIQKKRAEK
Sbjct  18   DIHA--EAAKKRRRTTKRPYSRSIVGASLEVIQKKRAEK  54



>gb|KFK34555.1| hypothetical protein AALP_AA5G161200 [Arabis alpina]
Length=162

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_008812940.1| PREDICTED: 60S ribosomal protein L24-like isoform X2 [Phoenix 
dactylifera]
Length=135

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  56   ETVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  88



>gb|AFW68254.1| 60S ribosomal protein L24 [Zea mays]
Length=113

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR   + PYSRSIVGA+LEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRATKKPYSRSIVGASLEVIQKKRAEK  100



>ref|NP_001235119.1| uncharacterized protein LOC100499979 [Glycine max]
 gb|ACU14473.1| unknown [Glycine max]
Length=163

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRAAKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_007145271.1| hypothetical protein PHAVU_007G224900g [Phaseolus vulgaris]
 gb|ESW17265.1| hypothetical protein PHAVU_007G224900g [Phaseolus vulgaris]
Length=164

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_006403736.1| hypothetical protein EUTSA_v10010779mg [Eutrema salsugineum]
 dbj|BAJ33856.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45189.1| hypothetical protein EUTSA_v10010779mg [Eutrema salsugineum]
Length=162

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>gb|KHG20192.1| 60S ribosomal L24 [Gossypium arboreum]
Length=190

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQKKR+EK
Sbjct  94   EAVKKRRRTAKKPYSRSIVGATLEVIQKKRSEK  126



>gb|KFK36539.1| hypothetical protein AALP_AA4G137000 [Arabis alpina]
Length=164

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>gb|KHN45681.1| 60S ribosomal protein L24 [Glycine soja]
Length=163

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRAAKKPYSRSIVGATLEVIQKKRAEK  100



>ref|NP_001276283.1| 60S ribosomal protein L24-like [Glycine max]
 gb|ACU20566.1| unknown [Glycine max]
Length=163

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRAAKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_006291963.1| hypothetical protein CARUB_v10018151mg [Capsella rubella]
 gb|EOA24861.1| hypothetical protein CARUB_v10018151mg [Capsella rubella]
Length=119

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  68   EAVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>emb|CDP05234.1| unnamed protein product [Coffea canephora]
Length=164

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRTTKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_004137862.1| PREDICTED: 60S ribosomal protein L24-like [Cucumis sativus]
 ref|XP_004161250.1| PREDICTED: 60S ribosomal protein L24-like [Cucumis sativus]
 gb|KGN59041.1| hypothetical protein Csa_3G748210 [Cucumis sativus]
Length=164

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_006829792.1| hypothetical protein AMTR_s00119p00055300 [Amborella trichopoda]
 gb|ERM97208.1| hypothetical protein AMTR_s00119p00055300 [Amborella trichopoda]
Length=164

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_010934466.1| PREDICTED: 60S ribosomal protein L24-like [Elaeis guineensis]
Length=163

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_007202682.1| hypothetical protein PRUPE_ppa012563mg [Prunus persica]
 gb|EMJ03881.1| hypothetical protein PRUPE_ppa012563mg [Prunus persica]
Length=152

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  68   EAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>gb|ACG40357.1| 60S ribosomal protein L24 [Zea mays]
Length=161

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR   + PYSRSIVGA+LEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRANKKPYSRSIVGASLEVIQKKRAEK  100



>ref|XP_008812939.1| PREDICTED: 60S ribosomal protein L24-like isoform X1 [Phoenix 
dactylifera]
Length=151

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            D+ +  ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  52   DVHA--ETVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  88



>ref|XP_002321904.1| hypothetical protein POPTR_0015s13330g [Populus trichocarpa]
 ref|XP_011048687.1| PREDICTED: 60S ribosomal protein L24 [Populus euphratica]
 gb|EEF06031.1| hypothetical protein POPTR_0015s13330g [Populus trichocarpa]
Length=163

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++KKRR T + PYSRSIVGATLEVIQKKR EK
Sbjct  69   TIKKRRRTTKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_006654559.1| PREDICTED: 60S ribosomal protein L24-like isoform X1 [Oryza brachyantha]
 ref|XP_006654560.1| PREDICTED: 60S ribosomal protein L24-like isoform X2 [Oryza brachyantha]
Length=161

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGA+LE IQKKRAEK
Sbjct  64   DIHA--EAVKKRRRTTKKPYSRSIVGASLEAIQKKRAEK  100



>ref|NP_001132205.1| uncharacterized protein LOC100193634 [Zea mays]
 ref|XP_008653543.1| PREDICTED: uncharacterized protein LOC100193634 isoform X1 [Zea 
mays]
 gb|ACF80960.1| unknown [Zea mays]
 tpg|DAA50212.1| TPA: 60S ribosomal protein L24 isoform 1 [Zea mays]
 tpg|DAA50213.1| TPA: 60S ribosomal protein L24 isoform 2 [Zea mays]
 tpg|DAA50214.1| TPA: 60S ribosomal protein L24 isoform 3 [Zea mays]
Length=161

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR   + PYSRSIVGA+LEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRATKKPYSRSIVGASLEVIQKKRAEK  100



>ref|NP_001150133.1| 60S ribosomal protein L24 [Zea mays]
 ref|XP_008643760.1| PREDICTED: 60S ribosomal protein L24 isoform X1 [Zea mays]
 gb|ACG37984.1| 60S ribosomal protein L24 [Zea mays]
 gb|AFW68252.1| 60S ribosomal protein L24 isoform 1 [Zea mays]
 gb|AFW68253.1| 60S ribosomal protein L24 isoform 2 [Zea mays]
Length=161

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR   + PYSRSIVGA+LEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRATKKPYSRSIVGASLEVIQKKRAEK  100



>ref|NP_001150101.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG30949.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG31379.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG32560.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG32773.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG33038.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG33302.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG34425.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG36216.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG36458.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG37834.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG38387.1| 60S ribosomal protein L24 [Zea mays]
 gb|ACG43529.1| 60S ribosomal protein L24 [Zea mays]
 gb|AFW82338.1| 60S ribosomal protein L24 isoform 1 [Zea mays]
 gb|AFW82339.1| 60S ribosomal protein L24 isoform 2 [Zea mays]
 gb|AFW82340.1| 60S ribosomal protein L24 isoform 3 [Zea mays]
Length=161

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR   + PYSRSIVGA+LEVIQKKRAEK
Sbjct  64   DIHA--EAVKKRRRATKKPYSRSIVGASLEVIQKKRAEK  100



>emb|CDX79691.1| BnaC03g20270D [Brassica napus]
Length=166

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  75   AVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  106



>ref|XP_004305372.1| PREDICTED: 60S ribosomal protein L24-like [Fragaria vesca subsp. 
vesca]
Length=265

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +SVKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  171  ESVKKRRRTNKKPYSRSIVGATLEVIQKRRTEK  203



>ref|XP_004955822.1| PREDICTED: 60S ribosomal protein L24-like [Setaria italica]
Length=161

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++ KKRR T + PYSRSIVGATLEVIQKKR EK
Sbjct  64   DIHA--EAAKKRRRTTKKPYSRSIVGATLEVIQKKRTEK  100



>gb|KHG15438.1| 60S ribosomal L24 [Gossypium arboreum]
Length=164

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T + PYSRSIVGATLEVIQK+R+EK
Sbjct  69   AVKKRRRTTKKPYSRSIVGATLEVIQKRRSEK  100



>ref|NP_190870.1| 60S ribosomal protein L24-2 [Arabidopsis thaliana]
 sp|P38666.2|RL242_ARATH RecName: Full=60S ribosomal protein L24-2; AltName: Full=Protein 
SHORT VALVE 1 [Arabidopsis thaliana]
 emb|CAB86906.1| 60S ribosomal protein-like [Arabidopsis thaliana]
 gb|AAL25545.1| AT3g53020/F8J2_190 [Arabidopsis thaliana]
 gb|AAM13179.1| 60S ribosomal protein-like [Arabidopsis thaliana]
 gb|AAP21353.1| At3g53020 [Arabidopsis thaliana]
 dbj|BAE48150.1| ribosomal protein L24 [Arabidopsis thaliana]
 gb|AEE79026.1| 60S ribosomal protein L24-2 [Arabidopsis thaliana]
Length=163

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_002877898.1| hypothetical protein ARALYDRAFT_485677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54157.1| hypothetical protein ARALYDRAFT_485677 [Arabidopsis lyrata subsp. 
lyrata]
Length=159

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  64   EAVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  96



>ref|XP_010515785.1| PREDICTED: 60S ribosomal protein L24-2 [Camelina sativa]
Length=163

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_006291962.1| hypothetical protein CARUB_v10018151mg [Capsella rubella]
 gb|EOA24860.1| hypothetical protein CARUB_v10018151mg [Capsella rubella]
Length=163

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_010255502.1| PREDICTED: 60S ribosomal protein L24 [Nelumbo nucifera]
 ref|XP_010255503.1| PREDICTED: 60S ribosomal protein L24 [Nelumbo nucifera]
Length=164

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  69   AVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|NP_001235068.1| uncharacterized protein LOC100499720 [Glycine max]
 gb|ACU13374.1| unknown [Glycine max]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +V+KRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVRKRRRAAKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_010278576.1| PREDICTED: 60S ribosomal protein L24-like [Nelumbo nucifera]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  69   AVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_007010133.1| 60S ribosomal protein L24-1 isoform 2 [Theobroma cacao]
 gb|EOY18943.1| 60S ribosomal protein L24-1 isoform 2 [Theobroma cacao]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  69   AVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_008241331.1| PREDICTED: 60S ribosomal protein L24 [Prunus mume]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  69   AVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_008792518.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L24-like 
[Phoenix dactylifera]
Length=163

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++KKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  69   TIKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>gb|AEC11017.1| 60S ribosomal protein L24, partial [Camellia sinensis]
Length=178

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  68   EAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_010516886.1| PREDICTED: 60S ribosomal protein L24-1 [Camelina sativa]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>gb|KDP22312.1| hypothetical protein JCGZ_26143 [Jatropha curcas]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  69   AVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|NP_565851.1| 60S ribosomal protein L24-1 [Arabidopsis thaliana]
 sp|Q42347.2|RL241_ARATH RecName: Full=60S ribosomal protein L24-1 [Arabidopsis thaliana]
 emb|CAC01930.1| 60S ribosomal protein L24 (RL24) [Arabidopsis thaliana]
 gb|AAL24194.1| At2g36620/F1O11.25 [Arabidopsis thaliana]
 gb|AAL62342.1| 60S ribosomal protein L24 [Arabidopsis thaliana]
 gb|AAD20138.2| 60S ribosomal protein L24 [Arabidopsis thaliana]
 gb|AAM15314.1| 60S ribosomal protein L24 [Arabidopsis thaliana]
 gb|AAM48047.1| 60S ribosomal protein L24 [Arabidopsis thaliana]
 gb|AAM62554.1| 60S ribosomal protein L24 [Arabidopsis thaliana]
 gb|AEC09274.1| 60S ribosomal protein L24-1 [Arabidopsis thaliana]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_002881455.1| RPL24A [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006295128.1| hypothetical protein CARUB_v10024202mg [Capsella rubella]
 gb|EFH57714.1| RPL24A [Arabidopsis lyrata subsp. lyrata]
 gb|EOA28026.1| hypothetical protein CARUB_v10024202mg [Capsella rubella]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_007038620.1| 60S ribosomal protein L24-1 [Theobroma cacao]
 gb|EOY23121.1| 60S ribosomal protein L24-1 [Theobroma cacao]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  68   EAVKKRRRTTKRPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_007202683.1| hypothetical protein PRUPE_ppa012563mg [Prunus persica]
 gb|EMJ03882.1| hypothetical protein PRUPE_ppa012563mg [Prunus persica]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  68   EAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_010509453.1| PREDICTED: 60S ribosomal protein L24-1-like [Camelina sativa]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_007010132.1| 60S ribosomal protein L24-1 isoform 1 [Theobroma cacao]
 gb|EOY18942.1| 60S ribosomal protein L24-1 isoform 1 [Theobroma cacao]
Length=181

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  85   EAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  117



>gb|EYU22234.1| hypothetical protein MIMGU_mgv1a015282mg [Erythranthe guttata]
Length=162

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR   + PYSRSIVGATLEVIQK+RAEK
Sbjct  68   EAVKKRRRATKKPYSRSIVGATLEVIQKRRAEK  100



>gb|EYU35878.1| hypothetical protein MIMGU_mgv1a015278mg [Erythranthe guttata]
Length=162

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR   + PYSRSIVGATLEVIQK+RAEK
Sbjct  68   EAVKKRRRATKKPYSRSIVGATLEVIQKRRAEK  100



>ref|XP_010922879.1| PREDICTED: 60S ribosomal protein L24-like [Elaeis guineensis]
Length=163

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++KKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  69   TIKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_002528634.1| 60S ribosomal protein L24, putative [Ricinus communis]
 gb|EEF33737.1| 60S ribosomal protein L24, putative [Ricinus communis]
Length=186

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  90   EAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  122



>ref|XP_010505209.1| PREDICTED: 60S ribosomal protein L24-1-like [Camelina sativa]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VK+RR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  69   AVKRRRRATKKPYSRSIVGATLEVIQKKRAEK  100



>ref|XP_007027572.1| Ribosomal protein L24 [Theobroma cacao]
 gb|EOY08074.1| Ribosomal protein L24 [Theobroma cacao]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  68   EAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>gb|AFA36497.1| L24 ribosomal protein, partial [Lolium perenne]
Length=89

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++ KKRR T + PYSRSIVGATLEVIQKK AEK
Sbjct  7    DIHA--EAAKKRRRTTKKPYSRSIVGATLEVIQKKIAEK  43



>ref|XP_010931447.1| PREDICTED: 60S ribosomal protein L24 [Elaeis guineensis]
 ref|XP_010931448.1| PREDICTED: 60S ribosomal protein L24 [Elaeis guineensis]
 ref|XP_010931449.1| PREDICTED: 60S ribosomal protein L24 [Elaeis guineensis]
 ref|XP_010931450.1| PREDICTED: 60S ribosomal protein L24 [Elaeis guineensis]
Length=163

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +++KKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  68   ETIKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>gb|EEC71698.1| hypothetical protein OsI_04199 [Oryza sativa Indica Group]
Length=1058

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++VKKRR T + PYSRSIVGATLEVIQKKR+EK
Sbjct  960  DIHA--EAVKKRRRTTKKPYSRSIVGATLEVIQKKRSEK  996



>ref|XP_006410833.1| hypothetical protein EUTSA_v10017341mg [Eutrema salsugineum]
 gb|ESQ52286.1| hypothetical protein EUTSA_v10017341mg [Eutrema salsugineum]
Length=164

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR+EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRSEK  100



>ref|XP_004498085.1| PREDICTED: 60S ribosomal protein L24-like [Cicer arietinum]
Length=163

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR+EK
Sbjct  69   TVKKRRRATKKPYSRSIVGATLEVIQKKRSEK  100



>sp|Q9FUL4.1|RL24_PRUAV RecName: Full=60S ribosomal protein L24 [Prunus avium]
 gb|AAG13986.1|AF298827_1 60S ribosomal protein L24 [Prunus avium]
Length=186

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR T + PYSRSIVGATLEVIQK+R EK
Sbjct  68   EAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_008462521.1| PREDICTED: 60S ribosomal protein L24 [Cucumis melo]
Length=164

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR+EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRSEK  100



>ref|XP_004143295.1| PREDICTED: 60S ribosomal protein L24-like [Cucumis sativus]
 ref|XP_004168617.1| PREDICTED: 60S ribosomal protein L24-like [Cucumis sativus]
 gb|KGN48224.1| hypothetical protein Csa_6G449310 [Cucumis sativus]
Length=164

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR   + PYSRSIVGATLEVIQKKR+EK
Sbjct  68   EAVKKRRRATKKPYSRSIVGATLEVIQKKRSEK  100



>gb|KHG04496.1| 60S ribosomal L24 [Gossypium arboreum]
Length=164

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR+EK
Sbjct  69   AVKKRRRAAKKPYSRSIVGATLEVIQKKRSEK  100



>gb|EMT26743.1| 60S ribosomal protein L24 [Aegilops tauschii]
Length=212

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++ KKRR T + PYSRSIVGA+LEVIQKKRAEK
Sbjct  116  DIHA--EAAKKRRRTTKRPYSRSIVGASLEVIQKKRAEK  152



>gb|EMS67681.1| Zinc finger protein VAR3, chloroplastic [Triticum urartu]
Length=1307

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72    DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
             DI +  ++ KKRR T + PYSRSIVGATLEVIQKKRAEK
Sbjct  1134  DIHA--EAAKKRRRTTKKPYSRSIVGATLEVIQKKRAEK  1170



>ref|XP_003590400.1| 60S ribosomal protein L24 [Medicago truncatula]
 gb|ABE80118.1| Ribosomal protein L24E [Medicago truncatula]
 gb|AES60651.1| 60S ribosomal protein L24-2 [Medicago truncatula]
 gb|AFK37423.1| unknown [Medicago truncatula]
Length=163

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR+EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRSEK  100



>ref|XP_010065496.1| PREDICTED: 60S ribosomal protein L24-like [Eucalyptus grandis]
Length=165

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 1/30 (3%)
 Frame = +3

Query  99   KKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            KKRR+TK+ PYSRSIVGATLEVIQKKRAEK
Sbjct  72   KKRRATKK-PYSRSIVGATLEVIQKKRAEK  100



>emb|CDP09795.1| unnamed protein product [Coffea canephora]
Length=162

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  96   VKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +KKRR T + PYSRSIVGATLEVIQKKR EK
Sbjct  70   LKKRRRTTKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_003563859.1| PREDICTED: 60S ribosomal protein L24-like [Brachypodium distachyon]
Length=161

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  ++ KKRR T + PYSRSIVGA+L+VIQKKRAEK
Sbjct  64   DIHA--EAAKKRRRTTKKPYSRSIVGASLDVIQKKRAEK  100



>ref|XP_010553352.1| PREDICTED: 60S ribosomal protein L24 [Tarenaya hassleriana]
Length=164

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>ref|NP_001266018.1| 60S ribosomal protein L24 [Cicer arietinum]
 sp|O65743.1|RL24_CICAR RecName: Full=60S ribosomal protein L24 [Cicer arietinum]
 emb|CAA12358.1| ribosomal protein L24 [Cicer arietinum]
Length=164

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_007162832.1| hypothetical protein PHAVU_001G184700g [Phaseolus vulgaris]
 gb|ESW34826.1| hypothetical protein PHAVU_001G184700g [Phaseolus vulgaris]
Length=163

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRAAKKPYSRSIVGATLEVIQKKRTEK  100



>ref|NP_001237396.1| uncharacterized protein LOC100499884 [Glycine max]
 gb|ACU14055.1| unknown [Glycine max]
Length=164

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>gb|ACJ86193.1| unknown [Medicago truncatula]
Length=163

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>gb|AFK43072.1| unknown [Lotus japonicus]
Length=164

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>gb|AFK40850.1| unknown [Medicago truncatula]
 gb|KEH24091.1| 60S ribosomal protein L24-2 [Medicago truncatula]
 gb|KEH24092.1| 60S ribosomal protein L24-2 [Medicago truncatula]
 gb|KEH24093.1| 60S ribosomal protein L24-2 [Medicago truncatula]
Length=163

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_004298778.1| PREDICTED: 60S ribosomal protein L24-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=133

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +SVKK+R + + PYSRSIVGATLEVIQK+R EK
Sbjct  68   ESVKKKRRSTKKPYSRSIVGATLEVIQKRRTEK  100



>gb|KHN48187.1| 60S ribosomal protein L24 [Glycine soja]
Length=164

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_010558971.1| PREDICTED: 60S ribosomal protein L24-like [Tarenaya hassleriana]
Length=164

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_010558216.1| PREDICTED: 60S ribosomal protein L24-like [Tarenaya hassleriana]
Length=163

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_001763745.1| predicted protein [Physcomitrella patens]
 gb|EDQ71387.1| predicted protein [Physcomitrella patens]
Length=161

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR T   PYSRSIVGA+LEVIQKKR EK
Sbjct  69   TVKKRRRTTNKPYSRSIVGASLEVIQKKRTEK  100



>ref|XP_008345349.1| PREDICTED: 60S ribosomal protein L24-like [Malus domestica]
Length=129

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +SVKK+R + + PYSRSIVGATLEVIQK+R EK
Sbjct  68   ESVKKKRRSTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|NP_001275204.1| ribosomal protein L24-like protein [Solanum tuberosum]
 gb|ABB72816.1| ribosomal protein L24-like protein [Solanum tuberosum]
Length=171

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++V+KRR   + PYSRSIVGATLEVIQKKRAE+
Sbjct  68   EAVRKRRRATKKPYSRSIVGATLEVIQKKRAER  100



>ref|XP_006341189.1| PREDICTED: 60S ribosomal protein L24 [Solanum tuberosum]
Length=163

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++V+KRR   + PYSRSIVGATLEVIQKKRAE+
Sbjct  68   EAVRKRRRATKKPYSRSIVGATLEVIQKKRAER  100



>gb|KHN02273.1| 60S ribosomal protein L24 [Glycine soja]
Length=579

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++V+KRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  483  EAVRKRRRAAKKPYSRSIVGATLEVIQKKRAEK  515



>ref|XP_004308109.1| PREDICTED: 60S ribosomal protein L24-like [Fragaria vesca subsp. 
vesca]
Length=166

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR + + PYSRSIVGATLEVIQK+R+EK
Sbjct  69   TVKKRRRSTKKPYSRSIVGATLEVIQKRRSEK  100



>ref|XP_002318822.1| hypothetical protein POPTR_0012s13380g [Populus trichocarpa]
 gb|ABK92733.1| unknown [Populus trichocarpa]
 gb|EEE97042.1| hypothetical protein POPTR_0012s13380g [Populus trichocarpa]
Length=163

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++KKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   TIKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_010662508.1| PREDICTED: 60S ribosomal protein L24 isoform X2 [Vitis vinifera]
Length=163

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKK+R T + PYSRSIVGATLEVIQK+R EK
Sbjct  69   AVKKKRRTAKKPYSRSIVGATLEVIQKRRTEK  100



>gb|KDO63542.1| hypothetical protein CISIN_1g031225mg [Citrus sinensis]
Length=108

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 1/30 (3%)
 Frame = +3

Query  99   KKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            KKRRSTK+ PYSRSIVGATLEVIQK+R EK
Sbjct  17   KKRRSTKK-PYSRSIVGATLEVIQKRRTEK  45



>ref|XP_011012371.1| PREDICTED: 60S ribosomal protein L24-like [Populus euphratica]
Length=163

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++KKRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   TIKKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_002279048.2| PREDICTED: 60S ribosomal protein L24 isoform X1 [Vitis vinifera]
Length=163

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKK+R T + PYSRSIVGATLEVIQK+R EK
Sbjct  69   AVKKKRRTAKKPYSRSIVGATLEVIQKRRTEK  100



>gb|ABR17906.1| unknown [Picea sitchensis]
Length=164

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  + VKKRR T   PYSRSIVGA+LEVIQKKR EK
Sbjct  64   DIHA--EQVKKRRRTTNKPYSRSIVGASLEVIQKKRTEK  100



>gb|KHN18810.1| 60S ribosomal protein L24 [Glycine soja]
Length=519

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  96   VKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            VKKRR   + PYSRSIVGATLEVIQKKRAEK
Sbjct  64   VKKRRRAAKKPYSRSIVGATLEVIQKKRAEK  94



>emb|CBI31821.3| unnamed protein product [Vitis vinifera]
Length=198

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKK+R T + PYSRSIVGATLEVIQK+R EK
Sbjct  103  EAVKKKRRTAKKPYSRSIVGATLEVIQKRRTEK  135



>ref|XP_004249675.1| PREDICTED: 60S ribosomal protein L24 [Solanum lycopersicum]
Length=164

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            + KKRR T + PYSRSIVGATLEVIQKKR E+
Sbjct  69   AAKKRRRTTKKPYSRSIVGATLEVIQKKRTER  100



>ref|NP_001275450.1| 60S ribosomal protein L24-like [Solanum tuberosum]
 gb|AFW90567.1| ribosomal protein L24 [Solanum tuberosum]
Length=164

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++ KKRR T + PYSRSIVGATLEVIQKKR E+
Sbjct  68   EAAKKRRRTTKKPYSRSIVGATLEVIQKKRTER  100



>ref|XP_006339101.1| PREDICTED: 60S ribosomal protein L24-like [Solanum tuberosum]
Length=163

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++ KKRR T + PYSRSIVGATLEVIQKKR E+
Sbjct  68   ETAKKRRRTTKKPYSRSIVGATLEVIQKKRTER  100



>ref|XP_004298777.1| PREDICTED: 60S ribosomal protein L24-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=164

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  78   QSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
             S  +SVKK+R + + PYSRSIVGATLEVIQK+R EK
Sbjct  64   DSAQESVKKKRRSTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_010504057.1| PREDICTED: 60S ribosomal protein L24-2-like [Camelina sativa]
Length=163

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VK+RR   + P+SRSIVGATLEVIQKKRAEK
Sbjct  69   AVKRRRRATKKPHSRSIVGATLEVIQKKRAEK  100



>ref|XP_004249467.1| PREDICTED: 60S ribosomal protein L24-like [Solanum lycopersicum]
Length=163

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            + KKRR T + PYSRSIVGATLEVIQKKR E+
Sbjct  69   AAKKRRRTTKKPYSRSIVGATLEVIQKKRTER  100



>gb|KDP29235.1| hypothetical protein JCGZ_16624 [Jatropha curcas]
Length=163

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQK+R EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_010654022.1| PREDICTED: 60S ribosomal protein L24 [Vitis vinifera]
 emb|CBI30217.3| unnamed protein product [Vitis vinifera]
Length=165

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQK+R EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_009386977.1| PREDICTED: 60S ribosomal protein L24-like [Musa acuminata subsp. 
malaccensis]
Length=162

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  72   DIQSFPKSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            DI +  +++KK+R   + PYSRSIVGATLEVIQKKR EK
Sbjct  64   DIHA--EAIKKKRRATKKPYSRSIVGATLEVIQKKRTEK  100



>gb|KDO63541.1| hypothetical protein CISIN_1g031225mg [Citrus sinensis]
Length=142

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 1/30 (3%)
 Frame = +3

Query  99   KKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            KKRRSTK+ PYSRSIVGATLEVIQK+R EK
Sbjct  51   KKRRSTKK-PYSRSIVGATLEVIQKRRTEK  79



>ref|XP_009345440.1| PREDICTED: 60S ribosomal protein L24-1 [Pyrus x bretschneideri]
Length=163

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            SVKK+R + + PYSRSIVGATLEVIQK+R EK
Sbjct  69   SVKKKRRSTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_010527858.1| PREDICTED: 60S ribosomal protein L24-like [Tarenaya hassleriana]
Length=164

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +V+KRR   + PYSRSIVGATLEVIQKKR EK
Sbjct  69   AVRKRRRATKKPYSRSIVGATLEVIQKKRTEK  100



>ref|XP_009598682.1| PREDICTED: 60S ribosomal protein L24 [Nicotiana tomentosiformis]
Length=164

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR   + PYSRSIVGATLEVIQKKR E+
Sbjct  68   EAVKKRRRATKKPYSRSIVGATLEVIQKKRTER  100



>ref|XP_008369466.1| PREDICTED: 60S ribosomal protein L24-1-like [Malus domestica]
 ref|XP_008355585.1| PREDICTED: 60S ribosomal protein L24-1-like [Malus domestica]
Length=164

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            SVKK+R + + PYSRSIVGATLEVIQK+R EK
Sbjct  69   SVKKKRRSTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_009369027.1| PREDICTED: 60S ribosomal protein L24-1-like [Pyrus x bretschneideri]
Length=163

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            SVKK+R + + PYSRSIVGATLEVIQK+R EK
Sbjct  69   SVKKKRRSTKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_009803776.1| PREDICTED: 60S ribosomal protein L24 [Nicotiana sylvestris]
Length=164

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR   + PYSRSIVGATLEVIQKKR E+
Sbjct  68   EAVKKRRRATKKPYSRSIVGATLEVIQKKRTER  100



>ref|XP_009612803.1| PREDICTED: 60S ribosomal protein L24-like [Nicotiana tomentosiformis]
 ref|XP_009787884.1| PREDICTED: 60S ribosomal protein L24-like [Nicotiana sylvestris]
Length=164

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR   + PYSRSIVGATLEVIQKKR E+
Sbjct  68   EAVKKRRRATKKPYSRSIVGATLEVIQKKRTER  100



>ref|XP_008387472.1| PREDICTED: 60S ribosomal protein L24 [Malus domestica]
 ref|XP_009334890.1| PREDICTED: 60S ribosomal protein L24 [Pyrus x bretschneideri]
 ref|XP_009340972.1| PREDICTED: 60S ribosomal protein L24 [Pyrus x bretschneideri]
Length=163

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  93   SVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            +VKKRR   + PYSRSIVGATLEVIQK+R EK
Sbjct  69   AVKKRRRATKKPYSRSIVGATLEVIQKRRTEK  100



>ref|XP_009612827.1| PREDICTED: 60S ribosomal protein L24-like [Nicotiana tomentosiformis]
 ref|XP_009760233.1| PREDICTED: 60S ribosomal protein L24-like [Nicotiana sylvestris]
Length=164

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  90   KSVKKRRSTKRNPYSRSIVGATLEVIQKKRAEK  188
            ++VKKRR   + PYSRSIVGATLEVIQKKR E+
Sbjct  68   EAVKKRRRATKKPYSRSIVGATLEVIQKKRTER  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1790173656348