BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25106_g2_i2 len=2006 path=[7284:0-464 7746:465-469 1332:470-534
1482:535-550 1498:551-723 1948:724-759 1984:760-772 @1997@!:773-1401
2622:1402-1476 2697:1477-1513 2734:1514-1607 2828:1608-1621
2842:1622-1665 2885:1666-1697 658:1698-2005]

Length=2006
                                                                      Score     E

ref|XP_011094168.1|  PREDICTED: lysosomal beta glucosidase-like         933   0.0     
ref|XP_009757149.1|  PREDICTED: lysosomal beta glucosidase-like         932   0.0     
ref|XP_009610986.1|  PREDICTED: lysosomal beta glucosidase-like         931   0.0     
ref|XP_011094175.1|  PREDICTED: lysosomal beta glucosidase-like         915   0.0     
ref|XP_008240500.1|  PREDICTED: lysosomal beta glucosidase-like         913   0.0     
ref|XP_004236622.1|  PREDICTED: lysosomal beta glucosidase-like         910   0.0     
ref|XP_008391778.1|  PREDICTED: lysosomal beta glucosidase-like         905   0.0     
ref|XP_010088030.1|  Lysosomal beta glucosidase                         905   0.0     
ref|XP_002266470.2|  PREDICTED: lysosomal beta glucosidase-like i...    904   0.0     Vitis vinifera
ref|XP_010653212.1|  PREDICTED: lysosomal beta glucosidase-like i...    902   0.0     
ref|XP_006350208.1|  PREDICTED: lysosomal beta glucosidase-like         902   0.0     
ref|XP_004489688.1|  PREDICTED: lysosomal beta glucosidase-like         901   0.0     
ref|XP_011094172.1|  PREDICTED: lysosomal beta glucosidase-like i...    900   0.0     
gb|KHN20835.1|  Lysosomal beta glucosidase                              899   0.0     
ref|XP_003551104.1|  PREDICTED: lysosomal beta glucosidase-like         897   0.0     
ref|XP_002319151.2|  beta-D-glucan exohydrolase family protein          896   0.0     Populus trichocarpa [western balsam poplar]
emb|CBI39076.3|  unnamed protein product                                895   0.0     
gb|EYU18174.1|  hypothetical protein MIMGU_mgv1a002879mg                894   0.0     
ref|XP_011077752.1|  PREDICTED: lysosomal beta glucosidase-like         892   0.0     
ref|XP_007204092.1|  hypothetical protein PRUPE_ppa002894mg             892   0.0     
ref|XP_004489700.1|  PREDICTED: lysosomal beta glucosidase-like         889   0.0     
ref|XP_004141128.1|  PREDICTED: lysosomal beta glucosidase-like         888   0.0     
gb|KEH25593.1|  beta-D-glucoside glucohydrolase                         888   0.0     
ref|XP_010054740.1|  PREDICTED: lysosomal beta glucosidase-like         887   0.0     
ref|XP_008464959.1|  PREDICTED: lysosomal beta glucosidase-like         885   0.0     
ref|XP_007030059.1|  Glycosyl hydrolase family protein                  885   0.0     
gb|AEP33579.1|  b-1,4-glucanase                                         885   0.0     
gb|AEP33563.1|  b-1,4-glucanase                                         885   0.0     
gb|KDP39683.1|  hypothetical protein JCGZ_02703                         882   0.0     
gb|AEP33577.1|  b-1,4-glucanase                                         881   0.0     
gb|AEP33582.1|  b-1,4-glucanase                                         881   0.0     
ref|XP_006371173.1|  hypothetical protein POPTR_0019s05340g             880   0.0     
gb|AEP33562.1|  b-1,4-glucanase                                         880   0.0     
ref|XP_007151483.1|  hypothetical protein PHAVU_004G050500g             880   0.0     
gb|AEP33560.1|  b-1,4-glucanase                                         880   0.0     
gb|KEH25594.1|  beta-D-glucoside glucohydrolase                         880   0.0     
gb|ABK95015.1|  unknown                                                 880   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011021458.1|  PREDICTED: lysosomal beta glucosidase-like         879   0.0     
gb|AEP33580.1|  b-1,4-glucanase                                         878   0.0     
gb|AEP33567.1|  b-1,4-glucanase                                         878   0.0     
gb|AEP33565.1|  b-1,4-glucanase                                         878   0.0     
gb|AEP33561.1|  b-1,4-glucanase                                         877   0.0     
gb|ADZ16110.1|  endo-alpha-1,4-glucanase                                877   0.0     
gb|ADZ16108.1|  endo-alpha-1,4-glucanase                                877   0.0     
ref|XP_004489701.1|  PREDICTED: lysosomal beta glucosidase-like         876   0.0     
gb|AEP33574.1|  b-1,4-glucanase                                         875   0.0     
gb|AAZ15705.1|  endo-alpha-1,4-glucanase                                875   0.0     Gossypium hirsutum [American cotton]
ref|XP_002525724.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    874   0.0     Ricinus communis
ref|XP_010917875.1|  PREDICTED: lysosomal beta glucosidase-like i...    874   0.0     
gb|AEP33566.1|  b-1,4-glucanase                                         873   0.0     
gb|AEP33568.1|  b-1,4-glucanase                                         872   0.0     
gb|KHG06450.1|  gluA                                                    869   0.0     
ref|XP_008443733.1|  PREDICTED: lysosomal beta glucosidase-like         868   0.0     
ref|XP_006361124.1|  PREDICTED: lysosomal beta glucosidase-like         868   0.0     
ref|XP_010266636.1|  PREDICTED: lysosomal beta glucosidase-like         868   0.0     
ref|XP_008777968.1|  PREDICTED: lysosomal beta glucosidase-like i...    868   0.0     
ref|XP_008777967.1|  PREDICTED: lysosomal beta glucosidase-like i...    868   0.0     
ref|XP_006424024.1|  hypothetical protein CICLE_v10028018mg             868   0.0     
gb|EPS66822.1|  hypothetical protein M569_07948                         867   0.0     
ref|XP_010279030.1|  PREDICTED: lysosomal beta glucosidase-like         867   0.0     
gb|EYU18175.1|  hypothetical protein MIMGU_mgv1a002782mg                866   0.0     
ref|XP_002325849.2|  beta-D-glucan exohydrolase family protein          866   0.0     Populus trichocarpa [western balsam poplar]
gb|KDO54375.1|  hypothetical protein CISIN_1g006872mg                   865   0.0     
ref|XP_006487803.1|  PREDICTED: lysosomal beta glucosidase-like i...    865   0.0     
emb|CDP15624.1|  unnamed protein product                                865   0.0     
gb|KDP39682.1|  hypothetical protein JCGZ_02702                         863   0.0     
ref|XP_010908052.1|  PREDICTED: lysosomal beta glucosidase-like i...    863   0.0     
ref|XP_002278363.1|  PREDICTED: lysosomal beta glucosidase-like         860   0.0     Vitis vinifera
gb|KEH25595.1|  beta-D-glucoside glucohydrolase                         859   0.0     
gb|EYU25636.1|  hypothetical protein MIMGU_mgv1a002814mg                859   0.0     
ref|XP_006379343.1|  hypothetical protein POPTR_0009s15590g             859   0.0     
gb|KEH25596.1|  beta-D-glucoside glucohydrolase                         858   0.0     
ref|XP_006367581.1|  PREDICTED: lysosomal beta glucosidase-like         857   0.0     
ref|XP_009614218.1|  PREDICTED: lysosomal beta glucosidase-like         856   0.0     
ref|XP_006479136.1|  PREDICTED: lysosomal beta glucosidase-like         855   0.0     
ref|XP_009417082.1|  PREDICTED: lysosomal beta glucosidase-like         855   0.0     
ref|XP_006443452.1|  hypothetical protein CICLE_v10019305mg             855   0.0     
gb|KHN46760.1|  Lysosomal beta glucosidase                              852   0.0     
gb|KHN34680.1|  Lysosomal beta glucosidase                              852   0.0     
ref|XP_009619848.1|  PREDICTED: lysosomal beta glucosidase-like         852   0.0     
ref|XP_008230878.1|  PREDICTED: lysosomal beta glucosidase-like         852   0.0     
ref|XP_006604247.1|  PREDICTED: lysosomal beta glucosidase-like i...    852   0.0     
ref|XP_006598973.1|  PREDICTED: lysosomal beta glucosidase-like i...    852   0.0     
ref|XP_007015579.1|  Glycosyl hydrolase family protein isoform 2        852   0.0     
ref|XP_003548716.1|  PREDICTED: lysosomal beta glucosidase-like i...    852   0.0     
ref|XP_003601350.1|  Beta-D-glucosidase                                 852   0.0     
gb|KGN66708.1|  hypothetical protein Csa_1G661750                       852   0.0     
gb|KGN59736.1|  hypothetical protein Csa_3G842090                       852   0.0     
ref|XP_003548467.1|  PREDICTED: lysosomal beta glucosidase-like i...    851   0.0     
ref|XP_009804819.1|  PREDICTED: lysosomal beta glucosidase-like         850   0.0     
ref|XP_010031611.1|  PREDICTED: lysosomal beta glucosidase-like         850   0.0     
ref|XP_002313632.1|  beta-D-glucan exohydrolase family protein          849   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004228467.1|  PREDICTED: lysosomal beta glucosidase-like i...    849   0.0     
ref|XP_003519468.1|  PREDICTED: lysosomal beta glucosidase-like i...    849   0.0     
emb|CDP15627.1|  unnamed protein product                                848   0.0     
ref|XP_008464960.1|  PREDICTED: lysosomal beta glucosidase-like         848   0.0     
ref|XP_002266675.1|  PREDICTED: lysosomal beta glucosidase-like         848   0.0     Vitis vinifera
ref|XP_009760946.1|  PREDICTED: lysosomal beta glucosidase-like         848   0.0     
ref|XP_009394272.1|  PREDICTED: lysosomal beta glucosidase-like         848   0.0     
ref|XP_002266589.1|  PREDICTED: lysosomal beta glucosidase-like         847   0.0     Vitis vinifera
gb|EYU38727.1|  hypothetical protein MIMGU_mgv1a003439mg                847   0.0     
gb|KHN46759.1|  Lysosomal beta glucosidase                              846   0.0     
ref|XP_004171886.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    845   0.0     
ref|XP_004295138.1|  PREDICTED: lysosomal beta glucosidase-like         843   0.0     
ref|XP_011032946.1|  PREDICTED: lysosomal beta glucosidase-like         843   0.0     
ref|XP_003594509.1|  Beta-D-glucosidase                                 844   0.0     
gb|KDP34274.1|  hypothetical protein JCGZ_12843                         844   0.0     
gb|KHG23007.1|  Lysosomal beta glucosidase                              865   0.0     
ref|XP_010550691.1|  PREDICTED: lysosomal beta glucosidase-like         842   0.0     
ref|XP_003546253.1|  PREDICTED: lysosomal beta glucosidase-like i...    843   0.0     
ref|XP_010535771.1|  PREDICTED: lysosomal beta glucosidase-like         841   0.0     
ref|XP_006604246.1|  PREDICTED: lysosomal beta glucosidase-like i...    841   0.0     
ref|XP_009418960.1|  PREDICTED: lysosomal beta glucosidase-like         842   0.0     
ref|XP_007206306.1|  hypothetical protein PRUPE_ppa025914mg             841   0.0     
ref|XP_008385601.1|  PREDICTED: lysosomal beta glucosidase-like         840   0.0     
gb|KHN34681.1|  Lysosomal beta glucosidase                              840   0.0     
ref|XP_010685489.1|  PREDICTED: lysosomal beta glucosidase-like         840   0.0     
gb|KHG06451.1|  gluA                                                    839   0.0     
ref|XP_007218946.1|  hypothetical protein PRUPE_ppa002559mg             841   0.0     
ref|XP_003545548.1|  PREDICTED: lysosomal beta glucosidase-like         839   0.0     
ref|XP_006340437.1|  PREDICTED: lysosomal beta glucosidase-like         839   0.0     
ref|XP_007141605.1|  hypothetical protein PHAVU_008G210100g             839   0.0     
ref|XP_008453517.1|  PREDICTED: lysosomal beta glucosidase-like         838   0.0     
ref|XP_004300933.1|  PREDICTED: lysosomal beta glucosidase-like         839   0.0     
ref|XP_009786310.1|  PREDICTED: lysosomal beta glucosidase-like         838   0.0     
ref|XP_002514453.1|  Periplasmic beta-glucosidase precursor, puta...    839   0.0     Ricinus communis
gb|KHN14336.1|  Lysosomal beta glucosidase                              840   0.0     
ref|XP_009342674.1|  PREDICTED: lysosomal beta glucosidase-like         837   0.0     
ref|XP_006347720.1|  PREDICTED: lysosomal beta glucosidase-like i...    837   0.0     
ref|XP_006347719.1|  PREDICTED: lysosomal beta glucosidase-like i...    838   0.0     
ref|XP_006361125.1|  PREDICTED: lysosomal beta glucosidase-like         837   0.0     
ref|XP_009368634.1|  PREDICTED: lysosomal beta glucosidase-like         837   0.0     
ref|XP_004230073.1|  PREDICTED: lysosomal beta glucosidase              838   0.0     
ref|XP_009609159.1|  PREDICTED: lysosomal beta glucosidase-like i...    837   0.0     
ref|XP_009609160.1|  PREDICTED: lysosomal beta glucosidase-like i...    837   0.0     
ref|XP_004135054.1|  PREDICTED: lysosomal beta glucosidase-like         837   0.0     
ref|XP_004241371.1|  PREDICTED: lysosomal beta glucosidase-like         835   0.0     
ref|XP_002311926.2|  beta-D-glucan exohydrolase family protein          835   0.0     Populus trichocarpa [western balsam poplar]
gb|KHN38459.1|  Lysosomal beta glucosidase                              835   0.0     
emb|CAN63654.1|  hypothetical protein VITISV_027177                     833   0.0     Vitis vinifera
ref|XP_010651644.1|  PREDICTED: lysosomal beta glucosidase-like         834   0.0     
gb|AAQ17461.1|  beta-D-glucosidase                                      834   0.0     Gossypium hirsutum [American cotton]
ref|XP_008446717.1|  PREDICTED: lysosomal beta glucosidase isofor...    835   0.0     
ref|XP_003535075.1|  PREDICTED: lysosomal beta glucosidase-like i...    835   0.0     
ref|XP_009801866.1|  PREDICTED: lysosomal beta glucosidase-like i...    834   0.0     
ref|XP_009801863.1|  PREDICTED: lysosomal beta glucosidase-like i...    834   0.0     
ref|XP_004137360.1|  PREDICTED: lysosomal beta glucosidase-like         833   0.0     
ref|XP_007147489.1|  hypothetical protein PHAVU_006G128800g             833   0.0     
gb|KDO54374.1|  hypothetical protein CISIN_1g038523mg                   832   0.0     
ref|XP_007145577.1|  hypothetical protein PHAVU_007G250300g             832   0.0     
ref|XP_004159282.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    833   0.0     
ref|XP_008355265.1|  PREDICTED: lysosomal beta glucosidase-like         832   0.0     
gb|EYU38726.1|  hypothetical protein MIMGU_mgv1a002845mg                832   0.0     
ref|XP_009799725.1|  PREDICTED: lysosomal beta glucosidase-like         833   0.0     
ref|XP_008231857.1|  PREDICTED: lysosomal beta glucosidase isofor...    833   0.0     
gb|EPS66823.1|  hypothetical protein M569_07949                         831   0.0     
ref|XP_009595457.1|  PREDICTED: lysosomal beta glucosidase-like i...    831   0.0     
gb|KEH25597.1|  beta-D-glucoside glucohydrolase                         830   0.0     
ref|XP_009412935.1|  PREDICTED: lysosomal beta glucosidase-like         830   0.0     
ref|XP_008231858.1|  PREDICTED: lysosomal beta glucosidase isofor...    832   0.0     
emb|CAA07070.1|  beta-D-glucosidase                                     832   0.0     Tropaeolum majus
ref|XP_006487879.1|  PREDICTED: lysosomal beta glucosidase-like         830   0.0     
gb|AAR14129.1|  exo-beta-glucanase                                      830   0.0     Lilium longiflorum [Easter lily]
ref|XP_008672746.1|  PREDICTED: uncharacterized protein LOC100280...    831   0.0     
ref|XP_009595456.1|  PREDICTED: lysosomal beta glucosidase-like i...    831   0.0     
ref|XP_010103976.1|  Lysosomal beta glucosidase                         831   0.0     
gb|KHN22996.1|  Lysosomal beta glucosidase                              832   0.0     
ref|XP_009400035.1|  PREDICTED: lysosomal beta glucosidase-like         829   0.0     
dbj|BAD13764.1|  exo-1,3-beta-glucanase                                 828   0.0     Lilium longiflorum [Easter lily]
ref|XP_008446716.1|  PREDICTED: lysosomal beta glucosidase isofor...    835   0.0     
dbj|BAA33065.1|  beta-D-glucan exohydrolase                             828   0.0     Nicotiana tabacum [American tobacco]
ref|XP_006424026.1|  hypothetical protein CICLE_v10030270mg             828   0.0     
ref|XP_004242118.1|  PREDICTED: lysosomal beta glucosidase-like         827   0.0     
ref|XP_004970125.1|  PREDICTED: lysosomal beta glucosidase-like         828   0.0     
ref|XP_004306422.1|  PREDICTED: lysosomal beta glucosidase-like         828   0.0     
gb|KHG09998.1|  Lysosomal beta glucosidase                              828   0.0     
ref|XP_006826367.1|  hypothetical protein AMTR_s00004p00129620          825   0.0     
ref|XP_008375543.1|  PREDICTED: lysosomal beta glucosidase              827   0.0     
ref|XP_008230855.1|  PREDICTED: lysosomal beta glucosidase-like         826   0.0     
ref|XP_009620993.1|  PREDICTED: lysosomal beta glucosidase-like         825   0.0     
ref|XP_002271545.1|  PREDICTED: lysosomal beta glucosidase              825   0.0     Vitis vinifera
ref|XP_008245228.1|  PREDICTED: lysosomal beta glucosidase-like         825   0.0     
gb|KHG30203.1|  Lysosomal beta glucosidase                              825   0.0     
gb|AFS50097.1|  beta-D-glucan exohydolase                               824   0.0     
ref|XP_010031608.1|  PREDICTED: lysosomal beta glucosidase-like         824   0.0     
ref|XP_009588263.1|  PREDICTED: lysosomal beta glucosidase-like         824   0.0     
ref|XP_009395659.1|  PREDICTED: lysosomal beta glucosidase-like         823   0.0     
ref|XP_010677827.1|  PREDICTED: lysosomal beta glucosidase-like         824   0.0     
ref|XP_007010542.1|  Glycosyl hydrolase family protein isoform 1        825   0.0     
ref|XP_007010543.1|  Glycosyl hydrolase family protein isoform 2        825   0.0     
ref|XP_007015581.1|  Glycosyl hydrolase family protein                  823   0.0     
ref|XP_003535890.1|  PREDICTED: lysosomal beta glucosidase              823   0.0     
ref|XP_011089012.1|  PREDICTED: lysosomal beta glucosidase-like         824   0.0     
ref|XP_010908054.1|  PREDICTED: lysosomal beta glucosidase-like i...    823   0.0     
ref|NP_001051275.1|  Os03g0749300                                       823   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_011087395.1|  PREDICTED: lysosomal beta glucosidase-like         825   0.0     
ref|XP_004493181.1|  PREDICTED: lysosomal beta glucosidase-like i...    822   0.0     
gb|AIO11756.1|  beta-glucosidase                                        822   0.0     
ref|XP_008363217.1|  PREDICTED: lysosomal beta glucosidase-like         824   0.0     
ref|XP_003624652.1|  Periplasmic beta-glucosidase                       821   0.0     
ref|XP_002523935.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    821   0.0     Ricinus communis
emb|CDP15622.1|  unnamed protein product                                821   0.0     
ref|XP_010067089.1|  PREDICTED: lysosomal beta glucosidase              822   0.0     
ref|XP_010313473.1|  PREDICTED: lysosomal beta glucosidase isofor...    820   0.0     
ref|XP_006379440.1|  hypothetical protein POPTR_0008s01410g             820   0.0     
ref|XP_007161966.1|  hypothetical protein PHAVU_001G112700g             819   0.0     
ref|XP_007205098.1|  hypothetical protein PRUPE_ppa014607mg             818   0.0     
ref|XP_006445671.1|  hypothetical protein CICLE_v10014537mg             820   0.0     
ref|XP_002523937.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    818   0.0     Ricinus communis
ref|XP_004251206.1|  PREDICTED: lysosomal beta glucosidase isofor...    820   0.0     
ref|XP_010313472.1|  PREDICTED: lysosomal beta glucosidase isofor...    820   0.0     
gb|KHN45535.1|  Lysosomal beta glucosidase                              818   0.0     
ref|XP_002456420.1|  hypothetical protein SORBIDRAFT_03g035970          819   0.0     Sorghum bicolor [broomcorn]
ref|XP_009395658.1|  PREDICTED: lysosomal beta glucosidase-like         817   0.0     
ref|XP_011094173.1|  PREDICTED: lysosomal beta glucosidase-like i...    814   0.0     
ref|XP_006286473.1|  hypothetical protein CARUB_v10000466mg             816   0.0     
ref|XP_006340297.1|  PREDICTED: lysosomal beta glucosidase-like         815   0.0     
gb|EYU26866.1|  hypothetical protein MIMGU_mgv1a002476mg                816   0.0     
ref|XP_010086714.1|  Lysosomal beta glucosidase                         814   0.0     
ref|XP_010452390.1|  PREDICTED: lysosomal beta glucosidase-like         814   0.0     
ref|NP_001044387.1|  Os01g0771900                                       814   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_003519089.1|  PREDICTED: lysosomal beta glucosidase-like         813   0.0     
ref|XP_006644778.1|  PREDICTED: lysosomal beta glucosidase-like         814   0.0     
ref|XP_011032947.1|  PREDICTED: lysosomal beta glucosidase              813   0.0     
ref|XP_004493183.1|  PREDICTED: lysosomal beta glucosidase-like i...    812   0.0     
ref|XP_004493184.1|  PREDICTED: lysosomal beta glucosidase-like i...    812   0.0     
gb|KEH23536.1|  beta-D-glucoside glucohydrolase                         811   0.0     
ref|XP_010917869.1|  PREDICTED: lysosomal beta glucosidase-like i...    810   0.0     
ref|XP_008385616.1|  PREDICTED: lysosomal beta glucosidase-like         810   0.0     
ref|XP_010553801.1|  PREDICTED: lysosomal beta glucosidase-like         811   0.0     
ref|XP_007161964.1|  hypothetical protein PHAVU_001G112600g             809   0.0     
ref|XP_002262992.1|  PREDICTED: lysosomal beta glucosidase              810   0.0     Vitis vinifera
ref|XP_010541670.1|  PREDICTED: lysosomal beta glucosidase-like         809   0.0     
ref|XP_003569924.1|  PREDICTED: lysosomal beta glucosidase-like         810   0.0     
ref|XP_010423524.1|  PREDICTED: lysosomal beta glucosidase-like i...    810   0.0     
ref|XP_010535769.1|  PREDICTED: lysosomal beta glucosidase-like         809   0.0     
ref|XP_010423523.1|  PREDICTED: lysosomal beta glucosidase-like i...    810   0.0     
ref|XP_010491016.1|  PREDICTED: lysosomal beta glucosidase-like         810   0.0     
ref|XP_010423522.1|  PREDICTED: lysosomal beta glucosidase-like i...    810   0.0     
ref|XP_010493212.1|  PREDICTED: lysosomal beta glucosidase-like         807   0.0     
ref|XP_011089216.1|  PREDICTED: uncharacterized protein LOC105170243    833   0.0     
ref|XP_010558244.1|  PREDICTED: lysosomal beta glucosidase              808   0.0     
ref|XP_009801845.1|  PREDICTED: lysosomal beta glucosidase-like         806   0.0     
gb|KHM99112.1|  Lysosomal beta glucosidase                              805   0.0     
ref|XP_004981774.1|  PREDICTED: lysosomal beta glucosidase-like i...    806   0.0     
ref|NP_680141.2|  Glycosyl hydrolase family protein                     807   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDM84404.1|  unnamed protein product                                806   0.0     
ref|NP_001051277.1|  Os03g0749500                                       805   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008791319.1|  PREDICTED: uncharacterized protein LOC103708257    828   0.0     
ref|XP_006651822.1|  PREDICTED: lysosomal beta glucosidase-like         806   0.0     
ref|XP_011089010.1|  PREDICTED: lysosomal beta glucosidase-like         805   0.0     
gb|AAL58976.1|AC091811_25  putative exohydrolase                        805   0.0     Oryza sativa [red rice]
gb|KHN03708.1|  Lysosomal beta glucosidase                              804   0.0     
ref|XP_002871119.1|  glycosyl hydrolase family 3 protein                805   0.0     
ref|XP_006398941.1|  hypothetical protein EUTSA_v10012900mg             804   0.0     
ref|XP_010088029.1|  Periplasmic beta-glucosidase                       803   0.0     
ref|NP_197595.2|  glycosyl hydrolase family protein                     801   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009609161.1|  PREDICTED: lysosomal beta glucosidase-like i...    801   0.0     
ref|XP_010694376.1|  PREDICTED: lysosomal beta glucosidase              803   0.0     
ref|NP_001130296.1|  exoglucanase1 precursor                            801   0.0     Zea mays [maize]
gb|KDP42928.1|  hypothetical protein JCGZ_23870                         799   0.0     
gb|AAM13694.1|  beta-D-glucan exohydrolase                              801   0.0     Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ97948.1|  predicted protein                                      801   0.0     
ref|XP_006287219.1|  hypothetical protein CARUB_v10000396mg             802   0.0     
ref|XP_006388312.1|  hypothetical protein POPTR_0231s00220g             800   0.0     
ref|XP_009396473.1|  PREDICTED: lysosomal beta glucosidase-like         800   0.0     
emb|CDP06849.1|  unnamed protein product                                799   0.0     
gb|AAC49170.1|  beta-D-glucan exohydrolase, isoenzyme ExoII             800   0.0     Hordeum vulgare [barley]
ref|XP_002874025.1|  glycosyl hydrolase family 3 protein                800   0.0     
ref|XP_010917928.1|  PREDICTED: uncharacterized protein LOC105042425    824   0.0     
gb|AAF79936.1|  exoglucanase precursor                                  799   0.0     Zea mays [maize]
ref|XP_011089217.1|  PREDICTED: lysosomal beta glucosidase-like         799   0.0     
ref|XP_008664722.1|  PREDICTED: exoglucanase1 isoform X2                799   0.0     
ref|XP_009368627.1|  PREDICTED: lysosomal beta glucosidase-like         798   0.0     
ref|XP_006826369.1|  hypothetical protein AMTR_s00004p00131000          798   0.0     
ref|XP_006400664.1|  hypothetical protein EUTSA_v10012963mg             797   0.0     
ref|XP_009769527.1|  PREDICTED: lysosomal beta glucosidase-like         797   0.0     
ref|XP_006361126.1|  PREDICTED: lysosomal beta glucosidase-like i...    796   0.0     
gb|EMT13488.1|  Lysosomal beta glucosidase                              795   0.0     
gb|EMS53505.1|  Lysosomal beta glucosidase                              796   0.0     
ref|XP_009126493.1|  PREDICTED: lysosomal beta glucosidase-like         795   0.0     
ref|XP_010034246.1|  PREDICTED: lysosomal beta glucosidase-like         796   0.0     
ref|XP_007208190.1|  hypothetical protein PRUPE_ppa020836mg             795   0.0     
emb|CDX80926.1|  BnaC03g01800D                                          796   0.0     
ref|XP_007207411.1|  hypothetical protein PRUPE_ppa014605mg             795   0.0     
ref|XP_010420941.1|  PREDICTED: lysosomal beta glucosidase-like         796   0.0     
emb|CDY11314.1|  BnaA03g01500D                                          795   0.0     
ref|XP_004981771.1|  PREDICTED: lysosomal beta glucosidase-like i...    794   0.0     
ref|XP_006575592.1|  PREDICTED: lysosomal beta glucosidase-like i...    792   0.0     
ref|XP_010313613.1|  PREDICTED: lysosomal beta glucosidase-like         792   0.0     
ref|XP_008245226.1|  PREDICTED: lysosomal beta glucosidase-like         794   0.0     
gb|KCW50975.1|  hypothetical protein EUGRSUZ_J00604                     793   0.0     
ref|XP_004981770.1|  PREDICTED: lysosomal beta glucosidase-like i...    794   0.0     
ref|XP_004981768.1|  PREDICTED: lysosomal beta glucosidase-like i...    795   0.0     
gb|EPS64616.1|  hypothetical protein M569_10162                         791   0.0     
ref|XP_004241372.1|  PREDICTED: lysosomal beta glucosidase-like         793   0.0     
ref|XP_009130844.1|  PREDICTED: lysosomal beta glucosidase-like         794   0.0     
ref|XP_009131828.1|  PREDICTED: lysosomal beta glucosidase              792   0.0     
ref|XP_004981769.1|  PREDICTED: lysosomal beta glucosidase-like i...    793   0.0     
emb|CDY09090.1|  BnaA02g05160D                                          791   0.0     
ref|XP_007015578.1|  Glycosyl hydrolase family protein isoform 1        789   0.0     
ref|XP_010679654.1|  PREDICTED: lysosomal beta glucosidase-like         790   0.0     
ref|XP_003559555.1|  PREDICTED: lysosomal beta glucosidase-like         788   0.0     
ref|XP_009412936.1|  PREDICTED: lysosomal beta glucosidase-like         786   0.0     
ref|XP_006289165.1|  hypothetical protein CARUB_v10002603mg             787   0.0     
ref|XP_010420942.1|  PREDICTED: lysosomal beta glucosidase-like         787   0.0     
emb|CDX98794.1|  BnaC09g50410D                                          789   0.0     
ref|XP_004141202.1|  PREDICTED: lysosomal beta glucosidase-like         783   0.0     
gb|AAD23382.1|AF102868_1  beta-D-glucan exohydrolase isoenzyme ExoI     785   0.0     
dbj|BAK05680.1|  predicted protein                                      785   0.0     
ref|XP_010034247.1|  PREDICTED: lysosomal beta glucosidase-like         785   0.0     
ref|XP_010034248.1|  PREDICTED: lysosomal beta glucosidase-like         785   0.0     
ref|XP_011090231.1|  PREDICTED: lysosomal beta glucosidase-like         785   0.0     
emb|CBI22347.3|  unnamed protein product                                780   0.0     
ref|XP_010456613.1|  PREDICTED: lysosomal beta glucosidase-like         786   0.0     
emb|CBI22348.3|  unnamed protein product                                780   0.0     
ref|XP_009120747.1|  PREDICTED: lysosomal beta glucosidase-like         783   0.0     
ref|XP_011004424.1|  PREDICTED: lysosomal beta glucosidase-like         782   0.0     
dbj|BAJ96045.1|  predicted protein                                      783   0.0     
ref|XP_008777969.1|  PREDICTED: lysosomal beta glucosidase-like i...    779   0.0     
ref|XP_003559563.1|  PREDICTED: lysosomal beta glucosidase-like         781   0.0     
emb|CDX70189.1|  BnaA10g25380D                                          785   0.0     
ref|XP_010908055.1|  PREDICTED: lysosomal beta glucosidase-like i...    775   0.0     
gb|ABK24242.1|  unknown                                                 778   0.0     
gb|ADC55526.1|  beta-D-glucan glucohydrolase precursor                  776   0.0     
gb|EEE55456.1|  hypothetical protein OsJ_03617                          777   0.0     
dbj|BAK02950.1|  predicted protein                                      776   0.0     
ref|XP_010097917.1|  Periplasmic beta-glucosidase                       776   0.0     
pdb|1EX1|A  Chain A, Beta-D-Glucan Exohydrolase From Barley             775   0.0     
ref|XP_010034245.1|  PREDICTED: lysosomal beta glucosidase-like         776   0.0     
pdb|1LQ2|A  Chain A, Crystal Structure Of Barley Beta-D-Glucan Gl...    775   0.0     
emb|CBI24413.3|  unnamed protein product                                771   0.0     
ref|XP_010312450.1|  PREDICTED: lysosomal beta glucosidase-like i...    771   0.0     
gb|AAS97960.1|  cell wall beta-glucosidase                              774   0.0     
ref|XP_010679080.1|  PREDICTED: lysosomal beta glucosidase-like         775   0.0     
ref|XP_010229891.1|  PREDICTED: lysosomal beta glucosidase-like i...    775   0.0     
gb|EEC71555.1|  hypothetical protein OsI_03907                          789   0.0     
ref|XP_003559552.1|  PREDICTED: lysosomal beta glucosidase-like i...    773   0.0     
ref|XP_002874024.1|  glycosyl hydrolase family 3 protein                773   0.0     
emb|CDX70953.1|  BnaC03g10370D                                          774   0.0     
ref|XP_011101353.1|  PREDICTED: lysosomal beta glucosidase-like         772   0.0     
ref|XP_008644501.1|  PREDICTED: lysosomal beta glucosidase-like i...    772   0.0     
ref|XP_008644502.1|  PREDICTED: lysosomal beta glucosidase-like i...    771   0.0     
ref|XP_004493185.1|  PREDICTED: lysosomal beta glucosidase-like i...    768   0.0     
ref|XP_008648088.1|  PREDICTED: LOC541703 isoform X2                    771   0.0     
ref|XP_008648090.1|  PREDICTED: LOC541703 isoform X1                    769   0.0     
tpg|DAA51354.1|  TPA: exhydrolase II                                    771   0.0     
tpg|DAA51353.1|  TPA: exhydrolase II                                    769   0.0     
emb|CBI27259.3|  unnamed protein product                                764   0.0     
ref|XP_004296272.1|  PREDICTED: probable beta-glucosidase J-like        766   0.0     
ref|XP_006445675.1|  hypothetical protein CICLE_v10017853mg             766   0.0     
ref|XP_008230844.1|  PREDICTED: uncharacterized protein LOC103330075    786   0.0     
ref|XP_006485566.1|  PREDICTED: lysosomal beta glucosidase-like         765   0.0     
emb|CBI24995.3|  unnamed protein product                                764   0.0     
ref|NP_001104913.1|  LOC541703 precursor                                764   0.0     
gb|EMT23539.1|  Lysosomal beta glucosidase                              765   0.0     
ref|XP_010696623.1|  PREDICTED: lysosomal beta glucosidase-like         763   0.0     
ref|XP_004952004.1|  PREDICTED: lysosomal beta glucosidase-like         761   0.0     
gb|EPS62891.1|  hypothetical protein M569_11897                         761   0.0     
tpg|DAA57426.1|  TPA: hypothetical protein ZEAMMB73_853432              760   0.0     
ref|XP_004971583.1|  PREDICTED: lysosomal beta glucosidase-like         761   0.0     
ref|NP_197594.2|  glycosyl hydrolase family protein                     760   0.0     
ref|XP_004954723.1|  PREDICTED: lysosomal beta glucosidase-like         759   0.0     
ref|XP_007208726.1|  hypothetical protein PRUPE_ppa015239mg             758   0.0     
emb|CDY16581.1|  BnaC09g36920D                                          755   0.0     
ref|XP_011100592.1|  PREDICTED: lysosomal beta glucosidase-like         753   0.0     
ref|XP_006650588.1|  PREDICTED: lysosomal beta glucosidase-like         754   0.0     
ref|XP_006445670.1|  hypothetical protein CICLE_v10014537mg             748   0.0     
emb|CAN80947.1|  hypothetical protein VITISV_023986                     745   0.0     
gb|EMT27147.1|  Periplasmic beta-glucosidase                            747   0.0     
gb|KCW50974.1|  hypothetical protein EUGRSUZ_J00603                     744   0.0     
emb|CDX92422.1|  BnaA10g14610D                                          744   0.0     
gb|EMT13489.1|  Lysosomal beta glucosidase                              743   0.0     
ref|XP_004954724.1|  PREDICTED: lysosomal beta glucosidase-like         742   0.0     
ref|XP_002960733.1|  hypothetical protein SELMODRAFT_74114              740   0.0     
ref|XP_008679990.1|  PREDICTED: lysosomal beta glucosidase-like i...    741   0.0     
ref|XP_002983938.1|  hypothetical protein SELMODRAFT_119324             737   0.0     
gb|EMS53026.1|  Lysosomal beta glucosidase                              736   0.0     
ref|XP_010917874.1|  PREDICTED: lysosomal beta glucosidase-like i...    733   0.0     
dbj|BAC42711.1|  unknown protein                                        732   0.0     
ref|XP_009368884.1|  PREDICTED: lysosomal beta glucosidase-like         735   0.0     
ref|XP_002987109.1|  hypothetical protein SELMODRAFT_125622             733   0.0     
ref|XP_008385600.1|  PREDICTED: lysosomal beta glucosidase-like         734   0.0     
ref|XP_002985402.1|  hypothetical protein SELMODRAFT_157260             732   0.0     
gb|EAY91867.1|  hypothetical protein OsI_13514                          733   0.0     
ref|NP_001051274.1|  Os03g0749100                                       732   0.0     
tpg|DAA51355.1|  TPA: hypothetical protein ZEAMMB73_928187              728   0.0     
gb|AFW66696.1|  hypothetical protein ZEAMMB73_778261                    729   0.0     
ref|XP_002453253.1|  hypothetical protein SORBIDRAFT_04g002560          728   0.0     
ref|XP_008679988.1|  PREDICTED: lysosomal beta glucosidase-like i...    729   0.0     
ref|XP_004952003.1|  PREDICTED: lysosomal beta glucosidase-like         727   0.0     
ref|XP_004981777.1|  PREDICTED: lysosomal beta glucosidase-like         727   0.0     
gb|EMT00661.1|  Lysosomal beta glucosidase                              725   0.0     
gb|KDO52251.1|  hypothetical protein CISIN_1g036635mg                   720   0.0     
emb|CDX88832.1|  BnaA03g08170D                                          719   0.0     
emb|CBI24412.3|  unnamed protein product                                709   0.0     
ref|NP_001105671.1|  beta-glucanase precursor                           714   0.0     
gb|EPS57810.1|  hypothetical protein M569_17006                         711   0.0     
ref|XP_003559419.1|  PREDICTED: lysosomal beta glucosidase-like         711   0.0     
ref|NP_001045791.2|  Os02g0131400                                       711   0.0     
gb|KFK26305.1|  hypothetical protein AALP_AA8G230300                    707   0.0     
dbj|BAD07748.1|  putative beta-D-glucan exohydrolase                    710   0.0     
ref|XP_002451476.1|  hypothetical protein SORBIDRAFT_04g002570          711   0.0     
ref|XP_002466456.1|  hypothetical protein SORBIDRAFT_01g008050          706   0.0     
emb|CDP10537.1|  unnamed protein product                                699   0.0     
emb|CDP10535.1|  unnamed protein product                                695   0.0     
ref|XP_001761531.1|  predicted protein                                  698   0.0     
ref|XP_010650935.1|  PREDICTED: lysosomal beta glucosidase-like         695   0.0     
ref|XP_008220446.1|  PREDICTED: lysosomal beta glucosidase-like         694   0.0     
ref|XP_006290760.1|  hypothetical protein CARUB_v10016864mg             694   0.0     
gb|EPS69367.1|  hypothetical protein M569_05399                         691   0.0     
ref|XP_007207129.1|  hypothetical protein PRUPE_ppa003012mg             690   0.0     
ref|XP_011032150.1|  PREDICTED: lysosomal beta glucosidase-like         687   0.0     
gb|KEH34189.1|  glycoside hydrolase family 3 protein                    687   0.0     
ref|XP_007016175.1|  Glycosyl hydrolase family protein isoform 1        686   0.0     
ref|XP_004296697.1|  PREDICTED: periplasmic beta-glucosidase-like       686   0.0     
ref|XP_004294237.1|  PREDICTED: lysosomal beta glucosidase-like         686   0.0     
ref|XP_009622673.1|  PREDICTED: lysosomal beta glucosidase-like         685   0.0     
gb|EMT13490.1|  Lysosomal beta glucosidase                              691   0.0     
ref|XP_004502135.1|  PREDICTED: lysosomal beta glucosidase-like         687   0.0     
gb|KDP46532.1|  hypothetical protein JCGZ_08504                         682   0.0     
ref|XP_007016177.1|  Glycosyl hydrolase family protein isoform 3        682   0.0     
ref|XP_011080690.1|  PREDICTED: lysosomal beta glucosidase-like         681   0.0     
ref|XP_006344039.1|  PREDICTED: lysosomal beta glucosidase-like         681   0.0     
ref|NP_190284.1|  glycosyl hydrolase family protein                     681   0.0     
ref|XP_002525596.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    680   0.0     
ref|XP_004301060.1|  PREDICTED: lysosomal beta glucosidase-like         676   0.0     
ref|XP_002313393.1|  glycosyl hydrolase family 3 family protein         678   0.0     
emb|CAN81230.1|  hypothetical protein VITISV_033665                     679   0.0     
ref|XP_001777176.1|  predicted protein                                  679   0.0     
ref|XP_009346882.1|  PREDICTED: lysosomal beta glucosidase-like         677   0.0     
emb|CDP09158.1|  unnamed protein product                                676   0.0     
ref|XP_009346879.1|  PREDICTED: lysosomal beta glucosidase-like i...    677   0.0     
ref|XP_008366240.1|  PREDICTED: lysosomal beta glucosidase-like i...    677   0.0     
ref|XP_004490576.1|  PREDICTED: lysosomal beta glucosidase-like         676   0.0     
ref|XP_006425018.1|  hypothetical protein CICLE_v10028048mg             676   0.0     
ref|XP_002877536.1|  glycosyl hydrolase family 3 protein                676   0.0     
ref|XP_008344965.1|  PREDICTED: lysosomal beta glucosidase-like         675   0.0     
ref|XP_007016181.1|  Glycosyl hydrolase family protein                  674   0.0     
ref|XP_010043470.1|  PREDICTED: lysosomal beta glucosidase-like         674   0.0     
gb|KHN26387.1|  Lysosomal beta glucosidase                              673   0.0     
ref|XP_004500232.1|  PREDICTED: lysosomal beta glucosidase-like         673   0.0     
ref|XP_010686158.1|  PREDICTED: lysosomal beta glucosidase-like         686   0.0     
ref|XP_008457394.1|  PREDICTED: lysosomal beta glucosidase-like i...    672   0.0     
gb|KFK34020.1|  hypothetical protein AALP_AA5G091600                    672   0.0     
ref|XP_009337307.1|  PREDICTED: lysosomal beta glucosidase-like         672   0.0     
ref|XP_006591200.1|  PREDICTED: lysosomal beta glucosidase-like         672   0.0     
ref|XP_010426157.1|  PREDICTED: lysosomal beta glucosidase-like         671   0.0     
emb|CBI16000.3|  unnamed protein product                                669   0.0     
ref|XP_010923122.1|  PREDICTED: lysosomal beta glucosidase-like         670   0.0     
ref|XP_006404423.1|  hypothetical protein EUTSA_v10010212mg             670   0.0     
ref|XP_008785418.1|  PREDICTED: lysosomal beta glucosidase-like         669   0.0     
ref|XP_010043457.1|  PREDICTED: lysosomal beta glucosidase-like         669   0.0     
ref|XP_010541442.1|  PREDICTED: lysosomal beta glucosidase-like         669   0.0     
ref|XP_010256651.1|  PREDICTED: lysosomal beta glucosidase-like i...    668   0.0     
ref|XP_008457393.1|  PREDICTED: lysosomal beta glucosidase-like i...    667   0.0     
gb|KGN65790.1|  hypothetical protein Csa_1G528550                       667   0.0     
ref|XP_004150625.1|  PREDICTED: lysosomal beta glucosidase-like         667   0.0     
ref|XP_004169524.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal be...    667   0.0     
ref|XP_001786487.1|  predicted protein                                  668   0.0     
ref|XP_007220051.1|  hypothetical protein PRUPE_ppa026252mg             666   0.0     
gb|EYU45973.1|  hypothetical protein MIMGU_mgv1a003210mg                665   0.0     
gb|AFM39013.1|  glycosyl hydrolase                                      665   0.0     
ref|XP_006293189.1|  hypothetical protein CARUB_v10019506mg             665   0.0     
gb|EMS50680.1|  Periplasmic beta-glucosidase                            671   0.0     
ref|XP_003568338.1|  PREDICTED: lysosomal beta glucosidase-like         665   0.0     
ref|XP_004150629.1|  PREDICTED: lysosomal beta glucosidase-like         664   0.0     
ref|XP_006290765.1|  hypothetical protein CARUB_v10016871mg             664   0.0     
gb|EEC79317.1|  hypothetical protein OsI_20160                          664   0.0     
ref|XP_007146739.1|  hypothetical protein PHAVU_006G065600g             663   0.0     
gb|EEE63918.1|  hypothetical protein OsJ_18743                          663   0.0     
emb|CDX99078.1|  BnaA06g17690D                                          663   0.0     
ref|NP_190285.3|  glycosyl hydrolase family protein                     663   0.0     
ref|XP_004142603.1|  PREDICTED: lysosomal beta glucosidase-like         666   0.0     
emb|CDX86116.1|  BnaC03g56310D                                          661   0.0     
ref|XP_008457398.1|  PREDICTED: lysosomal beta glucosidase-like i...    661   0.0     
ref|XP_009149942.1|  PREDICTED: lysosomal beta glucosidase              660   0.0     
dbj|BAJ90161.1|  predicted protein                                      660   0.0     
ref|NP_190288.1|  Glycosyl hydrolase family protein                     661   0.0     
ref|XP_006350824.1|  PREDICTED: lysosomal beta glucosidase-like         659   0.0     
ref|XP_010515030.1|  PREDICTED: lysosomal beta glucosidase-like         660   0.0     
ref|XP_010426159.1|  PREDICTED: lysosomal beta glucosidase-like         659   0.0     
gb|EEE56242.1|  hypothetical protein OsJ_05253                          659   0.0     
ref|XP_010253611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    694   0.0     
emb|CDP09157.1|  unnamed protein product                                658   0.0     
ref|XP_006655369.1|  PREDICTED: lysosomal beta glucosidase-like         660   0.0     
ref|XP_006848113.1|  hypothetical protein AMTR_s00029p00216320          657   0.0     
ref|XP_004241177.1|  PREDICTED: lysosomal beta glucosidase-like         656   0.0     
ref|XP_010923121.1|  PREDICTED: lysosomal beta glucosidase-like         657   0.0     
ref|XP_001781708.1|  predicted protein                                  656   0.0     
ref|NP_001145784.1|  hypothetical protein                               655   0.0     
emb|CDY25116.1|  BnaC06g18580D                                          656   0.0     
ref|XP_006402350.1|  hypothetical protein EUTSA_v10005832mg             656   0.0     
ref|NP_001190023.1|  glycosyl hydrolase family protein                  654   0.0     
gb|AFW66698.1|  hypothetical protein ZEAMMB73_778261                    653   0.0     
ref|XP_010525248.1|  PREDICTED: lysosomal beta glucosidase-like         655   0.0     
gb|EPS72736.1|  hypothetical protein M569_02021                         654   0.0     
ref|XP_004961906.1|  PREDICTED: lysosomal beta glucosidase-like i...    654   0.0     
emb|CDX99072.1|  BnaA06g17630D                                          654   0.0     
ref|XP_009149938.1|  PREDICTED: lysosomal beta glucosidase              653   0.0     



>ref|XP_011094168.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
 ref|XP_011094170.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
 ref|XP_011094171.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=627

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/599 (76%), Positives = 524/599 (87%), Gaps = 0/599 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M KG   LIG  L CC+  +A+A+Y LYKD ++P+ RRIKDLL RM+L+EKIGQMVQIER
Sbjct  1     MEKGPILLIGFLLFCCFGAIADAEYRLYKDPKKPLNRRIKDLLRRMSLEEKIGQMVQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VASA+VMKKYY+GSVLS GGS P PRAS +AWVDMVNGFQKGSLSTRLGIPMIYGIDAV
Sbjct  61    AVASAEVMKKYYIGSVLSGGGSAPAPRASPKAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+N  Y AT+FPHN+GLGATRDP+LV++IGAATALE+RATGI Y FAPC+AVCRDPRWG
Sbjct  121   HGHNTVYGATVFPHNIGLGATRDPQLVKKIGAATALELRATGIPYTFAPCVAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED EIV+AMTEIIPGLQG+ P N     P+VAG++KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDSEIVQAMTEIIPGLQGDIPANSRQGVPYVAGKKKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I++NNT+   H L SIHM  Y +SII+GVAT+M SYSS NG++MHANRD+ITGFLKKTLR
Sbjct  241   INQNNTVTSKHGLLSIHMPPYDDSIIKGVATIMVSYSSFNGIKMHANRDLITGFLKKTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD+K ID +T  +H NYTYSIL  I AGIDMVM+P NYTEFIDGLT+LVKN F+
Sbjct  301   FRGFVISDYKGIDQITSPIHANYTYSILAGIGAGIDMVMIPNNYTEFIDGLTFLVKNNFI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKF+MGLFE+PL DYS+  +LGSR H++LAR+AVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVKRILRVKFIMGLFENPLADYSMTKYLGSRVHKELAREAVRKSLVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTK  1649
             ADEP++PL K+AS++LVAGTHADNIG QCGGWTIEWQG +GNIT GTTILTAIKNTVD+K
Sbjct  421   ADEPLIPLPKRASKVLVAGTHADNIGNQCGGWTIEWQGKTGNITSGTTILTAIKNTVDSK  480

Query  1650  TQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKC  1829
             T+V+F ENPD ++VK+++FS+AIVVVGE  YAEG GDS NLT+P+P  SII NVC   KC
Sbjct  481   TKVIFHENPDAKYVKANEFSYAIVVVGEPPYAEGYGDSLNLTLPDPSYSIITNVCASLKC  540

Query  1830  VVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VVVLITGRPVVIQPYL QIDALVAAWLPG+EGQGVADVLFG+YGFSGKLP TWFKTVDQ
Sbjct  541   VVVLITGRPVVIQPYLAQIDALVAAWLPGSEGQGVADVLFGEYGFSGKLPQTWFKTVDQ  599



>ref|XP_009757149.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=628

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/600 (76%), Positives = 520/600 (87%), Gaps = 4/600 (1%)
 Frame = +3

Query  207   KMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             KMG    FL+ + +  CW+++  A+YM YKD  +P+GRRIKDL+SRMTL+EKIGQM+QI+
Sbjct  5     KMG----FLMRILVFFCWMILTKAEYMKYKDPNKPLGRRIKDLMSRMTLEEKIGQMIQID  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VA+ + MKKYY+GSVLS GGSVPK  ASAE W+DM+NGFQKGSLSTRLGIPMIYGIDA
Sbjct  61    RTVATPEAMKKYYIGSVLSGGGSVPKKEASAENWIDMINGFQKGSLSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHGNNN Y ATIFPHNVGLG TRDP+L+++IGAATALE RATGI YVFAPC+AVCRDPRW
Sbjct  121   VHGNNNVYKATIFPHNVGLGVTRDPQLIKKIGAATALEARATGIPYVFAPCLAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP IVRAM+E++PGLQG+ P N  L  PFVA ++KVAACAKHYVGDGGTVK
Sbjct  181   GRCYESYSEDPNIVRAMSEMVPGLQGDVPSNGRLGVPFVANKQKVAACAKHYVGDGGTVK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++D H L SIHMAGYYNSII+GVATVM SYSS NG+RMH NR+M+TGFLK TL
Sbjct  241   GINENNTIIDRHGLLSIHMAGYYNSIIKGVATVMVSYSSWNGLRMHGNREMVTGFLKGTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             RFRGFVISD+  ID LT   H NYTYSIL  +NAGIDMVM+PYN TEFIDGLTYLVKN F
Sbjct  301   RFRGFVISDWAGIDKLTYPWHANYTYSILEGVNAGIDMVMLPYNTTEFIDGLTYLVKNNF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             V +SRIDDAVKRILRVKF MGLFE+PL DYS+  +LGS +HR+LAR+AVR+SLVLLKNGA
Sbjct  361   VSMSRIDDAVKRILRVKFQMGLFENPLADYSMVKYLGSAEHRELAREAVRRSLVLLKNGA  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDT  1646
             NADEPVLPL KKAS ILVAG HA+N+GYQCGGWTI WQGLSGN TIGTTIL+AI+NTVD 
Sbjct  421   NADEPVLPLPKKASSILVAGIHANNMGYQCGGWTITWQGLSGNTTIGTTILSAIENTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
             +T+V+F+ENPD EF+K + FS+AIVVVGE  YAEGSGD+ NLTIP PGP  +  VC   K
Sbjct  481   ETKVVFKENPDAEFIKPNNFSYAIVVVGETPYAEGSGDTLNLTIPAPGPDTMTTVCATVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVL+TGRPVVIQPYL Q+DALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  541   CVVVLLTGRPVVIQPYLAQVDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  600



>ref|XP_009610986.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=628

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/600 (76%), Positives = 518/600 (86%), Gaps = 4/600 (1%)
 Frame = +3

Query  207   KMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             KMG    F + + +L CW+++A A+YM YKD  +P+GRRIKDL+SRMTL+EKIGQM+QI+
Sbjct  5     KMG----FFMRILVLFCWMILAKAEYMTYKDPNKPLGRRIKDLMSRMTLEEKIGQMIQID  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VA+   MKKYY+GSVLS GGSVPK  ASAE W+DM+NGFQKGSLSTRLGIPMIYGIDA
Sbjct  61    RTVATPDAMKKYYIGSVLSGGGSVPKKEASAENWIDMINGFQKGSLSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHGNNN Y ATIFPHNVGLG TRDP+L+++IGAATALE RATGI YVFAPC+A+CRDPRW
Sbjct  121   VHGNNNVYKATIFPHNVGLGVTRDPQLIKKIGAATALEARATGIPYVFAPCLAICRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP IVRAM+E++PGLQG+ P N  L  PFVA ++KVAACAKHYVGDGGTVK
Sbjct  181   GRCYESYSEDPNIVRAMSEMVPGLQGDVPSNGRLGVPFVANKQKVAACAKHYVGDGGTVK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++D H L SIHMAGYYNSII+GVATVM SYSS NGVRMH NR+++TGFLK TL
Sbjct  241   GINENNTIIDRHGLLSIHMAGYYNSIIKGVATVMVSYSSWNGVRMHGNRELVTGFLKGTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             RFRGFVISD+  ID LT   H NYTYSIL  +NAGIDMVM+PYN TEFIDGLTYLVKN F
Sbjct  301   RFRGFVISDWAGIDKLTYPWHANYTYSILEGVNAGIDMVMLPYNTTEFIDGLTYLVKNNF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             V +SRIDDAVKRILRVKF MGLFE PL DYS+  +LGS +HR+LAR+AVR+SLVLLKNGA
Sbjct  361   VQMSRIDDAVKRILRVKFQMGLFESPLADYSMVKYLGSAEHRELAREAVRRSLVLLKNGA  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDT  1646
             NADEPVLPL KKAS ILVAG HA+N+GYQCGGWTI WQGLSGN T+GTTIL+AI+NTVD 
Sbjct  421   NADEPVLPLPKKASSILVAGIHANNMGYQCGGWTITWQGLSGNTTVGTTILSAIENTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
             +T+V+F ENPD EF+KS+ FS+AIVVVGE  YAEGSGD+ NLTIP PGP  +  VC   K
Sbjct  481   ETKVVFNENPDAEFIKSNNFSYAIVVVGETPYAEGSGDTLNLTIPAPGPDTMTTVCATVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVL+TGRPVVIQPYL Q+DALV AWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  541   CVVVLLTGRPVVIQPYLAQVDALVEAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  600



>ref|XP_011094175.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=632

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/603 (73%), Positives = 516/603 (86%), Gaps = 0/603 (0%)
 Frame = +3

Query  198   FEEKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMV  377
                KM +     IG+ +LCCW+ VANA+Y +Y+D +QP+ +R+KDLL RMTL+EKIGQM 
Sbjct  2     LRRKMAEAPAVFIGILVLCCWIAVANAEYKIYQDPKQPISKRVKDLLGRMTLEEKIGQMT  61

Query  378   QIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYG  557
             QI+R VASA+VM+KYY+GS+LS GGS+P P AS E WVDMVNG+QKGSLSTRL IPM+YG
Sbjct  62    QIDRLVASAEVMEKYYIGSILSGGGSIPSPTASPETWVDMVNGYQKGSLSTRLKIPMLYG  121

Query  558   IDAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRD  737
             IDAVHG+N  Y ATIFPHNVGLGATRDPELV+ IGAATALEVRATGI Y FAPCIAVCRD
Sbjct  122   IDAVHGHNAVYRATIFPHNVGLGATRDPELVKRIGAATALEVRATGIPYAFAPCIAVCRD  181

Query  738   PRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGG  917
             PRWGRCYESYSEDP++VRAMTEIIPGLQG+ P N     PF+AG++KV A AKHYVGDGG
Sbjct  182   PRWGRCYESYSEDPKVVRAMTEIIPGLQGDIPANSRKGVPFLAGQQKVLATAKHYVGDGG  241

Query  918   TVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLK  1097
             T KGI+ENNTL   HDL  IHM  Y++SII+GV T+M SYSS NGV+MHANRD+ITGFLK
Sbjct  242   TTKGINENNTLASRHDLLRIHMPAYHDSIIKGVGTIMISYSSWNGVKMHANRDLITGFLK  301

Query  1098  KTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVK  1277
              TLRFRGFVISD++ +D +T   H NYTYSI+  + AGIDM+M+PYNYTEFIDGLT LVK
Sbjct  302   NTLRFRGFVISDWQGLDRITSPPHANYTYSIIAGVGAGIDMIMIPYNYTEFIDGLTSLVK  361

Query  1278  NKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLK  1457
             N F+P+SRIDDAVKRILRVKF +GLFE PL DYS+  +LGS++HR+LAR+AVRKSLVLLK
Sbjct  362   NNFIPMSRIDDAVKRILRVKFTIGLFEHPLADYSMTKYLGSQEHRELAREAVRKSLVLLK  421

Query  1458  NGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNT  1637
             NG +A++P++PL KKAS+ILVAGTHADNIG QCGGWTI+WQG  GN+T+GTTILTAI+NT
Sbjct  422   NGESANKPLIPLPKKASKILVAGTHADNIGNQCGGWTIQWQGQPGNVTVGTTILTAIRNT  481

Query  1638  VDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCP  1817
             V  +T+++F ENPDP +VKS+ +S+AIVVVGE  Y+E  GDS+NLTIP+PGPSII NVC 
Sbjct  482   VHPETKIVFNENPDPGYVKSNDYSYAIVVVGEPPYSETFGDSTNLTIPDPGPSIITNVCA  541

Query  1818  HTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKT  1997
               KCVVVLITGRPV IQPYL QIDALVAAWLPGTEGQGVADVLFGDYGF+GKLP TWFKT
Sbjct  542   SVKCVVVLITGRPVAIQPYLTQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTWFKT  601

Query  1998  VDQ  2006
             VDQ
Sbjct  602   VDQ  604



>ref|XP_008240500.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=636

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/602 (74%), Positives = 520/602 (86%), Gaps = 1/602 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             ++M +   FL+G+  LC ++ +A A Y+ Y+D +QP+  RIKDL+SRMTL+EKIGQMVQI
Sbjct  7     KEMARIPIFLMGLLFLCFYIAMAEAQYINYRDPKQPLNSRIKDLVSRMTLEEKIGQMVQI  66

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             +R VASA+VMKKY++GS+LS GGSVP  +ASAE W++MVN FQKGSLSTRLGIP+IYGID
Sbjct  67    DRSVASAEVMKKYFIGSILSGGGSVPAQKASAETWINMVNDFQKGSLSTRLGIPLIYGID  126

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN Y ATIFPHN+GLGATRDPELV+ IGAATALE RATGI YVFAPCIAVCRDPR
Sbjct  127   AVHGHNNVYKATIFPHNIGLGATRDPELVKRIGAATALEARATGIPYVFAPCIAVCRDPR  186

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSEDP+IV+AMTEIIPGLQGE P N     PFVAG +KVAACAKH+VGDGGT 
Sbjct  187   WGRCYESYSEDPKIVQAMTEIIPGLQGEIPANSRKGVPFVAGNKKVAACAKHFVGDGGTT  246

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
             KGI+ENNT+++ H L SIHM GYYNSII+GVAT+M SYSS NGV+MHAN D++T FLK T
Sbjct  247   KGINENNTVINRHGLLSIHMPGYYNSIIKGVATIMVSYSSWNGVKMHANHDLVTAFLKNT  306

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             LRFRGFVISD++ ID +T   H NY+YSI   INAGIDMVMVPYNYTEFIDGLT+LVKN 
Sbjct  307   LRFRGFVISDWEGIDRITSPPHANYSYSIQAGINAGIDMVMVPYNYTEFIDGLTFLVKNN  366

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAVKRILRVKFVMGLFE+P  D SL H LGS++HR+LAR+AVR+SLVLLKNG
Sbjct  367   IIPISRIDDAVKRILRVKFVMGLFEEPFADMSLVHQLGSQEHRELAREAVRRSLVLLKNG  426

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTV  1640
              +A++P+LPL KK S+ILVAG+HADN+GYQCGGWTIEWQGLSG N+T GTTILTAIK+TV
Sbjct  427   ESAEKPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTEGTTILTAIKDTV  486

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D K QV+++ENPD +FVKS+ FS+AIV+VGE  YAE  GDS NLTIP+PGP+ I NVC  
Sbjct  487   DPKAQVVYKENPDADFVKSNNFSYAIVIVGEHPYAETFGDSLNLTIPDPGPTTITNVCGA  546

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVV++I+GRPVVIQPY+  IDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTV
Sbjct  547   VKCVVIVISGRPVVIQPYVVSIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSRTWFKTV  606

Query  2001  DQ  2006
             DQ
Sbjct  607   DQ  608



>ref|XP_004236622.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
 ref|XP_010319196.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=631

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/608 (75%), Positives = 522/608 (86%), Gaps = 7/608 (1%)
 Frame = +3

Query  192   LKFEEKMGKGSR-FLIGVALLCCWVVVA-NAD-YMLYKDHRQPVGRRIKDLLSRMTLKEK  362
             ++   KMG   R FL+    L CW+++A NA+ Y+ YKD  +P+ RRIKDL+ RM+L+EK
Sbjct  1     MQRRSKMGLLMRNFLV----LFCWMILAVNAEEYVTYKDPNKPLNRRIKDLMKRMSLEEK  56

Query  363   IGQMVQIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGI  542
             IGQM+QI+R  A+ +VM KYYLGSVLS GGSVPK  ASAE W+DM+NGFQKGSLSTRLGI
Sbjct  57    IGQMIQIDRTAATPEVMNKYYLGSVLSGGGSVPKKEASAEDWIDMINGFQKGSLSTRLGI  116

Query  543   PMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCI  722
             PMIYGIDAVHGNNN Y ATIFPHNV LG TRDP+LV++IG+ATALE RATGI YVFAPC+
Sbjct  117   PMIYGIDAVHGNNNVYKATIFPHNVALGVTRDPQLVKKIGSATALEARATGIPYVFAPCL  176

Query  723   AVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHY  902
             AVCRDPRWGRCYESYSEDP IVR+M+E++PGLQG+ P N  L  PFVA ++KVAACAKHY
Sbjct  177   AVCRDPRWGRCYESYSEDPNIVRSMSEMVPGLQGDIPSNGRLGVPFVANKQKVAACAKHY  236

Query  903   VGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMI  1082
             VGDGGTVKGI+ENNT++D H L SIHMAGYY+SII+GV+TVM SYSS NG+RMHAN++M+
Sbjct  237   VGDGGTVKGINENNTIIDRHGLLSIHMAGYYSSIIKGVSTVMVSYSSWNGLRMHANKEMV  296

Query  1083  TGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGL  1262
             TGFLK TLRFRGFVISD+  ID LT   H NYTYSIL  +N+GIDMVM+PYNYTEFIDGL
Sbjct  297   TGFLKGTLRFRGFVISDWAGIDKLTYPWHTNYTYSILEGVNSGIDMVMLPYNYTEFIDGL  356

Query  1263  TYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKS  1442
             TYLV N FV ++RIDDAVKRILRVKF MGLFE+PL DYSL  +LGS +HR+LAR+AVR+S
Sbjct  357   TYLVNNNFVQMTRIDDAVKRILRVKFQMGLFENPLADYSLTKYLGSPEHRELAREAVRRS  416

Query  1443  LVLLKNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILT  1622
             LVLLKNGANADEPVLPL KKA+ ILVAG HA+N+GYQCGGWTI WQGLSGN T GTTIL+
Sbjct  417   LVLLKNGANADEPVLPLPKKATNILVAGAHANNMGYQCGGWTITWQGLSGNTTTGTTILS  476

Query  1623  AIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSII  1802
             AI+NTVD +T+V+++ENPD EFVKS+ FS+AIVVVGE  YAEGSGDS NLTIP PGP I+
Sbjct  477   AIENTVDPETKVVYKENPDSEFVKSNNFSYAIVVVGETPYAEGSGDSLNLTIPAPGPDIM  536

Query  1803  ANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPF  1982
               VC   KCVVVL+TGRPVVIQPYL Q+DALVAAWLPGTEGQGVADVLFGDYGF+GKL  
Sbjct  537   TTVCASVKCVVVLVTGRPVVIQPYLAQMDALVAAWLPGTEGQGVADVLFGDYGFTGKLAR  596

Query  1983  TWFKTVDQ  2006
             TWFKTVDQ
Sbjct  597   TWFKTVDQ  604



>ref|XP_008391778.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=820

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/602 (74%), Positives = 518/602 (86%), Gaps = 1/602 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
              +M +   FL+G+ L C ++ VA A+++ YKD +QP+  RIKDLLSRMTL+EKIGQMVQI
Sbjct  191   SEMARTPIFLMGLLLSCFFIAVAEAEHIRYKDPKQPLNTRIKDLLSRMTLEEKIGQMVQI  250

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             +R VAS++VMKKY++GS+LS GGSVP  RAS EAW++MVN FQKGSLSTRLGIPMIYGID
Sbjct  251   DRSVASSEVMKKYFIGSILSGGGSVPAQRASPEAWINMVNDFQKGSLSTRLGIPMIYGID  310

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN Y ATIFPHN+GLGATRDP LV+ IGAATALE RATGI YVFAPCIAVCRDPR
Sbjct  311   AVHGHNNVYKATIFPHNIGLGATRDPVLVKRIGAATALEARATGIPYVFAPCIAVCRDPR  370

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSED +IV+AMTEIIPGLQGE P N     PFV G +KVAACAKHYVGDGGT 
Sbjct  371   WGRCYESYSEDHKIVQAMTEIIPGLQGELPANSRKGIPFVGGNKKVAACAKHYVGDGGTT  430

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
             +GI+ENNT+++ H L SIHM GYY+SII+GVAT+M SYSS NGV+MHAN D++TGFLK T
Sbjct  431   RGINENNTVINRHGLLSIHMPGYYDSIIKGVATIMVSYSSWNGVKMHANHDLVTGFLKNT  490

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L FRGFVISD++ ID +T   H NY+YSI   +NAGIDMVM+PYNYTEFIDGLT LVKN 
Sbjct  491   LHFRGFVISDWEGIDRITSPPHANYSYSIQAGVNAGIDMVMIPYNYTEFIDGLTSLVKNG  550

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAVKRILRVKFVMGLFE+PL D SL   LGS++HR+LAR+AVR+SLVLLKNG
Sbjct  551   IIPMSRIDDAVKRILRVKFVMGLFEEPLADRSLVDQLGSKEHRELAREAVRRSLVLLKNG  610

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTV  1640
              +ADE +LPL KKAS+ILVAG+HADN+GYQCGGWTIEWQGLSG N+T GTTIL+AIKNTV
Sbjct  611   KSADELLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTEGTTILSAIKNTV  670

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D KT+V+++ENPD +FVKS+ FS+AIVVVGE  YAE  GDS NLTIP+PGPS I NVC  
Sbjct  671   DPKTKVVYKENPDADFVKSNDFSYAIVVVGEHPYAETFGDSLNLTIPDPGPSAITNVCGS  730

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVV++I+GRPVVIQPY+P +DALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTV
Sbjct  731   VKCVVIVISGRPVVIQPYVPLMDALVAAWLPGTEGQGVADVLFGDYGFTGKLSRTWFKTV  790

Query  2001  DQ  2006
             DQ
Sbjct  791   DQ  792


 Score =   170 bits (431),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  228  FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
            FL+G  L+ C + +A A+Y+ YKD +QP+  RIKDLLSRMTL+EKIGQMVQI+R VAS +
Sbjct  6    FLLGFLLVFC-IAIAEAEYIKYKDPKQPLNSRIKDLLSRMTLEEKIGQMVQIDRSVASPE  64

Query  408  VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
            VMKK+++GS+L    +VP  + SAE W++MVN  QKGSLSTRLGIP I+GIDAVHG+NN 
Sbjct  65   VMKKHFIGSILRGVVNVPPQKDSAETWINMVNDLQKGSLSTRLGIPFIFGIDAVHGHNNV  124

Query  588  YNATIFPHNVGLGATR  635
            Y ATIFPHNVGLGATR
Sbjct  125  YKATIFPHNVGLGATR  140



>ref|XP_010088030.1| Lysosomal beta glucosidase [Morus notabilis]
 gb|EXB31249.1| Lysosomal beta glucosidase [Morus notabilis]
Length=634

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/606 (74%), Positives = 515/606 (85%), Gaps = 7/606 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANAD--YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             M + ++FL+G+ L+  W  +A +   +  YKD +QP+  RIKDL+SRMTL+EKIGQMVQI
Sbjct  1     MARNAKFLVGLLLVIFWAAMAESSEKHYKYKDPKQPINIRIKDLISRMTLEEKIGQMVQI  60

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             +R VAS +VMKKY +GS+LS GGSVP   AS EAWVDMVN FQ+GSLSTRLGIPMIYGID
Sbjct  61    DRTVASFEVMKKYKIGSILSGGGSVPAKEASPEAWVDMVNDFQRGSLSTRLGIPMIYGID  120

Query  564   AVHGNNNAYNATIFPHNVGLGATR----DPELVREIGAATALEVRATGIQYVFAPCIAVC  731
             AVHGNNN Y ATIFPHNVGLGATR    DP+LV+ IGAATALEVRATGIQYVFAPCIAVC
Sbjct  121   AVHGNNNVYKATIFPHNVGLGATRQVDMDPQLVKRIGAATALEVRATGIQYVFAPCIAVC  180

Query  732   RDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGD  911
             RDPRWGRCYESYSEDP+IVRAMTEI+  LQGE P N     P+VAG + VAACAKH+VGD
Sbjct  181   RDPRWGRCYESYSEDPKIVRAMTEIVSALQGELPANSRKGVPYVAGNKNVAACAKHFVGD  240

Query  912   GGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGF  1091
             GGT KGI+ENNT+++ H L SIHM GYYN+II+GV+T+M SYSS NG +MHANR +ITGF
Sbjct  241   GGTTKGINENNTVINRHGLLSIHMGGYYNAIIKGVSTIMVSYSSWNGEKMHANRQLITGF  300

Query  1092  LKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYL  1271
             LK TLRFRGFVISD++ ID +T   H NY+YSI   ++AGIDM+M+PYNYTEFIDGLTY 
Sbjct  301   LKNTLRFRGFVISDWQGIDRITSPPHLNYSYSIQAGVSAGIDMIMIPYNYTEFIDGLTYQ  360

Query  1272  VKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVL  1451
             VKNK +P+SRIDDAV+RILRVKF+MGLFE PL DYSL H LGS++HR+LAR+AVRKSLVL
Sbjct  361   VKNKIIPISRIDDAVRRILRVKFIMGLFEKPLADYSLVHELGSQEHRELAREAVRKSLVL  420

Query  1452  LKNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAI  1628
             LKNG +AD PVLPL KKA +ILVAGTHADN+G QCGGWTIEWQGL+G N+T GTTILTAI
Sbjct  421   LKNGEHADNPVLPLPKKAPKILVAGTHADNLGNQCGGWTIEWQGLTGNNLTSGTTILTAI  480

Query  1629  KNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIAN  1808
             KNTVD KT+V++ ENPD  FVKS++FS+AIVVVGE  YAE  GDS NLTIPEPGPS I N
Sbjct  481   KNTVDPKTEVVYLENPDANFVKSNEFSYAIVVVGEPPYAETFGDSLNLTIPEPGPSTITN  540

Query  1809  VCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTW  1988
             VC   KC+V++I+GRPVVIQPY+ QIDALVAAWLPGTEGQGVADVLFGDYGF+GKLP TW
Sbjct  541   VCGAVKCIVIVISGRPVVIQPYVAQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTW  600

Query  1989  FKTVDQ  2006
             FKTVDQ
Sbjct  601   FKTVDQ  606



>ref|XP_002266470.2| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Vitis 
vinifera]
Length=676

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/603 (74%), Positives = 516/603 (86%), Gaps = 1/603 (0%)
 Frame = +3

Query  201   EEKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQ  380
             ++KM +    L+G+ L   W  +A A YM YKD +QP+  RIKDL+SRMTL+EKIGQMVQ
Sbjct  47    KQKMARIPIALLGLLLFYFWAAMAEAKYMKYKDPKQPLNTRIKDLMSRMTLEEKIGQMVQ  106

Query  381   IERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGI  560
             I+R VASA+VMKKY +GS+LS GGSVP  +ASAE W++MVN FQKG LSTRLGIPMIYGI
Sbjct  107   IDRTVASAEVMKKYLIGSILSGGGSVPAKQASAETWIEMVNDFQKGCLSTRLGIPMIYGI  166

Query  561   DAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDP  740
             DAVHG+NN Y ATIFPHNVGLGATRDPELV+ IGAATALEVRATGI YVFAPCIAVCRDP
Sbjct  167   DAVHGHNNVYKATIFPHNVGLGATRDPELVKRIGAATALEVRATGIPYVFAPCIAVCRDP  226

Query  741   RWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGT  920
             RWGRC+ESYSEDP++VRAMTEI+PGLQG+ PP Y    P+VAG +KVAACAKHYVGDGGT
Sbjct  227   RWGRCFESYSEDPKVVRAMTEIVPGLQGDLPPGYQKGIPYVAGNKKVAACAKHYVGDGGT  286

Query  921   VKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKK  1100
              +GI+ENNT++  H L SIHM GYY SII+GV+TVM SYSS NG +MHAN+++ITGFLK 
Sbjct  287   TEGINENNTVISRHGLLSIHMGGYYTSIIKGVSTVMISYSSWNGKKMHANQELITGFLKN  346

Query  1101  TLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKN  1280
             TLRFRGFVISD++ ID +T   H NY+YSI   I AGIDM+MVPYNYTEFIDGLTY VK+
Sbjct  347   TLRFRGFVISDWQGIDRITSPPHANYSYSIEAGIKAGIDMIMVPYNYTEFIDGLTYQVKS  406

Query  1281  KFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKN  1460
             K +P+SRIDDAV+RILRVKFVMGLFE PL D+SL H LGS+ HR+LAR+AVRKSLVLLKN
Sbjct  407   KIIPMSRIDDAVRRILRVKFVMGLFESPLADHSLVHELGSQVHRELAREAVRKSLVLLKN  466

Query  1461  GANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNT  1637
             G  AD+P+LPL KKA +ILVAGTHADN+G QCGGWTIEWQGLSG N+T GTTIL+AIK T
Sbjct  467   GEPADKPLLPLPKKAPKILVAGTHADNLGNQCGGWTIEWQGLSGNNLTSGTTILSAIKKT  526

Query  1638  VDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCP  1817
             VD KT+V+++ENPD  +VKSSKFS+AIVVVGE  YAE  GD+ NLTIP+PGPSII NVC 
Sbjct  527   VDPKTEVVYKENPDLSYVKSSKFSYAIVVVGEPPYAETFGDNLNLTIPDPGPSIITNVCG  586

Query  1818  HTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKT  1997
               KCVV++I+GRP+VIQPY+ QIDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWF+T
Sbjct  587   AVKCVVIVISGRPLVIQPYVDQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSRTWFRT  646

Query  1998  VDQ  2006
             V+Q
Sbjct  647   VEQ  649



>ref|XP_010653212.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Vitis 
vinifera]
Length=627

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/593 (75%), Positives = 511/593 (86%), Gaps = 1/593 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             L+G+ L   W  +A A YM YKD +QP+  RIKDL+SRMTL+EKIGQMVQI+R VASA+V
Sbjct  8     LLGLLLFYFWAAMAEAKYMKYKDPKQPLNTRIKDLMSRMTLEEKIGQMVQIDRTVASAEV  67

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             MKKY +GS+LS GGSVP  +ASAE W++MVN FQKG LSTRLGIPMIYGIDAVHG+NN Y
Sbjct  68    MKKYLIGSILSGGGSVPAKQASAETWIEMVNDFQKGCLSTRLGIPMIYGIDAVHGHNNVY  127

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
              ATIFPHNVGLGATRDPELV+ IGAATALEVRATGI YVFAPCIAVCRDPRWGRC+ESYS
Sbjct  128   KATIFPHNVGLGATRDPELVKRIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCFESYS  187

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             EDP++VRAMTEI+PGLQG+ PP Y    P+VAG +KVAACAKHYVGDGGT +GI+ENNT+
Sbjct  188   EDPKVVRAMTEIVPGLQGDLPPGYQKGIPYVAGNKKVAACAKHYVGDGGTTEGINENNTV  247

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             +  H L SIHM GYY SII+GV+TVM SYSS NG +MHAN+++ITGFLK TLRFRGFVIS
Sbjct  248   ISRHGLLSIHMGGYYTSIIKGVSTVMISYSSWNGKKMHANQELITGFLKNTLRFRGFVIS  307

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ ID +T   H NY+YSI   I AGIDM+MVPYNYTEFIDGLTY VK+K +P+SRIDD
Sbjct  308   DWQGIDRITSPPHANYSYSIEAGIKAGIDMIMVPYNYTEFIDGLTYQVKSKIIPMSRIDD  367

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV+RILRVKFVMGLFE PL D+SL H LGS+ HR+LAR+AVRKSLVLLKNG  AD+P+LP
Sbjct  368   AVRRILRVKFVMGLFESPLADHSLVHELGSQVHRELAREAVRKSLVLLKNGEPADKPLLP  427

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFE  1667
             L KKA +ILVAGTHADN+G QCGGWTIEWQGLSG N+T GTTIL+AIK TVD KT+V+++
Sbjct  428   LPKKAPKILVAGTHADNLGNQCGGWTIEWQGLSGNNLTSGTTILSAIKKTVDPKTEVVYK  487

Query  1668  ENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLIT  1847
             ENPD  +VKSSKFS+AIVVVGE  YAE  GD+ NLTIP+PGPSII NVC   KCVV++I+
Sbjct  488   ENPDLSYVKSSKFSYAIVVVGEPPYAETFGDNLNLTIPDPGPSIITNVCGAVKCVVIVIS  547

Query  1848  GRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             GRP+VIQPY+ QIDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWF+TV+Q
Sbjct  548   GRPLVIQPYVDQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSRTWFRTVEQ  600



>ref|XP_006350208.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=631

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/608 (74%), Positives = 519/608 (85%), Gaps = 7/608 (1%)
 Frame = +3

Query  192   LKFEEKMGKGSR-FLIGVALLCCWVVVA-NAD-YMLYKDHRQPVGRRIKDLLSRMTLKEK  362
             ++   KMG   R FL+    L CW+++A NA+ Y+ YKD  +P+ RRIKDL+ RMTL+EK
Sbjct  1     MQRRSKMGFLMRNFLV----LFCWIILAVNAEEYITYKDPNKPLNRRIKDLMKRMTLEEK  56

Query  363   IGQMVQIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGI  542
             IGQM+QI+R  A+ +VM KYYLGSVLS GGSVPK  ASAE W+DM+NGFQKGSLSTRLGI
Sbjct  57    IGQMIQIDRTAATPKVMNKYYLGSVLSGGGSVPKKEASAEDWIDMINGFQKGSLSTRLGI  116

Query  543   PMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCI  722
             PMIYGIDAVHGNNN Y ATIFPHNV LG  RDP+LV+ IG+ATALE RATGI YVFAPC+
Sbjct  117   PMIYGIDAVHGNNNVYKATIFPHNVALGVIRDPQLVKRIGSATALEARATGIPYVFAPCL  176

Query  723   AVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHY  902
             AVCRDPRWGRC+ESYSEDP IVR+M+E++PGLQG+ P N  L  PFVA ++KVAACAKHY
Sbjct  177   AVCRDPRWGRCFESYSEDPNIVRSMSEMVPGLQGDVPSNGRLGVPFVANKQKVAACAKHY  236

Query  903   VGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMI  1082
             VGDGGTVKGI+ENNT++D H L SIHMAGYY+SII+GV+TVM SYSS NG+RMH N++M+
Sbjct  237   VGDGGTVKGINENNTIIDRHGLLSIHMAGYYSSIIKGVSTVMVSYSSWNGLRMHENKEMV  296

Query  1083  TGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGL  1262
             TGFLK TLRFRGFVISD+  ID LT   H NYTYSIL  +N+GIDMVM+PYNYTEFIDGL
Sbjct  297   TGFLKGTLRFRGFVISDWAGIDKLTYPWHTNYTYSILEGVNSGIDMVMLPYNYTEFIDGL  356

Query  1263  TYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKS  1442
             TYLV N FV ++RIDDAVKRILRVKF MGLFE+PL DYSL  +LG  +HR+LAR+AVR+S
Sbjct  357   TYLVNNNFVQMTRIDDAVKRILRVKFQMGLFENPLADYSLTKYLGCPEHRELAREAVRRS  416

Query  1443  LVLLKNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILT  1622
             LVLLKNGANADEPVLPL KKA+ ILVAG HA+N+GYQCGGWTI WQGLSGN TIGTTIL+
Sbjct  417   LVLLKNGANADEPVLPLPKKATNILVAGAHANNMGYQCGGWTITWQGLSGNTTIGTTILS  476

Query  1623  AIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSII  1802
             AI+NTVD +T+V+++ENPD EFVKS+ FS+AIVVVGE  YAEGSGD+ NLTIP PGP I+
Sbjct  477   AIENTVDPETKVVYKENPDSEFVKSNNFSYAIVVVGETPYAEGSGDTLNLTIPAPGPDIM  536

Query  1803  ANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPF  1982
               VC   KCVVVL+TGRPVVIQPYL Q+DA+VAAWLPGTEGQGVADVLFGDYGF+GKL  
Sbjct  537   TTVCASVKCVVVLLTGRPVVIQPYLAQMDAVVAAWLPGTEGQGVADVLFGDYGFTGKLAR  596

Query  1983  TWFKTVDQ  2006
             TWFKTVDQ
Sbjct  597   TWFKTVDQ  604



>ref|XP_004489688.1| PREDICTED: lysosomal beta glucosidase-like [Cicer arietinum]
Length=628

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/600 (74%), Positives = 514/600 (86%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K + FL+G  +L CWV +A A+Y+ YKD +QP+  RIKDL+ RM+L+EK+GQMVQI+R
Sbjct  1     MAKATIFLVGFLILHCWVAMAEAEYLKYKDPKQPLNTRIKDLVGRMSLEEKVGQMVQIDR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VAS  VMKKYY+GS+LS GGSVPKP+ASA+ WVDMVN FQKG+LSTRLGIPMIYGIDAV
Sbjct  61    SVASVDVMKKYYIGSLLSGGGSVPKPQASAKDWVDMVNEFQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHN+GLGATRDP+LV++IG ATALE RATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNIGLGATRDPQLVKKIGEATALEARATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IV++MTEIIPGLQG+ P N P   PFVAG +KVAACAKH+VGDGGT KG
Sbjct  181   RCYESYSEDHTIVQSMTEIIPGLQGDIPSNSPKGVPFVAGNKKVAACAKHFVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+V  H+L SIHM  YYNSII GV+T+M SYSS NG +MHANRD+ITGFLK TLR
Sbjct  241   INENNTVVSRHELLSIHMPAYYNSIIHGVSTIMVSYSSWNGEKMHANRDLITGFLKNTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFV SD++ ID +T T H NYTYSI T++NAGIDM+M+PYNYTEFIDGLT+LVKN  +
Sbjct  301   FRGFVTSDWQGIDLITSTPHANYTYSIQTAVNAGIDMIMIPYNYTEFIDGLTFLVKNNAI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+PL DYSL   LGS++HR+LAR+AVRKSLVLLKNG N
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFENPLADYSLVDQLGSQEHRELAREAVRKSLVLLKNGEN  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
             AD+P+LPL KKAS+ILVAG+HADN+GYQCGGWTIEWQG SGN IT GTTIL+AIKNTVD 
Sbjct  421   ADKPLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGHSGNHITSGTTILSAIKNTVDK  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T ++++E PDP++VKS+ FS+AIVVVGEK YAE SGDS NLTI   G   I NVC   K
Sbjct  481   DTDIIYKEYPDPDYVKSNNFSYAIVVVGEKPYAETSGDSLNLTISSHGYDTINNVCAGVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVLITGRPVVIQPYL +I+ LVAAWLPG+EG GV DVLFGDYGFSGKL  TWFK+VDQ
Sbjct  541   CVVVLITGRPVVIQPYLDKIEGLVAAWLPGSEGHGVTDVLFGDYGFSGKLSRTWFKSVDQ  600



>ref|XP_011094172.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Sesamum 
indicum]
Length=627

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/599 (73%), Positives = 512/599 (85%), Gaps = 0/599 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M +     IG+ +LCCW+ VANA+Y +Y+D +QP+ +R+KDLL RMTL+EKIGQM QI+R
Sbjct  1     MAEAPAVFIGILVLCCWIAVANAEYKIYQDPKQPISKRVKDLLGRMTLEEKIGQMTQIDR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VAS +VMKKYY+GS+LS+GGS P P AS + W+DMVNG+QKGSLSTRL IPM++GIDAV
Sbjct  61    LVASEEVMKKYYIGSMLSAGGSGPPPTASPQTWIDMVNGYQKGSLSTRLKIPMLFGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HGN+  Y ATIFPHNVGLGATRDPELV+ IGAATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGNSAVYRATIFPHNVGLGATRDPELVKRIGAATALEVRATGIPYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP+IVRAMTEIIPGLQG+ P N     PF+AG++KV A AKHYVGDGGT KG
Sbjct  181   RCYESYSEDPKIVRAMTEIIPGLQGDIPANSRKGVPFLAGQQKVLATAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+   HDL  IHM  YY+SII+GV T+M SYSS NGV+MHANRD+ITGFLK TLR
Sbjct  241   INENNTVASRHDLLRIHMPAYYDSIIKGVGTIMISYSSWNGVKMHANRDLITGFLKNTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ +D +T   H NYTYSI+  + AGIDM+MVPYNYTEFIDGLT LVKN F+
Sbjct  301   FRGFVISDWQGLDRITSPPHANYTYSIIAGVGAGIDMIMVPYNYTEFIDGLTSLVKNNFI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKF +GLFE PL DYS+  +LGS++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVKRILRVKFTIGLFEHPLADYSMTKYLGSQEHRELAREAVRKSLVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTK  1649
             A++P++PL KKAS+ILVAGTHADNIG QCGGWTI+ QG  GN+T+GTTILTAI+NTV  +
Sbjct  421   ANKPLIPLPKKASKILVAGTHADNIGNQCGGWTIQLQGQPGNVTVGTTILTAIRNTVHPE  480

Query  1650  TQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKC  1829
             T+++F ENP P +VKS++FS+AI+VVGE  Y+   GD++NLTIP+PGPSII NVC   KC
Sbjct  481   TKIVFNENPHPGYVKSNEFSYAIIVVGEPPYSLTFGDNTNLTIPDPGPSIITNVCASVKC  540

Query  1830  VVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VVVLITGRPVVIQPYL QIDALVAAWLPGTEGQGVADVLFGDYGF+G LP TWFKTVDQ
Sbjct  541   VVVLITGRPVVIQPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFTGTLPRTWFKTVDQ  599



>gb|KHN20835.1| Lysosomal beta glucosidase [Glycine soja]
Length=628

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/600 (74%), Positives = 511/600 (85%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K   F +G+ LL CW  +  A+Y+ YKD +QP+  RIKDL++RMTL+EKIGQM QI+R
Sbjct  1     MAKIPIFSVGIMLLHCWAAMTGAEYLKYKDPKQPLNNRIKDLMNRMTLEEKIGQMTQIDR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VASA+VM KYY+GSVLS GGSVP+ +ASA+ W+ MVN FQKG+LSTRLGIPMIYGIDAV
Sbjct  61    KVASAEVMNKYYIGSVLSGGGSVPRAQASAKDWIHMVNDFQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLGATRDP+LVR+IG ATALEVRATGIQYVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNVGLGATRDPKLVRKIGEATALEVRATGIQYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED ++V+AMTEIIPGLQG+ PPN     PFVAG++KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDHKVVQAMTEIIPGLQGDIPPNSRKGVPFVAGKKKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++  H L SIHM  YYNSII+GV+T+M SYSS NG +MHAN ++IT FLK TLR
Sbjct  241   INENNTVISRHGLLSIHMPAYYNSIIKGVSTIMISYSSWNGQKMHANHNLITDFLKNTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYSI   I AGIDM+MVPYNYTEFIDGLT  VKN  +
Sbjct  301   FRGFVISDWQGIDRITTPSHANYTYSIYAGITAGIDMIMVPYNYTEFIDGLTSQVKNNLI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKF+MGLFE+PL DYSL   LGS+KHRKLARKAVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVKRILRVKFIMGLFENPLADYSLVKQLGSKKHRKLARKAVRKSLVLLKNGED  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGL-SGNITIGTTILTAIKNTVDT  1646
             AD+P+LPL KKAS+ILVAG+HADN+GYQCGGWTIEWQGL + N+T GTTIL+AIKNTVD 
Sbjct  421   ADQPLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGLETNNLTKGTTILSAIKNTVDK  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V+++ENPD ++VKS+ FS+AIVVVGEK YAE +GDS NLTI EPGP  I NVC   K
Sbjct  481   DTEVVYKENPDLDYVKSNGFSYAIVVVGEKPYAETNGDSMNLTISEPGPDTIMNVCGGVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CV V+I+GRPVVIQPYL  IDALVAAWLPG+EG GV DVLFGDYGF GKLP TWFKTVDQ
Sbjct  541   CVAVIISGRPVVIQPYLHLIDALVAAWLPGSEGHGVTDVLFGDYGFRGKLPRTWFKTVDQ  600



>ref|XP_003551104.1| PREDICTED: lysosomal beta glucosidase-like [Glycine max]
Length=628

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/600 (74%), Positives = 511/600 (85%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K   F +G+ LL CW  +  A+Y+ YKD +QP+  RIKDL++RMTL+EKIGQM QI+R
Sbjct  1     MAKIPIFSVGIMLLHCWAAMTGAEYLKYKDPKQPLNNRIKDLMNRMTLEEKIGQMTQIDR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VASA+VM KYY+GSVLS GGSVP+ +ASA+ W+ MVN FQKG+LSTRLGIPMIYGIDAV
Sbjct  61    KVASAEVMNKYYIGSVLSGGGSVPRAQASAKDWIHMVNDFQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLGATRDP+LVR+IG ATALEVRATGIQYVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNVGLGATRDPKLVRKIGEATALEVRATGIQYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED ++V+AMTEIIPGLQG+ PPN     PFVAG++KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDHKVVQAMTEIIPGLQGDIPPNSRKGVPFVAGKKKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++  H L SIH+  YYNSII+GV+T+M SYSS NG +MHAN ++IT FLK TLR
Sbjct  241   INENNTVISRHGLLSIHVPAYYNSIIKGVSTIMISYSSWNGQKMHANHNLITDFLKNTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYSI   I AGIDM+MVPYNYTEFIDGLT  VKN  +
Sbjct  301   FRGFVISDWQGIDRITTPSHANYTYSIYAGITAGIDMIMVPYNYTEFIDGLTSQVKNNLI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKF+MGLFE+PL DYSL   LGS+KHRKLARKAVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVKRILRVKFIMGLFENPLADYSLVKQLGSKKHRKLARKAVRKSLVLLKNGED  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGL-SGNITIGTTILTAIKNTVDT  1646
             AD+P+LPL KKAS+ILVAG+HADN+GYQCGGWTIEWQGL + N+T GTTIL+AIKNTVD 
Sbjct  421   ADQPLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGLETNNLTKGTTILSAIKNTVDK  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V+++ENPD ++VKS+ FS+AIVVVGEK YAE +GDS NLTI EPGP  I NVC   K
Sbjct  481   DTEVVYKENPDLDYVKSNGFSYAIVVVGEKPYAETNGDSMNLTISEPGPDTIMNVCGGVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CV V+I+GRPVVIQPYL  IDALVAAWLPG+EG GV DVLFGDYGF GKLP TWFKTVDQ
Sbjct  541   CVAVIISGRPVVIQPYLHLIDALVAAWLPGSEGHGVTDVLFGDYGFRGKLPRTWFKTVDQ  600



>ref|XP_002319151.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEE95074.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=627

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/594 (74%), Positives = 508/594 (86%), Gaps = 3/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             FL+G+A++  W  +A A+YM+YKD  +P+  RIKDL+SRMTL+EKIGQM QIER VASA+
Sbjct  8     FLMGLAVI--WAALAQAEYMIYKDATKPLNSRIKDLMSRMTLEEKIGQMTQIERNVASAE  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VMK Y++GSVLS GGSVP  +ASAE W++MVN FQKG+LSTRLGIPMIYGIDAVHG+NN 
Sbjct  66    VMKDYFIGSVLSGGGSVPSKQASAETWINMVNEFQKGALSTRLGIPMIYGIDAVHGHNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHNVGLGATR+PELV+ IGAATALEVRATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNVGLGATREPELVKRIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP++V+AMTEI+PGLQG+ P N     PFVAG+ KVAACAKHY+GDGGT  GI+ENNT
Sbjct  186   SEDPKLVQAMTEIVPGLQGDIPANSSKGIPFVAGKTKVAACAKHYLGDGGTTDGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
              +  H L S HM GYYNSII+GV+T+M SYSS NGV+MHANRDM+TGFLK  LRFRGFVI
Sbjct  246   QISRHGLLSTHMPGYYNSIIKGVSTIMVSYSSWNGVKMHANRDMVTGFLKNILRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NY+YSI   I+AGIDM+MVP NY E IDGLT  VKNK +P+SRID
Sbjct  306   SDWEGIDRITSPPHANYSYSIQAGISAGIDMIMVPNNYKELIDGLTSHVKNKVIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKFVMGLFE+PL D SL + LGS++HR+LAR+AVRKSLVLLKNG +ADEP+L
Sbjct  366   DAVKRILRVKFVMGLFENPLADKSLVNELGSQEHRELAREAVRKSLVLLKNGESADEPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMF  1664
             PL KKAS+ILVAG+HADN+GYQCGGWTIEWQGLSG N+T GTTILTAI+NTVD  T+V++
Sbjct  426   PLHKKASKILVAGSHADNLGYQCGGWTIEWQGLSGKNLTSGTTILTAIENTVDPSTEVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             +ENPD +FVKS+ FS+AIVVVGE  YAE  GD  NLTI EPGPS I NVC   KCV V+ 
Sbjct  486   KENPDADFVKSNNFSYAIVVVGEPPYAETFGDCLNLTISEPGPSTIQNVCGSVKCVTVIS  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVIQPYL  +DALVAAWLPGTEGQGVADVLFGDYGF+GKLP TWFKTVDQ
Sbjct  546   SGRPVVIQPYLSLMDALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTWFKTVDQ  599



>emb|CBI39076.3| unnamed protein product [Vitis vinifera]
Length=635

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/601 (74%), Positives = 511/601 (85%), Gaps = 9/601 (1%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             L+G+ L   W  +A A YM YKD +QP+  RIKDL+SRMTL+EKIGQMVQI+R VASA+V
Sbjct  8     LLGLLLFYFWAAMAEAKYMKYKDPKQPLNTRIKDLMSRMTLEEKIGQMVQIDRTVASAEV  67

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             MKKY +GS+LS GGSVP  +ASAE W++MVN FQKG LSTRLGIPMIYGIDAVHG+NN Y
Sbjct  68    MKKYLIGSILSGGGSVPAKQASAETWIEMVNDFQKGCLSTRLGIPMIYGIDAVHGHNNVY  127

Query  591   NATIFPHNVGLGATR--------DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
              ATIFPHNVGLGATR        DPELV+ IGAATALEVRATGI YVFAPCIAVCRDPRW
Sbjct  128   KATIFPHNVGLGATRQHSFDKELDPELVKRIGAATALEVRATGIPYVFAPCIAVCRDPRW  187

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRC+ESYSEDP++VRAMTEI+PGLQG+ PP Y    P+VAG +KVAACAKHYVGDGGT +
Sbjct  188   GRCFESYSEDPKVVRAMTEIVPGLQGDLPPGYQKGIPYVAGNKKVAACAKHYVGDGGTTE  247

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++  H L SIHM GYY SII+GV+TVM SYSS NG +MHAN+++ITGFLK TL
Sbjct  248   GINENNTVISRHGLLSIHMGGYYTSIIKGVSTVMISYSSWNGKKMHANQELITGFLKNTL  307

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             RFRGFVISD++ ID +T   H NY+YSI   I AGIDM+MVPYNYTEFIDGLTY VK+K 
Sbjct  308   RFRGFVISDWQGIDRITSPPHANYSYSIEAGIKAGIDMIMVPYNYTEFIDGLTYQVKSKI  367

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAV+RILRVKFVMGLFE PL D+SL H LGS+ HR+LAR+AVRKSLVLLKNG 
Sbjct  368   IPMSRIDDAVRRILRVKFVMGLFESPLADHSLVHELGSQVHRELAREAVRKSLVLLKNGE  427

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
              AD+P+LPL KKA +ILVAGTHADN+G QCGGWTIEWQGLSG N+T GTTIL+AIK TVD
Sbjct  428   PADKPLLPLPKKAPKILVAGTHADNLGNQCGGWTIEWQGLSGNNLTSGTTILSAIKKTVD  487

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
              KT+V+++ENPD  +VKSSKFS+AIVVVGE  YAE  GD+ NLTIP+PGPSII NVC   
Sbjct  488   PKTEVVYKENPDLSYVKSSKFSYAIVVVGEPPYAETFGDNLNLTIPDPGPSIITNVCGAV  547

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVV++I+GRP+VIQPY+ QIDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWF+TV+
Sbjct  548   KCVVIVISGRPLVIQPYVDQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSRTWFRTVE  607

Query  2004  Q  2006
             Q
Sbjct  608   Q  608



>gb|EYU18174.1| hypothetical protein MIMGU_mgv1a002879mg [Erythranthe guttata]
Length=628

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/600 (74%), Positives = 510/600 (85%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWV-VVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M K   F IG+  LCC + VVANA+Y  Y+D ++P+ +R+KDLLSRMTL+EK+GQM QI+
Sbjct  1     MAKAPPFFIGILALCCSIAVVANAEYKTYQDPKKPINKRVKDLLSRMTLEEKVGQMTQID  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             + V SA+V+KKYY+GSVLS GGSVP P AS E WVDMVNG+QKGSLSTRL IPM+YGIDA
Sbjct  61    KLVTSAEVLKKYYIGSVLSGGGSVPSPTASPETWVDMVNGYQKGSLSTRLKIPMLYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+N  Y ATIFPHNVGLGATRDPELV+ IGAATALEVRATGI YVFAPCIAVCRDPRW
Sbjct  121   VHGHNGVYKATIFPHNVGLGATRDPELVKRIGAATALEVRATGIPYVFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP++VR+MTEII GLQGE P N     PF+AG+EKV A AKH+VGDGGT K
Sbjct  181   GRCYESYSEDPKVVRSMTEIISGLQGEIPSNSRKGVPFLAGQEKVLATAKHFVGDGGTTK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             G++ENNTL   H L SIHM  YY+SII+GV T+M SYSS NGV+MHANRD+IT FLK TL
Sbjct  241   GMNENNTLATRHGLLSIHMPAYYDSIIKGVGTIMVSYSSWNGVKMHANRDLITVFLKNTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             RFRGFVISD++ ID +T   H NYTYSI+T INAGIDM+MVPYNYTEFIDGLT LVKNK 
Sbjct  301   RFRGFVISDWQGIDRITTPEHANYTYSIITGINAGIDMIMVPYNYTEFIDGLTSLVKNKV  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAV RILRVKF +GLFE PL DYS+  HLGS++HR++AR+AVRKSLVLLKNG 
Sbjct  361   IPMSRIDDAVARILRVKFTIGLFEHPLADYSMVKHLGSKEHREIAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDT  1646
             +AD+PVLPL KKAS+ILV G+HA+NIG QCGGWTI+WQG +GN+T+GTTILTA+KNTV  
Sbjct  421   SADKPVLPLPKKASKILVVGSHANNIGNQCGGWTIQWQGQTGNVTVGTTILTAVKNTVHP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
             +T+V+F ENPD +F+K +KFS+A+VVVGE  YAE  GDS NLT+PE G S I N+C   K
Sbjct  481   ETKVVFNENPDSKFLKLNKFSYAVVVVGEPPYAETFGDSLNLTLPESGYSTIKNMCASVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVLITGRPVVI PYL QIDALVAAWLPGTEGQGVADVLFGDYGFSGKLP TWFK+VDQ
Sbjct  541   CVVVLITGRPVVIGPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPHTWFKSVDQ  600



>ref|XP_011077752.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=633

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/604 (75%), Positives = 509/604 (84%), Gaps = 1/604 (0%)
 Frame = +3

Query  198   FEEKMGKGSRFLIGVALLCCWVVVANAD-YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQM  374
                KM K   FLIG+ +L CW    NA+ Y +YKD +QP+ RRI DL+ RMTL EKIGQM
Sbjct  2     LPRKMAKAPVFLIGILVLYCWAASVNAEEYRIYKDPKQPINRRINDLMDRMTLAEKIGQM  61

Query  375   VQIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIY  554
              QIER VASA+VMKKY++GSVLS GGSVP P+AS E W+DMVN  QKGSLSTRLGIPMIY
Sbjct  62    TQIERSVASAEVMKKYFIGSVLSGGGSVPAPQASPETWIDMVNDLQKGSLSTRLGIPMIY  121

Query  555   GIDAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCR  734
             GIDAVHG+NN Y ATIFPHNVGLGATRDP+LV++IGAATALEVRATGI Y FAPCIAVCR
Sbjct  122   GIDAVHGHNNVYKATIFPHNVGLGATRDPQLVKKIGAATALEVRATGIPYTFAPCIAVCR  181

Query  735   DPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDG  914
             DPRWGRCYESYSEDP +VRAMTEIIPGLQG+ P N     P+VAG   V ACAKHYVGDG
Sbjct  182   DPRWGRCYESYSEDPNVVRAMTEIIPGLQGDTPANGRKGVPYVAGPRNVMACAKHYVGDG  241

Query  915   GTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFL  1094
             GT KGI+ENNT+   H L SIHM  YY+SII+GV+TVM SYSS NG++MHANRD+ITGFL
Sbjct  242   GTTKGINENNTVATRHALLSIHMPAYYDSIIKGVSTVMISYSSWNGIKMHANRDLITGFL  301

Query  1095  KKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLV  1274
             K   RFRGFVISD++ ID +T   H NYTYSIL  +NAGIDM+MVPYNYTEFIDGLT LV
Sbjct  302   KTIQRFRGFVISDWQGIDRITSPPHANYTYSILAGVNAGIDMIMVPYNYTEFIDGLTSLV  361

Query  1275  KNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLL  1454
             K+ F+ +SRIDDAVKRILRVKF MGLFE PL DYS+  +LGS++HR+LAR+AVRKSLVLL
Sbjct  362   KSNFISMSRIDDAVKRILRVKFTMGLFEHPLADYSMTKYLGSQEHRELAREAVRKSLVLL  421

Query  1455  KNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKN  1634
             KNG +AD+P+LPL KKAS+ILVAGTHADNIG QCGGWTI+WQG SGNIT GTTILTA+KN
Sbjct  422   KNGKSADKPLLPLPKKASKILVAGTHADNIGNQCGGWTIQWQGQSGNITDGTTILTAVKN  481

Query  1635  TVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVC  1814
             TVD KT+V+F ENPD  +VKS+KFS+AIVVVGE  YAE  GD+ NLT+P+PGPSII NVC
Sbjct  482   TVDPKTEVVFSENPDSGYVKSNKFSYAIVVVGEPPYAETFGDNLNLTLPDPGPSIITNVC  541

Query  1815  PHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFK  1994
                KCVVVLITGRPVVIQPYL QIDALVAAWLPGTEGQGVADVL+GDYGF+GKL  TWFK
Sbjct  542   SSVKCVVVLITGRPVVIQPYLKQIDALVAAWLPGTEGQGVADVLYGDYGFTGKLSRTWFK  601

Query  1995  TVDQ  2006
              VDQ
Sbjct  602   NVDQ  605



>ref|XP_007204092.1| hypothetical protein PRUPE_ppa002894mg [Prunus persica]
 gb|EMJ05291.1| hypothetical protein PRUPE_ppa002894mg [Prunus persica]
Length=623

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/594 (74%), Positives = 508/594 (86%), Gaps = 6/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             FL+G+  LC  + +A A Y+ YKD +QP+  RIKDL+SRMTL+EKIGQMVQI+R VASA+
Sbjct  7     FLMGLLFLCFNIAIAEAQYINYKDPKQPLNSRIKDLVSRMTLEEKIGQMVQIDRSVASAE  66

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VMKKY++GS+LS GGSVP  +ASAE W++MVN FQKGSLSTRLGIP+IYGIDAVHG+NN 
Sbjct  67    VMKKYFIGSILSGGGSVPAQKASAETWINMVNDFQKGSLSTRLGIPLIYGIDAVHGHNNV  126

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATR     + IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  127   YKATIFPHNIGLGATR-----QRIGAATALEARATGIPYVFAPCIAVCRDPRWGRCYESY  181

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP+IV+AMTEIIPGLQGE P N     PFVAG +KVAACAKH+VGDGGT KGI+ENNT
Sbjct  182   SEDPKIVQAMTEIIPGLQGEIPANSRKGVPFVAGNKKVAACAKHFVGDGGTTKGINENNT  241

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ H L SIHM GYYNSII+GVAT+M SYSS NGV+MHAN D++T FLK TLRFRGFVI
Sbjct  242   VINRHGLLSIHMPGYYNSIIKGVATIMVSYSSWNGVKMHANHDLVTAFLKNTLRFRGFVI  301

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NY+YSI   INAGIDMVMVPYNY EFIDGLT+LVKNK +P+SRID
Sbjct  302   SDWEGIDRITSPPHANYSYSIQAGINAGIDMVMVPYNYMEFIDGLTFLVKNKIIPMSRID  361

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKFVMGLFE+P  D SL H LGS++HR+LAR+AVR+SLVLLKNG +A++P+L
Sbjct  362   DAVKRILRVKFVMGLFEEPFADMSLVHQLGSQEHRELAREAVRRSLVLLKNGESAEKPLL  421

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQGLSG N+T GTTILTAIKNTVD K QV++
Sbjct  422   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTEGTTILTAIKNTVDPKAQVVY  481

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             +ENPD +FVKS+  S+AIVVVGE  YAE  GDS NLTIP+PGP+ I NVC   KCVV++I
Sbjct  482   KENPDADFVKSNNISYAIVVVGEHPYAETFGDSLNLTIPDPGPTTITNVCGTVKCVVIVI  541

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVIQPY+  IDALV AWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  542   SGRPVVIQPYVASIDALVTAWLPGTEGQGVADVLFGDYGFTGKLSRTWFKTVDQ  595



>ref|XP_004489700.1| PREDICTED: lysosomal beta glucosidase-like [Cicer arietinum]
Length=628

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/600 (73%), Positives = 513/600 (86%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K + FL+G  +L CWV +A A+Y+ YKD +QP+  +IKDL+ RM+L+EK+G+MVQI+R
Sbjct  1     MAKATVFLVGFLILHCWVAMAEAEYLKYKDPKQPLNTKIKDLVGRMSLEEKVGEMVQIDR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VAS+ VMKKYY+G++LS GGSVPKP+ASA+ WVDMVN FQKG+LSTRLGIPMIYGIDAV
Sbjct  61    TVASSNVMKKYYIGTILSGGGSVPKPQASAKDWVDMVNEFQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHN+GLGATRDP+LV++IG ATALE RATGI YV+APCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNIGLGATRDPQLVKKIGEATALEARATGIPYVYAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  +V++MTEIIPGLQG+ P N P   PFVAG +KVAACAKH+VGDGGT KG
Sbjct  181   RCYESYSEDHTVVQSMTEIIPGLQGDIPSNSPKGVPFVAGNKKVAACAKHFVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+V  H+L SIHM  YYNSII+GV+T+M SYSS NG +MHANRD+ITGFLK TLR
Sbjct  241   INENNTVVSRHELLSIHMPAYYNSIIQGVSTIMVSYSSWNGEKMHANRDLITGFLKNTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T T H NYTYSI T++NAGIDM+M+PYNYTEFIDGLT+LVKN  +
Sbjct  301   FRGFVISDWQGIDRITSTPHANYTYSIQTAVNAGIDMIMIPYNYTEFIDGLTFLVKNNAI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+PL DYSL   LGS++HR+LAR+AVRKSLVLLKNG N
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFENPLADYSLVDQLGSQEHRELAREAVRKSLVLLKNGEN  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
             AD+P+LPL KKAS+ILVAG+HADN+GYQCGGWTIEWQGLSGN IT GTTIL AIKNTVD 
Sbjct  421   ADKPLLPLPKKASKILVAGSHADNLGYQCGGWTIEWQGLSGNYITSGTTILGAIKNTVDK  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T ++++E PD ++VKS+ FS+AIVVVGEK YAE SGDS NLTI   G   I NVC   K
Sbjct  481   DTNIIYKEYPDLDYVKSNNFSYAIVVVGEKPYAETSGDSLNLTISSHGYDTINNVCAGMK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
              VVVLITGRPVVIQPYL +I+ LVAAWLP +EG GV DVL GDYGFSGKL  TWFK+VDQ
Sbjct  541   WVVVLITGRPVVIQPYLDKIEGLVAAWLPRSEGHGVTDVLLGDYGFSGKLSRTWFKSVDQ  600



>ref|XP_004141128.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN59734.1| hypothetical protein Csa_3G842070 [Cucumis sativus]
Length=628

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/600 (73%), Positives = 501/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K   F +G  + C   V A   YM YKD +QP+  RI DLL RMTL+EKIGQMVQI+R
Sbjct  1     MAKNLIFFMGFFIFCLTEVWAKHQYMRYKDPKQPLNVRISDLLGRMTLEEKIGQMVQIDR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VAS +VMKKY +GSVLS GGSVP   AS + W+DMVN FQKGSLSTRLGIPMIYGIDAV
Sbjct  61    TVASKKVMKKYLIGSVLSGGGSVPSKEASPKVWIDMVNEFQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLGATRDP L + IGAATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNVGLGATRDPNLAKRIGAATALEVRATGISYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RC+ESYSEDP++V+ MTEII GLQGE P N     P+VAGREKVAACAKHYVGDGGT KG
Sbjct  181   RCFESYSEDPKVVQEMTEIISGLQGEIPSNSRKGVPYVAGREKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             ++ENNTL   H L SIHM GYYNSII+GV+TVM SYSS NG +MH NRD+ITGFLK TLR
Sbjct  241   MNENNTLASRHGLLSIHMPGYYNSIIKGVSTVMISYSSWNGKKMHENRDLITGFLKNTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYSI+  I AGIDM+MVP+NYTEFIDGLTYLVK   +
Sbjct  301   FRGFVISDWQGIDRITSPPHANYTYSIIAGITAGIDMIMVPFNYTEFIDGLTYLVKTNVI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+PL D S  + LG ++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PISRIDDAVKRILRVKFVMGLFENPLADSSFVNELGKKEHRELAREAVRKSLVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD+P+LPL KK  +ILVAG+HA+N+G+QCGGWTIEWQGL G N+T GTTIL+AIK+TVD 
Sbjct  421   ADKPILPLPKKVPKILVAGSHANNLGFQCGGWTIEWQGLGGNNLTSGTTILSAIKDTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
             KT+V+F+ENPD EFVKS+KFS+AIVVVGE  YAE  GDS NLTIPEPGPS I NVC   K
Sbjct  481   KTKVVFKENPDMEFVKSNKFSYAIVVVGEYPYAETFGDSLNLTIPEPGPSTITNVCGAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV++I+GRPVV+QPY+  IDALVAAWLPGTEG+G++DVLFGDYGFSGKL  TWFKTVDQ
Sbjct  541   CVVIVISGRPVVLQPYISSIDALVAAWLPGTEGKGISDVLFGDYGFSGKLSRTWFKTVDQ  600



>gb|KEH25593.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=622

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/600 (73%), Positives = 512/600 (85%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M KGS FL+G+ LL C V +A A+++ YKD +QP+  RIKDL+ RMTL+EKIGQMVQI+R
Sbjct  1     MAKGSHFLVGLVLLHCLVAMAEAEHLRYKDPKQPLNTRIKDLVDRMTLEEKIGQMVQIDR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VASA VMKKYY+GS+LS GGSVPKP A+A+ WVDM+N FQKG+LSTRLGIPMIYGIDAV
Sbjct  61    SVASADVMKKYYIGSILSGGGSVPKPEATAKDWVDMINEFQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HGNNN Y ATIFPHNVGLGATRDP+LV++IG ATALE RATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGNNNVYKATIFPHNVGLGATRDPQLVKKIGDATALEARATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED +IV++MTE+IPGLQG+ P N+    P+V G +KVAACAKH+VGDGGT KG
Sbjct  181   RCYESYSEDHKIVQSMTELIPGLQGDLPANWSKGVPYVGGSKKVAACAKHFVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+   H+L SIHM  YYNSII+GV+T+M SYSS NG +MHANRD+ITGFLK TLR
Sbjct  241   INENNTVATRHELLSIHMPAYYNSIIKGVSTIMVSYSSWNGEKMHANRDLITGFLKNTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYSI   +NAGIDM+M+P+NYTEFIDGLT LVK+  +
Sbjct  301   FRGFVISDWEGIDRITSPPHANYTYSIEAGVNAGIDMIMIPFNYTEFIDGLTLLVKSNAI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+PL DYSL   LGS++HR+LAR+AVRKSLVLLKNG N
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFENPLADYSLTDQLGSQEHRELAREAVRKSLVLLKNGEN  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD+P+LPL KKA +ILVAG+HADN+GYQCGGWTI+WQGLSG NIT GTTIL+AIKNTVD 
Sbjct  421   ADKPLLPLPKKAPKILVAGSHADNLGYQCGGWTIQWQGLSGNNITSGTTILSAIKNTVDK  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
             +T+V++EENP  ++VKS+ FS+A+VVVGE  YAE +GDS NLTI   G   I NVC   K
Sbjct  481   ETKVVYEENPSLDYVKSNDFSYAVVVVGETPYAETNGDSLNLTISGNGTETINNVCGRVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVL+TGRPV IQPYL +ID LVAAWLPG+EG GVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  541   CVVVLVTGRPVAIQPYLNKIDGLVAAWLPGSEGTGVADVLFGDYGFTGKLARTWFKTVDQ  600



>ref|XP_010054740.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 gb|KCW89890.1| hypothetical protein EUGRSUZ_A02118 [Eucalyptus grandis]
Length=631

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/602 (73%), Positives = 510/602 (85%), Gaps = 1/602 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             +KM +   F++G+ +LCC+  V  A+Y+ YKD +QP+  RI DLLSRM+L+EKIGQM QI
Sbjct  2     KKMARAPIFMVGILVLCCFSGVTRAEYLKYKDPKQPLNTRINDLLSRMSLEEKIGQMTQI  61

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             ER VAS +VMKKYY+GSVLS GGSVP P+ASAE W+DMVN FQ GSLSTRLGIPMIYGID
Sbjct  62    ERSVASFEVMKKYYIGSVLSGGGSVPAPQASAETWIDMVNDFQNGSLSTRLGIPMIYGID  121

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN Y ATIFPHNVGLGATRDP LV+ IGAATALEVRATGI YVFAPCIAVCRDPR
Sbjct  122   AVHGHNNVYRATIFPHNVGLGATRDPALVKRIGAATALEVRATGIPYVFAPCIAVCRDPR  181

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSEDP+IV+AMTEIIPGLQG+ P       P+VAG++ VAAC+KHYVGDGGT 
Sbjct  182   WGRCYESYSEDPKIVQAMTEIIPGLQGDLPAGSRKGVPYVAGKKNVAACSKHYVGDGGTT  241

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
              G++ENNT+ D H L  IHM GYY SII+GV+TVM SYSS NGV+MHAN +++TGFLK  
Sbjct  242   NGVNENNTVTDWHGLLGIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANGNLVTGFLKNK  301

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             LRFRGFVISD++ ID +T   H NY+YSI   I+AGIDMVMVP N+TEFIDGLT+ VKNK
Sbjct  302   LRFRGFVISDWEGIDRITSPPHANYSYSIQAGISAGIDMVMVPSNFTEFIDGLTFQVKNK  361

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAV+RILRVKF MGLFEDPL D SL + LGS++HR+LAR+AVR+SLVLLKNG
Sbjct  362   IIPMSRIDDAVRRILRVKFTMGLFEDPLADTSLVNQLGSQEHRELAREAVRRSLVLLKNG  421

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTV  1640
               AD P+LPL KKA +ILVAG+HADN+GYQCGGWTI+WQGLSG N+T GTTIL+AIKNTV
Sbjct  422   EGADAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIQWQGLSGNNLTSGTTILSAIKNTV  481

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D KT+V++EENPD + VKS KFS+AIVVVGE  YAE  GDSSNLTI +PG S I NVC  
Sbjct  482   DPKTKVVYEENPDTDTVKSGKFSYAIVVVGEHPYAETFGDSSNLTIADPGTSTIGNVCGA  541

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVVV+I+GRPVVIQPY+  +DA+VAAWLPGTEGQGVADVLFGDYGF+GKLP TWFKTV
Sbjct  542   VKCVVVIISGRPVVIQPYVAVMDAIVAAWLPGTEGQGVADVLFGDYGFTGKLPRTWFKTV  601

Query  2001  DQ  2006
             DQ
Sbjct  602   DQ  603



>ref|XP_008464959.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=628

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/600 (74%), Positives = 500/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K   F +G  + C   V A   YM YKD +QP+  RI DLL RMTL+EKIGQMVQI+R
Sbjct  1     MAKILIFFMGFFIFCLTEVWAKPRYMRYKDPKQPLNVRINDLLGRMTLEEKIGQMVQIDR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VAS +VMKKY +GSVLS GGSVP   AS + W+DMVN FQKGSLSTRLGIPMIYGIDAV
Sbjct  61    TVASKEVMKKYLIGSVLSGGGSVPSKEASPKVWIDMVNDFQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLGATRDP L + IGAATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNVGLGATRDPNLAKRIGAATALEVRATGISYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP+IV+ MTEII GLQGE P N     P+VAGREKVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDPKIVQEMTEIISGLQGEIPSNSRKGVPYVAGREKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNTL   H L SIHM GYYNSII+GV+TVM SYSS NG +MH NRD+ITGFLK TLR
Sbjct  241   INENNTLASRHGLLSIHMPGYYNSIIKGVSTVMISYSSWNGKKMHENRDLITGFLKNTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYSI+  I AGIDM+MVPYNYTEFIDGLTYLVK   +
Sbjct  301   FRGFVISDWQGIDRITSPPHANYTYSIIAGITAGIDMIMVPYNYTEFIDGLTYLVKTNVI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKF+MGLFE+PL D S  + LG ++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PISRIDDAVKRILRVKFIMGLFENPLADSSFVNELGKKEHRELAREAVRKSLVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD+P+LPL KK  +ILVAG+HA+N+G+QCGGWTIEWQGL G N+T GTTIL+AIK+TVD 
Sbjct  421   ADKPILPLPKKVPKILVAGSHANNLGFQCGGWTIEWQGLGGNNLTSGTTILSAIKDTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
             KT+V+F+ENPD EFVKS+KFS+AIVVVGE  YAE  GDS NLTIP+PG S I NVC   K
Sbjct  481   KTKVVFKENPDIEFVKSNKFSYAIVVVGEHPYAETFGDSLNLTIPDPGSSTITNVCGVVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV++I+GRPVV+QPY+  IDALVAAWLPGTEG+G++DVLFGDYGFSGKL  TWFKTVDQ
Sbjct  541   CVVIVISGRPVVLQPYISSIDALVAAWLPGTEGKGISDVLFGDYGFSGKLSRTWFKTVDQ  600



>ref|XP_007030059.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOY10561.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=1220

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/578 (76%), Positives = 504/578 (87%), Gaps = 1/578 (0%)
 Frame = +3

Query  276   ADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggs  455
             A+++ YKD +QP+  RIKDL+ RMTL+EKIGQMVQIER VASA+VMKKY++GSVLS GGS
Sbjct  616   AEHVKYKDPKQPLNVRIKDLIGRMTLEEKIGQMVQIERAVASAEVMKKYFIGSVLSGGGS  675

Query  456   vpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATR  635
             VP P+ASA+ W++MVN FQKGSLSTRLGIPMIYGIDAVHG+NN Y ATIFPHN+GLGATR
Sbjct  676   VPAPKASAKTWLNMVNEFQKGSLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNIGLGATR  735

Query  636   DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPG  815
             DP LV++IGAATALEVRATGI Y FAPC+AVCRDPRWGRCYESYSED +IV+AMTEIIPG
Sbjct  736   DPALVKKIGAATALEVRATGIPYAFAPCLAVCRDPRWGRCYESYSEDHKIVQAMTEIIPG  795

Query  816   LQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYY  995
             LQG+ P N     PFVAG++ VAACAKHYVGDGGT +GI+ENNT++D H L SIHM  YY
Sbjct  796   LQGDIPSNSRKGVPFVAGKKNVAACAKHYVGDGGTTRGINENNTVIDRHGLLSIHMPAYY  855

Query  996   NSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGN  1175
             NSII+GV+TVM SYSS NGV+ HAN +M+T FLKKTLRFRGFVISD++ ID +T   H N
Sbjct  856   NSIIKGVSTVMTSYSSWNGVKNHANHEMVTNFLKKTLRFRGFVISDWEGIDRITSPPHAN  915

Query  1176  YTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLF  1355
             YTYSIL SINAG+DM+MVP NY EFIDGLTYLVKNKF+P+SRIDDAVKRILRVKFVMGLF
Sbjct  916   YTYSILASINAGLDMIMVPNNYKEFIDGLTYLVKNKFIPMSRIDDAVKRILRVKFVMGLF  975

Query  1356  EDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHA  1535
             EDPL D SL   LGS++HR+LAR+AVRKSLVLLKNG +AD P+LPL KKA +ILVAG+HA
Sbjct  976   EDPLADDSLVDQLGSQEHRELAREAVRKSLVLLKNGDSADAPLLPLPKKAPKILVAGSHA  1035

Query  1536  DNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSH  1712
             +N+GYQCGGWTIEWQG  G NIT GTTILTAIK TVD KT+V+++E PD EFVKS+ FS+
Sbjct  1036  NNLGYQCGGWTIEWQGQGGNNITDGTTILTAIKKTVDPKTKVVYKEKPDAEFVKSNDFSY  1095

Query  1713  AIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDA  1892
             AIVVVGE  YAE +GDS NLTIPEPGPS I NVC   KCVVV+I+GRPVVIQPY+  IDA
Sbjct  1096  AIVVVGEHPYAETNGDSLNLTIPEPGPSTIGNVCGAVKCVVVVISGRPVVIQPYVRYIDA  1155

Query  1893  LVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +VAAWLPG+EGQGVADVLFGDYGF+GKL FTWFKTVDQ
Sbjct  1156  IVAAWLPGSEGQGVADVLFGDYGFTGKLSFTWFKTVDQ  1193


 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/583 (74%), Positives = 506/583 (87%), Gaps = 1/583 (0%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             FL+G+ L CC+ + A A+YM YKD +Q +  R++DLL RMTL+EKIGQMVQI+R+VASA+
Sbjct  24    FLMGLLLCCCFEISAKAEYMKYKDPKQSLPVRVQDLLDRMTLEEKIGQMVQIDRKVASAE  83

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VMKKY++GS+LS GGSVP P+ASA+AW+DMVN FQKG LSTRLGIPMIYGIDAVHG+NN 
Sbjct  84    VMKKYFIGSLLSGGGSVPAPQASAKAWIDMVNEFQKGCLSTRLGIPMIYGIDAVHGHNNV  143

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             YNATIFPHN+GLGATRDPELV++IGA+TALEVRATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  144   YNATIFPHNIGLGATRDPELVKKIGASTALEVRATGIPYVFAPCIAVCRDPRWGRCYESY  203

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDPE+V AMTEI+PGLQG+ P N P   PFVAG++ VAACAKHYVGDGGT +GI+ENNT
Sbjct  204   SEDPEVVEAMTEIVPGLQGDIPANSPKGVPFVAGQKNVAACAKHYVGDGGTTQGINENNT  263

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             ++D H L SIHM GYY SII+GV+T+M SYSS NG++MHANRD+IT FLK TLRFRGFVI
Sbjct  264   VIDRHGLVSIHMPGYYTSIIKGVSTIMVSYSSWNGIKMHANRDLITDFLKNTLRFRGFVI  323

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             +D++ +D +T   H NY+YSI   I AGIDMVMVP+NYTEFIDGLT+ VKN  +P+SRID
Sbjct  324   TDWEGLDRITSPPHANYSYSIQVGIKAGIDMVMVPFNYTEFIDGLTFQVKNNIIPMSRID  383

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAV RILRVKFVMGLFE+PL DYSL   LGS++HR+LAR+AVR+SLVLLKNG + D P+L
Sbjct  384   DAVMRILRVKFVMGLFENPLADYSLVDQLGSQEHRELAREAVRRSLVLLKNGQSTDHPLL  443

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQGLSG N+T GTTILTA+KNTVD+ T+V++
Sbjct  444   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTSGTTILTAVKNTVDSSTKVVY  503

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             ++NPD EFVKS+ FS+AIVVVGE  YAE  GDS NLTI +PGPS I NVC   KCVV++I
Sbjct  504   KKNPDAEFVKSNDFSYAIVVVGEHPYAETQGDSMNLTIADPGPSTITNVCGAVKCVVIII  563

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGK  1973
             +GRPVVIQP+L  IDALVAAWLPGTEGQGVADVLFGDYGF+ K
Sbjct  564   SGRPVVIQPFLNSIDALVAAWLPGTEGQGVADVLFGDYGFTDK  606



>gb|AEP33579.1| b-1,4-glucanase [Gossypium aridum]
Length=627

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/594 (73%), Positives = 503/594 (85%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FIDGLT+LVKN F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFLVKNNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVR+SLVLLKNG +AD+P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRRLAREAVRRSLVLLKNGHHADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+LI
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILI  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>gb|AEP33563.1| b-1,4-glucanase [Gossypium turneri]
 gb|AEP33571.1| b-1,4-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEP33575.1| b-1,4-glucanase [Gossypium armourianum]
 gb|AEP33576.1| b-1,4-glucanase [Gossypium harknessii]
Length=627

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/594 (73%), Positives = 501/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAG  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM  Y++GSVLS GGS P  +AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNNYFIGSVLSGGGSAPSSQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FIDGLT+LVKN F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFLVKNNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVR+SLVLLKNG +AD+P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRRLAREAVRRSLVLLKNGHHADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+LI
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILI  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>gb|KDP39683.1| hypothetical protein JCGZ_02703 [Jatropha curcas]
Length=625

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/600 (73%), Positives = 507/600 (85%), Gaps = 3/600 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+   FL+G+ALL  W  +A A+YM YKD +QP+  RIKDL+ RMTL+EKIGQM QIER
Sbjct  1     MGRILIFLMGLALL--WGAIAEAEYMKYKDPKQPLNVRIKDLMKRMTLEEKIGQMTQIER  58

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
               ASA+VMKKYY+GSVLS GGSVP  +ASAE W+ MVN FQKGSLSTRLGIPMIYGIDAV
Sbjct  59    SNASAEVMKKYYIGSVLSGGGSVPVKQASAETWIKMVNEFQKGSLSTRLGIPMIYGIDAV  118

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN +NATIFPHN+GLGATRDP+LV+ IGAATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  119   HGHNNVHNATIFPHNIGLGATRDPQLVKRIGAATALEVRATGIPYVFAPCIAVCRDPRWG  178

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RC+ESYSEDP+IV+AMTEI+PGLQG+ P       PFVAG+ KVAACAKHYVGDGGT  G
Sbjct  179   RCFESYSEDPKIVQAMTEIVPGLQGDIPSGSRKGVPFVAGKTKVAACAKHYVGDGGTKDG  238

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             ++ NNT+V  H L SIHM GYY+SII+GV+T+M S S+LNG++MHANR+ I G+LK T+R
Sbjct  239   LNANNTVVSRHGLLSIHMPGYYSSIIKGVSTIMVSQSTLNGIKMHANRNWIIGYLKNTIR  298

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T  +H NYTYSI T I+AGIDM+MVPYNYTEFIDGLT  VK   +
Sbjct  299   FRGFVISDWQGIDWITTPLHANYTYSIQTGISAGIDMIMVPYNYTEFIDGLTDQVKKNII  358

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+P  D SL H LGS +HR+LAR+AVRKSLVLLKNG  
Sbjct  359   PISRIDDAVKRILRVKFVMGLFENPYADESLVHQLGSEEHRELAREAVRKSLVLLKNGKY  418

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             A +P+LPL  K S+ILVAG+HADN+GYQCGGWTIEWQGLSG N+T GTTILTAIK  VD 
Sbjct  419   AGKPLLPLPNKTSKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTTGTTILTAIKKAVDP  478

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V++ ENPD +FVKS+KFS+AIVVVGE  YAE  GDS NLTIP PGP+ I NVC   K
Sbjct  479   STKVVYSENPDADFVKSNKFSYAIVVVGEHPYAETQGDSRNLTIPYPGPNTIKNVCEAVK  538

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV+L++GRPVV+QPY+  IDALVAAWLPGTEGQGVADVLFGDYGF+GKL FTWFKTVDQ
Sbjct  539   CVVILVSGRPVVMQPYMNLIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSFTWFKTVDQ  598



>gb|AEP33577.1| b-1,4-glucanase [Gossypium davidsonii]
 gb|AEP33578.1| b-1,4-glucanase [Gossypium klotzschianum]
Length=627

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/594 (73%), Positives = 501/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FIDGLT+LVKN F+PVSRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFLVKNNFIPVSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF +GLFE+PL D SL   LGS++HR+LAR+AVR+SLVLLKNG  AD+P+L
Sbjct  366   DAVKRILRVKFAVGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVLLKNGHYADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+LI
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILI  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EGQGV DVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSMDALVAAWLPGSEGQGVTDVLFGDYGFSGKLPRTWFKTVDQ  599



>gb|AEP33582.1| b-1,4-glucanase [Gossypium trilobum]
Length=627

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/594 (73%), Positives = 502/594 (85%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FIDGLT+LVKN F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFLVKNNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF +GLFE+PL D SL   LGS++HR+LAR+AVR+SLVLLKNG  AD+P+L
Sbjct  366   DAVKRILRVKFAVGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVLLKNGHYADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKKSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSVDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>ref|XP_006371173.1| hypothetical protein POPTR_0019s05340g [Populus trichocarpa]
 gb|ERP48970.1| hypothetical protein POPTR_0019s05340g [Populus trichocarpa]
Length=626

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/594 (73%), Positives = 501/594 (84%), Gaps = 3/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             FL+G  L+  W  +A A+YM+YKD  +P+  RIKDL+SRMTL+EKIGQM QIER VASA+
Sbjct  7     FLMG--LVVIWAALAEAEYMIYKDATKPLNSRIKDLMSRMTLEEKIGQMTQIERGVASAE  64

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VMK Y++GSVLS GGSVP  +ASAE W++MVN  QKG+LSTRLGIPMIYGIDAVHG+NN 
Sbjct  65    VMKDYFIGSVLSGGGSVPSKQASAETWINMVNELQKGALSTRLGIPMIYGIDAVHGHNNV  124

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHNVGLGATRDP LV+ IGAATALEVRATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  125   YKATIFPHNVGLGATRDPNLVKRIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYESY  184

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP++V+AMTEI+ GLQG+ P N     PFVAG+ KVAACAKHYVGDGGT KGI+ENNT
Sbjct  185   SEDPKLVQAMTEIVSGLQGDIPANSSKGVPFVAGKTKVAACAKHYVGDGGTTKGINENNT  244

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
              +  H L SIHM GYYNSII+GV+TVM SYSS NGV+MHANRDM+TGFLK  LRF+GFVI
Sbjct  245   QISRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGVKMHANRDMVTGFLKNILRFKGFVI  304

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NY+YSI   I+AGIDM+MVP NY EFIDGLT  VKNK +P+SRID
Sbjct  305   SDWEGIDRITSPPHANYSYSIQAGISAGIDMIMVPNNYKEFIDGLTSHVKNKVIPMSRID  364

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAV RILRVKF MGLFE+PL D SL + LGS++HR+LAR+AVRKSLVLLKNG +A EP+L
Sbjct  365   DAVTRILRVKFTMGLFENPLADNSLVNELGSQEHRELAREAVRKSLVLLKNGESAAEPLL  424

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMF  1664
             PL KKA++ILVAG+HADN+GYQCGGWTIEWQGL G N+T GTTILTAIKNTVD  T+V++
Sbjct  425   PLPKKATKILVAGSHADNLGYQCGGWTIEWQGLGGNNLTSGTTILTAIKNTVDPSTEVVY  484

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             +ENPD +FVKS+ FS+AIVVVGE  YAE  GDS NLTI EPGPS I NVC   KCV V+I
Sbjct  485   KENPDADFVKSNNFSYAIVVVGEPPYAETFGDSLNLTISEPGPSTIQNVCGTVKCVTVII  544

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVIQPY+  +DALVAAWLPG+EGQGVAD LFGDYGF+G L  TWFKTVDQ
Sbjct  545   SGRPVVIQPYVSLMDALVAAWLPGSEGQGVADALFGDYGFTGTLSRTWFKTVDQ  598



>gb|AEP33562.1| b-1,4-glucanase [Gossypium schwendimanii]
Length=627

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/594 (73%), Positives = 500/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHLRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FIDGLT+LVKN F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFLVKNNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR AVR+SLVLLKNG  A +P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELARDAVRRSLVLLKNGHYAHQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIKNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>ref|XP_007151483.1| hypothetical protein PHAVU_004G050500g [Phaseolus vulgaris]
 gb|ESW23477.1| hypothetical protein PHAVU_004G050500g [Phaseolus vulgaris]
Length=628

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/600 (73%), Positives = 505/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K S  ++G+ LL CWV +  A Y+ YKD +QP+  RIKDL+ RMTL+EKIGQM QIER
Sbjct  1     MAKLSISVVGIMLLHCWVAINEAKYLKYKDPKQPLNVRIKDLMKRMTLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VASA++MK YY+GSVLS GGSVPK +ASAE W++MVN FQKGSLSTRLGIPMIYGIDAV
Sbjct  61    KVASAEIMKNYYIGSVLSGGGSVPKAQASAEDWINMVNDFQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HGNNN YNATIFPHNVGLGATRDP LVR IGAATALEVRATGIQY FAPCIAVCRDPRWG
Sbjct  121   HGNNNVYNATIFPHNVGLGATRDPGLVRRIGAATALEVRATGIQYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED ++V+AMTEIIPGLQGE P N     PFVAG+ KV A AKHYVGDGGT  G
Sbjct  181   RCYESYSEDHKVVQAMTEIIPGLQGEIPTNSTKGVPFVAGKRKVIASAKHYVGDGGTKNG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++  H L SIHM  YY++II+GV+TVM SYSS NG +MHAN ++IT FLK +LR
Sbjct  241   INENNTVISRHGLLSIHMPAYYDAIIKGVSTVMVSYSSWNGEKMHANHNLITDFLKNSLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYSI  +I AGIDMVMVP NYTEFIDGLT LVK   +
Sbjct  301   FRGFVISDWEGIDRITTPPHANYTYSIYAAITAGIDMVMVPLNYTEFIDGLTSLVKVNAI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRI+DAV+RILRVKF+MGLFE+PL D+SL H LG +KHRKLAR+AVRKSLVLLKNG N
Sbjct  361   PMSRINDAVRRILRVKFIMGLFENPLADHSLVHELGRKKHRKLAREAVRKSLVLLKNGEN  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
              ++P+LPL K+AS+ILVAG+HADN+GYQCGGWTIEWQG++G N+T GTTIL+AIKNTV  
Sbjct  421   PNQPLLPLPKRASKILVAGSHADNLGYQCGGWTIEWQGVTGNNVTKGTTILSAIKNTVHK  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V+++ENPD +F+KS+ FS+ IVVVGEK YAE +GDS NLTI  PGP  I NVC   K
Sbjct  481   DTEVVYKENPDLDFIKSNNFSYGIVVVGEKPYAETNGDSLNLTISAPGPETIKNVCGGVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CV V+I+GRPVVIQPY+ +I+ALVAAWLPGTEG+GV DVLFGDYGF GKLP TWFKTVDQ
Sbjct  541   CVTVIISGRPVVIQPYVDKIEALVAAWLPGTEGKGVTDVLFGDYGFRGKLPRTWFKTVDQ  600



>gb|AEP33560.1| b-1,4-glucanase [Gossypium thurberi]
Length=627

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/594 (73%), Positives = 502/594 (85%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FIDGLT+LVKN F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFLVKNNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF +GLFE+PL D SL   LGS++HR+LAR+AVR+SLVLLKNG  AD+P+L
Sbjct  366   DAVKRILRVKFAVGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVLLKNGHYADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKKSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>gb|KEH25594.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=631

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/600 (73%), Positives = 508/600 (85%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K + FL+G+ LL   V +A A ++ YKD +QP+  RIKDLL RMTL+EKIGQMVQIER
Sbjct  1     MAKSTMFLVGLVLLHYLVAMAEAKHLRYKDSKQPLNTRIKDLLDRMTLEEKIGQMVQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VASA+VM  Y++GSVLS GGSVPKP+A+A+ WVDM+N FQKG+LSTRLGIPMIYGIDAV
Sbjct  61    NVASAEVMNNYFIGSVLSGGGSVPKPKATAKDWVDMINEFQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HGNNN YNATIFPHNVGLGATRDP+LV++IG ATALE RATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGNNNVYNATIFPHNVGLGATRDPQLVKKIGEATALESRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED ++V+AMTEIIPGLQG+ P N+    P+VAG +KVAACAKH+VGDGGT KG
Sbjct  181   RCYESYSEDHKVVQAMTEIIPGLQGDLPANWSNGVPYVAGNKKVAACAKHFVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+E+NT+ + H+LFSIHM  YYNSII+GV TVM SYSS NG +MHANRD+ITGFLK TLR
Sbjct  241   INEDNTVANRHELFSIHMPAYYNSIIKGVLTVMVSYSSWNGEKMHANRDLITGFLKNTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISD++ ID +T   H NYT+SI   +NAGIDM+M+P+NYTEFIDGLT LVK   +
Sbjct  301   FKGFVISDWEGIDRITSPPHANYTFSIEAGVNAGIDMIMIPHNYTEFIDGLTLLVKKNVI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+PL DYSLA  LGS++HR+LAR+AVRKSLVLLKNG N
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFENPLADYSLADQLGSQEHRELAREAVRKSLVLLKNGEN  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
              D+P+LPL KKAS+ILVAG+HADN+GYQCGGWTI+WQG SG NIT GT IL+AIKN VD 
Sbjct  421   VDKPILPLPKKASKILVAGSHADNLGYQCGGWTIQWQGQSGNNITTGTPILSAIKNAVDK  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
             +T+V +EENP  ++VKS+ FS+AIV+VGE  YAE +GDS NLTI   G   I NVC   K
Sbjct  481   ETKVFYEENPSLDYVKSNDFSYAIVIVGETPYAETNGDSLNLTISGHGYETIDNVCSGVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVLITGRP+VIQPYL +I+ LV  WLPG+EG GVADVLFGDYGF+GKLP TWFKTVDQ
Sbjct  541   CVVVLITGRPIVIQPYLEKIEGLVDDWLPGSEGSGVADVLFGDYGFTGKLPRTWFKTVDQ  600



>gb|ABK95015.1| unknown [Populus trichocarpa]
Length=626

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/594 (73%), Positives = 501/594 (84%), Gaps = 3/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             FL+G  L+  W  +A A+YM+YKD  +P+  RIKDL+SRMTL+EKIGQM QIER VASA+
Sbjct  7     FLMG--LVVIWAALAEAEYMIYKDATKPLNSRIKDLMSRMTLEEKIGQMTQIERGVASAE  64

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VMK Y++GSVLS GGSVP  +ASAE W++MVN  QKG+LSTRLGIPMIYGIDAVHG+NN 
Sbjct  65    VMKDYFIGSVLSGGGSVPSKQASAETWINMVNELQKGALSTRLGIPMIYGIDAVHGHNNV  124

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHNVGLGATRDP LV+ IGAATALEVRATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  125   YKATIFPHNVGLGATRDPNLVKRIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYESY  184

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP++V+AMTE++ GLQG+ P N     PFVAG+ KVAACAKHYVGDGGT KGI+ENNT
Sbjct  185   SEDPKLVQAMTEMVSGLQGDIPANSSKGVPFVAGKTKVAACAKHYVGDGGTTKGINENNT  244

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
              +  H L SIHM GYYNSII+GV+TVM SYSS NGV+MHANRDM+TGFLK  LRF+GFVI
Sbjct  245   QISRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGVKMHANRDMVTGFLKNILRFKGFVI  304

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NY+YSI   I+AGIDM+MVP NY EFIDGLT  VKNK +P+SRID
Sbjct  305   SDWEGIDRITSPPHANYSYSIQAGISAGIDMIMVPNNYKEFIDGLTSHVKNKVIPMSRID  364

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAV RILRVKF MGLFE+PL D SL + LGS++HR+LAR+AVRKSLVLLKNG +A EP+L
Sbjct  365   DAVTRILRVKFTMGLFENPLADNSLVNELGSQEHRELAREAVRKSLVLLKNGESAAEPLL  424

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMF  1664
             PL KKA++ILVAG+HADN+GYQCGGWTIEWQGL G N+T GTTILTAIKNTVD  T+V++
Sbjct  425   PLPKKATKILVAGSHADNLGYQCGGWTIEWQGLGGNNLTSGTTILTAIKNTVDPSTEVVY  484

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             +ENPD +FVKS+ FS+AIVVVGE  YAE  GDS NLTI EPGPS I NVC   KCV V+I
Sbjct  485   KENPDADFVKSNNFSYAIVVVGEPPYAETFGDSLNLTISEPGPSTIQNVCGTVKCVTVII  544

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVIQPY+  +DALVAAWLPG+EGQGVAD LFGDYGF+G L  TWFKTVDQ
Sbjct  545   SGRPVVIQPYVSLMDALVAAWLPGSEGQGVADALFGDYGFTGTLSRTWFKTVDQ  598



>ref|XP_011021458.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
Length=626

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/594 (73%), Positives = 501/594 (84%), Gaps = 1/594 (0%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F+  + L+  W  +A A+YM+YKD  + +  RIKDL++RMTL+EKIGQM QIER VASA+
Sbjct  5     FIFLMGLVVIWAALAEAEYMIYKDATKSLNSRIKDLMNRMTLEEKIGQMTQIERGVASAE  64

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VMK Y++GSVLS GGS P  +ASAE W++MVN FQKG+LSTRLGIPMIYGIDAVHG+NN 
Sbjct  65    VMKDYFIGSVLSGGGSAPSKQASAETWINMVNEFQKGALSTRLGIPMIYGIDAVHGHNNV  124

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHNVGLGATRDP LV+ IGAATALEVRATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  125   YKATIFPHNVGLGATRDPNLVKRIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYESY  184

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP++V+AMTE++ GLQG+ P N     PFVAG+ KVAACAKH+VGDGGT KGI+ENNT
Sbjct  185   SEDPKLVQAMTEMVSGLQGDIPANSSKGVPFVAGKTKVAACAKHFVGDGGTTKGINENNT  244

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
              +  H L SIHM GYYNSII+GV+TVM SYSS NGV+MHANRDM+TGFLK  LRFRGFVI
Sbjct  245   QISRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGVKMHANRDMVTGFLKNILRFRGFVI  304

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   HGNY+YSI   I+AGIDM+MVP NY EFIDGLT  VKN+ VP+SRID
Sbjct  305   SDWEGIDRITSPPHGNYSYSIQAGISAGIDMIMVPNNYKEFIDGLTSHVKNEVVPMSRID  364

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL + LGS++HR+LAR+AVRKSLVLLKNG +A EP+L
Sbjct  365   DAVKRILRVKFTMGLFENPLADNSLVNELGSQEHRELAREAVRKSLVLLKNGESAAEPLL  424

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMF  1664
             PL KKA++ILVAG+HADN+GYQCGGWTIEWQG+ G N+T GTTILTAIKNTVD  T+V++
Sbjct  425   PLPKKATKILVAGSHADNLGYQCGGWTIEWQGVGGNNLTSGTTILTAIKNTVDPSTEVVY  484

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             +ENPD +FV+S+ FS+AIVVVGE  YAE  GDS NLTI EPGPS I NVC   KC  V+I
Sbjct  485   KENPDADFVRSNNFSYAIVVVGEPPYAETFGDSLNLTISEPGPSTIQNVCGTVKCATVII  544

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVIQPY+  +DALVAAWLPG+EGQGVADVLFGDYGF+G L  TWFKTVDQ
Sbjct  545   SGRPVVIQPYVSLMDALVAAWLPGSEGQGVADVLFGDYGFTGTLSQTWFKTVDQ  598



>gb|AEP33580.1| b-1,4-glucanase [Gossypium gossypioides]
Length=627

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/594 (73%), Positives = 500/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLRCC---LTKAQYMKYKDPKQAVNVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS  AW++M+N FQKGSL+TR+ IPMIYGID+VHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPGAWINMINDFQKGSLATRMQIPMIYGIDSVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FIDGLT+LVKN F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFLVKNNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVR+SLVLLKNG  AD+P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVLLKNGHYADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>gb|AEP33567.1| b-1,4-glucanase [Gossypium darwinii]
 gb|AEP33581.1| b-1,4-glucanase [Gossypium lobatum]
Length=627

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/594 (73%), Positives = 501/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FIDGLT+LVKN F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFLVKNNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVR+SLVLLKNG  A +P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVLLKNGHYAHQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FV+S+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVESNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DAL+AAWLPG+EGQGVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSMDALIAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>gb|AEP33565.1| b-1,4-glucanase [Gossypium mustelinum]
 gb|AEP33573.1| b-1,4-glucanase [Gossypium barbadense var. peruvianum]
Length=627

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/594 (73%), Positives = 500/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGVPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FIDGLT+LVKN F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFLVKNNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF +GLFE+PL D SL   LGS +HR+LAR+AVR+SLVLLKNG  AD+P+L
Sbjct  366   DAVKRILRVKFAVGLFENPLADNSLVDQLGSEEHRELAREAVRRSLVLLKNGHYADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS A+VVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAVVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFKT DQ
Sbjct  546   SGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKTADQ  599



>gb|AEP33561.1| b-1,4-glucanase [Gossypium laxum]
 gb|AEP33569.1| b-1,4-glucanase [Gossypium tomentosum]
Length=627

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/594 (73%), Positives = 501/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER V+SA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVSSAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FIDGLT+LVKN F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIDGLTFLVKNNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVR+SLVLLKNG  A +P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRRSLVLLKNGHYAHQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FV+S+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVESNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DAL+AAWLPG+EGQGVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSMDALIAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>gb|ADZ16110.1| endo-alpha-1,4-glucanase [Gossypium raimondii]
Length=627

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/594 (73%), Positives = 501/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDMPAKSSKGVPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPY+Y+ FIDGLT+LVKN F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYDYSSFIDGLTFLVKNNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF +GLFE+PL D SL   LG ++HR+LAR+AVR+SLVLLKNG  AD+P+L
Sbjct  366   DAVKRILRVKFAVGLFENPLADNSLVDQLGRQEHRELAREAVRRSLVLLKNGHYADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+LTAIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLTAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>gb|ADZ16108.1| endo-alpha-1,4-glucanase [Gossypium barbadense]
 gb|ADZ16109.1| endo-alpha-1,4-glucanase [Gossypium herbaceum subsp. africanum]
 gb|ADZ16111.1| endo-alpha-1,4-glucanase [Gossypium hirsutum]
 gb|AEP33564.1| b-1,4-glucanase [Gossypium mustelinum]
 gb|AEP33570.1| b-1,4-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEP33572.1| b-1,4-glucanase [Gossypium barbadense var. peruvianum]
Length=627

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/594 (73%), Positives = 500/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FI GLT+LVK+ F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFLVKSNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVRKSLVLLKNG +AD+P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVLLKNGHSADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+L AIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EG GVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSVDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>ref|XP_004489701.1| PREDICTED: lysosomal beta glucosidase-like [Cicer arietinum]
Length=614

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/586 (75%), Positives = 504/586 (86%), Gaps = 6/586 (1%)
 Frame = +3

Query  267   VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlss  446
             +A A+Y+ YKD +QP+  RIKDL+ RM+L+EK+GQMVQI+R VASA VMKKYY+GS+LS 
Sbjct  1     MAEAEYLKYKDPKQPLNTRIKDLVGRMSLEEKVGQMVQIDRTVASADVMKKYYIGSLLSG  60

Query  447   ggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLG  626
             GGSVPKP+ASA+ WVDMVN FQKG+LSTRLGIPMIYGIDAVHG+NN Y ATIFPHN+GLG
Sbjct  61    GGSVPKPQASAKDWVDMVNEFQKGALSTRLGIPMIYGIDAVHGHNNVYKATIFPHNIGLG  120

Query  627   ATR-----DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVR  791
             AT      DP+LV++IG ATALE RATGI YVFAPCIAVCRDPRWGRCYESYSED  +V+
Sbjct  121   ATSIIVLLDPQLVKKIGEATALEARATGIPYVFAPCIAVCRDPRWGRCYESYSEDHTVVQ  180

Query  792   AMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLF  971
             +MTEIIPGLQG+ P N P   PFVAG +KVAACAKH+VGDGGT KGI+ENNT+V  H+L 
Sbjct  181   SMTEIIPGLQGDIPSNSPKGVPFVAGNKKVAACAKHFVGDGGTTKGINENNTVVSRHELL  240

Query  972   SIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDN  1151
             SIHM  YYNSII+GV+T+M SYSS NG +MHANRD+ITGFLK TLRFRGFVISDF+ ID 
Sbjct  241   SIHMPAYYNSIIQGVSTIMVSYSSWNGEKMHANRDLITGFLKNTLRFRGFVISDFQGIDR  300

Query  1152  LTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILR  1331
             +T T H NYTYSI T++NAGIDM+M+PYNYTEFIDG+T+LVKN  +P+SRIDDAVKRILR
Sbjct  301   ITSTPHANYTYSIQTAVNAGIDMIMIPYNYTEFIDGITFLVKNNAIPMSRIDDAVKRILR  360

Query  1332  VKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASR  1511
             VKFVMGLFE+PL DYSL   LGS++HR+LAR+AVRKSLVLLKNG NAD+P+LPL KKAS+
Sbjct  361   VKFVMGLFENPLADYSLVDQLGSQEHRELAREAVRKSLVLLKNGENADKPLLPLPKKASK  420

Query  1512  ILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDPEF  1688
             ILVAG+HADN+GYQCGGWTIEWQGLSGN IT GTTIL+AIKNTVD  T ++++E PD ++
Sbjct  421   ILVAGSHADNLGYQCGGWTIEWQGLSGNHITSGTTILSAIKNTVDKDTDIIYKEYPDLDY  480

Query  1689  VKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQ  1868
             VKS+ FS+AIVVVGEK YAE SGDS NLTI   G   I NVC   KCVVVLITGRPVVIQ
Sbjct  481   VKSNNFSYAIVVVGEKPYAETSGDSLNLTISSHGYDTINNVCAGVKCVVVLITGRPVVIQ  540

Query  1869  PYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             PYL +I+ LVAAWLPG+EG GV DVLFGDYGFSGKL  TWFK+VDQ
Sbjct  541   PYLDKIEGLVAAWLPGSEGHGVTDVLFGDYGFSGKLSRTWFKSVDQ  586



>gb|AEP33574.1| b-1,4-glucanase [Gossypium hirsutum subsp. latifolium]
Length=627

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/594 (73%), Positives = 500/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FI GLT+LVK+ F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFLVKSNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVRKSLVLLKNG +AD+P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVLLKNGHSADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+L AIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EG GVADVLFGDYGFSGKLP TWF+TVDQ
Sbjct  546   SGRPVVIEPDIDSVDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRTWFRTVDQ  599



>gb|AAZ15705.1| endo-alpha-1,4-glucanase [Gossypium hirsutum]
Length=627

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/594 (73%), Positives = 500/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMV+VPYNY+ FI GLT+LVK+ F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVVVPYNYSSFIHGLTFLVKSNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVRKSLVLLKNG +AD+P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVLLKNGHSADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+L AIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EG GVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSVDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>ref|XP_002525724.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF36707.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=625

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/594 (75%), Positives = 512/594 (86%), Gaps = 3/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             FL+G+ LL  W  +A A+YM YKD +QP+  RIKDL+ +MTL+EKIGQM QIER VAS +
Sbjct  7     FLVGLVLL--WGAIAEAEYMRYKDPKQPLNLRIKDLMKKMTLEEKIGQMTQIERSVASTE  64

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VMKKY++GSVLS GGSVP  +ASAE W+ MVN FQKGSLSTRLGIPMIYGIDAVHG+NN 
Sbjct  65    VMKKYFIGSVLSGGGSVPAKQASAETWIKMVNDFQKGSLSTRLGIPMIYGIDAVHGHNNV  124

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             YNATIFPHN+GLGATRDPELV+ IGAATALEVRATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  125   YNATIFPHNIGLGATRDPELVKRIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYESY  184

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP+IV+AMTEI+PGLQG+ P   P   PF+AG+ KVAACAKHYVGDGGT  GI+ENNT
Sbjct  185   SEDPKIVQAMTEIVPGLQGDIPSGSPKGVPFLAGKTKVAACAKHYVGDGGTTDGINENNT  244

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             ++  H L SIHM GYYNSII+GV+TVM SYSS NG++MHANRDM+TGFLK TLRFRGFVI
Sbjct  245   VISRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGIKMHANRDMVTGFLKNTLRFRGFVI  304

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYS+L  I+AGIDM+MVPYNYTEFIDGLTYLVK+  +P+SRID
Sbjct  305   SDWQGIDRITFPPHANYTYSVLAGISAGIDMIMVPYNYTEFIDGLTYLVKSGIIPMSRID  364

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKFVMGLFE+P  D SL + LGS +HR+LAR+AVRKSLVLL+NG  AD+P L
Sbjct  365   DAVKRILRVKFVMGLFENPNADESLVNQLGSHEHRQLAREAVRKSLVLLRNGKYADKPSL  424

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KKAS+ILVAG+HADN+GYQCGGWTIEWQGL GN +T GTTILTAIKNTVD+ T+V++
Sbjct  425   PLPKKASKILVAGSHADNLGYQCGGWTIEWQGLGGNDLTSGTTILTAIKNTVDSSTKVVY  484

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPD +FVK++ FS+AIVVVGE  YAE  GDS NLTI EPGPS I NVC   KCVVV++
Sbjct  485   EENPDADFVKANNFSYAIVVVGEHPYAETQGDSMNLTIAEPGPSTIQNVCGAVKCVVVVV  544

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVIQPY+  IDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  545   SGRPVVIQPYVNIIDALVAAWLPGTEGQGVADVLFGDYGFTGKLSHTWFKTVDQ  598



>ref|XP_010917875.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917876.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=627

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/592 (72%), Positives = 496/592 (84%), Gaps = 0/592 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             L+ V L+ CW ++  A+YM YKD  QPV  R++DL+ RMTL EKIGQM QIERQVASAQV
Sbjct  8     LLSVLLILCWALIGEAEYMKYKDPNQPVNVRVRDLMKRMTLPEKIGQMTQIERQVASAQV  67

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             +K +++GS+LS GGSVPKP+ASAE WV+MVN FQKG LSTRLGIPMIYGIDAVHG+NN Y
Sbjct  68    VKDHFIGSLLSGGGSVPKPQASAEDWVNMVNEFQKGCLSTRLGIPMIYGIDAVHGHNNVY  127

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
             NATIFPHNVGLGATRDP+LV+ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYESYS
Sbjct  128   NATIFPHNVGLGATRDPDLVKRIGAATALEVRATGITYAFAPCIAVCRDPRWGRCYESYS  187

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED +IV+AMTEIIPGLQG+ P NY   FP+VAG+  VAAC+KH+VGDGGT  GIDENNT+
Sbjct  188   EDHKIVQAMTEIIPGLQGDLPVNYSKGFPYVAGKNNVAACSKHFVGDGGTHNGIDENNTI  247

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             +D   LFSIHM  YY+SI +GV+TVM SYSS NG+RMHANR ++TGFLK  L F+GFVIS
Sbjct  248   IDQRGLFSIHMPAYYDSIAKGVSTVMVSYSSWNGLRMHANRGLVTGFLKNKLGFKGFVIS  307

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ ID +T     NYTYS+L  INAGIDMVMVP +YT+FID LT LV NKF+P+SRIDD
Sbjct  308   DWQGIDRITTPPGANYTYSVLAGINAGIDMVMVPNDYTQFIDTLTSLVNNKFIPMSRIDD  367

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV+RILRVKF MGLFE+PL D S    LG ++HR+LAR++VRKSLVLLKNG + ++P+LP
Sbjct  368   AVRRILRVKFTMGLFENPLADLSFVDQLGKKEHRELARESVRKSLVLLKNGKSTNKPLLP  427

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEE  1670
             L KKA +ILVAG+HADN+GYQCGGWTIEWQG SG IT+GTTIL AIK+TVD  T V+F E
Sbjct  428   LPKKAPKILVAGSHADNLGYQCGGWTIEWQGGSGEITVGTTILNAIKSTVDPATNVLFSE  487

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
             NPD  FVKS+ FSHAIVVVGE  Y E  GDS NLTIP+PGP  I  VC   KCVVV+I+G
Sbjct  488   NPDANFVKSNNFSHAIVVVGEHPYTEMYGDSLNLTIPDPGPRTIQTVCGAVKCVVVIISG  547

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RPVVI+PY+  IDALVAAWLPG+EGQG+ADVLFGDYGFSGKLP TWFK+VDQ
Sbjct  548   RPVVIEPYVTLIDALVAAWLPGSEGQGIADVLFGDYGFSGKLPRTWFKSVDQ  599



>gb|AEP33566.1| b-1,4-glucanase [Gossypium darwinii]
Length=627

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/594 (73%), Positives = 499/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FI GLT+LVK+ F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFLVKSNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVRKSLVLLKNG +AD+P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVLLKNGHSADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+L AIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EG GVA VLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSVDALVAAWLPGSEGHGVAYVLFGDYGFSGKLPRTWFKTVDQ  599



>gb|AEP33568.1| b-1,4-glucanase [Gossypium tomentosum]
Length=627

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/594 (72%), Positives = 499/594 (84%), Gaps = 4/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGLGATRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWGRCYESY  185

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  186   SEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  245

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  246   VINWHDLLSIHMPGYYTSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  305

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FI GLT+LVK+ F+P+SRID
Sbjct  306   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFLVKSNFIPMSRID  365

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL    GS++HR+LAR+AVR+SLVLLKNG +AD+P+L
Sbjct  366   DAVKRILRVKFAMGLFENPLADNSLVDQPGSQEHRELAREAVRRSLVLLKNGHSADQPLL  425

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+L AIKNTVD+ T V++
Sbjct  426   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAIKNTVDSSTNVVY  485

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  486   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  545

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EG GVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   SGRPVVIEPDIDSVDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRTWFKTVDQ  599



>gb|KHG06450.1| gluA [Gossypium arboreum]
Length=633

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/600 (72%), Positives = 501/600 (84%), Gaps = 10/600 (2%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATR------DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             Y ATIFPHN+GLGATR      DP+LV++IGAATALE RATGI YVFAPCIAVCRDPRWG
Sbjct  126   YKATIFPHNIGLGATRHYMLLRDPKLVKKIGAATALESRATGIPYVFAPCIAVCRDPRWG  185

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KG
Sbjct  186   RCYESYSEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKG  245

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+++ HDL SIHM GYY+SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LR
Sbjct  246   INENNTVINWHDLLSIHMPGYYSSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLR  305

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FI GLT+LVK+ F+
Sbjct  306   FRGFVISDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFLVKSNFI  365

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVRKSLVLLKNG +
Sbjct  366   PMSRIDDAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVLLKNGHS  425

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
             AD+P+LPL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+L AIKNTVD+
Sbjct  426   ADQPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAIKNTVDS  485

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T V++EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   K
Sbjct  486   STNVVYEENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALK  545

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV+L++GRPVVI+P +  +DALVAAWLPG+EG GVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  546   CVVILMSGRPVVIEPDIDSMDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRTWFKTVDQ  605



>ref|XP_008443733.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=627

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/600 (72%), Positives = 503/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K    LIG+ LLC +   A A+ + YKD +QP+  RIKDLL RMTL+EKIGQM QIER
Sbjct  1     MAKAINILIGLLLLCFFETWAKAENLKYKDPKQPLNVRIKDLLGRMTLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
               AS  VMKKY++GSVLS GGSVP   ASA+ WV MVN  Q+G+LSTRLGIPMIYGIDAV
Sbjct  61    VNASTDVMKKYFIGSVLSGGGSVPSKEASAQDWVQMVNEIQQGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHN+GLGATRDP+L++ IG A+ALE+RATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNIGLGATRDPQLLKRIGEASALEIRATGIPYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESY EDP++V+ MTEIIPGLQGE PPN     P+VAG+EKV ACAKHYVGDGGT KG
Sbjct  181   RCYESYGEDPKLVQEMTEIIPGLQGEIPPNSRKGVPYVAGKEKVVACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT++D H L SIHM GYY+SII+GVATVM SYSS NGV+MHAN++++T FLK TL 
Sbjct  241   IDENNTVIDRHGLLSIHMPGYYHSIIKGVATVMVSYSSWNGVKMHANKELVTDFLKNTLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISD++AID +T   H NYTYSIL S+ AG+DM+MVPYNYTEFIDGLTYLV N F+
Sbjct  301   FQGFVISDWQAIDRITDPPHANYTYSILASVTAGLDMIMVPYNYTEFIDGLTYLVNNNFI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P++RIDDAVKRILRVKF+MGLFE+P+ D SL + LG ++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PITRIDDAVKRILRVKFIMGLFENPIADLSLVNELGKQEHRELAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD+P+LPL KK  +ILVAG+HADN+GYQCGGWTIEWQGLSG N+T GTT+L AIK+TVD 
Sbjct  421   ADKPLLPLEKKTQKILVAGSHADNLGYQCGGWTIEWQGLSGNNLTSGTTVLDAIKDTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V+F ENPD  F++S  FS+AIVVVGE  YAE  GDS NLTIP+PGPS I NVC   K
Sbjct  481   STEVIFNENPDKGFLQSGTFSYAIVVVGEHPYAEMMGDSLNLTIPDPGPSTITNVCGVIK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRPVVIQPY+  +DALVAAWLPGTEG+G+ DVLFGDYGF+GKL  TWFKTVDQ
Sbjct  541   CVVVIISGRPVVIQPYVDSVDALVAAWLPGTEGKGITDVLFGDYGFTGKLSQTWFKTVDQ  600



>ref|XP_006361124.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=628

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/600 (71%), Positives = 504/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S  + G  L C W V+A A+Y+ YKD +QP+  RIKDL+ RMTL+EKIGQM QIER
Sbjct  1     MGRVSIPMKGFVLFCLWAVIAEAEYLKYKDPKQPMVTRIKDLMKRMTLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VA   VMK+Y++GSVLS GGSVP P+ASAE W++MVN  QKG+LSTRLGIPMIYGIDAV
Sbjct  61    KVALPDVMKQYFIGSVLSGGGSVPVPKASAEDWINMVNEIQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHN+GLG TRDP+LV+ IGAATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNIGLGVTRDPDLVKRIGAATALEVRATGIPYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IVR MTEIIPGLQG+ P N     PFV G+ KVAACAKH+VGDGGTV+G
Sbjct  181   RCYESYSEDHNIVRTMTEIIPGLQGDLPANSRKGVPFVDGKSKVAACAKHFVGDGGTVRG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT+++++ LF IHM  YY+SII+GV+TVM SYSS NG RMHANRD++TGFLK  L 
Sbjct  241   IDENNTVINSNGLFGIHMPAYYDSIIKGVSTVMVSYSSWNGERMHANRDLVTGFLKDRLN  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYS+   ++AGIDM+MVP NY EFID LT LVK+  +
Sbjct  301   FRGFVISDWQGIDRITSPPHANYTYSVQAGVSAGIDMIMVPENYNEFIDTLTLLVKDNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKF MGLFE+PL D SL + LGS++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVKRILRVKFTMGLFENPLADLSLVNQLGSQEHRELAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
               +P+LPL KKA +ILVAGTHADN+GYQCGGWTIEWQG++GN +T+GTTIL+AIK TVD 
Sbjct  421   TSQPLLPLPKKAPKILVAGTHADNLGYQCGGWTIEWQGVAGNDLTVGTTILSAIKKTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++++NPD  FVKS++F +AIVVVGE  YAE  GDSSNLTI EPGPS I NVC   K
Sbjct  481   STQVVYQQNPDANFVKSNEFDYAIVVVGEVPYAEMMGDSSNLTITEPGPSTINNVCGAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRPVV++PY+ +IDA+VAAWLPGTEGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  541   CVVVIVSGRPVVLEPYVEKIDAVVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKSVDQ  600



>ref|XP_010266636.1| PREDICTED: lysosomal beta glucosidase-like [Nelumbo nucifera]
Length=665

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/600 (72%), Positives = 497/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+    L+G  LLC WV +A A+Y+ YKD +QP+  R+KDLLSRMTL+EKIGQM QIER
Sbjct  1     MGRFLNPLMGFLLLCSWVAIAEAEYLKYKDPQQPLNVRVKDLLSRMTLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              V+SA+VMK Y++GSVLS GGSVP  RAS E+WV MVN  QKG+LSTRLGIPMIYGIDAV
Sbjct  61    SVSSAKVMKNYFIGSVLSGGGSVPASRASPESWVAMVNDLQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHNVGLG TRDPELV++IGAATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNVGLGVTRDPELVKKIGAATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IV+ MT+IIPGLQGE P N     PFVAG+ KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDHSIVQLMTDIIPGLQGEIPANSQKGVPFVAGKTKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++  + L SIHM  Y +SI +GVAT+M SYSS NG +MHAN D++T +LK  L+
Sbjct  241   INENNTVIGRNGLLSIHMPAYLDSISKGVATIMVSYSSWNGKKMHANWDLVTDYLKNHLQ  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F GFVISD+  ID +T   H NY+YS+  +I+AGIDMVMVPYNYTEF+D LT+ V+NK +
Sbjct  301   FGGFVISDWMGIDRITSPPHANYSYSVQAAISAGIDMVMVPYNYTEFVDDLTFQVQNKII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV RILRVKF MGLFE+PL D +LA  LGS +HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVSRILRVKFTMGLFENPLADLTLADELGSHEHRELAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
             AD+P+LPL KKA +ILVAG+HADN+G QCGGWTI WQGL GN +T GTTIL AIKNTVD 
Sbjct  421   ADKPLLPLPKKAPKILVAGSHADNLGAQCGGWTITWQGLEGNSLTSGTTILGAIKNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++ ENPD  F+KS+KFS+AIVVVGE  Y E  GDS +L IPEPGPS I NVC   K
Sbjct  481   STQVVYSENPDTNFIKSNKFSYAIVVVGEHPYVETFGDSMDLKIPEPGPSTITNVCSSVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             C+VV+I+GRPVVIQPY+  IDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  541   CIVVIISGRPVVIQPYIDSIDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  600



>ref|XP_008777968.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Phoenix 
dactylifera]
Length=660

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/592 (72%), Positives = 493/592 (83%), Gaps = 0/592 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             L+G+  L CW  +  A+YM+YKD  QPV  RI DL+  MTL EKIGQM QIER+VASA+V
Sbjct  9     LLGLLFLFCWASIGKAEYMIYKDRHQPVNVRIDDLMKWMTLAEKIGQMTQIERKVASAKV  68

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             MK Y++GSVLS GGSVP P+ASAE WV+MVN FQKGSLSTRLGIPMIYGIDAVHGNNNAY
Sbjct  69    MKDYFIGSVLSGGGSVPAPQASAEEWVNMVNEFQKGSLSTRLGIPMIYGIDAVHGNNNAY  128

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
              ATIFPHN+GLGATRDPEL ++IG ATALEVRATGIQYVFAPCIAVCRDPRWGRCYES+S
Sbjct  129   KATIFPHNIGLGATRDPELAKKIGEATALEVRATGIQYVFAPCIAVCRDPRWGRCYESFS  188

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED ++VR MTE+IPGLQG+ P NY    P+VAG+ KVAACAKHYVGDGGT  GI+ENNT+
Sbjct  189   EDYQVVRDMTEVIPGLQGDLPANYSKGVPYVAGKNKVAACAKHYVGDGGTHDGINENNTI  248

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             +D+H L S+HM  Y  SII+GV+TVM SYSS NG +MHAN D++TGFLK TL FRGFVIS
Sbjct  249   IDSHGLLSMHMPAYDISIIKGVSTVMVSYSSWNGEKMHANHDLVTGFLKNTLHFRGFVIS  308

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ ID +T     NYTYS+   INAGIDMVMVPYNYT+FI+ LT LV+   +P++RIDD
Sbjct  309   DWQGIDRITTPPGANYTYSVQAGINAGIDMVMVPYNYTDFINDLTSLVQKNIIPMTRIDD  368

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV+RIL VKF MGLFE+PL D SL   LG ++HR LAR+AVRKSLVLLKNG + +E +LP
Sbjct  369   AVRRILLVKFTMGLFENPLSDLSLVDQLGKKEHRVLAREAVRKSLVLLKNGKSINESLLP  428

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEE  1670
             L KKA +ILVAG+HADN+GYQCGGWTIEWQG SGNITIGTTIL AIK+TVD  T +++ E
Sbjct  429   LPKKARKILVAGSHADNLGYQCGGWTIEWQGASGNITIGTTILDAIKSTVDPSTTIIYSE  488

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
             NPD  FVK + FS+AIVVVGE  Y E +GDS NLT+P+PGPS I  VC   KCVVV+I+G
Sbjct  489   NPDASFVKDNDFSYAIVVVGEPPYTETAGDSLNLTLPDPGPSTIQTVCSAVKCVVVIISG  548

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RPVVI+PY+P +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFK+VDQ
Sbjct  549   RPVVIEPYVPLMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKSVDQ  600



>ref|XP_008777967.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Phoenix 
dactylifera]
Length=661

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/592 (72%), Positives = 493/592 (83%), Gaps = 0/592 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             L+G+  L CW  +  A+YM+YKD  QPV  RI DL+  MTL EKIGQM QIER+VASA+V
Sbjct  10    LLGLLFLFCWASIGKAEYMIYKDRHQPVNVRIDDLMKWMTLAEKIGQMTQIERKVASAKV  69

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             MK Y++GSVLS GGSVP P+ASAE WV+MVN FQKGSLSTRLGIPMIYGIDAVHGNNNAY
Sbjct  70    MKDYFIGSVLSGGGSVPAPQASAEEWVNMVNEFQKGSLSTRLGIPMIYGIDAVHGNNNAY  129

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
              ATIFPHN+GLGATRDPEL ++IG ATALEVRATGIQYVFAPCIAVCRDPRWGRCYES+S
Sbjct  130   KATIFPHNIGLGATRDPELAKKIGEATALEVRATGIQYVFAPCIAVCRDPRWGRCYESFS  189

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED ++VR MTE+IPGLQG+ P NY    P+VAG+ KVAACAKHYVGDGGT  GI+ENNT+
Sbjct  190   EDYQVVRDMTEVIPGLQGDLPANYSKGVPYVAGKNKVAACAKHYVGDGGTHDGINENNTI  249

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             +D+H L S+HM  Y  SII+GV+TVM SYSS NG +MHAN D++TGFLK TL FRGFVIS
Sbjct  250   IDSHGLLSMHMPAYDISIIKGVSTVMVSYSSWNGEKMHANHDLVTGFLKNTLHFRGFVIS  309

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ ID +T     NYTYS+   INAGIDMVMVPYNYT+FI+ LT LV+   +P++RIDD
Sbjct  310   DWQGIDRITTPPGANYTYSVQAGINAGIDMVMVPYNYTDFINDLTSLVQKNIIPMTRIDD  369

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV+RIL VKF MGLFE+PL D SL   LG ++HR LAR+AVRKSLVLLKNG + +E +LP
Sbjct  370   AVRRILLVKFTMGLFENPLSDLSLVDQLGKKEHRVLAREAVRKSLVLLKNGKSINESLLP  429

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEE  1670
             L KKA +ILVAG+HADN+GYQCGGWTIEWQG SGNITIGTTIL AIK+TVD  T +++ E
Sbjct  430   LPKKARKILVAGSHADNLGYQCGGWTIEWQGASGNITIGTTILDAIKSTVDPSTTIIYSE  489

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
             NPD  FVK + FS+AIVVVGE  Y E +GDS NLT+P+PGPS I  VC   KCVVV+I+G
Sbjct  490   NPDASFVKDNDFSYAIVVVGEPPYTETAGDSLNLTLPDPGPSTIQTVCSAVKCVVVIISG  549

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RPVVI+PY+P +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFK+VDQ
Sbjct  550   RPVVIEPYVPLMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKSVDQ  601



>ref|XP_006424024.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 ref|XP_006424025.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 gb|ESR37264.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
 gb|ESR37265.1| hypothetical protein CICLE_v10028018mg [Citrus clementina]
Length=628

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/600 (72%), Positives = 499/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S  ++G  LLC    V  A Y+ YKD +QP+G RI+DL+SRMTL EKIGQM QIER
Sbjct  1     MGRFSVPMLGFLLLCFLAAVTEATYIKYKDPKQPLGARIRDLMSRMTLAEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+  VMK++++GSVLS GGSVP P+A+AE WV+MVNG QKG+LSTRLGIPMIYGIDAV
Sbjct  61    AVATPDVMKQFFIGSVLSGGGSVPAPKATAETWVNMVNGLQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDP LV++IG ATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNVGLGVTRDPALVKKIGDATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED +IV+AMTEIIPGLQG+ P N     PFVAG++KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDHKIVQAMTEIIPGLQGDLPANSKKGVPFVAGKKKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+++ + L SIHM  YYNSI +GVATVM SYSS NG +MHAN +++TGFLK  L+
Sbjct  241   INENNTVINLNGLLSIHMPAYYNSISKGVATVMVSYSSWNGKKMHANHELVTGFLKNKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+   ++AGIDMVMVP NY EFID LT  VK   +
Sbjct  301   FRGFVISDWEGIDRITAPPHANYSYSVQAGVSAGIDMVMVPNNYKEFIDDLTDQVKKNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLF+ PL D SL + LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFDSPLADTSLVNELGSQEHRQLAREAVRKSLVLLKNGEA  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
             AD+P++PL KKAS+ILVAG+HADN+GYQCGGWTI WQGL GN +T GTTIL A+ NTVD 
Sbjct  421   ADKPLVPLPKKASKILVAGSHADNLGYQCGGWTITWQGLGGNDLTAGTTILHAVSNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV+F ENPD  FVKS+KFSHAIVVVGE+ YAE  GDS NLTI EPG S I NVC   K
Sbjct  481   TTQVVFNENPDANFVKSNKFSHAIVVVGEQPYAETYGDSLNLTISEPGLSTITNVCGAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRPVVIQPYL QIDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  541   CVVVVISGRPVVIQPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  600



>gb|EPS66822.1| hypothetical protein M569_07948 [Genlisea aurea]
Length=610

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/582 (74%), Positives = 488/582 (84%), Gaps = 0/582 (0%)
 Frame = +3

Query  261   VVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvl  440
             +  ANA+   Y+D  QP+G R+ DLL RMTL+EKIGQM QI+R VAS +VM +Y++GS+L
Sbjct  1     MAAANAERPKYRDPDQPIGARVLDLLDRMTLEEKIGQMTQIDRSVASPEVMNRYFIGSLL  60

Query  441   ssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVG  620
             S GGSVP P+AS EAW+DMVNGFQ GSLSTRLGIPMIYGIDAVHG+NN Y ATIFPHNVG
Sbjct  61    SGGGSVPAPKASPEAWIDMVNGFQNGSLSTRLGIPMIYGIDAVHGHNNVYRATIFPHNVG  120

Query  621   LGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMT  800
             LGATRDPELVR IGAATALEVRATGIQY FAPCIAVCRDPRWGRCYESYSEDP +V+ MT
Sbjct  121   LGATRDPELVRRIGAATALEVRATGIQYAFAPCIAVCRDPRWGRCYESYSEDPAVVKTMT  180

Query  801   EIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIH  980
             EII GLQGE P N     PF+A ++ VAACAKHYVGDGGT +GI+ENNT+   H+L SIH
Sbjct  181   EIINGLQGEIPSNSMKGVPFLASQKHVAACAKHYVGDGGTTEGINENNTVASRHNLLSIH  240

Query  981   MAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTP  1160
             M  Y++SIIRGV+TVM SYSS NGV+MHANRD+ITGFLK T RFRGFVISD++ ID +T 
Sbjct  241   MPAYFDSIIRGVSTVMISYSSWNGVKMHANRDLITGFLKGTQRFRGFVISDWQGIDRITS  300

Query  1161  TVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKF  1340
               H NYTYSILT INAGIDM+MVPYNYTEFIDGLT LVK  F+P+SRIDDAVKRILRVKF
Sbjct  301   PPHLNYTYSILTGINAGIDMIMVPYNYTEFIDGLTELVKANFIPMSRIDDAVKRILRVKF  360

Query  1341  VMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILV  1520
              MGLFE PL DYSL   LGS++HR +AR+AVRKSLVLLKNG +ADEP+LPL K A +ILV
Sbjct  361   TMGLFEHPLADYSLTKQLGSQEHRDIAREAVRKSLVLLKNGESADEPLLPLSKTAPKILV  420

Query  1521  AGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSS  1700
             AGTHADNIGYQCGGWTI WQG SG  T GTTIL  IK  V  +T V+F ENP  ++V+S+
Sbjct  421   AGTHADNIGYQCGGWTITWQGGSGATTEGTTILEGIKKAVSKETAVVFNENPSSDYVRSN  480

Query  1701  KFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLP  1880
              FSHA+VVVGE  YAE  GDS NLTIP PGPSIIA+VC   KCVVVLI+GRP+VI+PY+ 
Sbjct  481   NFSHAVVVVGEFPYAETLGDSLNLTIPSPGPSIIADVCGSVKCVVVLISGRPLVIEPYVS  540

Query  1881  QIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             Q+DALVAAWLPG+EGQGVADVLFGDYGF+GKL  TWF++VDQ
Sbjct  541   QVDALVAAWLPGSEGQGVADVLFGDYGFTGKLSRTWFRSVDQ  582



>ref|XP_010279030.1| PREDICTED: lysosomal beta glucosidase-like [Nelumbo nucifera]
Length=628

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/600 (72%), Positives = 495/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+    L+G+  LC W  +A   Y+ YKD +QP+G RIKDLLSRMTL+EKIGQM QIER
Sbjct  1     MGRVLIPLVGLLFLCSWGAIAEGKYLKYKDPKQPLGARIKDLLSRMTLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+A VMKKY++GSVLS GGSVP  +AS + WV M+N  QKGSLSTRLGIPMIYGIDAV
Sbjct  61    SVATADVMKKYFIGSVLSGGGSVPASQASPQTWVSMMNDLQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y AT+FPHN+GLG TRDPELV++IGAATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATVFPHNIGLGVTRDPELVKKIGAATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED +IV+ MT+IIPGLQGE P N     PFV G+ KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDHKIVQLMTDIIPGLQGEIPANSRKGVPFVGGKTKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++  + LF+IHM  Y NSI +GVAT+M SYSS NG +MHANRD++T +LK  L 
Sbjct  241   INENNTVISRNGLFNIHMPAYLNSISKGVATIMVSYSSWNGKKMHANRDLVTDYLKNHLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD+  ID +T   H NY+YS+   I+AGIDM+MVP N+TEFID LT+ VKN  +
Sbjct  301   FRGFVISDWMGIDRITSPPHANYSYSVQAGISAGIDMIMVPNNFTEFIDILTFQVKNNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV RILRVKF MGLFEDPL D SLA  LGS++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVSRILRVKFTMGLFEDPLADLSLADQLGSQEHRELAREAVRKSLVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD+P+LPL KKAS+ILVAG+HADN+G QCGGWTI WQGL G N+T GTTIL AIKNTVD 
Sbjct  421   ADKPLLPLPKKASKILVAGSHADNLGAQCGGWTITWQGLQGNNLTSGTTILNAIKNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV+++ENPD  FVKS+KFS AIVVVGE  YAE  GDS NL IPEPGPS I NVC   K
Sbjct  481   STQVVYKENPDANFVKSNKFSFAIVVVGEPPYAETFGDSMNLIIPEPGPSTITNVCSSVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV+LI+GRPVVIQPY+  +DALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWF+TVDQ
Sbjct  541   CVVILISGRPVVIQPYIDSMDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFRTVDQ  600



>gb|EYU18175.1| hypothetical protein MIMGU_mgv1a002782mg [Erythranthe guttata]
Length=638

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/602 (71%), Positives = 503/602 (84%), Gaps = 2/602 (0%)
 Frame = +3

Query  207   KMGKGSRFLIGVALLCCWVVVANA-DY-MLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQ  380
             KM K   F++ + + CC +  A+A +Y  LYKD + P+ RRIKDLL+RMTL+EKIGQMVQ
Sbjct  10    KMAKRQSFVVALLVSCCLLAAADAAEYKALYKDPKMPINRRIKDLLARMTLEEKIGQMVQ  69

Query  381   IERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGI  560
             IER VAS  V+ KYY+GSVL  GGS P P+A  E WVDMVN FQ G+LSTRLGIPMIYGI
Sbjct  70    IERTVASRDVINKYYIGSVLGGGGSAPSPKAPPEKWVDMVNNFQNGALSTRLGIPMIYGI  129

Query  561   DAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDP  740
             DAVHG+N  Y AT+FPHN+GLGATRDPELV++IGAATALE+RATGI Y FAPC+AVCRDP
Sbjct  130   DAVHGHNGVYKATVFPHNIGLGATRDPELVKKIGAATALELRATGIPYTFAPCVAVCRDP  189

Query  741   RWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGT  920
             RWGRCYESYSED  +VRAMTEIIPGLQG+ P N     P+++G+EKV ACAKHYVGDGGT
Sbjct  190   RWGRCYESYSEDTSVVRAMTEIIPGLQGDIPANSTKGVPYISGKEKVVACAKHYVGDGGT  249

Query  921   VKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKK  1100
              KGI++N+T++    L SIHM  Y +SI++GVAT+M SYSS NGV+MHANRD+ITG+LK 
Sbjct  250   TKGINQNDTVISNRGLLSIHMPPYNDSIVKGVATIMISYSSFNGVKMHANRDLITGYLKN  309

Query  1101  TLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKN  1280
             TLRFRGFVISDF+ ID++T   H NYTYSIL  + AGIDM+M+PYNYTEFIDGLT+LVK 
Sbjct  310   TLRFRGFVISDFEGIDHITTPPHANYTYSILAGVGAGIDMIMIPYNYTEFIDGLTFLVKK  369

Query  1281  KFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKN  1460
             KF+P+SRIDDAV RILRVKF MGLFE+PL DYS+  +LGS++HR+LAR+AVRKSLVLLKN
Sbjct  370   KFIPMSRIDDAVIRILRVKFTMGLFENPLADYSMTKYLGSQEHRELAREAVRKSLVLLKN  429

Query  1461  GANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTV  1640
             G ++D+P++PL KKAS++LVAGTHAD+IG QCGGWTI+WQG SGNIT GTTIL A+KN V
Sbjct  430   GKSSDKPLIPLPKKASKVLVAGTHADDIGNQCGGWTIQWQGQSGNITFGTTILNAVKNAV  489

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D   +V+F E PD E+VKS++FS+AIVVVGE  YAEG GD+ NLT+PE G S I NVC  
Sbjct  490   DPTMEVVFVEKPDIEYVKSNEFSYAIVVVGESPYAEGYGDNLNLTLPESGYSTITNVCGS  549

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVVVLITGRP+VI PYL QID LVAAWLPGTEGQGVADVLFGDYGFSGKL  TWFK+V
Sbjct  550   VKCVVVLITGRPIVIGPYLGQIDGLVAAWLPGTEGQGVADVLFGDYGFSGKLSRTWFKSV  609

Query  2001  DQ  2006
             DQ
Sbjct  610   DQ  611



>ref|XP_002325849.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEF00231.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=621

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/594 (73%), Positives = 497/594 (84%), Gaps = 8/594 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             FL+G  L+  W  +A A+YM+YKD  +P+  RIKDL+SRMTL+EKIGQM QIER VASA+
Sbjct  7     FLMG--LVVIWAALAEAEYMIYKDATKPLNSRIKDLMSRMTLEEKIGQMTQIERGVASAE  64

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VMK Y++GSVLS GGSVP  +ASAE W++MVN  QKG+LSTRLGIPMIYGIDAVHG+NN 
Sbjct  65    VMKDYFIGSVLSGGGSVPSKQASAETWINMVNELQKGALSTRLGIPMIYGIDAVHGHNNV  124

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHNVGLGATR     + IGAATALEVRATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  125   YKATIFPHNVGLGATR-----QRIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYESY  179

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP++V+AMTEI+ GLQG+ P N     PFVAG+ KVAACAKHYVGDGGT KGI+ENNT
Sbjct  180   SEDPKLVQAMTEIVSGLQGDIPANSSKGVPFVAGKTKVAACAKHYVGDGGTTKGINENNT  239

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
              +  H L SIHM GYYNSII+GV+TVM SYSS NGV+MHANRDM+TGFLK  LRF+GFVI
Sbjct  240   QISRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGVKMHANRDMVTGFLKNILRFKGFVI  299

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NY+YSI   I+AGIDM+MVP NY EFIDGLT  VKNK +P+SRID
Sbjct  300   SDWEGIDRITSPPHANYSYSIQAGISAGIDMIMVPNNYKEFIDGLTSHVKNKVIPMSRID  359

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAV RILRVKF MGLFE+PL D SL + LGS++HR+LAR+AVRKSLVLLKNG +A EP+L
Sbjct  360   DAVTRILRVKFTMGLFENPLADNSLVNELGSQEHRELAREAVRKSLVLLKNGESAAEPLL  419

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMF  1664
             PL KKA++ILVAG+HADN+GYQCGGWTIEWQGL G N+T GTTILTAIKNTVD  T+V++
Sbjct  420   PLPKKATKILVAGSHADNLGYQCGGWTIEWQGLGGNNLTSGTTILTAIKNTVDPSTEVVY  479

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             +ENPD +FVKS+ FS+AIVVVGE  YAE  GDS NLTI EPGPS I NVC   KCV V+I
Sbjct  480   KENPDADFVKSNNFSYAIVVVGEPPYAETFGDSLNLTISEPGPSTIQNVCGTVKCVTVII  539

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVIQPY+  +DALVAAWLPG+EGQGVAD LFGDYGF+G L  TWFKTVDQ
Sbjct  540   SGRPVVIQPYVSLMDALVAAWLPGSEGQGVADALFGDYGFTGTLSRTWFKTVDQ  593



>gb|KDO54375.1| hypothetical protein CISIN_1g006872mg [Citrus sinensis]
Length=628

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/600 (72%), Positives = 499/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S  ++G  LLC    V  A Y+ YKD +QP+G RI+DL+SRMTL EKIGQM QIER
Sbjct  1     MGRFSVPMLGFLLLCFLAAVTEATYIKYKDPKQPLGARIRDLMSRMTLAEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+  VMK++++GSVLS GGSVP P+A+AE WV+MVNG QKG+LSTRLGIPMIYGIDAV
Sbjct  61    AVATPDVMKQFFIGSVLSGGGSVPAPKATAETWVNMVNGLQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDP LV++IG ATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNVGLGVTRDPALVKKIGDATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED +IV+AMTEIIPGLQG+ P N     PFVAG++KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDHKIVQAMTEIIPGLQGDLPANSKKGVPFVAGKKKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+++ + L SIHM  YYNSI +GVATVM SYSS NG +MHAN +++TGFLK  L+
Sbjct  241   INENNTVINLNGLLSIHMPAYYNSISKGVATVMVSYSSWNGKKMHANHELVTGFLKNKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+   ++AGIDMVMVP NY EFID LT  VK   +
Sbjct  301   FRGFVISDWEGIDRITAPPHANYSYSVQAGVSAGIDMVMVPNNYKEFIDDLTDQVKKNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLF+ PL D SL + LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFDSPLADTSLVNELGSQEHRELAREAVRKSLVLLKNGEA  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
             AD+P+LPL KKAS+ILVAG+HADN+GYQCGGWTI WQGL GN +T G+TIL A+ NTVD 
Sbjct  421   ADKPLLPLPKKASKILVAGSHADNLGYQCGGWTITWQGLGGNDLTAGSTILHAVSNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV+F ENPD  FVKS+KFS+AIVVVGE+ YAE  GDS NLTI EPG S I NVC   K
Sbjct  481   TTQVVFNENPDANFVKSNKFSYAIVVVGEQPYAETYGDSLNLTISEPGLSTITNVCGAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRPVVIQPYL QIDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  541   CVVVVISGRPVVIQPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  600



>ref|XP_006487803.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487804.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Citrus 
sinensis]
Length=628

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/600 (72%), Positives = 499/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S  ++G  LLC    V  A Y+ YKD +QP+G RI+DL+SRMTL EKIGQM QIER
Sbjct  1     MGRFSVPMLGFLLLCFLAAVTEATYIKYKDPKQPLGARIRDLMSRMTLAEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+  VMK++++GSVLS GGSVP P+A+AE WV+MVNG QKG+LSTRLGIPMIYGIDAV
Sbjct  61    AVATPDVMKQFFIGSVLSGGGSVPAPKATAETWVNMVNGLQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDP LV++IG ATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNVGLGVTRDPALVKKIGDATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED +IV+AMTEIIPGLQG+ P N     PFVAG++KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDHKIVQAMTEIIPGLQGDLPANSKKGVPFVAGKKKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+++ + L SIHM  YYNSI +GVATVM SYSS NG +MHAN +++TGFLK  L+
Sbjct  241   INENNTVINLNGLLSIHMPAYYNSISKGVATVMVSYSSWNGKKMHANHELVTGFLKNKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+   ++AGIDMVMVP NY EFID LT  VK   +
Sbjct  301   FRGFVISDWEGIDRITAPPHANYSYSVQAGVSAGIDMVMVPNNYKEFIDDLTDQVKKNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLF+ PL D SL + LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFDSPLADTSLVNQLGSQEHRELAREAVRKSLVLLKNGEA  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
             AD+P+LPL KKAS+ILVAG+HADN+GYQCGGWTI WQGL GN +T G+TIL A+ NTVD 
Sbjct  421   ADKPLLPLPKKASKILVAGSHADNLGYQCGGWTITWQGLGGNDLTAGSTILHAVSNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV+F ENPD  FVKS+KFS+AIVVVGE+ YAE  GDS NLTI EPG S I NVC   K
Sbjct  481   TTQVVFNENPDANFVKSNKFSYAIVVVGEQPYAETYGDSLNLTISEPGLSTITNVCGAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRPVVIQPYL QIDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  541   CVVVVISGRPVVIQPYLAQIDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  600



>emb|CDP15624.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/596 (72%), Positives = 501/596 (84%), Gaps = 5/596 (1%)
 Frame = +3

Query  231   LIGVA-LLCCW--VVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVAS  401
             L+G A LLC W   V   A Y+ YKD +QP+  RIKDL+SRMTL+EKIGQM QIER++AS
Sbjct  8     LMGFAVLLCLWSAAVAEGAAYLKYKDPKQPISARIKDLMSRMTLEEKIGQMTQIERKLAS  67

Query  402   AQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNN  581
             + +MKKY++GSVLS GGSVP P ASAE W++MVN FQKGSLSTRLGIPMIYGIDAVHG+N
Sbjct  68    SDIMKKYFVGSVLSGGGSVPAPMASAETWINMVNEFQKGSLSTRLGIPMIYGIDAVHGHN  127

Query  582   NAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYE  761
             N YNATIFPHNVGLG TRDP+L++ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYE
Sbjct  128   NVYNATIFPHNVGLGVTRDPQLLKRIGAATALEVRATGIPYTFAPCIAVCRDPRWGRCYE  187

Query  762   SYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDEN  941
             SYSED  IV+AMTEIIPGLQG+AP   P   PFVAG+ KVAACAKH+VGDGGTVKGIDEN
Sbjct  188   SYSEDHRIVQAMTEIIPGLQGDAPAGTPKGVPFVAGKTKVAACAKHFVGDGGTVKGIDEN  247

Query  942   NTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGF  1121
             NT++D   L SIHM  Y++++ +GVATVM SYSS NG RMHAN D++TGFLK  L+FRGF
Sbjct  248   NTVIDYKGLLSIHMPAYFDAVRKGVATVMVSYSSWNGKRMHANHDLVTGFLKDKLKFRGF  307

Query  1122  VISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSR  1301
             VISD++ ID +T   H NY YS+   + AGIDMVM+P N+TEFID LT LVK   +P+SR
Sbjct  308   VISDWQGIDRITDPPHSNYVYSVQAGVLAGIDMVMLPENFTEFIDDLTSLVKKNVIPMSR  367

Query  1302  IDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEP  1481
             IDDAVKRILRVKF MGLFE+PL D SL + LGS++HR+LAR+AVRKSLVLLKNG + ++P
Sbjct  368   IDDAVKRILRVKFTMGLFENPLADLSLVNQLGSQEHRELAREAVRKSLVLLKNGID-NQP  426

Query  1482  VLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQV  1658
             +LPL KK+ +ILVAG+HA+N+GYQCGGWTIEWQG  GN +T+GTTILTAIKNTVD  TQV
Sbjct  427   LLPLPKKSPKILVAGSHANNLGYQCGGWTIEWQGHGGNDLTVGTTILTAIKNTVDPSTQV  486

Query  1659  MFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVV  1838
             +++ENPD  FVKS+ FSHAIVVVGE  YAEG+GDS NLTIPEPGPS I NVC   KCVVV
Sbjct  487   IYDENPDANFVKSNSFSHAIVVVGETPYAEGAGDSLNLTIPEPGPSTIKNVCGSVKCVVV  546

Query  1839  LITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +I+GRPVV++PYL  I ALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  547   IISGRPVVVEPYLSSISALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKSVDQ  602



>gb|KDP39682.1| hypothetical protein JCGZ_02702 [Jatropha curcas]
Length=644

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/619 (70%), Positives = 506/619 (82%), Gaps = 22/619 (4%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+   FL+G+AL      +A A+Y+ YKD +QP+  RIKDL+ RMTL+EKIGQM QIER
Sbjct  1     MGRIPIFLMGLALFLG--AMAEAEYVKYKDPKQPLNVRIKDLMKRMTLEEKIGQMTQIER  58

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VAS +VM+KY++GSVLS GGSVP  +ASAE W+ MVN FQKGSLSTRLGIPMIYGIDAV
Sbjct  59    SVASTEVMEKYHIGSVLSGGGSVPVKQASAETWIKMVNEFQKGSLSTRLGIPMIYGIDAV  118

Query  570   HGNNNAYNATIFPHNVGLGATR-------------DPELVREIGAATALEVRATGIQYVF  710
             HG+NN Y ATIFPHN+GLGATR             DPELV+ IGAATALEVRATGI YVF
Sbjct  119   HGHNNVYKATIFPHNIGLGATRQIFLMKISFLLTRDPELVKRIGAATALEVRATGIPYVF  178

Query  711   APCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAAC  890
             APCIAVCRDPRWGRCYESYSEDP++V++MTEIIPGLQG+ P   P   PFVA + KVAAC
Sbjct  179   APCIAVCRDPRWGRCYESYSEDPKVVQSMTEIIPGLQGDIPSGSPKGVPFVADKTKVAAC  238

Query  891   AKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHAN  1070
             AKHYVGDGGT  GI+E+NT+   H L SIHM GYYNSII+GV+TVM SYSS NG++MH N
Sbjct  239   AKHYVGDGGTTNGINEDNTVTSRHGLLSIHMPGYYNSIIKGVSTVMVSYSSWNGIKMHTN  298

Query  1071  RDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDM------VMVP  1232
              ++ITGFLKKTLRFRGFVISD++ ID +T   H NYTYSI   I+AGIDM      +MVP
Sbjct  299   GELITGFLKKTLRFRGFVISDWQGIDRITSPPHANYTYSIQAGISAGIDMASPILQIMVP  358

Query  1233  YNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHR  1412
             +NYTEFIDGLT  VK   +P+SRIDDAVKRILRVKF MGLFE+P  D SL + LGS++HR
Sbjct  359   FNYTEFIDGLTDQVKKNIIPMSRIDDAVKRILRVKFTMGLFENPYADESLVNQLGSQEHR  418

Query  1413  KLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG  1592
             +LAR+AVRKSLVLLKNG NA+EP+LPL KK+S+ILVAG+HADN+GYQCGGWTIEWQGLSG
Sbjct  419   ELAREAVRKSLVLLKNGKNANEPLLPLPKKSSKILVAGSHADNLGYQCGGWTIEWQGLSG  478

Query  1593  NI-TIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSN  1769
             N  T GTTILTAIKNTVD  T++++ ENPD +FVKS+KFS+AIVVVGE  YAE  GDS N
Sbjct  479   NNHTSGTTILTAIKNTVDPSTKIVYNENPDADFVKSNKFSYAIVVVGEHPYAETQGDSMN  538

Query  1770  LTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLF  1949
             LT+  PGPS I NVC   KCVV++++GRPVV+QPY+  I+ALVAAWLPGTEGQGVADVLF
Sbjct  539   LTLSNPGPSTIQNVCGAVKCVVIVVSGRPVVMQPYVNSIEALVAAWLPGTEGQGVADVLF  598

Query  1950  GDYGFSGKLPFTWFKTVDQ  2006
             GDYGF+GKL  TWFK+VDQ
Sbjct  599   GDYGFTGKLSRTWFKSVDQ  617



>ref|XP_010908052.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=660

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/593 (72%), Positives = 490/593 (83%), Gaps = 0/593 (0%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
              L+G+  L C   +A A+Y++YKD  QPV  RI DL+ RMTL EKIGQM QIER+VASA+
Sbjct  8     LLLGLVFLFCCASIAKAEYVIYKDPNQPVNARIDDLVKRMTLAEKIGQMTQIERKVASAK  67

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VMK Y++GSVLS GGSVP  +ASAE WV+MVN FQKGSLSTRLGIPMIYGIDAVHGNNN 
Sbjct  68    VMKDYFIGSVLSGGGSVPASQASAEDWVNMVNEFQKGSLSTRLGIPMIYGIDAVHGNNNV  127

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GLGATRDPELV++IG ATALEVRATGIQY FAPCIAVCRDPRWGRCYES+
Sbjct  128   YGATIFPHNIGLGATRDPELVKKIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCYESF  187

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SED  IVR MTEIIPGLQG+ P NY    P+VAG+ KVAACAKHYVGDGGT  GI+ENNT
Sbjct  188   SEDYHIVREMTEIIPGLQGDLPANYSKGVPYVAGKNKVAACAKHYVGDGGTHDGINENNT  247

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             ++D H L SIHM  Y  SII+GV+TVM SYSS NG +MHAN D++TGFLK TL FRGFVI
Sbjct  248   VIDYHGLLSIHMPAYDISIIKGVSTVMVSYSSWNGAKMHANHDLVTGFLKNTLHFRGFVI  307

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T     NYTYS+   INAGIDMVMVPYNYT+FI+ LT LV    +P+SRID
Sbjct  308   SDWQGIDRITTPPGANYTYSVQAGINAGIDMVMVPYNYTDFINDLTSLVHKNIIPMSRID  367

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAV+RIL VKF MGLFE+PL D SL   LG ++HR+LAR+AVRKSLVLLKNG + +E +L
Sbjct  368   DAVRRILLVKFTMGLFENPLADLSLVDQLGKKEHRELAREAVRKSLVLLKNGKSINESLL  427

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFE  1667
             PL KKA +ILVAG+HADN+GYQCGGWTIEWQG SGNIT+GTTIL AIK+TVD  T +++ 
Sbjct  428   PLPKKARKILVAGSHADNLGYQCGGWTIEWQGDSGNITVGTTILDAIKSTVDPSTTIIYS  487

Query  1668  ENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLIT  1847
             ENPD   VK++ FSHAIVVVGE  Y E +GDS NLT+P+PGPS +  VC   KCVVV+I+
Sbjct  488   ENPDASSVKNNDFSHAIVVVGEPPYTETAGDSLNLTLPDPGPSTVQTVCGSVKCVVVVIS  547

Query  1848  GRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             GRPVVI+PY+P +DALVAAWLPG+EGQGVADVLFGDYGFSGKLP TWFK+VDQ
Sbjct  548   GRPVVIEPYVPLMDALVAAWLPGSEGQGVADVLFGDYGFSGKLPRTWFKSVDQ  600



>ref|XP_002278363.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
 ref|XP_010651642.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
 ref|XP_010651643.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=628

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/600 (72%), Positives = 506/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K S  L+G+ LLC W  V  A Y+ YKD +QP+G RIKDL++RMTL+EKIGQMVQIER
Sbjct  1     MVKFSMPLMGLMLLCLWATVTEAKYIKYKDPKQPLGVRIKDLMARMTLQEKIGQMVQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + ASA +MKKY++GS+LS GGSVP  RAS E WV +VN FQKGSLSTRLGIPMIYGIDAV
Sbjct  61    EAASADIMKKYFIGSILSGGGSVPAKRASPETWVSVVNEFQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNAT+FPHNVGLGATRDPELV++IGAATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATVFPHNVGLGATRDPELVKKIGAATALEVRATGIPYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED +IV+AMTEIIPGLQG+ P       PFV G+ KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDHKIVQAMTEIIPGLQGDLPAGSKKGVPFVGGKTKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++D + L +IHM  Y NSI +GVATVM SYSS NG +MHAN D+I GFLK  LR
Sbjct  241   INENNTIIDFNGLLNIHMPAYRNSISKGVATVMVSYSSWNGKKMHANHDLIIGFLKNKLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+   + AGIDMVMVPYN+TEF+D LT+ VKN  +
Sbjct  301   FRGFVISDWQGIDRITSPPHANYSYSVEAGVGAGIDMVMVPYNFTEFLDDLTFQVKNGII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P++RIDDAVKRILRVKFVMGLFE+P+ D SL + LGS++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMARIDDAVKRILRVKFVMGLFENPMADLSLVNQLGSQEHRELAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
             A  P+LPL KKA +ILVAG+HADN+GYQCGGWTIEWQGL GN +T GTTILTA+KNTV++
Sbjct  421   AKNPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGLGGNDLTSGTTILTAVKNTVES  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQ+++ ENPD E+VKS+KFS+AIVVVGE  YAE +GDS +LTI EPG S I+NVC   K
Sbjct  481   GTQIVYNENPDLEYVKSNKFSYAIVVVGEPPYAETAGDSMSLTIAEPGASTISNVCAAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRPVVIQPYL +IDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTV+Q
Sbjct  541   CVVVIVSGRPVVIQPYLAKIDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVEQ  600



>gb|KEH25595.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=641

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/601 (71%), Positives = 505/601 (84%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLI-GVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M KG+  L+ G+ L  CWV +A A+++ YKD +QP+  RIKDL+ RMTL+EKIGQMVQIE
Sbjct  1     MVKGAISLVAGLVLFHCWVAMAEAEHLRYKDSKQPLNTRIKDLIDRMTLEEKIGQMVQIE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VASA+VM KY++GSVLS GGSVPKP+A+A+ WVDM+N FQKG+LSTRLGIPMIYGIDA
Sbjct  61    RGVASAEVMNKYFIGSVLSGGGSVPKPKATAKDWVDMINEFQKGALSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHGNNN YNATIFPHNVGLGATRDP+LV++IG ATALE RATGI YVFAP IAVCRDPRW
Sbjct  121   VHGNNNVYNATIFPHNVGLGATRDPQLVKKIGEATALESRATGIPYVFAPSIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSED +IV+AMTE+IPGLQG+ P N+    P+V G +KVAACAKH+VGDGGT +
Sbjct  181   GRCYESYSEDHKIVQAMTELIPGLQGDLPANWSNGVPYVVGNKKVAACAKHFVGDGGTTE  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+E+NT+   H+LFSIHM  YYNSI + V T+M SYSS NG +MH+NRD++TGFLK TL
Sbjct  241   GINEDNTVATRHELFSIHMQAYYNSITKVVLTIMVSYSSWNGEKMHSNRDLVTGFLKNTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              FRGFVISD+K ID +T   H NYT+SI   +NAGIDM+M+P+NYTEFIDGLT LVK   
Sbjct  301   HFRGFVISDWKGIDRITSPPHANYTFSIEAGVNAGIDMIMIPFNYTEFIDGLTLLVKKNV  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAVKRILRVKFVMGLFE+PL DYSLA  +GS +HR+LAR+AVRKSLVLLKNG 
Sbjct  361   IPMSRIDDAVKRILRVKFVMGLFENPLADYSLADQIGSPEHRELAREAVRKSLVLLKNGE  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
             N D+P+LPL KK+S+ILVAG+HADN+GYQCGGWTI+WQG SG NIT GT IL+AIK+ VD
Sbjct  421   NVDKPILPLPKKSSKILVAGSHADNLGYQCGGWTIQWQGQSGNNITTGTPILSAIKHAVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
              +T+V++EENP  ++VK + FS+AIVVVGE  YAE +GDS NLTI   G   I NVC   
Sbjct  481   KETKVVYEENPSLDYVKFNDFSYAIVVVGETPYAETNGDSLNLTISGHGYETIDNVCSGV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVVLITGRP+VIQPYL +I+ LV AWLPG+EG GVADVLFGDYGF+GKLP TWFKTVD
Sbjct  541   KCVVVLITGRPIVIQPYLEKIEGLVVAWLPGSEGSGVADVLFGDYGFTGKLPRTWFKTVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>gb|EYU25636.1| hypothetical protein MIMGU_mgv1a002814mg [Erythranthe guttata]
Length=635

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/595 (72%), Positives = 499/595 (84%), Gaps = 2/595 (0%)
 Frame = +3

Query  228   FLIGVALLCCW-VVVANAD-YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVAS  401
              LIGV +  C+   +ANA+ YM YKD +QP+ +RI+DL+ RMTL+EKIGQM QIER VA+
Sbjct  13    LLIGVIVAVCYSTAIANAEEYMKYKDPKQPINKRIRDLMERMTLEEKIGQMTQIERTVAA  72

Query  402   AQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNN  581
               V+KKY +GS+LS GGSVP   ASAE W+DMVN FQK +L  RLGIPMIY IDAVHGNN
Sbjct  73    DHVLKKYSIGSILSGGGSVPASHASAETWIDMVNHFQKNALMQRLGIPMIYAIDAVHGNN  132

Query  582   NAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYE  761
             N Y ATIFPHNVGLGATRDPELV+ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYE
Sbjct  133   NVYKATIFPHNVGLGATRDPELVKRIGAATALEVRATGIPYAFAPCIAVCRDPRWGRCYE  192

Query  762   SYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDEN  941
             SYSEDP++VR+MTEIIPGLQG+ P   P   P+V G +KV ACAKHYVGDGGTVKGI+EN
Sbjct  193   SYSEDPKVVRSMTEIIPGLQGDIPAGSPKGVPYVGGPDKVMACAKHYVGDGGTVKGINEN  252

Query  942   NTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGF  1121
             NT+   H+L  IHM  YY+S+I+GV+TVM SYSS NGV+MHANRD+ITGFLKK  RFRGF
Sbjct  253   NTIASWHELLGIHMPAYYDSVIKGVSTVMVSYSSWNGVKMHANRDLITGFLKKAQRFRGF  312

Query  1122  VISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSR  1301
             VI+D++AID +T   H NYTYSI TSINAGIDMVMVPYNYTEFIDGLTYLV N FV +SR
Sbjct  313   VITDWQAIDKMTTPPHANYTYSIETSINAGIDMVMVPYNYTEFIDGLTYLVNNNFVSMSR  372

Query  1302  IDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEP  1481
             IDDAVKRILRVKF MGLFE+P+ DYS+A HLGS+++R++AR+AVRKSLVLLKNG + D+P
Sbjct  373   IDDAVKRILRVKFTMGLFENPMADYSMAKHLGSQENREVAREAVRKSLVLLKNGKSGDKP  432

Query  1482  VLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVM  1661
             +LPL KKASRILVAGTHA++IG QCGGWTIEW G SGN T GTTIL+A++N VD +T V 
Sbjct  433   LLPLPKKASRILVAGTHANDIGNQCGGWTIEWHGKSGNTTAGTTILSAVRNAVDPETTVS  492

Query  1662  FEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVL  1841
             F  +PDPEFVKS KF +A+VVVGE  Y+E  GD+ NLT+P+PG  II NVC   KCVVVL
Sbjct  493   FRVDPDPEFVKSGKFEYAVVVVGEVPYSETYGDNLNLTLPDPGYGIINNVCSSVKCVVVL  552

Query  1842  ITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +TGRPVVI+PYL  +DA+VAAWLPG+EGQGVADVLFGDYGF+GKLP TWFK VDQ
Sbjct  553   VTGRPVVIEPYLGGMDAVVAAWLPGSEGQGVADVLFGDYGFTGKLPITWFKNVDQ  607



>ref|XP_006379343.1| hypothetical protein POPTR_0009s15590g [Populus trichocarpa]
 gb|ERP57140.1| hypothetical protein POPTR_0009s15590g [Populus trichocarpa]
Length=629

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/602 (71%), Positives = 500/602 (83%), Gaps = 3/602 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ SR ++G  LLCC +V   A+Y+ YKD + P+G RIKDL+ RMTL+EKIGQMVQIER
Sbjct  1     MGRLSRPILGFLLLCCLIVAGEAEYLKYKDPKMPIGARIKDLMKRMTLEEKIGQMVQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+  VMK+Y++GSVLS GGSVP P+ASAEAWV++VNG QK SLSTRLGIPMIYGIDAV
Sbjct  61    TVATPDVMKQYFIGSVLSGGGSVPGPKASAEAWVNLVNGIQKASLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG++N YNATIFPHNVGLG TRDP+LV++IG ATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHSNVYNATIFPHNVGLGVTRDPQLVKKIGEATALEVRATGIPYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVA-GREKVAACAKHYVGDGGTVK  926
             RCYESYSED  IV+ MTEIIPGLQGE P N     PFVA G  KVAACAKH+VGDGGT K
Sbjct  181   RCYESYSEDHRIVQLMTEIIPGLQGELPANSKKGVPFVAPGNTKVAACAKHFVGDGGTTK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GIDENNT++  + L +IHM  YYN+I +GVATVM SYSS NG RMH NRD++TGFLK  +
Sbjct  241   GIDENNTVISMNGLLNIHMPAYYNAISKGVATVMVSYSSWNGKRMHINRDLVTGFLKNKM  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +FRGFVISD++ ID +T   H NY+ S+   ++AGIDM+MVP+N+TEFID LTY VKN  
Sbjct  301   KFRGFVISDWQGIDRVTSPPHANYSSSVHAGVDAGIDMIMVPFNFTEFIDDLTYQVKNNI  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRI+DAV+RILRVKFVMGLFE PL D S+A+ LGS++HR+LAR+AVRKSLVLLKNG 
Sbjct  361   IPMSRINDAVQRILRVKFVMGLFEKPLADLSMANQLGSQEHRELAREAVRKSLVLLKNGK  420

Query  1467  -NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTV  1640
              +  +P LPL KKA +IL+AG+HADN+GYQCGGWTI WQGL GN +T GTTIL A+KNTV
Sbjct  421   YSTAKPFLPLPKKAPKILIAGSHADNLGYQCGGWTITWQGLGGNDLTTGTTILNAVKNTV  480

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  TQV++ ENPD  FVKS+KFS+AIVVVGE  YAE  GDSSNLTI EPGPS I NVC  
Sbjct  481   DPTTQVVYNENPDSNFVKSNKFSYAIVVVGEPPYAEMYGDSSNLTISEPGPSTINNVCGA  540

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVV++I+GRPVVIQPYL +IDALVAAWLPGTEGQGV D LFGDYGF+GKL  TWFKTV
Sbjct  541   VKCVVIVISGRPVVIQPYLEKIDALVAAWLPGTEGQGVVDNLFGDYGFTGKLARTWFKTV  600

Query  2001  DQ  2006
             DQ
Sbjct  601   DQ  602



>gb|KEH25596.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=685

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/601 (71%), Positives = 505/601 (84%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLI-GVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M KG+  L+ G+ L  CWV +A A+++ YKD +QP+  RIKDL+ RMTL+EKIGQMVQIE
Sbjct  1     MVKGAISLVAGLVLFHCWVAMAEAEHLRYKDSKQPLNTRIKDLIDRMTLEEKIGQMVQIE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VASA+VM KY++GSVLS GGSVPKP+A+A+ WVDM+N FQKG+LSTRLGIPMIYGIDA
Sbjct  61    RGVASAEVMNKYFIGSVLSGGGSVPKPKATAKDWVDMINEFQKGALSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHGNNN YNATIFPHNVGLGATRDP+LV++IG ATALE RATGI YVFAP IAVCRDPRW
Sbjct  121   VHGNNNVYNATIFPHNVGLGATRDPQLVKKIGEATALESRATGIPYVFAPSIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSED +IV+AMTE+IPGLQG+ P N+    P+V G +KVAACAKH+VGDGGT +
Sbjct  181   GRCYESYSEDHKIVQAMTELIPGLQGDLPANWSNGVPYVVGNKKVAACAKHFVGDGGTTE  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+E+NT+   H+LFSIHM  YYNSI + V T+M SYSS NG +MH+NRD++TGFLK TL
Sbjct  241   GINEDNTVATRHELFSIHMQAYYNSITKVVLTIMVSYSSWNGEKMHSNRDLVTGFLKNTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              FRGFVISD+K ID +T   H NYT+SI   +NAGIDM+M+P+NYTEFIDGLT LVK   
Sbjct  301   HFRGFVISDWKGIDRITSPPHANYTFSIEAGVNAGIDMIMIPFNYTEFIDGLTLLVKKNV  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAVKRILRVKFVMGLFE+PL DYSLA  +GS +HR+LAR+AVRKSLVLLKNG 
Sbjct  361   IPMSRIDDAVKRILRVKFVMGLFENPLADYSLADQIGSPEHRELAREAVRKSLVLLKNGE  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
             N D+P+LPL KK+S+ILVAG+HADN+GYQCGGWTI+WQG SG NIT GT IL+AIK+ VD
Sbjct  421   NVDKPILPLPKKSSKILVAGSHADNLGYQCGGWTIQWQGQSGNNITTGTPILSAIKHAVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
              +T+V++EENP  ++VK + FS+AIVVVGE  YAE +GDS NLTI   G   I NVC   
Sbjct  481   KETKVVYEENPSLDYVKFNDFSYAIVVVGETPYAETNGDSLNLTISGHGYETIDNVCSGV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVVLITGRP+VIQPYL +I+ LV AWLPG+EG GVADVLFGDYGF+GKLP TWFKTVD
Sbjct  541   KCVVVLITGRPIVIQPYLEKIEGLVVAWLPGSEGSGVADVLFGDYGFTGKLPRTWFKTVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_006367581.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=629

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/601 (72%), Positives = 501/601 (83%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRF-LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MGK  +  ++G  L C   +V  A+ M YKD +Q +G RIKDLL RMTL+EKIGQM QIE
Sbjct  1     MGKFVKIPIMGFMLFCVLAMVIEAENMKYKDPKQKLGVRIKDLLKRMTLEEKIGQMTQIE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R+VASA+VM KY++GS+LS GGSVPKP A+AE WV+MVN FQKGSLSTRLGIPMIYGIDA
Sbjct  61    RKVASAEVMSKYFIGSLLSGGGSVPKPNATAEDWVNMVNDFQKGSLSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN Y ATIFPHNVGLG TRDPEL++ IGAATALEVRATGI Y F+PCIAVCR+PRW
Sbjct  121   VHGHNNVYKATIFPHNVGLGVTRDPELMKRIGAATALEVRATGIPYAFSPCIAVCRNPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYES+SED  IVR+MTEIIPGLQG+ P N     P+V G+ KVA CAKH+V DGGTV 
Sbjct  181   GRCYESFSEDINIVRSMTEIIPGLQGDLPANMSKGTPYVNGKTKVAGCAKHFVADGGTVN  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             G+DENNT+VD+  LFSIHM  YY+S+I+GVATVMASYSSLNG RMHAN  ++TGFLKK L
Sbjct  241   GLDENNTIVDSKGLFSIHMPAYYDSVIKGVATVMASYSSLNGERMHANTHLLTGFLKKRL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              FRGFVISD++ I+ +T   + NYTYS+  SI AGIDMVMVP NYT+FI  LT LV    
Sbjct  301   NFRGFVISDWEGINRITNPANANYTYSVEASIMAGIDMVMVPNNYTDFIGNLTMLVNKNV  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             VP+SRIDDAVKRILRVKFVMGLFEDPLGD SLA HLGS +HR++AR+AVRKSLVLLKNG 
Sbjct  361   VPMSRIDDAVKRILRVKFVMGLFEDPLGDLSLAKHLGSPEHREIAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGL-SGNITIGTTILTAIKNTVD  1643
              A++P++PL KKA++ILVAGTHADN+GYQCGGWTI WQG+   N+T+GTT+L AIK TVD
Sbjct  421   TAEQPLVPLPKKAAKILVAGTHADNLGYQCGGWTITWQGVPHSNLTVGTTVLDAIKKTVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               TQV+F E PD  FV+SSKF +A+VVVGE TYAE +GDSSNLTIP+PGPSII NVC   
Sbjct  481   PATQVVFNEEPDTNFVQSSKFDYAVVVVGENTYAEVNGDSSNLTIPDPGPSIIQNVCGAV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVV+I+GRPVVI+PY+ ++D +VAAWLPGTEGQGVADVLFGDYGF+GKL  TWFK VD
Sbjct  541   KCVVVIISGRPVVIEPYVEKMDVIVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKRVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_009614218.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=639

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/589 (72%), Positives = 496/589 (84%), Gaps = 3/589 (1%)
 Frame = +3

Query  246   LLCCW-VVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKky  422
             L   W   +A  DY++YKD  +P+  RI+DL+SRMTL EKIGQM Q++R++ ++Q+MK Y
Sbjct  18    LFSAWEACMAEGDYLIYKDPTKPLNIRIRDLMSRMTLAEKIGQMTQLDRRILTSQIMKDY  77

Query  423   ylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATI  602
              +GSVLS GGSVPKP A+A  WVDMVN FQKG+LSTRLGIPMIYGIDAVHG+NN Y AT+
Sbjct  78    GIGSVLSGGGSVPKPEATAREWVDMVNEFQKGALSTRLGIPMIYGIDAVHGHNNVYKATV  137

Query  603   FPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPE  782
             FPHNVGLGATRDP+LV+ IGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPE
Sbjct  138   FPHNVGLGATRDPDLVKRIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPE  197

Query  783   IVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTH  962
             IV+ MTEIIPGLQG+ PP      P+VAG+EKVAACAKH+VGDGGT KGI+ENNT+ D H
Sbjct  198   IVKQMTEIIPGLQGDHPPR-KAGIPYVAGKEKVAACAKHFVGDGGTTKGINENNTVTDWH  256

Query  963   DLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKA  1142
              L SIHM GYY SII+GV+TVM SYSS NGV+MHA+ +++T FLK TL+FRGFVISD++ 
Sbjct  257   TLLSIHMPGYYQSIIKGVSTVMVSYSSWNGVKMHAHHNLVTNFLKDTLKFRGFVISDWQG  316

Query  1143  IDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKR  1322
             ID +T   H NYT+S+LT + AGIDM+MVP N+TEFID LT LV N F+P+SRIDDAV+R
Sbjct  317   IDKITSPPHANYTHSVLTGVQAGIDMIMVPLNHTEFIDILTSLVNNNFIPMSRIDDAVRR  376

Query  1323  ILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKK  1502
             ILRVKF MGLFE+PL DY L  HLGS+ HR LAR+AVRKSLVLLKNGANADEPVLPL KK
Sbjct  377   ILRVKFTMGLFENPLADYRLVKHLGSQAHRDLAREAVRKSLVLLKNGANADEPVLPLPKK  436

Query  1503  ASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPD  1679
             A+RILVAG+HA+N+GYQCGGWTI WQG+ G N+T+GTTIL AI  TVD  T+V++ ENP 
Sbjct  437   ATRILVAGSHANNLGYQCGGWTITWQGVEGNNVTLGTTILDAITATVDPSTEVVYSENPT  496

Query  1680  PEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPV  1859
              EF++S+KFS+AIVVVGE  YAE +GDS NLTIPE G + + NVC   KCVVVLI+GRP+
Sbjct  497   TEFMESNKFSYAIVVVGELPYAETAGDSLNLTIPEQGITTMNNVCGSIKCVVVLISGRPL  556

Query  1860  VIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             V+QP+L  ID+LVAAWLPGTEGQGVADVLFGDY F+GKL  TWFKTV+Q
Sbjct  557   VVQPHLSNIDSLVAAWLPGTEGQGVADVLFGDYEFTGKLSRTWFKTVNQ  605



>ref|XP_006479136.1| PREDICTED: lysosomal beta glucosidase-like [Citrus sinensis]
Length=635

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/586 (71%), Positives = 496/586 (85%), Gaps = 11/586 (2%)
 Frame = +3

Query  282   YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvp  461
             Y+ YKD +QP+  R+ DL+SRMTL+EKIGQM QIER VASA+VMKKY++GSVL+ GGS P
Sbjct  22    YLKYKDPKQPLHVRVNDLVSRMTLEEKIGQMTQIERGVASAEVMKKYFIGSVLTGGGSAP  81

Query  462   kpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDP  641
               +ASAEAW++++N FQKG+LSTRLGIPMIYGIDAVHG+NN YNATIFPHN+GLGATRDP
Sbjct  82    ARQASAEAWINIINDFQKGALSTRLGIPMIYGIDAVHGHNNVYNATIFPHNIGLGATRDP  141

Query  642   ELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQ  821
             +LV+ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSEDP+IV+AMTE+IPGLQ
Sbjct  142   DLVKRIGAATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDPKIVQAMTELIPGLQ  201

Query  822   GEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNS  1001
             G+ P   P   P+VAG+ KVAACAKH+VGDGGT+ G++ENNT++D H L +IHM  YYNS
Sbjct  202   GDIPAGSPKGVPYVAGKTKVAACAKHFVGDGGTINGVNENNTIIDRHGLLAIHMPAYYNS  261

Query  1002  IIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYT  1181
             II+GV+TVM SYSS NG++MHAN++++TGFLK TL+FRGFVI+D++ +D +T   H NY+
Sbjct  262   IIKGVSTVMVSYSSWNGIKMHANQELVTGFLKNTLQFRGFVITDWEGLDRITSPPHANYS  321

Query  1182  YSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFED  1361
             YS+   I AGIDMVMVPYNY EFID LT+ VKN  +P+SRIDDAV+RILRVKFVMGLFE+
Sbjct  322   YSVEVGIKAGIDMVMVPYNYIEFIDDLTFQVKNNIIPMSRIDDAVRRILRVKFVMGLFEN  381

Query  1362  PLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEP----------VLPLRKKASR  1511
             PL D SL   LGS++HR+LAR+AVRKSLVLLKNG + + P          +LPL KK S+
Sbjct  382   PLADDSLVDQLGSQEHRELAREAVRKSLVLLKNGDSTEVPLLPLPKKTSKILPLPKKTSK  441

Query  1512  ILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDPEF  1688
             ILVAG+HADN+GYQCGGWTIEWQGLSGN +T GTTIL AIKNTVD +T+V+++ENPD  F
Sbjct  442   ILVAGSHADNLGYQCGGWTIEWQGLSGNDLTRGTTILNAIKNTVDQQTEVVYQENPDANF  501

Query  1689  VKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQ  1868
             VKS+ FS+AIVVVGE  YAE +GDS NL I +PGP+ I NVC   +CVVV+I+GRPVVIQ
Sbjct  502   VKSNNFSYAIVVVGEHPYAETNGDSMNLNIADPGPNTITNVCGAVECVVVVISGRPVVIQ  561

Query  1869  PYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             PYL  IDALVAAWLPGTEGQGVADVLFGDY F+GKLP TWFKTVDQ
Sbjct  562   PYLSYIDALVAAWLPGTEGQGVADVLFGDYDFTGKLPRTWFKTVDQ  607



>ref|XP_009417082.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417083.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=656

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/599 (69%), Positives = 493/599 (82%), Gaps = 0/599 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M +  +F + + LL CW  +  ADYM YKD +QP+  RIKDL+ RMTL EKIGQM QIER
Sbjct  1     MARSRKFCLYLLLLMCWAYIGEADYMKYKDPKQPINVRIKDLMDRMTLAEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VASAQVMK Y++GSVLS GGSVP+P AS   WV+MVN FQKGSLSTRLGIPMIYGIDAV
Sbjct  61    EVASAQVMKNYFIGSVLSGGGSVPRPEASVADWVNMVNEFQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHN+GLGATRDPELV+ IGAATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNIGLGATRDPELVKRIGAATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IV+ MTEIIPGLQG+ P  Y    P+V+G+EKVAACAKHYVGDGGT  G
Sbjct  181   RCYESYSEDHNIVQQMTEIIPGLQGDVPAKYRKGVPYVSGKEKVAACAKHYVGDGGTHNG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+V+  DL SIHM  Y NSII+GV+T+M SYSS NGV+MHANRD++TG+LK TLR
Sbjct  241   INENNTIVNRADLLSIHMPAYLNSIIKGVSTIMVSYSSWNGVKMHANRDLVTGYLKNTLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T +   NYTYS+   I+AGIDMVMVPYNY+EFI+ LT LVK   +
Sbjct  301   FRGFVISDWQGIDRITSSPGANYTYSVQAGISAGIDMVMVPYNYSEFINDLTSLVKKNVI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV RILRVKF +GLFE+PL D SL   LG ++HR LAR+AVRKSLVLLKNG +
Sbjct  361   PLSRIDDAVGRILRVKFTIGLFENPLADLSLVDQLGKKEHRDLAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTK  1649
              ++  LPL KKA++IL+AG+HA N+GYQCGGWTIEWQG SGNIT+GTTIL A+++ +D  
Sbjct  421   TNDSFLPLPKKAAKILIAGSHASNLGYQCGGWTIEWQGDSGNITVGTTILDAVRSAIDPS  480

Query  1650  TQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKC  1829
             T+V++ ENPD   VK + FS+AIVVVGE  Y E +GD+ NL +P+P PSII  VC   KC
Sbjct  481   TEVVYSENPDSNIVKGNDFSYAIVVVGEPPYTETAGDNLNLELPDPAPSIIQTVCGTIKC  540

Query  1830  VVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VVV+I+GRPVVI+PY+P +DALVAAWLPG+EGQG+ DVL+GDYGF+GKL  TWFK+VDQ
Sbjct  541   VVVIISGRPVVIEPYVPLVDALVAAWLPGSEGQGLTDVLYGDYGFTGKLSRTWFKSVDQ  599



>ref|XP_006443452.1| hypothetical protein CICLE_v10019305mg [Citrus clementina]
 gb|ESR56692.1| hypothetical protein CICLE_v10019305mg [Citrus clementina]
Length=627

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/586 (71%), Positives = 496/586 (85%), Gaps = 11/586 (2%)
 Frame = +3

Query  282   YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvp  461
             Y+ YKD +QP+  R+ DL+SRMTL+EKIGQM QIER VASA+VMKKY++GSVL+ GGS P
Sbjct  14    YLKYKDPKQPLHVRVNDLVSRMTLEEKIGQMTQIERGVASAEVMKKYFIGSVLTGGGSAP  73

Query  462   kpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDP  641
               +ASAEAW++++N FQKG+LSTRLGIPMIYGIDAVHG+NN YNATIFPHN+GLGATRDP
Sbjct  74    ARQASAEAWINIINDFQKGALSTRLGIPMIYGIDAVHGHNNVYNATIFPHNIGLGATRDP  133

Query  642   ELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQ  821
             +LV+ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSEDP+IV+AMTE+IPGLQ
Sbjct  134   DLVKRIGAATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDPKIVQAMTELIPGLQ  193

Query  822   GEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNS  1001
             G+ P   P   P+VAG+ KVAACAKH+VGDGGT+ G++ENNT++D H L +IHM  YYNS
Sbjct  194   GDIPAGSPKGVPYVAGKTKVAACAKHFVGDGGTINGVNENNTIIDRHGLLAIHMPAYYNS  253

Query  1002  IIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYT  1181
             II+GV+TVM SYSS NG++MHAN++++TGFLK TL+FRGFVI+D++ +D +T   H NY+
Sbjct  254   IIKGVSTVMVSYSSWNGIKMHANQELVTGFLKNTLQFRGFVITDWEGLDRITSPPHANYS  313

Query  1182  YSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFED  1361
             YS+   I AGIDMVMVPYNY EFID LT+ VKN  +P+SRIDDAV+RILRVKFVMGLFE+
Sbjct  314   YSVEVGIKAGIDMVMVPYNYIEFIDDLTFQVKNNIIPMSRIDDAVRRILRVKFVMGLFEN  373

Query  1362  PLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEP----------VLPLRKKASR  1511
             PL D SL   LGS++HR+LAR+AVRKSLVLLKNG + + P          +LPL KK S+
Sbjct  374   PLADDSLVDQLGSQEHRELAREAVRKSLVLLKNGDSTEVPLLPLPKKTSKILPLPKKTSK  433

Query  1512  ILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDPEF  1688
             ILVAG+HADN+GYQCGGWTIEWQGLSGN +T GTTIL AIKNTVD +T+V+++ENPD  F
Sbjct  434   ILVAGSHADNLGYQCGGWTIEWQGLSGNDLTRGTTILNAIKNTVDQQTEVVYQENPDANF  493

Query  1689  VKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQ  1868
             VKS+ FS+AIVVVGE  YAE +GDS NL I +PGP+ I NVC   +CVVV+I+GRPVVIQ
Sbjct  494   VKSNNFSYAIVVVGEHPYAETNGDSMNLNIADPGPNTITNVCGAVECVVVVISGRPVVIQ  553

Query  1869  PYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             PYL  IDALVAAWLPGTEGQGVADVLFGDY F+GKLP TWFKTVDQ
Sbjct  554   PYLSYIDALVAAWLPGTEGQGVADVLFGDYDFTGKLPRTWFKTVDQ  599



>gb|KHN46760.1| Lysosomal beta glucosidase [Glycine soja]
Length=636

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/602 (70%), Positives = 505/602 (84%), Gaps = 1/602 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             E M K S  L+G+ LL  W  + +A YM YK+ +  +  R++DL+ RMTL+EKIGQM+Q+
Sbjct  4     EGMAKISILLVGLWLLVNWSGLLDAKYMKYKNPKLSIDTRVEDLVRRMTLEEKIGQMLQV  63

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             ER+   A ++KKY++GSVLS GGS+P P+ASAE W+DMVN FQKG+LSTRLGIPM YGID
Sbjct  64    ERKYVPADLLKKYFIGSVLSEGGSIPAPQASAETWIDMVNEFQKGALSTRLGIPMFYGID  123

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+N  +NATIFPHN+GLGATRDPELVR IGAATALEVRATGIQYV++PCIAVCRDPR
Sbjct  124   AVHGHNTIHNATIFPHNIGLGATRDPELVRRIGAATALEVRATGIQYVYSPCIAVCRDPR  183

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSEDPE+V+AMTEIIPGLQG+ P + P   PF+AG+EKV  CAKHYVGDGGT+
Sbjct  184   WGRCYESYSEDPELVQAMTEIIPGLQGDIPNDSPKGVPFIAGKEKVIGCAKHYVGDGGTI  243

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
              GIDE+NT++D   L  IHM GY +SI +GVAT+MASYSS NGV+MHA+ D+ITG+LK T
Sbjct  244   NGIDEHNTVIDRDGLMKIHMPGYLSSISKGVATIMASYSSWNGVKMHAHHDLITGYLKNT  303

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L F+GFVISDF+ ID +T     N TYSI   ++AGIDM MVP +YTEFID LT LVKNK
Sbjct  304   LHFKGFVISDFEGIDRITSPPRANITYSIEAGVSAGIDMFMVPKHYTEFIDVLTMLVKNK  363

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAV+RIL VKF+MG+FE+P  DYSLA +LG ++HR LAR+AVRKS+VLLKNG
Sbjct  364   HIPMSRIDDAVRRILWVKFMMGIFENPFADYSLAKYLGIQEHRNLAREAVRKSMVLLKNG  423

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTV  1640
              +AD+P+LPL KKA +ILVAG+HADN+GYQCGGWTIEWQG+SG N+  GTTIL A+K+TV
Sbjct  424   ESADKPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILAAVKDTV  483

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D +T V+++ENPD EFVKS++FS+AIVVVGE  YAE  GDS NLTIPEPGP II NVC  
Sbjct  484   DPETTVVYKENPDVEFVKSNEFSYAIVVVGEHPYAEMHGDSMNLTIPEPGPEIITNVCGA  543

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVV++I+GRPVVI+PY+  IDALVAAWLPG+EGQGVADVLFGDYGF+GKLP TWFKTV
Sbjct  544   IKCVVIIISGRPVVIEPYVGSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRTWFKTV  603

Query  2001  DQ  2006
             DQ
Sbjct  604   DQ  605



>gb|KHN34680.1| Lysosomal beta glucosidase [Glycine soja]
Length=631

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/600 (70%), Positives = 503/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K S  L+G+ LL  W  + +A+YM YKD ++ +  R++DL+SRMTL+EKIGQM+QIER
Sbjct  1     MAKISILLVGLWLLGSWTGLLDAEYMKYKDTKESIDTRVEDLVSRMTLEEKIGQMLQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + ASA ++KKY++GSV+S GGSVP P+ASAE W+DMVN FQKG+LSTRLGIPM YGIDAV
Sbjct  61    KYASADLVKKYFIGSVMSEGGSVPAPQASAETWIDMVNEFQKGALSTRLGIPMFYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+N   NATIFPHN+GLGATRDPELV+ IGAATALE+RATGIQY +APCIAVCRDPRWG
Sbjct  121   HGHNTINNATIFPHNIGLGATRDPELVKRIGAATALELRATGIQYTYAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP++V+AMTEIIPGLQG+ P N P   PF+ G+EKV ACAKHYVGDGGTV G
Sbjct  181   RCYESYSEDPKLVQAMTEIIPGLQGDIPDNLPKGVPFMTGKEKVLACAKHYVGDGGTVNG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT++D   L  IHM GY+NSI +GVA++M SYSS NGV+MHAN D+ITG+LK TL 
Sbjct  241   IDENNTVIDRDGLMRIHMPGYFNSISKGVASIMVSYSSWNGVKMHANNDLITGYLKNTLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISDF+ ID +T   H N+TYSI   ++AGIDM M P  Y EFI+ L  LVKNKF+
Sbjct  301   FKGFVISDFEGIDRITLPPHANFTYSIEAGVSAGIDMFMNPKLYIEFIEDLIMLVKNKFI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV+RIL VKF+MG+FE P  DYSL  +LG +KHR+LAR+AVRKS+VLLKNG +
Sbjct  361   PMSRIDDAVRRILWVKFMMGIFETPFADYSLVGYLGIQKHRQLAREAVRKSMVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD+P+LPL KK  +IL+AG+HADN+GYQCGGWTIEWQG+SG N+  GTTILTA+KNTVD 
Sbjct  421   ADKPLLPLPKKVPKILLAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILTAVKNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
             +T V+++ENPD EFVKS++FS+ IVVVGE  YAE  GD+ NLTIP+ GP  IANVC   K
Sbjct  481   ETTVVYKENPDAEFVKSNEFSYGIVVVGENPYAEMHGDNMNLTIPDHGPETIANVCGAIK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV++I+GRPVVI+PY+  +DALVAAWLPG+EGQGVADVLFGDYGF+GKLP TWFKTVDQ
Sbjct  541   CVVIVISGRPVVIEPYVDSVDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRTWFKTVDQ  600



>ref|XP_009619848.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=624

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/596 (72%), Positives = 501/596 (84%), Gaps = 4/596 (1%)
 Frame = +3

Query  225   RFLI-GVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVAS  401
             RFLI G  L C   VV  A++M YKD +Q +G RIKDL+ RMTL+EKIGQM QIER+VAS
Sbjct  3     RFLIMGFGLFCLLAVVTEAEHMKYKDPKQKLGVRIKDLMKRMTLEEKIGQMTQIERKVAS  62

Query  402   AQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNN  581
             A VMKKY++GS+LS GGSVPKP ASAE WV+MVN FQKG+L TRLGIPMIYGIDAVHG+N
Sbjct  63    ADVMKKYFIGSLLSGGGSVPKPNASAEDWVNMVNEFQKGALKTRLGIPMIYGIDAVHGHN  122

Query  582   NAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYE  761
             N Y ATIFPHNVGLG TRDP+LV+ IGAATALEVRATGIQY F+PC+A+CR+PRWGRCYE
Sbjct  123   NVYKATIFPHNVGLGVTRDPDLVKRIGAATALEVRATGIQYAFSPCLAICRNPRWGRCYE  182

Query  762   SYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDEN  941
             SYSED  IVR+MTEIIPGLQG+ P N     PFV G++KV ACAKH+V DGGTV GIDEN
Sbjct  183   SYSEDVNIVRSMTEIIPGLQGDVPANMSKGVPFVDGKKKVVACAKHFVADGGTVNGIDEN  242

Query  942   NTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGF  1121
             NT++D+  LFSIHM  YY+S+I+GVATVMASYSSLNG RMHAN  ++TGFLK+ L FRGF
Sbjct  243   NTVIDSQGLFSIHMPAYYDSVIKGVATVMASYSSLNGERMHANTHLLTGFLKERLNFRGF  302

Query  1122  VISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSR  1301
             VISD++ I+ +T   + NYTYS+  S+ AG+DM+MVP NYT+FI  LT+LVKN FVP+SR
Sbjct  303   VISDWEGINRITNPANSNYTYSVQASVMAGVDMIMVPENYTDFIGNLTFLVKNNFVPMSR  362

Query  1302  IDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEP  1481
             IDDAVKRILRVKFVMGLFEDP+ D SLA +LG ++HR+LAR+AVRKSLVLLKNG   D+P
Sbjct  363   IDDAVKRILRVKFVMGLFEDPMADLSLAKYLGCQEHRELAREAVRKSLVLLKNGKKPDQP  422

Query  1482  VLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQV  1658
             +LPL KKA RILVAGTHA+N+GYQCGGWTI+WQG+ G N+TIGTTI  AI NTVD  T+V
Sbjct  423   LLPLPKKARRILVAGTHAENLGYQCGGWTIQWQGVPGNNLTIGTTISKAIMNTVDPSTEV  482

Query  1659  MFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVV  1838
             ++++N  P  V+SS+F +AIVVVGE  YAE  GDSSNLTI +PGPSII NVC   KCVVV
Sbjct  483   VYQQN--PVLVESSQFDYAIVVVGEPPYAEMYGDSSNLTILDPGPSIIKNVCGIVKCVVV  540

Query  1839  LITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +I+GRPVVI+PY+ ++DALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFK VDQ
Sbjct  541   VISGRPVVIEPYIERMDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKRVDQ  596



>ref|XP_008230878.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=630

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/602 (71%), Positives = 501/602 (83%), Gaps = 3/602 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVV-ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M + S  ++G  LLC  ++    A Y+ YKD +QP+  RI+DL+ RMTL+EKIGQMVQIE
Sbjct  1     MARFSIPMMGFLLLCIILLAPTEAAYLKYKDPKQPLNVRIRDLMKRMTLEEKIGQMVQIE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VA+   M KY++GSVLS GGSVP P+ASAEAWV++VNG QKGSLSTRLGIPMIYGIDA
Sbjct  61    RSVATPDAMNKYFIGSVLSGGGSVPAPKASAEAWVNLVNGIQKGSLSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHGNNN YNATIFPHNVGLGATRDP+LV++IG ATALEVRATGI YVFAPCIAVCRDPRW
Sbjct  121   VHGNNNVYNATIFPHNVGLGATRDPKLVKKIGEATALEVRATGIPYVFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVA-GREKVAACAKHYVGDGGTV  923
             GRCYESYSED +IV+AMTE+IPGLQG+ PP+     PFV+  + KVAACAKHYVGDGGT 
Sbjct  181   GRCYESYSEDHKIVQAMTELIPGLQGDMPPSAQKGAPFVSIAKGKVAACAKHYVGDGGTT  240

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
             KGI+ENNT++D + L SIHM  Y +SI++GVATVM SYSS NG +MHAN++++TGFLK  
Sbjct  241   KGINENNTVIDLNGLLSIHMPAYLDSILKGVATVMVSYSSWNGKKMHANQELVTGFLKNK  300

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             LRFRGFVISD++ ID LT     NY+YS+   ++AGIDM+MVPYN+T+FID LTY VKN 
Sbjct  301   LRFRGFVISDWEGIDRLTSPPKANYSYSVQAGVSAGIDMIMVPYNFTDFIDDLTYQVKNN  360

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAVKRILRVKFVMGLFE+P  D SL + LG ++HR+LAR+AVRKSLVLLKNG
Sbjct  361   IIPMSRIDDAVKRILRVKFVMGLFEEPFADLSLVNELGKKEHRELAREAVRKSLVLLKNG  420

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTV  1640
              +AD+P LPL KKA +IL+AG+HADN+G QCGGWTI WQGL GN +T+GTTIL A+K+ V
Sbjct  421   KSADKPSLPLPKKAGKILIAGSHADNLGNQCGGWTITWQGLGGNDLTVGTTILNAVKSAV  480

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  TQV++ ENPD  FVKS+KF +A+VVVGE  YAE  GDS NLTI EPGPS IANVC  
Sbjct  481   DPTTQVVYNENPDANFVKSNKFDYAVVVVGEPPYAETFGDSLNLTISEPGPSTIANVCGA  540

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVVV+I+GRPVVIQPYL ++DALVAAWLPGTEGQGV DVLFGDYGF+GKL  TWFKTV
Sbjct  541   VKCVVVVISGRPVVIQPYLAKVDALVAAWLPGTEGQGVTDVLFGDYGFTGKLARTWFKTV  600

Query  2001  DQ  2006
             DQ
Sbjct  601   DQ  602



>ref|XP_006604247.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006604248.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
 ref|XP_006604249.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Glycine 
max]
Length=631

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/600 (69%), Positives = 503/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K S  L+G+ LL  W  + +A+YM YKD ++ +  R++DL+SRMTL+EKIGQM+QIER
Sbjct  1     MAKISILLVGLWLLGSWTGLLDAEYMKYKDTKESIDTRVEDLVSRMTLEEKIGQMLQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + ASA ++KKY++GSV+S GGSVP P+ASAE W+DMVN FQKG+LSTRLGIPM YGIDAV
Sbjct  61    KYASADLVKKYFIGSVMSEGGSVPAPQASAETWIDMVNEFQKGALSTRLGIPMFYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+N   NATIFPHN+GLGATRDPELV+ IGAATALE+RATGIQY +APCIAVCRDPRWG
Sbjct  121   HGHNTINNATIFPHNIGLGATRDPELVKRIGAATALELRATGIQYTYAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP++V+AMTEIIPGLQG+ P N P   PF+ G+EKV ACAKHYVGDGGT+ G
Sbjct  181   RCYESYSEDPKLVQAMTEIIPGLQGDIPDNLPKGVPFMTGKEKVLACAKHYVGDGGTING  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT++D   L  IHM GY+NSI +GVA++M SYSS NGV+MHAN D+ITG+LK TL 
Sbjct  241   IDENNTVIDRDGLMRIHMPGYFNSISKGVASIMVSYSSWNGVKMHANNDLITGYLKNTLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISDF+ ID +T   H N+TYSI   ++AGIDM M P  Y EFI+ L  LVKNKF+
Sbjct  301   FKGFVISDFEGIDRITLPPHANFTYSIEAGVSAGIDMFMNPKLYIEFIEDLIMLVKNKFI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV+RIL VKF+MG+FE P  DYSL  +LG +KHR+LAR+AVRKS+VLLKNG +
Sbjct  361   PMSRIDDAVRRILWVKFMMGIFETPFADYSLVGYLGIQKHRQLAREAVRKSMVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD+P+LPL KK  +IL+AG+HADN+GYQCGGWTIEWQG+SG N+  GTTILTA+KNTVD 
Sbjct  421   ADKPLLPLPKKVPKILLAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILTAVKNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
             +T V+++ENPD EFVKS++FS+ IVVVGE  YAE  GD+ NLTIP+ GP  IANVC   K
Sbjct  481   ETTVVYKENPDAEFVKSNEFSYGIVVVGENPYAEMHGDNMNLTIPDHGPETIANVCGAIK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV++I+GRPVVI+PY+  +DALVAAWLPG+EGQGVADVLFGDYGF+GKLP TWFKTVDQ
Sbjct  541   CVVIVISGRPVVIEPYVDSVDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRTWFKTVDQ  600



>ref|XP_006598973.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=671

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/602 (70%), Positives = 505/602 (84%), Gaps = 1/602 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             E M K S  L+G+ LL  W  + +A YM YK+ +  +  R++DL+ RMTL+EKIGQM+Q+
Sbjct  39    EGMAKISILLVGLWLLVNWSGLLDAKYMKYKNPKLSIDTRVEDLVKRMTLEEKIGQMLQV  98

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             ER+   A ++KKY++GSVLS GGS+P P+ASAE W+DMVN FQKG+LSTRLGIPM YGID
Sbjct  99    ERKYVPADLLKKYFIGSVLSEGGSIPAPQASAETWIDMVNEFQKGALSTRLGIPMFYGID  158

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+N  +NATIFPHN+GLGATRDPELV+ IGAATALEVRATGIQYV++PCIAVCRDPR
Sbjct  159   AVHGHNTIHNATIFPHNIGLGATRDPELVKRIGAATALEVRATGIQYVYSPCIAVCRDPR  218

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSEDPE+V+AMTEIIPGLQG+ P + P   PF+AG+EKV  CAKHYVGDGGT 
Sbjct  219   WGRCYESYSEDPELVQAMTEIIPGLQGDIPNDSPKGVPFIAGKEKVIGCAKHYVGDGGTT  278

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
              GIDE+NT++D   L  IHM GY++SI +GVAT+MASYSS NGV+MHA+ D+ITG+LK T
Sbjct  279   NGIDEHNTVIDRDGLMKIHMPGYFSSISKGVATIMASYSSWNGVKMHAHHDLITGYLKNT  338

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L F+GFVISDF+ ID +T     N TYSI   ++AGIDM MVP +YTEFID LT LVKNK
Sbjct  339   LHFKGFVISDFEGIDRITSPPRANITYSIEAGVSAGIDMFMVPKHYTEFIDVLTMLVKNK  398

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAV+RIL VKF+MG+FE+P  DYSLA +LG ++HR LAR+AVRKS+VLLKNG
Sbjct  399   HIPMSRIDDAVRRILWVKFMMGIFENPFADYSLAKYLGIQEHRNLAREAVRKSMVLLKNG  458

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTV  1640
              +AD+P+LPL KKA +ILVAG+HADN+GYQCGGWTIEWQG+SG N+  GTTIL A+K+TV
Sbjct  459   ESADKPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILAAVKDTV  518

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D +T V+++ENPD EFVKS++FS+AIVVVGE  YAE  GDS NLTIPEPGP II NVC  
Sbjct  519   DPETTVVYKENPDVEFVKSNEFSYAIVVVGEHPYAEMHGDSMNLTIPEPGPEIITNVCGA  578

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVV++I+GRPVVI+PY+  IDALVAAWLPG+EGQGVADVLFGDYGF+GKLP TWFKTV
Sbjct  579   IKCVVIIISGRPVVIEPYVGSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRTWFKTV  638

Query  2001  DQ  2006
             DQ
Sbjct  639   DQ  640



>ref|XP_007015579.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 ref|XP_007015580.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY33198.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY33199.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
Length=628

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/592 (71%), Positives = 492/592 (83%), Gaps = 1/592 (0%)
 Frame = +3

Query  234   IGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVM  413
             +G  LLCC   V +A YM YKD + P+G RIKDL+SRMTL EKIGQM QIER VA+  VM
Sbjct  9     LGFLLLCCLAAVTDATYMKYKDPKLPLGVRIKDLMSRMTLAEKIGQMTQIERSVATPDVM  68

Query  414   KkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYN  593
             KKY++GSVLS GGSVP  +A+ E W+ MVN  QKG+LST LGIPM+YGIDAVHG+NN Y 
Sbjct  69    KKYFIGSVLSGGGSVPAAKATPETWIKMVNSIQKGALSTHLGIPMLYGIDAVHGHNNVYK  128

Query  594   ATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSE  773
             +TIFPHNVGLG TRDP+L+++IG ATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSE
Sbjct  129   STIFPHNVGLGVTRDPQLIKKIGDATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSE  188

Query  774   DPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLV  953
             D +IV+ MTEIIPGLQG+ P N     PFVAG++KVAACAKHY+GDGGT KGI+ENNT++
Sbjct  189   DHKIVQLMTEIIPGLQGDLPANAKKGVPFVAGKKKVAACAKHYLGDGGTTKGINENNTVI  248

Query  954   DTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISD  1133
               + L SIHM  Y NSI +GVATVM SYSS NG +MHANRD++TGFLK  L+FRGFVISD
Sbjct  249   SLNGLLSIHMPAYINSIRKGVATVMVSYSSWNGKKMHANRDLVTGFLKNKLKFRGFVISD  308

Query  1134  FKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDA  1313
             ++ +D +T   H NY+YS+   ++AGIDM+MVPYN+TEFID LTY VK+  +P+SRIDDA
Sbjct  309   WQGLDRITSPPHANYSYSVEAGVSAGIDMIMVPYNFTEFIDDLTYQVKHNIIPMSRIDDA  368

Query  1314  VKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPL  1493
             VKRILRVKFVMGLFE+P+ DYSL + LGS++HR+LAR+AVRK+LVLLKNG +ADE +LPL
Sbjct  369   VKRILRVKFVMGLFENPIADYSLVNQLGSQEHRELAREAVRKTLVLLKNGESADEALLPL  428

Query  1494  RKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEE  1670
              KK ++IL+AG+HADN+G QCGGWTI WQGL GN +T GTTIL AIK TVD  TQV++ E
Sbjct  429   PKKTTKILIAGSHADNLGCQCGGWTITWQGLGGNDLTSGTTILQAIKKTVDPTTQVVYSE  488

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
             NPD  FVKS++FS+AIVVVGE  YAE  GDS NLTI EPGPS I NVC   KCVVV+I+G
Sbjct  489   NPDAVFVKSNEFSYAIVVVGEPPYAETFGDSLNLTISEPGPSTIYNVCGAVKCVVVVISG  548

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RPVV+QPYL  IDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  549   RPVVMQPYLSSIDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  600



>ref|XP_003548716.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
Length=636

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/602 (70%), Positives = 505/602 (84%), Gaps = 1/602 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             E M K S  L+G+ LL  W  + +A YM YK+ +  +  R++DL+ RMTL+EKIGQM+Q+
Sbjct  4     EGMAKISILLVGLWLLVNWSGLLDAKYMKYKNPKLSIDTRVEDLVKRMTLEEKIGQMLQV  63

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             ER+   A ++KKY++GSVLS GGS+P P+ASAE W+DMVN FQKG+LSTRLGIPM YGID
Sbjct  64    ERKYVPADLLKKYFIGSVLSEGGSIPAPQASAETWIDMVNEFQKGALSTRLGIPMFYGID  123

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+N  +NATIFPHN+GLGATRDPELV+ IGAATALEVRATGIQYV++PCIAVCRDPR
Sbjct  124   AVHGHNTIHNATIFPHNIGLGATRDPELVKRIGAATALEVRATGIQYVYSPCIAVCRDPR  183

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSEDPE+V+AMTEIIPGLQG+ P + P   PF+AG+EKV  CAKHYVGDGGT 
Sbjct  184   WGRCYESYSEDPELVQAMTEIIPGLQGDIPNDSPKGVPFIAGKEKVIGCAKHYVGDGGTT  243

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
              GIDE+NT++D   L  IHM GY++SI +GVAT+MASYSS NGV+MHA+ D+ITG+LK T
Sbjct  244   NGIDEHNTVIDRDGLMKIHMPGYFSSISKGVATIMASYSSWNGVKMHAHHDLITGYLKNT  303

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L F+GFVISDF+ ID +T     N TYSI   ++AGIDM MVP +YTEFID LT LVKNK
Sbjct  304   LHFKGFVISDFEGIDRITSPPRANITYSIEAGVSAGIDMFMVPKHYTEFIDVLTMLVKNK  363

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAV+RIL VKF+MG+FE+P  DYSLA +LG ++HR LAR+AVRKS+VLLKNG
Sbjct  364   HIPMSRIDDAVRRILWVKFMMGIFENPFADYSLAKYLGIQEHRNLAREAVRKSMVLLKNG  423

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTV  1640
              +AD+P+LPL KKA +ILVAG+HADN+GYQCGGWTIEWQG+SG N+  GTTIL A+K+TV
Sbjct  424   ESADKPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILAAVKDTV  483

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D +T V+++ENPD EFVKS++FS+AIVVVGE  YAE  GDS NLTIPEPGP II NVC  
Sbjct  484   DPETTVVYKENPDVEFVKSNEFSYAIVVVGEHPYAEMHGDSMNLTIPEPGPEIITNVCGA  543

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVV++I+GRPVVI+PY+  IDALVAAWLPG+EGQGVADVLFGDYGF+GKLP TWFKTV
Sbjct  544   IKCVVIIISGRPVVIEPYVGSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRTWFKTV  603

Query  2001  DQ  2006
             DQ
Sbjct  604   DQ  605



>ref|XP_003601350.1| Beta-D-glucosidase [Medicago truncatula]
 gb|AES71601.1| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=627

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/600 (70%), Positives = 495/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MGK S  ++GV LLC  V  + A+Y  YKD + P+ RRIKDL+SRMTL+EKIGQM Q+ER
Sbjct  1     MGKSSITVVGVLLLCFLVSFSEAEYRKYKDPKVPLNRRIKDLMSRMTLEEKIGQMTQLER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+ + M KY++GSVLS GGSVP  +ASAE WV MVN  Q  +LST LGIPMIYGIDAV
Sbjct  61    SVATPEAMTKYFIGSVLSGGGSVPAEKASAETWVKMVNQIQNAALSTPLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHNVGLG TRDP L+++IG ATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNVGLGVTRDPVLIKKIGEATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP+IV+ MTEIIPGLQG+ P N     PFVAG+ KVAACAKH+VGDGGT KG
Sbjct  181   RCYESYSEDPKIVKTMTEIIPGLQGDIPGNSRKGTPFVAGKNKVAACAKHFVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++    L  IHM  YY+S+I+GV+TVM SY+S NG +MHANRD++TG+LK  LR
Sbjct  241   INENNTVISYKGLLGIHMPAYYDSVIKGVSTVMISYTSWNGKKMHANRDLVTGYLKNKLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+   ++AGIDM+MVPYN+TEFID LT+ VKN  +
Sbjct  301   FRGFVISDWQGIDRITSPPHANYSYSVEAGVSAGIDMIMVPYNFTEFIDDLTFQVKNNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV RILRVKF MGLFE+PL D SL + LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  361   PISRIDDAVARILRVKFTMGLFENPLADLSLINQLGSKEHRELAREAVRKSLVLLKNGKY  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             A++P+LPL KKAS++LVAG+HADN+G QCGGWTI WQGLSG ++T GTTIL  IK TVD 
Sbjct  421   ANKPLLPLPKKASKVLVAGSHADNLGNQCGGWTITWQGLSGSDLTTGTTILDGIKQTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V++ ENPD  F+KS+KFS+AIV+VGEK YAE  GDS NLTI EPGPS I NVC   +
Sbjct  481   ATEVVYNENPDANFIKSNKFSYAIVIVGEKPYAETFGDSLNLTIAEPGPSTITNVCGSIQ  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVL+TGRPVVIQPYL +IDALVAAWLPGTEGQGVADVL+GD+ F+GKL  TWFKTVDQ
Sbjct  541   CVVVLVTGRPVVIQPYLSKIDALVAAWLPGTEGQGVADVLYGDFEFTGKLARTWFKTVDQ  600



>gb|KGN66708.1| hypothetical protein Csa_1G661750 [Cucumis sativus]
Length=627

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/586 (71%), Positives = 493/586 (84%), Gaps = 1/586 (0%)
 Frame = +3

Query  252   CCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylg  431
             CC+   A A+   YKD  Q +  RIKDLL RMTL+EKIGQMVQIER  AS +VMKKY++G
Sbjct  15    CCFETGAKAENFKYKDPTQRLNVRIKDLLGRMTLEEKIGQMVQIERVNASTEVMKKYFIG  74

Query  432   svlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPH  611
             SVLS GGSVP  +ASA+ W++MVN  QKG+LSTRLGIPMIYGIDAVHG+NN YNATIFPH
Sbjct  75    SVLSGGGSVPSKQASAQDWINMVNEIQKGALSTRLGIPMIYGIDAVHGHNNVYNATIFPH  134

Query  612   NVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVR  791
             N+GLGATRDP+L++ IG A+A E+RATGI Y FAPC+AVCRDPRWGRCYESY EDP+IV+
Sbjct  135   NIGLGATRDPQLLKRIGVASAREIRATGIPYAFAPCVAVCRDPRWGRCYESYGEDPKIVQ  194

Query  792   AMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLF  971
              MTEIIPGLQGE PPN     P+VAG+E V ACAKHYVGDGGT KGIDENNT++D H L 
Sbjct  195   EMTEIIPGLQGEIPPNSRKGVPYVAGKENVVACAKHYVGDGGTTKGIDENNTVIDRHGLL  254

Query  972   SIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDN  1151
             SIHM GYY+SII+GVAT+M SYSS NG +MHAN++++T FLK TL F+GFVISD++AID 
Sbjct  255   SIHMPGYYHSIIKGVATIMVSYSSWNGEKMHANKNLVTDFLKNTLHFQGFVISDWEAIDR  314

Query  1152  LTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILR  1331
             +T   H NYTYSIL SI AG+DM+M+PYNY EFIDGLT LVK+ ++P+SRIDDAVKRILR
Sbjct  315   ITDPPHANYTYSILASITAGLDMIMIPYNYPEFIDGLTNLVKSNYIPISRIDDAVKRILR  374

Query  1332  VKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASR  1511
             VKFVMGLFE+P+ D SL + LG ++HR+LAR+AVRKSLVLLKNG +AD+P+LPL KK  +
Sbjct  375   VKFVMGLFENPIADLSLVNELGKQEHRELAREAVRKSLVLLKNGKSADKPLLPLEKKTQK  434

Query  1512  ILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEF  1688
             ILVAG+HA+N+GYQCGGWTIEWQGLSG N+T GTT+L AIK+TVD  T+V+F ENPD + 
Sbjct  435   ILVAGSHANNLGYQCGGWTIEWQGLSGNNLTSGTTVLDAIKDTVDPTTEVIFNENPDKKS  494

Query  1689  VKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQ  1868
             ++S  FS+AIVVVGE  YAE +GDS NLTIP+PGP+ I NVC   KC VV+I+GRPVVIQ
Sbjct  495   LQSDTFSYAIVVVGEHPYAELNGDSLNLTIPDPGPNTITNVCGVIKCAVVIISGRPVVIQ  554

Query  1869  PYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             PY+  IDALVAAWLPGTEG+G+ DVLFGDYGF+GKL  TWFKTVDQ
Sbjct  555   PYVDSIDALVAAWLPGTEGKGITDVLFGDYGFTGKLSQTWFKTVDQ  600



>gb|KGN59736.1| hypothetical protein Csa_3G842090 [Cucumis sativus]
Length=629

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/593 (71%), Positives = 502/593 (85%), Gaps = 1/593 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
              +G+ +LC    +A A+Y+ YKD +QP+  RIKDLL RMTL+EKIGQMVQIER  ASA V
Sbjct  10    FVGLLVLCFSETLAKAEYLKYKDPKQPLNVRIKDLLGRMTLEEKIGQMVQIERANASADV  69

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             MK+Y++GSVLS GGS P  +ASA+ WV MVN  Q+ +LSTRLGIPMIYGIDAVHG+NN Y
Sbjct  70    MKQYFIGSVLSGGGSAPSKQASAKDWVHMVNKIQEAALSTRLGIPMIYGIDAVHGHNNVY  129

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
             NATIFPHN+GLGATRDP+L++ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYESY 
Sbjct  130   NATIFPHNIGLGATRDPQLLKRIGAATALEVRATGIPYAFAPCIAVCRDPRWGRCYESYG  189

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED  IV+AMTEIIPGLQG+ P N     P+VAG+  VAACAKH+VGDGGT KGI+ENNT+
Sbjct  190   EDHTIVQAMTEIIPGLQGDVPANIRKGVPYVAGKNNVAACAKHFVGDGGTTKGINENNTV  249

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             VD H LFSIHM  YYNSII+GVATVM SYSS+NG +MHAN+ ++T FLK TL F+GFVIS
Sbjct  250   VDGHGLFSIHMPAYYNSIIKGVATVMVSYSSINGEKMHANKKLVTDFLKNTLHFKGFVIS  309

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ ID +T   H NYTYSIL S+NAG+DM+MVPYNYTEFIDGLTYLVKN  +P+SRIDD
Sbjct  310   DWQGIDKITTPPHANYTYSILASVNAGVDMIMVPYNYTEFIDGLTYLVKNNAIPISRIDD  369

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AVKRILRVKFVMGLFE+PL D SL + LG ++HR+LAR+AVRKSLVLLKNG   ++P+LP
Sbjct  370   AVKRILRVKFVMGLFENPLADLSLINELGKQEHRELAREAVRKSLVLLKNGKLPNQPLLP  429

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFE  1667
             L KKA +ILVAGTHA+++G QCGGWT+EWQGL+G N+T GTTILTAIK+TVD +T+V+F 
Sbjct  430   LPKKAPKILVAGTHANDLGNQCGGWTMEWQGLTGNNLTSGTTILTAIKDTVDPETEVVFH  489

Query  1668  ENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLIT  1847
             +NP+ EF+++ +FS+AIVVVGE  YAE +GDS NLTIPEPGP  I NVC   KCVVV+I+
Sbjct  490   DNPNAEFLQTHQFSYAIVVVGEHPYAETNGDSLNLTIPEPGPETIKNVCGAVKCVVVVIS  549

Query  1848  GRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             GRPVV+QPY+  IDA+VAAWLPGTEG+G++DVLFGDYGF+GKL  TWFK+VDQ
Sbjct  550   GRPVVLQPYIDSIDAVVAAWLPGTEGKGISDVLFGDYGFTGKLSQTWFKSVDQ  602



>ref|XP_003548467.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006598970.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
 ref|XP_006598971.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Glycine 
max]
 ref|XP_006598972.1| PREDICTED: lysosomal beta glucosidase-like isoform X4 [Glycine 
max]
Length=631

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/600 (69%), Positives = 501/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K S  L+G+ +L  W  + +A+YM YKD +Q +  R++DL+SRMTL+EKIGQM+QIER
Sbjct  1     MAKISILLVGLWVLGSWTGLLDAEYMKYKDPKQSIDTRVEDLVSRMTLEEKIGQMLQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + ASA ++KKY++GSV+S GGSVP P+ASAE W+DMVN FQKG++STRLGIPM YGIDAV
Sbjct  61    KYASADLVKKYFIGSVMSEGGSVPAPQASAETWIDMVNEFQKGAVSTRLGIPMFYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+N  Y ATIFPHN+GLGATRDPELV+ IGAATALE+RATGIQY +APCIAVCRDPRWG
Sbjct  121   HGHNTIYKATIFPHNIGLGATRDPELVKRIGAATALEIRATGIQYTYAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP++V+AMTEIIPGLQGE P N P   PF+ G+EKV ACAKHYVGDGGT+ G
Sbjct  181   RCYESYSEDPKLVQAMTEIIPGLQGEIPDNLPKGVPFITGKEKVLACAKHYVGDGGTING  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT++D   L  IHM GY+NSI +GVA++M SYSS NG +MHAN+D+ITG+LK TL 
Sbjct  241   IDENNTVIDRDGLMRIHMPGYFNSISKGVASIMVSYSSWNGEKMHANQDLITGYLKNTLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISDF+ ID +T   H N+TYSI   ++AGIDM M P  Y EFI+ LT LVKNKF+
Sbjct  301   FKGFVISDFEGIDRITSPPHANFTYSIEAGVSAGIDMFMNPKLYIEFIEDLTMLVKNKFI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV+RIL VKF+MG+FE P  DYSL  +LG +KHR+LAR+AVRKS+VLLKNG +
Sbjct  361   PMSRIDDAVRRILWVKFMMGIFETPFADYSLVRYLGIQKHRQLAREAVRKSMVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD+P+LPL KK  +ILVAG+HADN+GYQCGGWTI+WQG+SG N+  GTTIL A+KNTVD 
Sbjct  421   ADKPLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGVSGNNLLKGTTILAAVKNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T V++++NPD EFVKS+ FS+AIVVVGE  YAE  GD+ NLTIP+ GP  I NVC   K
Sbjct  481   DTTVVYKDNPDAEFVKSNGFSYAIVVVGEHPYAEMHGDNMNLTIPDHGPETITNVCGAIK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV++I+GRPVVI+PY+  IDALVAAWLPG+EGQGVADVLFGDYGF+GKLP TWFKTVDQ
Sbjct  541   CVVIIISGRPVVIEPYVGSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRTWFKTVDQ  600



>ref|XP_009804819.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
 ref|XP_009804820.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=634

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/581 (72%), Positives = 493/581 (85%), Gaps = 2/581 (0%)
 Frame = +3

Query  267   VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlss  446
             +A  DY+LYKD  +P+  RI+DL+SRMTL EKIGQM Q++R++ + ++MK Y +GSVLS 
Sbjct  23    MAEGDYLLYKDPTKPLNIRIRDLMSRMTLAEKIGQMTQLDRRILTPKIMKDYGIGSVLSG  82

Query  447   ggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLG  626
             GGSVPKP A+A  WVDMVN FQKG+LSTRLGIPMIYGIDAVHG+NN Y AT+FPHNVGLG
Sbjct  83    GGSVPKPEATAREWVDMVNEFQKGALSTRLGIPMIYGIDAVHGHNNVYKATVFPHNVGLG  142

Query  627   ATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEI  806
             ATRDPELV+ IGAATA+EVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIV+ MTEI
Sbjct  143   ATRDPELVKRIGAATAIEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVKQMTEI  202

Query  807   IPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMA  986
             IPGLQG+ PP      P+VAG+EKVAACAKH+VGDGGT KGI+ENNT+ D H L SIHM 
Sbjct  203   IPGLQGDHPPR-KAGIPYVAGKEKVAACAKHFVGDGGTTKGINENNTVTDWHTLLSIHMP  261

Query  987   GYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTV  1166
             GYY SII+GV+TVM SYSS NGV+MHA+ +++T FLK TL+FRGFVISD++ ID +T   
Sbjct  262   GYYQSIIKGVSTVMVSYSSWNGVKMHAHHNLVTNFLKDTLKFRGFVISDWQGIDRITSPP  321

Query  1167  HGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVM  1346
             H NYT+S+LT + AGIDM+MVP N+TEFID LT LV N ++P+SRIDDAV+RILRVKF M
Sbjct  322   HANYTHSVLTGVQAGIDMIMVPLNHTEFIDILTSLVNNNYIPMSRIDDAVRRILRVKFTM  381

Query  1347  GLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAG  1526
             GLFE+PL DY L  HLGS+ HR LAR+AVRKSLVLLKNGANADEPVLPL KKA+RILVAG
Sbjct  382   GLFENPLADYRLVKHLGSQAHRDLAREAVRKSLVLLKNGANADEPVLPLPKKATRILVAG  441

Query  1527  THADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSK  1703
             +HA+N+GYQCGGWTI WQG+ G N+T+GTTI+ AI  TVD  T+V++ ENP  E+++S+K
Sbjct  442   SHANNLGYQCGGWTITWQGVEGNNVTLGTTIVDAITATVDPSTEVVYSENPTTEYMESNK  501

Query  1704  FSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQ  1883
             FS+AIVVVGE  YAE +GD+ NLTIPE G + + NVC   KCVVVLI+GRP+V+QP+L  
Sbjct  502   FSYAIVVVGELPYAETAGDNLNLTIPEQGITTMNNVCGSIKCVVVLISGRPLVVQPHLSN  561

Query  1884  IDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             IDALVAAWLPGTEGQGVADVLFGDY F+GKL  TWFKTVDQ
Sbjct  562   IDALVAAWLPGTEGQGVADVLFGDYEFTGKLSRTWFKTVDQ  602



>ref|XP_010031611.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 gb|KCW50980.1| hypothetical protein EUGRSUZ_J00609 [Eucalyptus grandis]
Length=634

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/589 (71%), Positives = 487/589 (83%), Gaps = 2/589 (0%)
 Frame = +3

Query  246   LLCCWVV-VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKky  422
             LLC W   V  ++YM YKD +QP+  RI+DL+ RMTL EKIGQM QIER  ASA VMK Y
Sbjct  18    LLCFWAASVTGSEYMKYKDPKQPINVRIEDLMKRMTLAEKIGQMTQIERSNASADVMKNY  77

Query  423   ylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATI  602
             ++GSVLS GGSVP P A  E WV+MVN FQ+G+LSTRLGIPMIYGIDAVHG+NN Y ATI
Sbjct  78    FIGSVLSGGGSVPAPNAPVETWVNMVNEFQRGALSTRLGIPMIYGIDAVHGHNNVYKATI  137

Query  603   FPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPE  782
             FPHNVGLG TRDP+LV++IGAATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSEDP 
Sbjct  138   FPHNVGLGVTRDPQLVKKIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSEDPA  197

Query  783   IVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTH  962
             IV+ MTEIIPGLQG+ PP      PFVAG+  VA+CAKHYVGDGGT  GI+ENNT++D H
Sbjct  198   IVKTMTEIIPGLQGDIPPGSRKGVPFVAGKNNVASCAKHYVGDGGTTNGINENNTVIDFH  257

Query  963   DLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKA  1142
              L SIHM GY++++I+GV+T+M SYSS NGV+MHAN D+ITG LK  LRFRGFVISD++ 
Sbjct  258   GLLSIHMQGYFSAVIKGVSTIMISYSSWNGVKMHANHDLITGLLKNKLRFRGFVISDWQG  317

Query  1143  IDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKR  1322
             ID +TP    NYTYS+ T + AGIDM+MVPYNYT+FI  LT LV   F+P+SRIDDAVKR
Sbjct  318   IDRMTPIAGSNYTYSVQTGVLAGIDMIMVPYNYTDFIGNLTMLVNKNFIPMSRIDDAVKR  377

Query  1323  ILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKK  1502
             ILRVKF MGLFE+P+ D SL+H LGS++HR+LAR+AVRKSLVLLKNG    EPVLPL KK
Sbjct  378   ILRVKFTMGLFENPIADLSLSHQLGSQEHRELAREAVRKSLVLLKNGKPGQEPVLPLPKK  437

Query  1503  ASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPD  1679
             A +ILVAGTHADN+GYQCGGWTI WQG SG N ++GTTIL A++ TV+  T+V++ E PD
Sbjct  438   APKILVAGTHADNLGYQCGGWTITWQGTSGNNNSVGTTILDAVRKTVNPSTEVVYNEEPD  497

Query  1680  PEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPV  1859
               FV SSKFS+AIVVVGE +YAE  GDS N++IP+PGPSII NVC   KCVVV+I+GRPV
Sbjct  498   AGFVASSKFSYAIVVVGEHSYAESYGDSMNMSIPDPGPSIIKNVCGSVKCVVVIISGRPV  557

Query  1860  VIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VI+PY+ Q+DALVAAWLPGTEG G+ DVLFGDYGF+GKL  TWF+TVDQ
Sbjct  558   VIEPYVAQMDALVAAWLPGTEGLGITDVLFGDYGFTGKLARTWFRTVDQ  606



>ref|XP_002313632.1| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEE87587.1| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=627

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/602 (71%), Positives = 498/602 (83%), Gaps = 5/602 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ SR ++G  LLCC +V   A+Y+ YKD + P+G RIKDL+ RMTL+EKIGQMVQIER
Sbjct  1     MGRLSRPILGFLLLCCLIVAGEAEYLKYKDPKMPIGARIKDLMKRMTLEEKIGQMVQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+  VMK+Y++GSVLS GGSVP P+ASAEAWV++VNG QK SLSTRLGIPMIYGIDAV
Sbjct  61    TVATPDVMKQYFIGSVLSGGGSVPGPKASAEAWVNLVNGIQKASLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG++N YNATIFPHNVGLG TR  +LV++IG ATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHSNVYNATIFPHNVGLGVTR--QLVKKIGEATALEVRATGIPYAFAPCIAVCRDPRWG  178

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVA-GREKVAACAKHYVGDGGTVK  926
             RCYESYSED  IV+ MTEIIPGLQGE P N     PFVA G  KVAACAKH+VGDGGT K
Sbjct  179   RCYESYSEDHRIVQLMTEIIPGLQGELPANSKKGVPFVAPGNTKVAACAKHFVGDGGTTK  238

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GIDENNT++  + L +IHM  YYN+I +GVATVM SYSS NG RMH NRD++TGFLK  +
Sbjct  239   GIDENNTVISMNGLLNIHMPAYYNAISKGVATVMVSYSSWNGKRMHINRDLVTGFLKNKM  298

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +FRGFVISD++ ID +T   H NY+ S+   ++AGIDM+MVP+N+TEFID LTY VKN  
Sbjct  299   KFRGFVISDWQGIDRVTSPPHANYSSSVHAGVDAGIDMIMVPFNFTEFIDDLTYQVKNNI  358

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRI+DAV+RILRVKFVMGLFE PL D S+A+ LGS++HR+LAR+AVRKSLVLLKNG 
Sbjct  359   IPMSRINDAVQRILRVKFVMGLFEKPLADLSMANQLGSQEHRELAREAVRKSLVLLKNGK  418

Query  1467  -NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTV  1640
              +  +P LPL KKA +IL+AG+HADN+GYQCGGWTI WQGL GN +T GTTIL A+KNTV
Sbjct  419   YSTAKPFLPLPKKAPKILIAGSHADNLGYQCGGWTITWQGLGGNDLTTGTTILNAVKNTV  478

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  TQV++ ENPD  FVKS+KFS+AIVVVGE  YAE  GDSSNLTI EPGPS I NVC  
Sbjct  479   DPTTQVVYNENPDSNFVKSNKFSYAIVVVGEPPYAEMYGDSSNLTISEPGPSTINNVCGA  538

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVV++I+GRPVVIQPYL +IDALVAAWLPGTEGQGV D LFGDYGF+GKL  TWFKTV
Sbjct  539   VKCVVIVISGRPVVIQPYLEKIDALVAAWLPGTEGQGVVDNLFGDYGFTGKLARTWFKTV  598

Query  2001  DQ  2006
             DQ
Sbjct  599   DQ  600



>ref|XP_004228467.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Solanum 
lycopersicum]
Length=634

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/601 (71%), Positives = 497/601 (83%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRF-LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MGK  +   IG  L C   +V  A+ M YKD +Q +  RIKDLL RMTL+EKIGQM QIE
Sbjct  1     MGKFVKIPFIGFMLFCVLAMVIEAENMKYKDPKQKLSVRIKDLLKRMTLEEKIGQMTQIE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R+VASA+VM KY++GS+LS GGSVPKP A+AE WV+MVN FQKGSLSTRLGIPMIYGIDA
Sbjct  61    RKVASAEVMSKYFIGSLLSGGGSVPKPNATAEDWVNMVNDFQKGSLSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN Y ATIFPHN+GLG TRDPEL++ IGAATALEVRATGI Y F+PCIAVCR+PRW
Sbjct  121   VHGHNNVYKATIFPHNIGLGVTRDPELMKRIGAATALEVRATGIPYAFSPCIAVCRNPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYES+SED  IVR+MTEIIPGLQG+ P       P+V G+ KVA CAKH+V DGGTV 
Sbjct  181   GRCYESFSEDINIVRSMTEIIPGLQGDLPAGMSKGTPYVNGKTKVAGCAKHFVADGGTVN  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             G+DENNT+VD+  LFSIHM  YY+S+I+GVATVMASYSSLNG RMHAN  ++TGFLKK L
Sbjct  241   GLDENNTIVDSKGLFSIHMPAYYDSVIKGVATVMASYSSLNGDRMHANTHLLTGFLKKRL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              FRGFVISD++ I+ +T   + NYTYS+  SINAGIDMVMVP NYT+FI  LT LV    
Sbjct  301   NFRGFVISDWEGINRITNPANSNYTYSVEASINAGIDMVMVPNNYTDFIGNLTMLVNKNI  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             VP+SRIDDAVKRILRVKFVMGLFEDP+GD+SLA HLGS +HR++AR+AVRKSLVLLKNG 
Sbjct  361   VPMSRIDDAVKRILRVKFVMGLFEDPMGDHSLAKHLGSPEHREIAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGL-SGNITIGTTILTAIKNTVD  1643
                +P+LPL KKA++ILVAGTHA N+GYQCGGWTI WQG+   N+TIGTT+L A+K TVD
Sbjct  421   TPQQPLLPLPKKAAKILVAGTHAHNLGYQCGGWTILWQGVPHNNLTIGTTVLDAVKKTVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               TQV+F E PD  FV+SSKF +A+VVVGE TYAE  GDSSNLTIP+PGPSII NVC   
Sbjct  481   PATQVVFNEVPDSNFVQSSKFDYAVVVVGENTYAEMYGDSSNLTIPDPGPSIIQNVCGAM  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVV+I+GRPVVI+PY+ ++DA+VAAWLPGTEGQG+ADVLFGDYGF+GKL  TWFK VD
Sbjct  541   KCVVVIISGRPVVIEPYVEKMDAIVAAWLPGTEGQGIADVLFGDYGFTGKLARTWFKRVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_003519468.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
Length=627

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/581 (72%), Positives = 484/581 (83%), Gaps = 1/581 (0%)
 Frame = +3

Query  267   VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlss  446
             V  A+Y+ YKD +QP+  RIK+LL RMTL+EKIGQMVQIER VA+ QVMKKY++GSVLS 
Sbjct  20    VLQAEYLKYKDPKQPLNVRIKNLLKRMTLEEKIGQMVQIERSVATPQVMKKYFIGSVLSG  79

Query  447   ggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLG  626
             G SVP   ASAE W+ MVNG Q GSLSTRLGIPMIYGIDAVHGNNN Y ATIFPHNVGLG
Sbjct  80    GESVPATNASAETWIQMVNGIQNGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLG  139

Query  627   ATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEI  806
              TRDP L+++IG ATALEVRATGIQYVFAPCIAVCRDPRWGRC+ESYSEDP+I +AMTEI
Sbjct  140   VTRDPVLIKKIGDATALEVRATGIQYVFAPCIAVCRDPRWGRCFESYSEDPKIAQAMTEI  199

Query  807   IPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMA  986
             IPGLQG+   N     P+V+G+ KVAACAKHYVGDGGT KGI+ENNT++   +L  IHM 
Sbjct  200   IPGLQGDISSNSRKGVPYVSGKNKVAACAKHYVGDGGTTKGINENNTVISYSELLRIHMP  259

Query  987   GYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTV  1166
              YY+SI++GV+TVM SYSS NG +MHAN  ++T +LK  L+FRGFVISD+  ID +T   
Sbjct  260   PYYDSIVKGVSTVMVSYSSWNGQKMHANHFLVTNYLKNKLKFRGFVISDWLGIDKITSPP  319

Query  1167  HGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVM  1346
             H NY+YSI   + AGIDM+MVP+N+TEFID LTY VKN  +PVSRIDDAVKRILRVKFVM
Sbjct  320   HSNYSYSIQVGVGAGIDMIMVPFNFTEFIDVLTYQVKNNIIPVSRIDDAVKRILRVKFVM  379

Query  1347  GLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAG  1526
             GLFE+PL D SL + LGS +HR++AR+AVRKSLVLLKNG +A++P+LPL KKA++ILVAG
Sbjct  380   GLFENPLADLSLVNQLGSEEHRQIAREAVRKSLVLLKNGKSAEKPLLPLPKKAAKILVAG  439

Query  1527  THADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSK  1703
             +HADN+GYQCGGWTI WQGL G N+T+GTTIL A+K T+D  T+V+F ENPD  FVKS+ 
Sbjct  440   SHADNLGYQCGGWTITWQGLGGNNLTVGTTILEAVKQTIDPATKVVFNENPDSNFVKSNN  499

Query  1704  FSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQ  1883
             FS AIVVVGE  YA   GDS NLTIPEPGPS I NVC   +CVVVLITGRPVVIQPYL +
Sbjct  500   FSCAIVVVGEHPYATTFGDSLNLTIPEPGPSTITNVCGSIQCVVVLITGRPVVIQPYLSK  559

Query  1884  IDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +DALVAAWLPGTEGQGVAD+LFGDYGF+GKL  TWFKTVDQ
Sbjct  560   VDALVAAWLPGTEGQGVADLLFGDYGFTGKLARTWFKTVDQ  600



>emb|CDP15627.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/587 (70%), Positives = 492/587 (84%), Gaps = 0/587 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             +L  W  V  A+YM YKD  +PV  R++DLLSRMTL+EKIGQM QI+R+++S ++MKKY+
Sbjct  13    VLHLWTAVTEAEYMKYKDPNRPVNVRVRDLLSRMTLEEKIGQMTQIDRKISSKEIMKKYF  72

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GSVLS GGS P P ASAE W++M+N FQ+G+LSTRLGIPMIYGIDA+HGNNN YNATIF
Sbjct  73    IGSVLSGGGSYPSPTASAETWINMINEFQEGALSTRLGIPMIYGIDAIHGNNNVYNATIF  132

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHN+GLG TRDPELV+ IGAATALE RATGI Y FAPCIAVCRDPRWGRCYESYSED +I
Sbjct  133   PHNIGLGVTRDPELVKRIGAATALETRATGIPYTFAPCIAVCRDPRWGRCYESYSEDHKI  192

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             V+AMTEIIPGLQG+ P N+P   P++AGR KVA CAKH+VGDGGT  GI+ENNT++D + 
Sbjct  193   VQAMTEIIPGLQGDVPANFPKGIPYIAGRNKVAGCAKHFVGDGGTTNGINENNTVIDWNG  252

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             L SIHM  Y +SI +GVATVM SYSS NG +MHAN+ +ITG+LKK L+F+GFVISD + I
Sbjct  253   LQSIHMPAYLDSIKKGVATVMVSYSSWNGEKMHANKKLITGYLKKQLKFKGFVISDSQGI  312

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T   H NYTYS+   I AGIDM+MVP  +TEFID LT LVK   +P+SRIDDAV+RI
Sbjct  313   DRITSPPHANYTYSVEAGILAGIDMIMVPEKFTEFIDDLTSLVKKNVIPMSRIDDAVRRI  372

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LRVKFV+GLFE+P+ DYSL H LGS++HR+LAR+AVRKSLVLLKNG N DEP+LPL K+A
Sbjct  373   LRVKFVLGLFENPMADYSLVHELGSQEHRELAREAVRKSLVLLKNGKNIDEPLLPLPKRA  432

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPE  1685
             S+ILVAG+HA NIG QCGGWTIEW+GL+GNIT+GTTILTA+KNTVD  T+V++ ENP+ E
Sbjct  433   SKILVAGSHAHNIGNQCGGWTIEWRGLAGNITVGTTILTAVKNTVDPLTEVVYRENPETE  492

Query  1686  FVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVI  1865
              +KS+KFS+AIVVVGE  Y+E  GD+ NLTIPE G   I NVC   KCVVV+I+GRPVVI
Sbjct  493   LLKSNKFSYAIVVVGEPPYSESFGDNMNLTIPESGIRTITNVCEAIKCVVVIISGRPVVI  552

Query  1866  QPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +PYL +I+ALVAAWLPGTEGQGVADVLFG YGF+GKL  TWFKTVDQ
Sbjct  553   EPYLAKIEALVAAWLPGTEGQGVADVLFGGYGFTGKLARTWFKTVDQ  599



>ref|XP_008464960.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=628

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/593 (70%), Positives = 500/593 (84%), Gaps = 1/593 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
              +G+ +LC    +A A+Y+ YKD +QP+  RIKDL  RMTL+EKIGQMVQIER  AS  V
Sbjct  9     FVGLLVLCFSETLAKAEYLKYKDPKQPLNVRIKDLFGRMTLEEKIGQMVQIERANASMDV  68

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             M+KY++GSVLS GGSVP   ASA+ WV MVN  Q+G+LSTRLGIPMIYGIDA+HG+NN Y
Sbjct  69    MRKYFIGSVLSGGGSVPSKNASAKTWVHMVNKIQEGALSTRLGIPMIYGIDAIHGHNNVY  128

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
             NATIFPHN+GLGATRDP+L++ IG ATALEVRATGI Y FAPCIAVCRDPRWGRCYESY 
Sbjct  129   NATIFPHNIGLGATRDPQLIKRIGVATALEVRATGIPYAFAPCIAVCRDPRWGRCYESYG  188

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED +IV+AMTEIIPGLQG+ P N     P+VAG+  VAACAKH+VGDGGT KGI+ENNT+
Sbjct  189   EDHKIVQAMTEIIPGLQGDLPSNIRKGVPYVAGKNNVAACAKHFVGDGGTTKGINENNTV  248

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             +D H LFSIHM  YYNSII+GVAT+M SYSS+NG +MHAN+ ++T FLK TL F+GFVIS
Sbjct  249   IDGHGLFSIHMPAYYNSIIKGVATIMVSYSSVNGEKMHANKKLVTDFLKNTLHFKGFVIS  308

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ ID +T   H NYTYSIL S+NAG+DM+MVPYNYTEFID LTYLVKN  +P+SRIDD
Sbjct  309   DWQGIDKITSPPHANYTYSILASVNAGVDMIMVPYNYTEFIDALTYLVKNNAIPISRIDD  368

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AVKRILRVKFVMGLFE+PL D SL + +G ++HR+LAR+AVRKSLVLLKNG   ++P+LP
Sbjct  369   AVKRILRVKFVMGLFENPLADLSLVNEIGKQEHRELAREAVRKSLVLLKNGKLPNQPLLP  428

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFE  1667
             L KKA +ILVAGTHA+++G QCGGWTIEWQGL+G N+T GTT+LTAIK+TVD +T+V+F+
Sbjct  429   LPKKAPKILVAGTHANDLGNQCGGWTIEWQGLTGNNLTSGTTVLTAIKDTVDPETEVVFD  488

Query  1668  ENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLIT  1847
              NP+ EF+K+ +FS+AIVVVGE  YAE +GDS NLTIPEPGP  I NVC   KCVVV+I+
Sbjct  489   NNPNAEFLKTHQFSYAIVVVGEHPYAETNGDSLNLTIPEPGPETIKNVCGAVKCVVVVIS  548

Query  1848  GRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             GRPVVIQPY+  IDALVAAWLPGTEG+G++DVLFGDYGF+GKL  TWFK+VDQ
Sbjct  549   GRPVVIQPYIDSIDALVAAWLPGTEGKGISDVLFGDYGFTGKLSQTWFKSVDQ  601



>ref|XP_002266675.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=629

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/600 (70%), Positives = 488/600 (81%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K S   +G+ L+     +  A    YKD +QP+  RI+DL++RMTL EKIGQMVQ+ER
Sbjct  1     MAKVSVIWVGLLLVFGLAAMGEAASEKYKDPKQPINIRIRDLMNRMTLAEKIGQMVQLER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
               A+ ++MK + +GS+LS GGS P  +A+AE W++MVN FQKGSLS+RLGIPMIYGIDAV
Sbjct  61    ANATPEIMKDFSIGSLLSGGGSGPGIQATAEDWINMVNEFQKGSLSSRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHNVGLGATRDPELV+ IGAATA+EVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNVGLGATRDPELVKRIGAATAIEVRATGISYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP IVRAMTEIIPGLQGE P N     P+V G++KVAACAKH+VGDGGT  G
Sbjct  181   RCYESYSEDPNIVRAMTEIIPGLQGEIPANSRKGVPYVNGKDKVAACAKHFVGDGGTTNG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++D H L SIHM  YY+SII+GVATVM SYSS NG +MHAN +++TGFLK TL+
Sbjct  241   INENNTVIDRHGLLSIHMPAYYSSIIKGVATVMVSYSSWNGKKMHANHELVTGFLKNTLQ  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYS+   + AGIDMVM+P+N+TEFID LT LV++  +
Sbjct  301   FRGFVISDWQGIDRITSPPHANYTYSVQAGVQAGIDMVMLPFNHTEFIDILTNLVESNVI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV+RILRVKF MGLFE+PL D S    LGS+ HR LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVRRILRVKFSMGLFENPLADLSFVDQLGSQAHRDLAREAVRKSLVLLKNGDE  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD P+LPL KKA++ILVAGTHA ++GYQCGGWTI WQGLSG N T GTTIL+AI   VD 
Sbjct  421   ADAPLLPLPKKANKILVAGTHAHDLGYQCGGWTITWQGLSGNNHTTGTTILSAISAAVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+++F ENPD EFVKS+ FS+A+VV+GE  YAE +GDS NLTI EPGPS I NVC   K
Sbjct  481   STEIVFTENPDAEFVKSNNFSYAVVVIGEPPYAETAGDSLNLTISEPGPSTITNVCSGVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRPVVIQPYL  I ALVAAWLPGTEGQGV DVLFGDYGF+GKLP TWFKTVDQ
Sbjct  541   CVVVVISGRPVVIQPYLSSIHALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTWFKTVDQ  600



>ref|XP_009760946.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=624

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/597 (71%), Positives = 499/597 (84%), Gaps = 4/597 (1%)
 Frame = +3

Query  222   SRFLI-GVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVA  398
              RFLI G  L     VV  A++M YKD +Q +G RIKDL+ RMTL+EKIGQM QIER+VA
Sbjct  2     ERFLIMGFMLFSLLAVVTEAEHMKYKDPKQKLGVRIKDLMKRMTLEEKIGQMTQIERKVA  61

Query  399   SAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGN  578
             SA VM+KY++GS+LS GGSVPKP ASAE WV+MVN FQKG+L TRLGIPMIYGIDAVHG+
Sbjct  62    SADVMRKYFIGSLLSGGGSVPKPNASAEDWVNMVNEFQKGALKTRLGIPMIYGIDAVHGH  121

Query  579   NNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCY  758
             NN Y ATIFPHNVGLG TRDP+LV+ IGAATALEVRATGIQY F+PC+AVCR+PRWGRCY
Sbjct  122   NNVYKATIFPHNVGLGVTRDPDLVKRIGAATALEVRATGIQYAFSPCLAVCRNPRWGRCY  181

Query  759   ESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDE  938
             ESYSED  IVR+MTEIIPGLQG+ P N     PFV G++KV ACAKH+V DGGTV GIDE
Sbjct  182   ESYSEDVNIVRSMTEIIPGLQGDVPANMSKGVPFVDGKKKVVACAKHFVADGGTVNGIDE  241

Query  939   NNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRG  1118
             NNT++D   LFSIHM  YY+S+I+GVATVMASYSSLNG RMHAN  ++TGFLK+ L FRG
Sbjct  242   NNTVIDPQGLFSIHMPAYYDSVIKGVATVMASYSSLNGERMHANTHLLTGFLKERLNFRG  301

Query  1119  FVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVS  1298
             FVISD++ I+ +T   + NYTYS+  S+ AG+DMVMVP NYT+FI  LT+LVKN FVP+S
Sbjct  302   FVISDWEGINRITNPANSNYTYSVQASVMAGVDMVMVPENYTDFIGNLTFLVKNNFVPMS  361

Query  1299  RIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADE  1478
             RIDDAVKRILRVKFVMGLFEDP+ D S+A +LG ++HR+LAR+AVRKSLVLLKNG   D+
Sbjct  362   RIDDAVKRILRVKFVMGLFEDPMADLSMAKYLGCKEHRELAREAVRKSLVLLKNGKKPDQ  421

Query  1479  PVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQ  1655
             P+LPL KKA RILVAGTHADN+GYQCGGWTI+WQG+ G N+TIGTTI  AI NTVD  T+
Sbjct  422   PLLPLPKKARRILVAGTHADNLGYQCGGWTIQWQGVPGNNLTIGTTISKAIMNTVDPSTE  481

Query  1656  VMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVV  1835
             V++++N  P  V+SS+F +AIVVVGE  YAE  GDSSNLTI +PGPSII N+C   KCVV
Sbjct  482   VVYQQN--PVLVESSQFDYAIVVVGEPPYAEMYGDSSNLTILDPGPSIIKNICGTVKCVV  539

Query  1836  VLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             V+I+GRPVVI+PY+ ++DALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFK VDQ
Sbjct  540   VVISGRPVVIEPYVEKMDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKRVDQ  596



>ref|XP_009394272.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=629

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/592 (70%), Positives = 490/592 (83%), Gaps = 0/592 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             ++G+  L CW     A+YM YKD +Q V  RIKDL+ RMTL EKIGQM QIER  AS++V
Sbjct  8     MLGLVFLLCWAATTQAEYMKYKDPKQSVNVRIKDLMKRMTLAEKIGQMTQIERANASSRV  67

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             +K Y++GS+LS GGSVP P+ASA+ WV+M+  FQK  LSTRLGIPMIYGIDAVHG+NN Y
Sbjct  68    LKDYFIGSILSGGGSVPAPQASAKDWVEMITTFQKACLSTRLGIPMIYGIDAVHGHNNVY  127

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
             NATIFPHN+GLGATRDP LV+ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYESYS
Sbjct  128   NATIFPHNIGLGATRDPGLVKRIGAATALEVRATGIPYAFAPCIAVCRDPRWGRCYESYS  187

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED  +V+AMTE+IPGLQG+ PPNY   FPFVAG+  VAAC+KH+VGDGGT KGIDENNT+
Sbjct  188   EDHGVVQAMTELIPGLQGDVPPNYAKDFPFVAGKNNVAACSKHFVGDGGTQKGIDENNTI  247

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             +D H+LF IHM  Y +SI +GV+TVM SYSS NGV+MHANR ++TG LKK L F+GFVIS
Sbjct  248   IDAHELFGIHMPAYIDSIAKGVSTVMVSYSSWNGVKMHANRRLVTGHLKKKLGFKGFVIS  307

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ ID +T     NYTYS+  SI AG+DMVMVPY+Y  FI  LT LV  K +P+ RI+D
Sbjct  308   DWQGIDRITTPPGANYTYSVQASITAGLDMVMVPYDYPAFIGTLTNLVNQKVIPMKRIND  367

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV+RILRVKFV+GLFE+PL D SLA  +G ++HR+LAR+AVRKSLVLLKNG +++EP+LP
Sbjct  368   AVRRILRVKFVLGLFENPLPDPSLADQIGKQEHRELAREAVRKSLVLLKNGKSSNEPLLP  427

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEE  1670
             L KKA +ILVAG+HADNIGYQCGGWTIEWQG SGNIT GTTIL AI++TVD  T V+F E
Sbjct  428   LPKKADKILVAGSHADNIGYQCGGWTIEWQGGSGNITGGTTILDAIRSTVDPATNVVFSE  487

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
              PD + V+S+ FS+AIVVVGE  YAE +GDS NLTIPEPGPS I  VC   +CVVVLI+G
Sbjct  488   KPDADLVQSNHFSYAIVVVGEPPYAETAGDSLNLTIPEPGPSTIQTVCGAVRCVVVLISG  547

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RPVVIQPYLP +DALVAAWLPG+EGQGVADVLFGD+GF+GKLP TWFK+V+Q
Sbjct  548   RPVVIQPYLPVMDALVAAWLPGSEGQGVADVLFGDFGFAGKLPRTWFKSVEQ  599



>ref|XP_002266589.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=629

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/600 (69%), Positives = 487/600 (81%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K S   +G+ L+     +  A    YKD +QP+  RI+DL+ RMTL EKIGQMVQ+ER
Sbjct  1     MAKVSVIWVGLLLVFGLAAMGEAASEKYKDPKQPINIRIRDLMYRMTLAEKIGQMVQLER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
               A+ ++MK + +GS+LS GGS P  +A+AE W++MVN FQKGSLS+RLGIPMIYGIDAV
Sbjct  61    ANATPEIMKDFSIGSLLSGGGSGPGIQATAEDWINMVNEFQKGSLSSRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHNVGLGATRDPELV+ IGAATA+EVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNVGLGATRDPELVKRIGAATAIEVRATGISYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP IVRAMTEIIPGLQGE P N     P+V G++KVAACAKH+VGDGGT  G
Sbjct  181   RCYESYSEDPNIVRAMTEIIPGLQGEIPANSRKGVPYVNGKDKVAACAKHFVGDGGTTNG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++D H L SIHM  YY+SII+GVATVM SYSS NG +MHAN +++TGFLK TL+
Sbjct  241   INENNTVIDRHGLLSIHMPAYYSSIIKGVATVMVSYSSWNGQKMHANHELVTGFLKNTLQ  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYS+   + AGIDMVM+P+N+TEFID LT LV++ F+
Sbjct  301   FRGFVISDWQGIDRITSPPHANYTYSVQAGVQAGIDMVMLPFNHTEFIDILTNLVESNFI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV+RILRVKF MGLFE+PL + S    LGS+ HR LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVRRILRVKFSMGLFENPLANLSFVDQLGSQAHRDLAREAVRKSLVLLKNGDE  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
              D P+LPL KKA++ILVAGTHA ++GYQCGGWTI WQGLSG N T GTTIL+AI   VD 
Sbjct  421   TDAPLLPLPKKANKILVAGTHAHDLGYQCGGWTITWQGLSGNNHTTGTTILSAISAAVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+++F ENPD EFVKS+ FS+A+VV+GE  YAE +GDS NLTI EPGPS I NVC   K
Sbjct  481   STEIVFTENPDAEFVKSNNFSYAVVVIGEPPYAETAGDSLNLTISEPGPSTITNVCSGVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRPVVIQPYL  I ALVAAWLPGTEGQGV DVLFGDYGF+GKLP TWFKTVDQ
Sbjct  541   CVVVVISGRPVVIQPYLSSIHALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTWFKTVDQ  600



>gb|EYU38727.1| hypothetical protein MIMGU_mgv1a003439mg [Erythranthe guttata]
Length=585

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/557 (74%), Positives = 479/557 (86%), Gaps = 0/557 (0%)
 Frame = +3

Query  336   LSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQK  515
             + +MTL+EKIGQM QIER VASA+V+KKY++GSVLS GGSVP P+AS E W+DMVN FQK
Sbjct  1     MGKMTLEEKIGQMTQIERSVASAEVVKKYFIGSVLSGGGSVPAPQASPEKWIDMVNDFQK  60

Query  516   GSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATG  695
             GSLSTRLGIP IYGIDAVHGNNN Y ATIFPHN+GLGATRDP+LV++IGAATALEVRATG
Sbjct  61    GSLSTRLGIPTIYGIDAVHGNNNVYKATIFPHNIGLGATRDPQLVKKIGAATALEVRATG  120

Query  696   IQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGRE  875
             I Y FAPCIAVCRDPRWGRCYESYSEDP +VR+MTEII GLQG+ P N     P++ G+ 
Sbjct  121   INYAFAPCIAVCRDPRWGRCYESYSEDPMVVRSMTEIISGLQGDVPANSRKGVPYLGGQH  180

Query  876   KVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGV  1055
             KV   AKHYVGDGGT  GI+ENNT+   H+L SIHM  YY+SII+GV+T+M SYSS NG 
Sbjct  181   KVIVSAKHYVGDGGTTHGINENNTVASMHELLSIHMPAYYDSIIKGVSTIMISYSSFNGK  240

Query  1056  RMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPY  1235
             +MHANRD+ITGFLKKT RFRGFVISD++ ID +T   H NYTYSIL ++NAGIDMVMVPY
Sbjct  241   KMHANRDLITGFLKKTQRFRGFVISDWQGIDRITSPPHANYTYSILAAVNAGIDMVMVPY  300

Query  1236  NYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRK  1415
             NYTEFIDGLT+LVKN FVP++RI+DAV+RILRVKF MG+FE+PL DYS+A +LG+++HR+
Sbjct  301   NYTEFIDGLTFLVKNNFVPMTRINDAVRRILRVKFTMGVFENPLADYSMAKYLGTQEHRE  360

Query  1416  LARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN  1595
             LAR+AVRKSLVLLKNG +AD+P+LPL K A +ILVAGTHAD+IG QCGGWTIEWQG SGN
Sbjct  361   LAREAVRKSLVLLKNGKSADKPLLPLSKTAPKILVAGTHADDIGNQCGGWTIEWQGKSGN  420

Query  1596  ITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLT  1775
              T GTTILTA++NTVD KT+V+F +NPD  +VK + FS+AIVVVGE  Y+E  GDS NLT
Sbjct  421   TTAGTTILTAVRNTVDPKTEVVFSQNPDSGYVKQNNFSYAIVVVGELPYSETMGDSLNLT  480

Query  1776  IPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGD  1955
             + EP P+II NVC   KCVVVL+TGRPVVIQP + QIDALVAAWLPG+EGQGVADVLFGD
Sbjct  481   LAEPAPTIIKNVCGSVKCVVVLVTGRPVVIQPLVDQIDALVAAWLPGSEGQGVADVLFGD  540

Query  1956  YGFSGKLPFTWFKTVDQ  2006
             YGFSGKLP TWFKTVDQ
Sbjct  541   YGFSGKLPHTWFKTVDQ  557



>gb|KHN46759.1| Lysosomal beta glucosidase [Glycine soja]
Length=631

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/600 (69%), Positives = 500/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K S  L+G+ +L     + +A+YM YKD +Q +  R++DL+SRMTL+EKIGQM+QIER
Sbjct  1     MAKISILLVGLWVLGSSTGLLDAEYMKYKDPKQSIDTRVEDLVSRMTLEEKIGQMLQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + ASA ++KKY++GSV+S GGSVP P+ASAE W+DMVN FQKG++STRLGIPM YGIDAV
Sbjct  61    KYASADLVKKYFIGSVMSEGGSVPAPQASAETWIDMVNEFQKGAVSTRLGIPMFYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+N  Y ATIFPHN+GLGATRDPELV+ IGAATALE+RATGIQY +APCIAVCRDPRWG
Sbjct  121   HGHNTIYKATIFPHNIGLGATRDPELVKRIGAATALEIRATGIQYTYAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP++V+AMTEIIPGLQGE P N P   PF+ G+EKV ACAKHYVGDGGT+ G
Sbjct  181   RCYESYSEDPKLVQAMTEIIPGLQGEIPDNLPKGVPFITGKEKVLACAKHYVGDGGTING  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT++D   L  IHM GY+NSI +GVA++M SYSS NG +MHAN+D+ITG+LK TL 
Sbjct  241   IDENNTVIDRDGLMRIHMPGYFNSISKGVASIMVSYSSWNGEKMHANQDLITGYLKNTLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISDF+ ID +T   H N+TYSI   ++AGIDM M P  Y EFI+ LT LVKNKF+
Sbjct  301   FKGFVISDFEGIDRITSPPHANFTYSIEAGVSAGIDMFMNPKLYIEFIEDLTMLVKNKFI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV+RIL VKF+MG+FE P  DYSL  +LG +KHR+LAR+AVRKS+VLLKNG +
Sbjct  361   PMSRIDDAVRRILWVKFMMGIFETPFADYSLVRYLGIQKHRQLAREAVRKSMVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD+P+LPL KK  +ILVAG+HADN+GYQCGGWTI+WQG+SG N+  GTTIL A+KNTVD 
Sbjct  421   ADKPLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGVSGNNLLKGTTILAAVKNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T V++++NPD EFVKS+ FS+AIVVVGE  YAE  GD+ NLTIP+ GP  I NVC   K
Sbjct  481   DTTVVYKDNPDAEFVKSNGFSYAIVVVGEHPYAEMHGDNMNLTIPDHGPETITNVCGAIK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV++I+GRPVVI+PY+  IDALVAAWLPG+EGQGVADVLFGDYGF+GKLP TWFKTVDQ
Sbjct  541   CVVIIISGRPVVIEPYVGSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRTWFKTVDQ  600



>ref|XP_004171886.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal beta glucosidase-like 
[Cucumis sativus]
Length=628

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/588 (71%), Positives = 492/588 (84%), Gaps = 3/588 (1%)
 Frame = +3

Query  252   CCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylg  431
             CC+   A A+   YKD  Q +  RIKDLL RMTL+EKIGQMVQIER  AS +VMKKY++G
Sbjct  14    CCFETGAKAENFKYKDPTQRLNVRIKDLLGRMTLEEKIGQMVQIERVNASTEVMKKYFIG  73

Query  432   svlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPH  611
             SVLS GGSVP  +ASA+ W++MVN  QKG+LSTRLGIPMIYGIDAVHG+NN YNATIFPH
Sbjct  74    SVLSGGGSVPSKQASAQDWINMVNEIQKGALSTRLGIPMIYGIDAVHGHNNVYNATIFPH  133

Query  612   NVGLGATR--DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             N+GLGATR  DP+L++ IG A+A E+RATGI Y FAPC+AVCRDPRWGRCYESY EDP+I
Sbjct  134   NIGLGATRQDDPQLLKRIGVASAREIRATGIPYAFAPCVAVCRDPRWGRCYESYGEDPKI  193

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             V+ MTEIIPGLQGE PPN     P+VAG+E V ACAKHYVGDGGT KGIDENNT++D H 
Sbjct  194   VQEMTEIIPGLQGEIPPNSRKGVPYVAGKENVVACAKHYVGDGGTTKGIDENNTVIDRHG  253

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             L SIHM GYY+SII+GVAT+M SYSS NG +MHAN++++T FLK TL F GFVISD++AI
Sbjct  254   LLSIHMPGYYHSIIKGVATIMVSYSSWNGEKMHANKNLVTDFLKNTLHFSGFVISDWEAI  313

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T   H NYTYSIL SI AG+DM+M+PYNY EFIDGLT LVK+ ++P+SRIDDAVKRI
Sbjct  314   DRITDPPHANYTYSILASITAGLDMIMIPYNYPEFIDGLTNLVKSNYIPISRIDDAVKRI  373

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LRVKFVMGLFE+P+ D SL + LG ++HR+LAR+AVRKSLVLLKNG +AD+P+LPL KK 
Sbjct  374   LRVKFVMGLFENPIADLSLVNELGKQEHRELAREAVRKSLVLLKNGKSADKPLLPLEKKT  433

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDP  1682
              +ILVAG+HA+N+GYQCGGWTIEWQGLSG N+T GTT+L AIK+TVD  T+V+F ENPD 
Sbjct  434   QKILVAGSHANNLGYQCGGWTIEWQGLSGNNLTSGTTVLDAIKDTVDPTTEVIFNENPDK  493

Query  1683  EFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVV  1862
             + ++S  FS+AIVVVGE  YAE +GDS NLTIP+PGP+ I NVC   KC VV+I+GRPVV
Sbjct  494   KSLQSDTFSYAIVVVGEHPYAELNGDSLNLTIPDPGPNTITNVCGVIKCAVVIISGRPVV  553

Query  1863  IQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             IQPY+  IDALVAAWLPGTEG+G+ DVLFGDYGF+GKL  TWFKTVDQ
Sbjct  554   IQPYVDSIDALVAAWLPGTEGKGITDVLFGDYGFTGKLSQTWFKTVDQ  601



>ref|XP_004295138.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=628

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/578 (72%), Positives = 486/578 (84%), Gaps = 1/578 (0%)
 Frame = +3

Query  276   ADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggs  455
             A Y  YKD +QP+  RI+DL+ RMTL EKIGQMVQIER+VA+  VM KY +GSVLS GGS
Sbjct  23    AKYSKYKDPKQPLNVRIRDLMKRMTLAEKIGQMVQIEREVATPDVMTKYLIGSVLSGGGS  82

Query  456   vpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATR  635
             VP P+ASA  WV++VNG QKGSLSTRLGIPMIYGIDAVHG+NN YNATIFPHNVGLGATR
Sbjct  83    VPAPKASAATWVNLVNGIQKGSLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  142

Query  636   DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPG  815
             DP L++ IG ATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSED +IV+AMTEIIPG
Sbjct  143   DPALIKRIGEATALEVRATGIPYAFAPCIAVCRDPRWGRCYESYSEDHKIVQAMTEIIPG  202

Query  816   LQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYY  995
             LQG+ PP++    P+V G+ KVAACAKHYVGDGGT +GI+ENNT++D + L  IHM  Y 
Sbjct  203   LQGDMPPSFQKGAPYVGGKGKVAACAKHYVGDGGTTRGINENNTVIDWNGLLGIHMPAYL  262

Query  996   NSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGN  1175
             NSI++GVATVM SYSS NG +MHAN+D++TG+LK  LRFRGFVISD++ ID +T     N
Sbjct  263   NSILKGVATVMVSYSSWNGKKMHANQDLVTGYLKNKLRFRGFVISDWEGIDRITSPPKAN  322

Query  1176  YTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLF  1355
             Y+YS+   ++AGIDM+MVPYN+TEFID LTY VKN  +P+SRIDDAVKRILRVKFVMGLF
Sbjct  323   YSYSVQAGVSAGIDMIMVPYNFTEFIDDLTYQVKNNIIPMSRIDDAVKRILRVKFVMGLF  382

Query  1356  EDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHA  1535
             E+PL D SLA  LG+++HR+LAR+AVRKSLVLLKNG +A +P+LPL KKA +IL+AG+HA
Sbjct  383   ENPLADLSLADQLGNKEHRELAREAVRKSLVLLKNGKSATKPLLPLSKKAGKILIAGSHA  442

Query  1536  DNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSH  1712
             DN+G+QCGGWTI WQGL GN +T+GTTIL A+K TVD  TQV++ E+PD  FVKS+KFSH
Sbjct  443   DNLGFQCGGWTITWQGLGGNDLTVGTTILNAVKTTVDPTTQVVYNESPDANFVKSNKFSH  502

Query  1713  AIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDA  1892
             A+VVVGE  YAE  GDS NLTI E G S I NVC   KCVVV+I+GRPVV+QPYL +IDA
Sbjct  503   AVVVVGEPPYAETFGDSMNLTISEAGLSTINNVCGAVKCVVVIISGRPVVVQPYLSKIDA  562

Query  1893  LVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             LVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  563   LVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKSVDQ  600



>ref|XP_011032946.1| PREDICTED: lysosomal beta glucosidase-like [Populus euphratica]
Length=627

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/601 (69%), Positives = 497/601 (83%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANAD-YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M K    L+G+  +CCW     A+ ++LYKD  +PV +R+KDLL RMTL EKIGQMVQ+E
Sbjct  1     MAKAWITLVGLLFICCWSSTMGAEEHVLYKDPTKPVDKRVKDLLKRMTLDEKIGQMVQLE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R   +A++M+KYY+GS+LS GGSVP  RAS + WVDMVN FQKGSLSTRLGIPMIYGIDA
Sbjct  61    RTNMTAEIMRKYYIGSLLSGGGSVPADRASPKQWVDMVNTFQKGSLSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN Y ATIFPHNVGLG TRDP LV++IGAATALEVRATGI Y FAPCIAVCRDPRW
Sbjct  121   VHGHNNVYKATIFPHNVGLGVTRDPALVKKIGAATALEVRATGIPYAFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSED +IV+ MTEIIPGLQG+ P N+    PFV+G++KVAACAKH+VGDGGTVK
Sbjct  181   GRCYESYSEDHKIVQMMTEIIPGLQGDVPANFQRGTPFVSGKDKVAACAKHFVGDGGTVK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT+V  ++L++IHM  Y NS+ +GVATVM SYSS+NG++MHANR ++T FLK+ L
Sbjct  241   GINENNTIVTHNELYNIHMPAYLNSLDKGVATVMVSYSSINGLKMHANRGLVTRFLKRKL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +FRGFVISD++ ID +T   H NY+YSIL S+NAG+DMVMVPYNY EFI+GLT LV  K 
Sbjct  301   KFRGFVISDWEGIDRITYPPHKNYSYSILKSVNAGVDMVMVPYNYIEFINGLTDLVNKKA  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             + + RIDDAVKRILRVKF MGLFE+PL DYS    LGS++HR+LAR+AVRKSLVLLKNG 
Sbjct  361   IRIQRIDDAVKRILRVKFAMGLFENPLADYSFVDKLGSKEHRELAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
              A  PV+PL KKAS+ILVAGTHADN+GYQCGGWTI+WQG  G N+T GTTIL  I+  VD
Sbjct  421   FAKSPVVPLPKKASKILVAGTHADNLGYQCGGWTIKWQGQEGNNLTAGTTILKGIQAAVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T+++F+ENP  ++VKS  FSHAIVVVGE  YAE +GD+ NLT+P PGP II NVC   
Sbjct  481   PSTKIVFKENPKAKYVKSQGFSHAIVVVGEPPYAETAGDNLNLTLPNPGPEIINNVCGAV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVV+++GRP+VI+ Y+P+IDALVAAWLPG+EGQGVADVLFGDYGF+GKL  TWFK VD
Sbjct  541   KCVVVIVSGRPLVIESYVPKIDALVAAWLPGSEGQGVADVLFGDYGFTGKLARTWFKRVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_003594509.1| Beta-D-glucosidase [Medicago truncatula]
 gb|AES64760.1| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=660

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/597 (70%), Positives = 490/597 (82%), Gaps = 5/597 (1%)
 Frame = +3

Query  231   LIGVAL-LCCWVVV---ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVA  398
             L+GV L LCCW+VV   A  D M YKD +QPV  R+KDLLSRMTL+EKIGQM QI+R VA
Sbjct  6     LLGVVLWLCCWLVVTADAQVDEMKYKDPKQPVAVRVKDLLSRMTLEEKIGQMTQIDRSVA  65

Query  399   SAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGN  578
             +A VMK  ++GSVLS GGS P P+A+A+ WV+M+N FQKGSL++RLGIPM+YGIDAVHG+
Sbjct  66    NANVMKNSFIGSVLSGGGSEPLPKATAQDWVNMINEFQKGSLASRLGIPMMYGIDAVHGH  125

Query  579   NNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCY  758
             NN YNATIFPHNVGLG TRDP+L R IGAATALE+RATGI Y FAPCIAVCRDPRWGRCY
Sbjct  126   NNVYNATIFPHNVGLGCTRDPDLARRIGAATALEIRATGIPYAFAPCIAVCRDPRWGRCY  185

Query  759   ESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDE  938
             ESYSEDP+IVR MTEIIPGLQG+ PP      P+V G+ KVAACAKH+VGDGGT KG++E
Sbjct  186   ESYSEDPKIVREMTEIIPGLQGDIPPGARKGVPYVGGKTKVAACAKHFVGDGGTTKGLNE  245

Query  939   NNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRG  1118
             NN +VD H L S+HM  Y +SII+GV+TVMASYSS NGV+MHANRD+ITG+LK TL+F+G
Sbjct  246   NNAVVDWHTLMSLHMPAYIDSIIKGVSTVMASYSSWNGVKMHANRDLITGYLKNTLKFKG  305

Query  1119  FVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVS  1298
             FVISD++ ID +T     NYTYS+  SI AG+DMVMVPY + +FI  LT LVKN  +P+ 
Sbjct  306   FVISDWQGIDKITTPPGSNYTYSVQASIEAGVDMVMVPYEFEDFIKDLTLLVKNNIIPMD  365

Query  1299  RIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADE  1478
             RIDDAV+RIL VKF MGLFE+PL D+SL + LGS+ HR LAR+AVRKSLVLLKNG N   
Sbjct  366   RIDDAVERILVVKFTMGLFENPLADFSLVNELGSQAHRDLAREAVRKSLVLLKNGKNQSA  425

Query  1479  PVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQ  1655
              +LPL KKA +ILVAGTHADN+GYQCGGWTI+WQG  GN  T GTTIL+AI +TVD  T+
Sbjct  426   QLLPLPKKARKILVAGTHADNLGYQCGGWTIKWQGFIGNGDTSGTTILSAINSTVDPSTE  485

Query  1656  VMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVV  1835
             V+F ENPD  FVKS+ F +AIVVVGE  YAE +GDS+ LTI +PGP+II NVC   KCVV
Sbjct  486   VVFRENPDAGFVKSNNFEYAIVVVGEPPYAETAGDSTALTILDPGPNIINNVCGAVKCVV  545

Query  1836  VLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             V +TGRPVVI+PYL  IDALVAAWLPG+EGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  546   VTVTGRPVVIEPYLSSIDALVAAWLPGSEGQGVADVLFGDYGFTGKLARTWFKSVDQ  602



>gb|KDP34274.1| hypothetical protein JCGZ_12843 [Jatropha curcas]
Length=660

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/592 (69%), Positives = 494/592 (83%), Gaps = 4/592 (1%)
 Frame = +3

Query  243   ALLCCWVV---VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVM  413
              +L  WV+   +A A Y+ YKD  QPVG R+KDL+SRMTL+EKI QMVQI+R +A+ Q+M
Sbjct  7     GILWFWVLGIAIAEAKYVQYKDPEQPVGARVKDLISRMTLEEKIAQMVQIDRLIATPQLM  66

Query  414   KkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYN  593
             K Y +GSVLS GGS P P ASAE WV+M+NGFQ GSLS+RLGIPMIYGIDAVHG+NN YN
Sbjct  67    KTYSIGSVLSGGGSAPLPEASAEDWVNMINGFQNGSLSSRLGIPMIYGIDAVHGHNNVYN  126

Query  594   ATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSE  773
             ATIFPHN+GLGATRDP+LV+ IG+ATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSE
Sbjct  127   ATIFPHNIGLGATRDPDLVKRIGSATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSE  186

Query  774   DPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLV  953
             D ++V  MTEIIPGLQG+ P N     P+V G++KVAACAKH+VGDGGT KGI+ENNT++
Sbjct  187   DHKVVEQMTEIIPGLQGDVPANSRRGVPYVGGKKKVAACAKHFVGDGGTTKGINENNTVI  246

Query  954   DTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISD  1133
             D H L SIHM  Y +SII+GV+T+M SYSS NG +MHANR++ITGFLK TL+F+GFVISD
Sbjct  247   DMHGLLSIHMPAYSDSIIKGVSTIMVSYSSWNGEKMHANRELITGFLKGTLKFKGFVISD  306

Query  1134  FKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDA  1313
             ++ ID +T   H NY+YS+  +I AGIDMVMVP+NY+EFID LT+LVKN  +P+ RIDDA
Sbjct  307   WQGIDRITSPPHANYSYSVQAAIQAGIDMVMVPFNYSEFIDDLTHLVKNNVIPMDRIDDA  366

Query  1314  VKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPL  1493
             V RIL VKF MGLFE+PL D S  + LGS++HR LAR+AVRKSLVLLKNG N  +P+LPL
Sbjct  367   VGRILFVKFTMGLFENPLADLSFVNELGSQEHRDLAREAVRKSLVLLKNGKNGTDPLLPL  426

Query  1494  RKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEE  1670
              KKAS +LVAGTHADN+GYQCGGWTI WQG SG N T GTTIL AI++TVD  T+V+F+E
Sbjct  427   PKKASAVLVAGTHADNLGYQCGGWTIAWQGFSGNNYTRGTTILGAIRSTVDPSTKVVFQE  486

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
             NPD  FVKS+KF++AIVVVGE  YAE +GDS++LT+ +PGPS+I NVC   KC+VV+I+G
Sbjct  487   NPDSNFVKSNKFAYAIVVVGEPPYAETAGDSTDLTMMDPGPSVINNVCEAVKCIVVIISG  546

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RP+VI+PY+  IDALVAAWLPG+EGQGV+DVLFGDYGF+GKL  TWFK V+Q
Sbjct  547   RPIVIEPYVSSIDALVAAWLPGSEGQGVSDVLFGDYGFTGKLSRTWFKNVEQ  598



>gb|KHG23007.1| Lysosomal beta glucosidase [Gossypium arboreum]
Length=1245

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/601 (71%), Positives = 501/601 (83%), Gaps = 8/601 (1%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
              ++GV L CC    A A+YM YKD +QP+  RI+DLL RMTL+EKIGQMVQIER+VASA 
Sbjct  9     LIMGVVLWCCLTTPAKAEYMKYKDPKQPIPVRIQDLLDRMTLEEKIGQMVQIERKVASAD  68

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VMK+Y++GSVLS GGSVP P+ASAE W++MVN FQ+GSLSTRLGIPMIYGID+VHGNNN 
Sbjct  69    VMKEYFIGSVLSGGGSVPAPQASAETWINMVNDFQRGSLSTRLGIPMIYGIDSVHGNNNV  128

Query  588   YNATIFPHNVGLGATR-------DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             Y ATIFPHN+GLGA+R       DPELV +IGAATALE RATGI Y FAPCIAVCRDPRW
Sbjct  129   YKATIFPHNIGLGASRHVDALLLDPELVNKIGAATALETRATGIPYAFAPCIAVCRDPRW  188

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP+IV+ MT+IIPGLQG  P + P   PFVAG+  V AC+KHYVGDGGT K
Sbjct  189   GRCYESYSEDPQIVKDMTDIIPGLQGNIPTDSPKGVPFVAGKNNVVACSKHYVGDGGTTK  248

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++D   L SIHM  Y+ SI++GV+TVM SYSS NG++MHANR++ITGFLK TL
Sbjct  249   GINENNTVIDWQGLLSIHMPAYHTSIMKGVSTVMISYSSWNGIKMHANRELITGFLKNTL  308

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              F+GFVISD++ +D +T   H NY+YSI   I+AGIDMVMVPYNY EFIDGLT+ VKN  
Sbjct  309   GFKGFVISDWEGLDRITYPPHANYSYSIQAGIHAGIDMVMVPYNYKEFIDGLTFHVKNNV  368

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAV+RILRVKFVMGLFE+PL D SL   LGS++HR+LAR+AVRKSLVLLKNG 
Sbjct  369   IPMSRIDDAVRRILRVKFVMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVLLKNGQ  428

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
             + + P+LPL KK S+ILVAG+HADN+GYQCGGWTIEWQG +G N TIGTTI+ AIKNT+D
Sbjct  429   SLNRPLLPLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFNGNNRTIGTTIVAAIKNTID  488

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T V+F+ENP+ EFVKS+ FS+AIVVVGE  YAE  GDS NLTI +PGP+ I NVC   
Sbjct  489   PSTNVVFKENPNAEFVKSNNFSYAIVVVGEHPYAETDGDSMNLTIADPGPTTIRNVCGAM  548

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVV++I+GRPVVI+PYL  IDALVAAWLPGTEGQGVADV+FGDYGF+GKLP TWFKTVD
Sbjct  549   KCVVIIISGRPVVIEPYLASIDALVAAWLPGTEGQGVADVVFGDYGFTGKLPRTWFKTVD  608

Query  2004  Q  2006
             Q
Sbjct  609   Q  609


 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/582 (71%), Positives = 479/582 (82%), Gaps = 10/582 (2%)
 Frame = +3

Query  267   VANADY-MLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvls  443
             + NAD  M+YKD  QP   RIKDL+ RMTL+EKIGQM+QIER V+S +VM+KY++GS+LS
Sbjct  644   LTNADTKMIYKDSNQPYNVRIKDLIGRMTLEEKIGQMIQIERNVSSPEVMRKYFIGSLLS  703

Query  444   sggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGL  623
              GGS P P+AS + W+DMVN FQKGSLS+RLGIPMIYGIDAVHG+NN Y ATIFPHN+GL
Sbjct  704   GGGSEPTPQASPKDWIDMVNEFQKGSLSSRLGIPMIYGIDAVHGHNNVYKATIFPHNIGL  763

Query  624   GATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTE  803
                     V  IG  TALEVRATGI YVFAPCIAVCRDPRWGRCYESYSEDP+IV+ MTE
Sbjct  764   --------VSRIGVVTALEVRATGIHYVFAPCIAVCRDPRWGRCYESYSEDPKIVQDMTE  815

Query  804   IIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHM  983
             IIPGLQG+ P +YP   PFV G E VAACAKHY+GDGGT +GI+ENNT++D   L SI +
Sbjct  816   IIPGLQGQIPSSYPKGVPFVGGMESVAACAKHYIGDGGTTEGINENNTVIDNKGLLSILL  875

Query  984   AGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPT  1163
              GY +SI +GVATVM SYSSLNGV+MHAN +M+T FLKK LRF+GFVISD++ ID +T  
Sbjct  876   PGYVSSIRKGVATVMISYSSLNGVKMHANYEMVTNFLKKNLRFKGFVISDWEGIDRITSP  935

Query  1164  VHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFV  1343
              H NYTYSI  S+NAG+DM+M+PYNYTEFIDGLTYLVKN FVP+SRIDDAVKRIL VKF 
Sbjct  936   PHANYTYSIEASVNAGLDMIMLPYNYTEFIDGLTYLVKNNFVPMSRIDDAVKRILLVKFT  995

Query  1344  MGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVA  1523
             MGLFE+PL D      LG   HR+LAR AVRKSLVLLKNG +AD P+LPL KKAS ILVA
Sbjct  996   MGLFENPLADERFVKQLGCEAHRELARDAVRKSLVLLKNGKSADAPLLPLPKKASNILVA  1055

Query  1524  GTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSS  1700
             G+HADN+GYQCGGWTI+W G SG N+T GTTILTAIKNTVD  ++V++ ENPD EFVKS 
Sbjct  1056  GSHADNLGYQCGGWTIKWMGFSGNNLTTGTTILTAIKNTVDPTSKVVYNENPDAEFVKSG  1115

Query  1701  KFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLP  1880
              FS+AIVVVGE  YAE  GD+ NLTIPEPGPS I NVC   KCVVV+++GRPVVIQPY+ 
Sbjct  1116  GFSYAIVVVGEHPYAETKGDNLNLTIPEPGPSTITNVCGTVKCVVVVVSGRPVVIQPYVA  1175

Query  1881  QIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
              I+ALVAAWLPG+EGQGVADVLFGD+GF+GKL FTWFKTVDQ
Sbjct  1176  SIEALVAAWLPGSEGQGVADVLFGDFGFTGKLSFTWFKTVDQ  1217



>ref|XP_010550691.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=634

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/594 (70%), Positives = 486/594 (82%), Gaps = 1/594 (0%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F + + L     V   + Y+ YKD R+    RI DLL RMT++EKIGQMVQI+R+ AS  
Sbjct  4     FKVLLILFLIIPVFGKSKYIRYKDPRENTENRITDLLGRMTIEEKIGQMVQIDRRTASPD  63

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             +MK Y++GSVLS GGSVP   A+AE W++MVN FQ+GSLSTRLGIPM+YGIDAVHG+N  
Sbjct  64    IMKTYFIGSVLSGGGSVPGTNATAEEWIEMVNEFQRGSLSTRLGIPMLYGIDAVHGHNTV  123

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHNVGLGATRDP LVR IGAATALE+RATGI Y FAPC+AVCRDPRWGRCYESY
Sbjct  124   YRATIFPHNVGLGATRDPPLVRRIGAATALELRATGIPYTFAPCVAVCRDPRWGRCYESY  183

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP IV  MTEIIPGLQGE P   P   PFVA + KV ACAKHYVGDGGTV+GI+ENNT
Sbjct  184   SEDPRIVEDMTEIIPGLQGELPATLPRGTPFVADKTKVVACAKHYVGDGGTVRGINENNT  243

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             ++D   L  IHM GYY S+ +GV+TVMASYSS NG++MHAN D+IT FLKK LRF+GFVI
Sbjct  244   IIDKKGLLEIHMPGYYRSLSKGVSTVMASYSSWNGLKMHANYDLITSFLKKKLRFQGFVI  303

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  ++NAGIDMVM+PYNYTEF+  LT+LVKNK++P++RID
Sbjct  304   SDWEGIDRITYPPHANYTYSIQAAVNAGIDMVMIPYNYTEFMGKLTFLVKNKYIPMARID  363

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAV RILRVKF+ GLFE+PL D S  H LGS +HR+LAR+AVRKSLVLLKNG   DEP+L
Sbjct  364   DAVTRILRVKFIAGLFEEPLADTSFVHKLGSLEHRELAREAVRKSLVLLKNGETGDEPLL  423

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMF  1664
             PL K+A +ILVAG+HADN+GYQCGGWTI WQG SG N T GTTIL AIKNTVD++TQV++
Sbjct  424   PLPKRARKILVAGSHADNLGYQCGGWTITWQGHSGNNFTEGTTILKAIKNTVDSETQVIY  483

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
              ENP  EFVKS +FSHA+VVVGE+ YAE  GDS++LTI +PGPS I NVC   KCVVV+I
Sbjct  484   SENPIAEFVKSGEFSHAVVVVGERPYAESEGDSNDLTIADPGPSTITNVCGVMKCVVVII  543

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVV+QPY+  +DA+VAAWLPG+EGQG+ADVLFGDYGF+GK P TWFKTVDQ
Sbjct  544   SGRPVVLQPYISMVDAVVAAWLPGSEGQGIADVLFGDYGFTGKSPRTWFKTVDQ  597



>ref|XP_003546253.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006597657.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=661

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/603 (69%), Positives = 490/603 (81%), Gaps = 4/603 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVV---ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQ  380
             M +    L+GV  LCCW+     +  +Y+ YKD +QPV  R++DL+SRMTL+EKIGQMVQ
Sbjct  1     MSRALVHLLGVLWLCCWLASTGESQIEYLRYKDPKQPVPTRVRDLMSRMTLEEKIGQMVQ  60

Query  381   IERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGI  560
             I+R VA+A VMK  ++GSVLS GGS P PRA+AE WV+M+N FQKG+L +RLGIPMIYGI
Sbjct  61    IDRSVANANVMKTSFIGSVLSGGGSEPLPRATAEDWVNMINDFQKGALESRLGIPMIYGI  120

Query  561   DAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDP  740
             DAVHG+NN YNATIFPHNVGLG TRDP L + IGAATALEVRATGI YVFAPCIAVCRDP
Sbjct  121   DAVHGHNNVYNATIFPHNVGLGCTRDPNLAQRIGAATALEVRATGIPYVFAPCIAVCRDP  180

Query  741   RWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGT  920
             RWGRCYESYSEDP+IV+ MTEIIPGLQG  P N    FP+V G+ KVAACAKH+VGDGGT
Sbjct  181   RWGRCYESYSEDPKIVQEMTEIIPGLQGSIPANSRKGFPYVGGKTKVAACAKHFVGDGGT  240

Query  921   VKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKK  1100
              KGI+ENNT++D H L SIHM  Y +SII+GV+TVM SYSS NGVRMHANRD++TGFLK 
Sbjct  241   TKGINENNTVIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGVRMHANRDLVTGFLKN  300

Query  1101  TLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKN  1280
             TL+F+GFVISD++ ID LT     NYTYS+  SI AG+DMVMVP+ Y +FI  LT LVK+
Sbjct  301   TLKFKGFVISDWQGIDRLTSPPSSNYTYSVQASIEAGVDMVMVPFEYGKFIQDLTLLVKS  360

Query  1281  KFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKN  1460
               +P+ RIDDAV+RIL VKF MGLFE+PL D SL + LGS++HR LAR+AVRKSLVLLKN
Sbjct  361   NIIPMERIDDAVERILLVKFTMGLFENPLADTSLVNELGSQEHRDLAREAVRKSLVLLKN  420

Query  1461  GANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNT  1637
             G N    +LPL KK  +ILVAG+HADN+GYQCGGWTI+WQG SGN  T GTTIL AIK+ 
Sbjct  421   GKNESASLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGFSGNSDTRGTTILNAIKSA  480

Query  1638  VDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCP  1817
             VDT T+V+F +NPD EFVKS+ F +AIVVVGE  YAE +GDS+ LT+ E GP++I NVC 
Sbjct  481   VDTSTEVVFRDNPDNEFVKSNNFEYAIVVVGEPPYAETAGDSTTLTMMESGPNVINNVCG  540

Query  1818  HTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKT  1997
               KCVVV+I+GRP+VI+PY+  IDALVAAWLPGTEGQG+ DVLFGDYGF+GKL  TWFK+
Sbjct  541   TVKCVVVIISGRPIVIEPYISSIDALVAAWLPGTEGQGMTDVLFGDYGFTGKLARTWFKS  600

Query  1998  VDQ  2006
             VDQ
Sbjct  601   VDQ  603



>ref|XP_010535771.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=633

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/593 (70%), Positives = 492/593 (83%), Gaps = 3/593 (1%)
 Frame = +3

Query  234   IGVALLCCWVVVAN-ADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             +G  LLCC V     +  + YKD +QP+  R+KDL+SRMTL+EKIGQMVQI+  VA  +V
Sbjct  11    LGFLLLCCAVSAKQPSTNVKYKDPKQPLRTRVKDLMSRMTLEEKIGQMVQIDLSVAKPEV  70

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             M KY +GSVLS GGSVP  +AS E WV+ VN  QK +LSTRLGIPMIYGIDAVHG+NN Y
Sbjct  71    MTKYLIGSVLSGGGSVPAQKASPETWVNAVNDIQKAALSTRLGIPMIYGIDAVHGHNNVY  130

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
             NATIFPHNVGLG TRDP+LVR IG ATALEVRATGIQY FAPCIAVCRDPRWGRCYESYS
Sbjct  131   NATIFPHNVGLGVTRDPKLVRRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCYESYS  190

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED  IV+ MTEII GLQG+ P       PFV G+ KVAACAKH+VGDGGTV+GI+ENNT+
Sbjct  191   EDHRIVQQMTEIITGLQGDLPAKQK-GIPFVDGKRKVAACAKHFVGDGGTVRGINENNTV  249

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             +D   LF+IHMA Y++++ +GVATVM SYSSLNGV+MHAN+ ++TGFLK  L+F+GFVIS
Sbjct  250   IDKKGLFNIHMAAYHDAVDKGVATVMISYSSLNGVKMHANKKLVTGFLKNKLKFKGFVIS  309

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ ID +T   H NY+YS+  S+ AGIDM+MVPYNYTEFID +T  VK K +P+ RI+D
Sbjct  310   DWQGIDKITYPPHSNYSYSVFASVTAGIDMIMVPYNYTEFIDEITSQVKRKIIPMRRIND  369

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV+RILRVKF MGLFE P+GD+SLA+HLGS++HR+LAR+AVRKSLVLLKNG NAD P+LP
Sbjct  370   AVERILRVKFTMGLFEHPMGDHSLANHLGSKEHRELAREAVRKSLVLLKNGENADSPILP  429

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGL-SGNITIGTTILTAIKNTVDTKTQVMFE  1667
             L KKA ++LVAGTHADN+G QCGGWTI WQGL + ++TIGTTILTA+KNTVD  TQV+  
Sbjct  430   LPKKAKKLLVAGTHADNLGNQCGGWTITWQGLNTTDLTIGTTILTAVKNTVDPTTQVVHI  489

Query  1668  ENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLIT  1847
             ENPD EFV+S+ F +AIVVVGE  YAEG+GDS+NLTIPEPGPS I NVC   KCVVV+++
Sbjct  490   ENPDREFVESNGFDYAIVVVGEPPYAEGNGDSTNLTIPEPGPSTITNVCGSVKCVVVIVS  549

Query  1848  GRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             GRPV+ QPY+  IDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  550   GRPVITQPYISGIDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  602



>ref|XP_006604246.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
 ref|XP_003554030.2| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
Length=636

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/602 (69%), Positives = 501/602 (83%), Gaps = 1/602 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             E M K S  L+G+ LL  W  + +A  M YK+ +     R++DL+SRMTL+EKIGQM+Q+
Sbjct  4     EGMAKISILLVGLWLLVNWSGLLDAKNMKYKNPKHSTDTRVEDLVSRMTLEEKIGQMLQV  63

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             ER+  SA ++KKY++G+VLS GGS+P P+ASAE W+DMVN FQKG+LSTRLGIPM YGID
Sbjct  64    ERKYVSADLLKKYFIGAVLSEGGSIPAPQASAETWIDMVNEFQKGALSTRLGIPMFYGID  123

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+N  +NATIFPHN+GLGATRDPELV+ IGAATALEVRATGIQYV++PCIAVCRDPR
Sbjct  124   AVHGHNTVHNATIFPHNIGLGATRDPELVKRIGAATALEVRATGIQYVYSPCIAVCRDPR  183

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYES+SEDPE+V+AMTEIIPGLQG+ P + P   PF+ G+EKV  CAKHYVGDGGT+
Sbjct  184   WGRCYESFSEDPELVQAMTEIIPGLQGDIPNDSPKGVPFITGKEKVIGCAKHYVGDGGTI  243

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
              GIDE+NT++D   L  IHM GY++SI +GVAT+MASYSS NGV+MHA+ D+ITGFLK T
Sbjct  244   NGIDEHNTVIDRDGLMKIHMPGYFSSISKGVATIMASYSSWNGVKMHAHHDLITGFLKNT  303

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L F+GFVISDF+ +D +T     N TYSI   ++AGIDM MVP +YTEFID LT LVKNK
Sbjct  304   LHFKGFVISDFEGLDRITSPPRANITYSIEAGVSAGIDMFMVPKHYTEFIDVLTMLVKNK  363

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAV RIL VK +MG+FE+P  DYSL  +LG ++HR LAR+AVRKS+VLLKNG
Sbjct  364   HIPMSRIDDAVGRILWVKLMMGIFENPFADYSLVKYLGIQEHRNLAREAVRKSMVLLKNG  423

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTV  1640
              +AD+P+LPL KK+ +ILVAG+HADN+GYQCGGWTIEWQG+SG N+  GTTILTA+KNTV
Sbjct  424   ESADKPLLPLPKKSPKILVAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILTAVKNTV  483

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D +T V+++ENPD EFVKS+ FS+AIV+VGE  YAE  GDS NLTIPEPGP II NVC  
Sbjct  484   DPETTVVYKENPDVEFVKSNGFSYAIVIVGEHPYAEMYGDSMNLTIPEPGPKIITNVCGA  543

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVV++I+GRPVVI+PY+  IDALVAAWLPG+EGQGVADVL+G YGF+GKLP TWFKTV
Sbjct  544   IKCVVIIISGRPVVIEPYVGLIDALVAAWLPGSEGQGVADVLYGGYGFTGKLPRTWFKTV  603

Query  2001  DQ  2006
             DQ
Sbjct  604   DQ  605



>ref|XP_009418960.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418961.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418962.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418963.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418964.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418966.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=670

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/599 (69%), Positives = 489/599 (82%), Gaps = 0/599 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M +   F + +  L CW  V  A+YM YKD +Q +  RIKDL+ RMTL EKIGQM QIER
Sbjct  1     MARRQTFWLHLLFLACWTSVGEAEYMKYKDPKQSINVRIKDLMDRMTLAEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VASAQVMK Y++GS+LS GGSVP P+ASA  WV+MVN  QKGSLSTRLGIPMIYGIDA+
Sbjct  61    KVASAQVMKDYFIGSLLSGGGSVPGPQASASDWVNMVNELQKGSLSTRLGIPMIYGIDAI  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHN+GLGATRDP LV+ IG ATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNIGLGATRDPALVKRIGEATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IV+ MTEIIPGLQG+ P NY    P+++G+ KVAACAKH+VGDGGT  G
Sbjct  181   RCYESYSEDHNIVQEMTEIIPGLQGDVPANYHKGVPYISGKVKVAACAKHFVGDGGTHNG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+V+   L SIHM  YYNSI++GVATVM SYSS NGV+MHAN D++TG+LK TL 
Sbjct  241   INENNTIVNRDGLLSIHMPAYYNSIMKGVATVMVSYSSWNGVKMHANHDLVTGYLKNTLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVI+D++ ID +T     NYTYS+   INAGIDMVMVPY+Y+E+I+ LT LV    +
Sbjct  301   FRGFVITDWQGIDRITSPPGANYTYSVQAGINAGIDMVMVPYDYSEYINALTSLVNKHVI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV+RILRVKF MGLFE+PL D SL   LG ++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVRRILRVKFTMGLFENPLADLSLVDQLGKKEHRELAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTK  1649
              ++  LPL KKA++ILVAG+HADN+GYQCGGWTIEWQG SGNIT+GTTIL AIK TVD  
Sbjct  421   RNDSFLPLPKKAAKILVAGSHADNLGYQCGGWTIEWQGASGNITVGTTILGAIKTTVDHS  480

Query  1650  TQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKC  1829
             T+V++ ENPD +FVK + FS+AIVVVGE  Y E +GD+ NLT+P+PGPS I  VC   KC
Sbjct  481   TEVVYSENPDEKFVKDNGFSYAIVVVGEPPYTETAGDNLNLTLPDPGPSTIRTVCGAIKC  540

Query  1830  VVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VV++I+GRPVVI+PY+  +DAL+AAWLPG+EGQGV DVLFGDYGF+GKL  TWFK+VDQ
Sbjct  541   VVIIISGRPVVIEPYVHLMDALIAAWLPGSEGQGVTDVLFGDYGFTGKLSRTWFKSVDQ  599



>ref|XP_007206306.1| hypothetical protein PRUPE_ppa025914mg [Prunus persica]
 gb|EMJ07505.1| hypothetical protein PRUPE_ppa025914mg [Prunus persica]
Length=647

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/619 (69%), Positives = 502/619 (81%), Gaps = 20/619 (3%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVV-ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M + S  +IG  LLC  ++    A Y+ YKD +QP+  RI+DL+ RMTL+EKIGQMVQIE
Sbjct  1     MARFSIPMIGFLLLCIILLAPTEAAYLKYKDPKQPLNVRIRDLMKRMTLEEKIGQMVQIE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VA+   M KY++GSVLS GGSVP P+ASAEAWV++VNG QKGSLSTRLGIPMIYGIDA
Sbjct  61    RSVATPDAMTKYFIGSVLSGGGSVPAPKASAEAWVNLVNGIQKGSLSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATR-----------------DPELVREIGAATALEVRATG  695
             VHGNNN YNATIFPHNVGLGATR                 DP+LV++IG ATALEVRATG
Sbjct  121   VHGNNNVYNATIFPHNVGLGATRQFGQIQWCDVLLMLDFIDPKLVKKIGEATALEVRATG  180

Query  696   IQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVA-GR  872
             I YVFAPCIAVCRDPRWGRCYESYSED +IV+AMTE+IPGLQG+ PP+     PFV+  +
Sbjct  181   IPYVFAPCIAVCRDPRWGRCYESYSEDHKIVQAMTELIPGLQGDMPPSAQKGAPFVSTAK  240

Query  873   EKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNG  1052
              KVAACAKHYVGDGGT KGI+ENNT++D + L SIHM  Y++SI++GVATVM SYSS NG
Sbjct  241   GKVAACAKHYVGDGGTTKGINENNTVIDLNGLLSIHMPAYFDSILKGVATVMVSYSSWNG  300

Query  1053  VRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVP  1232
              +MHAN+++++GFLK  LRFRGFVISD++ ID LT     NY+YS+   ++AGIDM+MVP
Sbjct  301   KKMHANQELVSGFLKNKLRFRGFVISDWEGIDRLTSPPKANYSYSVQAGVSAGIDMIMVP  360

Query  1233  YNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHR  1412
             YN+TEFID LTY VKN  +P+SRIDDAV+RILRVKFVMGLFE+PL D SL + LG ++HR
Sbjct  361   YNFTEFIDDLTYQVKNNIIPMSRIDDAVRRILRVKFVMGLFEEPLADLSLVNELGKKEHR  420

Query  1413  KLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG  1592
             +LAR+AVRKSLVLLKNG +AD+P LPL KKA +ILVAG+HADN+G QCGGWTI WQGL G
Sbjct  421   ELAREAVRKSLVLLKNGKSADKPSLPLPKKAGKILVAGSHADNLGNQCGGWTITWQGLGG  480

Query  1593  N-ITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSN  1769
             N +T+GTTIL A+K+ VD  TQV++ ENPD  FVKS+K  +A+VVVGE  YAE  GDS N
Sbjct  481   NDLTVGTTILNAVKSAVDPTTQVVYNENPDANFVKSNKVDYAVVVVGEPPYAETFGDSLN  540

Query  1770  LTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLF  1949
             LTI EPGPS IANVC   KCVVV+I+GRPVVIQPYL ++DALVAAWLPGTEGQGV DVLF
Sbjct  541   LTISEPGPSTIANVCGAVKCVVVVISGRPVVIQPYLAKVDALVAAWLPGTEGQGVTDVLF  600

Query  1950  GDYGFSGKLPFTWFKTVDQ  2006
             GDYGF+GKL  TWFKTVDQ
Sbjct  601   GDYGFTGKLAHTWFKTVDQ  619



>ref|XP_008385601.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
 ref|XP_008359191.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=632

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/582 (72%), Positives = 487/582 (84%), Gaps = 2/582 (0%)
 Frame = +3

Query  267   VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlss  446
             +  ADY  YKD +QP+  RI+DL+ +MTL EKIGQM QIER VA+  VM KY++GSVLS 
Sbjct  24    LTEADYFKYKDPKQPLNARIRDLMKQMTLAEKIGQMTQIERTVATPDVMTKYFIGSVLSG  83

Query  447   ggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLG  626
             GGSVP P+ASAE W+++VNG QKGSLSTRLGIPMIYGIDAVHG+NN YNATIFPHNVGLG
Sbjct  84    GGSVPAPKASAETWINLVNGLQKGSLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLG  143

Query  627   ATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEI  806
             ATRDP LV+ IG ATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSED +IV+AMTEI
Sbjct  144   ATRDPNLVKRIGEATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSEDHKIVQAMTEI  203

Query  807   IPGLQGEAPPNYPLSFPFVA-GREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHM  983
             IPGLQG+ PP      P+V+  + KVAACAKHY+GDGGT KGI+ENNT++D + L  IHM
Sbjct  204   IPGLQGDMPPTAQKGAPYVSTAKGKVAACAKHYLGDGGTTKGINENNTVIDLNGLLRIHM  263

Query  984   AGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPT  1163
               Y NSI++GVATVM SYSS NG +MHAN++++TG+LK  LRFRGFVISD++ ID +T  
Sbjct  264   PAYLNSILKGVATVMVSYSSWNGKKMHANKELVTGYLKDKLRFRGFVISDWEGIDRITSP  323

Query  1164  VHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFV  1343
                NY+YS+   + AGIDM+MVPYN+T+FID LTY VKN  +P+SRIDDAVKRILRVKFV
Sbjct  324   PKANYSYSVQAGVXAGIDMIMVPYNFTDFIDDLTYQVKNNIIPMSRIDDAVKRILRVKFV  383

Query  1344  MGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVA  1523
             MGLFE+PL D SLA  LGS++HR+LAR+AVRKSLVLLKNG +A +P+LPL KKA +ILVA
Sbjct  384   MGLFENPLADLSLASQLGSKEHRELAREAVRKSLVLLKNGKSAYKPLLPLPKKAGKILVA  443

Query  1524  GTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSS  1700
             G+HADN+G QCGGWTI WQGL G N T+GTTIL+AIK+TVD  TQV++ ENPD  FVKS+
Sbjct  444   GSHADNLGNQCGGWTITWQGLEGNNNTMGTTILSAIKSTVDPTTQVVYNENPDANFVKSN  503

Query  1701  KFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLP  1880
             KFS+AIVVVGE  YAE  GD+ NLTIP+PGPS IANVC   KCVVV+I+GRPVVIQPYL 
Sbjct  504   KFSYAIVVVGEPPYAETFGDNLNLTIPQPGPSTIANVCGAVKCVVVVISGRPVVIQPYLA  563

Query  1881  QIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
              IDALVAAWLPGTEGQGV D LFGDYGF+GKL  TWFKTVDQ
Sbjct  564   GIDALVAAWLPGTEGQGVTDALFGDYGFTGKLARTWFKTVDQ  605



>gb|KHN34681.1| Lysosomal beta glucosidase [Glycine soja]
Length=631

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/600 (69%), Positives = 500/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M K S  L+G+ LL  W  + +A  M YK+ +     R++DL+SRMTL+EKIGQM+Q+ER
Sbjct  1     MAKISILLVGLWLLVNWSGLLDAKNMKYKNPKHSTDTRVEDLVSRMTLEEKIGQMLQVER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +  SA ++KKY++G+VLS GGS+P P+ASAE W+DMVN FQKG+LSTRLGIPM YGIDAV
Sbjct  61    KYVSADLLKKYFIGAVLSEGGSIPAPQASAETWIDMVNEFQKGALSTRLGIPMFYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+N  +NATIFPHN+GLGATRDPELV+ IGAATALEVRATGIQYV++PCIAVCRDPRWG
Sbjct  121   HGHNTVHNATIFPHNIGLGATRDPELVKRIGAATALEVRATGIQYVYSPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYES+SEDPE+V+AMTEIIPGLQG+ P + P   PF+ G+EKV  CAKHYVGDGGT+ G
Sbjct  181   RCYESFSEDPELVQAMTEIIPGLQGDIPNDSPKGVPFITGKEKVIGCAKHYVGDGGTING  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDE+NT++D   L  IHM GY++SI +GVAT+MASYSS NGV+MHA+ D+ITGFLK TL 
Sbjct  241   IDEHNTVIDRDGLMKIHMPGYFSSISKGVATIMASYSSWNGVKMHAHHDLITGFLKNTLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISDF+ +D +T     N TYSI   ++AGIDM MVP +YTEFID LT LVKNK +
Sbjct  301   FKGFVISDFEGLDRITSPPRANITYSIEAGVSAGIDMFMVPKHYTEFIDVLTMLVKNKHI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV RIL VK +MG+FE+P  DYSL  +LG ++HR LAR+AVRKS+VLLKNG +
Sbjct  361   PMSRIDDAVGRILWVKLMMGIFENPFADYSLVKYLGIQEHRNLAREAVRKSMVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD+P+LPL KK+ +ILVAG+HADN+GYQCGGWTIEWQG+SG N+  GTTILTA+KNTVD 
Sbjct  421   ADKPLLPLPKKSPKILVAGSHADNLGYQCGGWTIEWQGVSGNNLLKGTTILTAVKNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
             +T V+++ENPD EFVKS+ FS+AIV+VGE  YAE  GDS NLTIPEPGP II NVC   K
Sbjct  481   ETTVVYKENPDVEFVKSNGFSYAIVIVGEHPYAEMYGDSMNLTIPEPGPKIITNVCGAIK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV++I+GRPVVI+PY+  IDALVAAWLPG+EGQGVADVL+G YGF+GKLP TWFKTVDQ
Sbjct  541   CVVIIISGRPVVIEPYVGLIDALVAAWLPGSEGQGVADVLYGGYGFTGKLPRTWFKTVDQ  600



>ref|XP_010685489.1| PREDICTED: lysosomal beta glucosidase-like [Beta vulgaris subsp. 
vulgaris]
Length=628

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/600 (72%), Positives = 496/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MGK     +G  LL  WV +  A+ M YKD    V +R+ DLLSRMTL+EKIGQMVQIER
Sbjct  1     MGKMLLPQVGFLLLFIWVSLIEAEDMRYKDPTLAVNKRVNDLLSRMTLEEKIGQMVQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VASA VMK Y++GSVLS GGSVP P+ASAEAWV+MVN FQKGSL+TRLGIPMIYGIDAV
Sbjct  61    KVASADVMKTYFIGSVLSGGGSVPGPKASAEAWVNMVNEFQKGSLATRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NNAYNATIFPHNVGLG TRDPELV++IGAATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHNNAYNATIFPHNVGLGVTRDPELVKKIGAATALEVRATGIPYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IV+ MTEIIPGLQG+ P NYP  FP+V G++ VA CAKH+VGDGGT KG
Sbjct  181   RCYESYSEDHRIVQMMTEIIPGLQGDVPTNYPEGFPYVNGKKSVAGCAKHFVGDGGTQKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++   +LFSIHM  Y +SI +G+ATVM SYSS NGV+MHANR+++TG+LK  L+
Sbjct  241   INENNTVISAKELFSIHMPAYLDSIKKGIATVMVSYSSWNGVKMHANRNLVTGYLKNKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F GFVISD++ ID +T   H NY+YS+   + AGIDMVMVP N+ EFID L   VKN  +
Sbjct  301   FHGFVISDWEGIDRITSPPHANYSYSVQAGVQAGIDMVMVPMNFNEFIDDLKLQVKNNVI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+ RIDDAV+RILRVKFVMGLFE+P+ D SL + +GS++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMKRIDDAVRRILRVKFVMGLFENPMADLSLVNEVGSQEHRELAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
             A +P+LPL KKA +ILVAGTHADN+G QCGGWTIEWQG +GN IT GTTILTA+KNTVD 
Sbjct  421   AYKPLLPLPKKAPKILVAGTHADNLGNQCGGWTIEWQGANGNDITSGTTILTAVKNTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV+F ENPDP FVKS  FS+AIVVVGE  YAE +GDS NLTIPEPG + I NVC    
Sbjct  481   TTQVVFNENPDPNFVKSGGFSYAIVVVGEPPYAETNGDSLNLTIPEPGLNTIKNVCGGVT  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRPVVIQPYL  IDALVAAWLPGTEGQGV DVLFGDYGF+GKL  TWFK+VDQ
Sbjct  541   CVVVVISGRPVVIQPYLATIDALVAAWLPGTEGQGVTDVLFGDYGFTGKLARTWFKSVDQ  600



>gb|KHG06451.1| gluA [Gossypium arboreum]
Length=611

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/594 (71%), Positives = 485/594 (82%), Gaps = 20/594 (3%)
 Frame = +3

Query  228   FLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             F +G+ L CC   +  A+YM YKD +Q V  R +DLL RMTL+EKIGQMVQIER VASA 
Sbjct  9     FFMGLVLWCC---LTKAEYMKYKDPKQAVHVRTRDLLDRMTLEEKIGQMVQIERSVASAD  65

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             VM KY++GSVLS GGS P P+AS EAW++M+N FQKGSL+TR+ IPMIYGIDAVHGNNN 
Sbjct  66    VMNKYFIGSVLSGGGSAPSPQASPEAWINMINDFQKGSLATRMQIPMIYGIDAVHGNNNV  125

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             Y ATIFPHN+GL                ALE RATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  126   YKATIFPHNIGL----------------ALESRATGIPYVFAPCIAVCRDPRWGRCYESY  169

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SEDP +V AMTEI+PGLQG+ P       PFVAG + VAACAKHYVGDGGT KGI+ENNT
Sbjct  170   SEDPHLVDAMTEIVPGLQGDIPAKSSKGIPFVAGNKNVAACAKHYVGDGGTTKGINENNT  229

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             +++ HDL SIHM GYY+SII+GV+TVM SYSS NGV+MHANRD++TGFLK  LRFRGFVI
Sbjct  230   VINWHDLLSIHMPGYYSSIIKGVSTVMVSYSSWNGVKMHANRDLVTGFLKNKLRFRGFVI  289

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYSI  +I +GIDMVMVPYNY+ FI GLT+LVK+ F+P+SRID
Sbjct  290   SDWEGIDRITYPPHANYTYSIQAAIGSGIDMVMVPYNYSSFIHGLTFLVKSNFIPMSRID  349

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAVKRILRVKF MGLFE+PL D SL   LGS++HR+LAR+AVRKSLVLLKNG +AD+P+L
Sbjct  350   DAVKRILRVKFAMGLFENPLADNSLVDQLGSQEHRELAREAVRKSLVLLKNGHSADQPLL  409

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMF  1664
             PL KK S+ILVAG+HADN+GYQCGGWTIEWQG SGN +T GTT+L AIKNTVD+ T V++
Sbjct  410   PLPKKTSKILVAGSHADNLGYQCGGWTIEWQGFSGNDLTNGTTVLKAIKNTVDSSTNVVY  469

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
             EENPDP+FVKS+ FS AIVVVGE  Y E  GDS NLTIPEPGP+ I NVC   KCVV+L+
Sbjct  470   EENPDPKFVKSNNFSCAIVVVGEHPYVETKGDSMNLTIPEPGPTTIRNVCGALKCVVILM  529

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRPVVI+P +  +DALVAAWLPG+EG GVADVLFGDYGFSGKLP TWFKTVDQ
Sbjct  530   SGRPVVIEPDIDSMDALVAAWLPGSEGHGVADVLFGDYGFSGKLPRTWFKTVDQ  583



>ref|XP_007218946.1| hypothetical protein PRUPE_ppa002559mg [Prunus persica]
 gb|EMJ20145.1| hypothetical protein PRUPE_ppa002559mg [Prunus persica]
Length=658

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/597 (69%), Positives = 491/597 (82%), Gaps = 5/597 (1%)
 Frame = +3

Query  231   LIGVALLCCWV--VVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASA  404
             ++G+ L+  WV     NADY+ YKD  QPV  R+ DLLSRMTL+EKIGQMVQI+R VA+ 
Sbjct  8     VVGMLLVWWWVGFSAVNADYIKYKDANQPVASRVGDLLSRMTLEEKIGQMVQIDRSVANV  67

Query  405   QVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNN  584
               M+ + +GSVLS GGS P P ASAE WV+M+N FQKG+L++RLGIPMIYGIDAVHG+NN
Sbjct  68    DTMRTHSIGSVLSGGGSAPLPEASAEDWVNMINEFQKGALASRLGIPMIYGIDAVHGHNN  127

Query  585   AYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYES  764
              YNATIFPHNVGLGATRDPELVR IG+ATALE RATGI YVFAPCIAVCRDPRWGRCYES
Sbjct  128   VYNATIFPHNVGLGATRDPELVRRIGSATALEARATGIPYVFAPCIAVCRDPRWGRCYES  187

Query  765   YSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENN  944
             YSED +IV+ MTEIIPGLQG+ P N     P+V G +KVAACAKH+VGDGGT +GI+ENN
Sbjct  188   YSEDHKIVQEMTEIIPGLQGDIPANSRKGVPYVGGNKKVAACAKHFVGDGGTTRGINENN  247

Query  945   TLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFV  1124
             T+VD H+L SIHM  Y +SII+GVATVM SYSS NG +MHANRD++TGFLK TL+F+GFV
Sbjct  248   TVVDRHELLSIHMPAYSDSIIKGVATVMISYSSWNGEKMHANRDLVTGFLKGTLKFKGFV  307

Query  1125  ISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRI  1304
             ISD++ +D +T   H NY+YS+  SI AG+DM+M+P+ Y EFID L  LVKN  VP+ RI
Sbjct  308   ISDWEGVDRITSPPHANYSYSVQASILAGLDMIMIPFKYIEFIDDLISLVKNNVVPMDRI  367

Query  1305  DDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD--E  1478
             DDAV RIL VKF MGLFE+PL D SL + LGS+ HR LAR+AVRKSLVLLKNG N     
Sbjct  368   DDAVGRILLVKFTMGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVLLKNGKNGTNPN  427

Query  1479  PVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQ  1655
             PV+PL KK S+ILVAG+HADN+GYQCGGWT+EWQG SG N T GTTIL+AIK+TVD+ T+
Sbjct  428   PVIPLPKKVSKILVAGSHADNLGYQCGGWTMEWQGFSGNNYTRGTTILSAIKSTVDSSTE  487

Query  1656  VMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVV  1835
             +++ ENPD  FVKS+ F++AIVVVGE  YAE SGDS NLT+ EPGPS+I+NVC   KC+V
Sbjct  488   IIYRENPDGNFVKSNNFAYAIVVVGEHPYAETSGDSMNLTMAEPGPSVISNVCESVKCIV  547

Query  1836  VLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ++I+GRP+VI+PY+  IDALVAAWLPGTEGQG+ DVLFGD+GFSGKLP TWF+TVDQ
Sbjct  548   IIISGRPIVIEPYISSIDALVAAWLPGTEGQGITDVLFGDHGFSGKLPRTWFRTVDQ  604



>ref|XP_003545548.1| PREDICTED: lysosomal beta glucosidase-like [Glycine max]
Length=627

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/581 (72%), Positives = 484/581 (83%), Gaps = 1/581 (0%)
 Frame = +3

Query  267   VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlss  446
             V+ A+Y+ YKD ++P+  RIKDLL RMTL+EKIGQMVQIER VA+ QVMKKY++GSVLS 
Sbjct  20    VSQAEYLKYKDPKRPLNVRIKDLLKRMTLEEKIGQMVQIERSVATPQVMKKYFIGSVLSG  79

Query  447   ggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLG  626
             GGSVP+  ASAE W+ MVNG Q GSLSTRLGIPMIYGIDAVHG+NN Y ATIFPHNVGLG
Sbjct  80    GGSVPETNASAETWIQMVNGIQNGSLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLG  139

Query  627   ATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEI  806
              TRDP L+++IG ATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDP+IV+AMTEI
Sbjct  140   VTRDPVLIKKIGDATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPKIVQAMTEI  199

Query  807   IPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMA  986
             IPGLQG+   N     PFVAG+ KVAACAKHYVGDGGT KGI+ENNT+V  + L  IHM 
Sbjct  200   IPGLQGDISDNSRKGVPFVAGKNKVAACAKHYVGDGGTTKGINENNTVVSYNGLLRIHMP  259

Query  987   GYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTV  1166
              Y++SI++GV+TVM SYSS NG +MHAN  ++T +LK  L+FRGFVISD+  ID +T   
Sbjct  260   AYHDSIVKGVSTVMVSYSSWNGQKMHANHFLVTDYLKNKLKFRGFVISDWLGIDRITSPS  319

Query  1167  HGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVM  1346
             H NY+YSI   + AGIDM+MVP+N+TEFID LTY VKN  +PVSRIDDAV+RILRVKFVM
Sbjct  320   HSNYSYSIQVGVGAGIDMIMVPFNFTEFIDVLTYQVKNNIIPVSRIDDAVRRILRVKFVM  379

Query  1347  GLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAG  1526
             GLFE+P  D SL + LGS +HR+LAR+AVRKSLVLLKNG +A++P+LPL KKA++ILVAG
Sbjct  380   GLFENPHADISLVNQLGSEEHRQLAREAVRKSLVLLKNGKSAEKPLLPLPKKAAKILVAG  439

Query  1527  THADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSK  1703
             +HADN+GYQCGGWTI WQG  G N+T+GTTIL A+K  +D  T+V++ ENPD  FVKS+ 
Sbjct  440   SHADNLGYQCGGWTITWQGGGGNNLTVGTTILDAVKQAIDPATKVVYNENPDSNFVKSNN  499

Query  1704  FSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQ  1883
             FS+AIV VGE  YAE  GDS NLTI EPGPS I NVC   +CVVVLITGRPVVIQPYL +
Sbjct  500   FSYAIVTVGEHPYAETFGDSLNLTISEPGPSTITNVCGSIQCVVVLITGRPVVIQPYLSK  559

Query  1884  IDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             IDALVAAWLPGTEGQGV D+LFGDYGF+GKL  TWFKTVDQ
Sbjct  560   IDALVAAWLPGTEGQGVTDLLFGDYGFTGKLARTWFKTVDQ  600



>ref|XP_006340437.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=635

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/596 (69%), Positives = 493/596 (83%), Gaps = 5/596 (1%)
 Frame = +3

Query  231   LIGVALL-CCW--VVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVAS  401
             L+G+ LL   W   +    DYMLYKD  +P+  RIKDL+SRMTL EKIGQM Q+ER+  +
Sbjct  9     LLGLVLLFSTWESCMAQQGDYMLYKDPNKPINARIKDLMSRMTLSEKIGQMTQLERKNMT  68

Query  402   AQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNN  581
               +MK Y +GS+LS GGSVPKP A+A  WVDMVN FQ+G+LS+RLGIPMIYGIDAVHG+N
Sbjct  69    TDIMKNYGIGSLLSGGGSVPKPEATAREWVDMVNEFQRGALSSRLGIPMIYGIDAVHGHN  128

Query  582   NAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYE  761
             N Y ATIFPHNVGLGATRD ELV+ IG ATALEVRATGI Y FAPCIAVCRDPRWGRCYE
Sbjct  129   NVYKATIFPHNVGLGATRDSELVKRIGVATALEVRATGIPYAFAPCIAVCRDPRWGRCYE  188

Query  762   SYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDEN  941
             SYSEDP+IV+ MTEIIPGLQG+ P N  +  P+V G+EKV ACAKH+VGDGGT+KGI+EN
Sbjct  189   SYSEDPQIVKQMTEIIPGLQGDLPTNI-VGIPYVGGKEKVVACAKHFVGDGGTIKGINEN  247

Query  942   NTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGF  1121
             NT+ D H L SIHM  YY+SII+GV+T+M SYSSLNGV+MHAN D++T FLK TL FRGF
Sbjct  248   NTVADWHTLLSIHMPAYYHSIIKGVSTIMVSYSSLNGVKMHANHDLVTNFLKGTLNFRGF  307

Query  1122  VISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSR  1301
             VISD++ ID +T   H NYT+S+L  + AGIDM+MVP NYTEFID LT LVKN F+P++R
Sbjct  308   VISDWEGIDRITSPPHSNYTHSVLAGVQAGIDMIMVPLNYTEFIDTLTSLVKNNFIPMTR  367

Query  1302  IDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEP  1481
             IDDAV+RILRVKF +GLFE+PL DY L  H+GS+ HR+LAR+AVRKSLVLLKNGANA++P
Sbjct  368   IDDAVRRILRVKFTLGLFENPLADYKLVKHVGSQAHRELAREAVRKSLVLLKNGANANDP  427

Query  1482  VLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQV  1658
             +LPL KKASRILVAG+HA+N+GYQCGGWTI WQG+ G N+TIGTTIL AI  +VD+ T+V
Sbjct  428   MLPLPKKASRILVAGSHANNLGYQCGGWTITWQGVEGNNVTIGTTILDAITASVDSNTEV  487

Query  1659  MFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVV  1838
             ++ E+P  EF+KS+ FS++IVVVGE  YAE +GDS NLTI + G   ++NVC +TKCVVV
Sbjct  488   VYSESPTTEFLKSNNFSYSIVVVGELPYAETAGDSMNLTITKGGIDTMSNVCGNTKCVVV  547

Query  1839  LITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             LI+GRP+V+QPYL  IDALVAAWLPG+EGQGVADVLFGDY F GKL  TWFK V+Q
Sbjct  548   LISGRPLVVQPYLSNIDALVAAWLPGSEGQGVADVLFGDYEFRGKLSRTWFKNVNQ  603



>ref|XP_007141605.1| hypothetical protein PHAVU_008G210100g [Phaseolus vulgaris]
 gb|ESW13599.1| hypothetical protein PHAVU_008G210100g [Phaseolus vulgaris]
Length=627

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/600 (70%), Positives = 491/600 (82%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG  +  L+ V L CC V V+ A+Y+ YKD  Q +  RIKDLL RMTL+EKIGQMVQIER
Sbjct  1     MGAIATPLVVVLLFCCLVSVSQAEYLKYKDPTQSLNVRIKDLLKRMTLEEKIGQMVQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              +A+ QVMKKY++GSVLS GGSVP+  ASAE W+ MVNG Q GSLSTRLGIPMIYGIDAV
Sbjct  61    SIATPQVMKKYFIGSVLSGGGSVPETNASAETWIQMVNGIQNGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDP L+++IG ATALEVRATGIQYVFAPCIAV RDPRWG
Sbjct  121   HGHNNVYKATIFPHNVGLGVTRDPVLIKKIGDATALEVRATGIQYVFAPCIAVSRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDPEIV+AMTEII GLQG+   N     P+VAG+ KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDPEIVKAMTEIILGLQGDISGNSRKGVPYVAGKNKVAACAKHYVGDGGTSKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNTL+    L +IHM  Y++SI++GV+TVM SYSS NG +MHAN  ++T +LK  L+
Sbjct  241   INENNTLISYRGLLNIHMPAYHDSILKGVSTVMVSYSSWNGKKMHANHFLVTDYLKNKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD+  ID +T   H NY+YSI   + AGIDM+MVP+N+TEFID L Y VKN  +
Sbjct  301   FRGFVISDWLGIDRITSPPHSNYSYSIQAGVGAGIDMIMVPFNFTEFIDVLVYQVKNNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P SRIDDAV+RILRVKFVMGLFE+PL D SL + LGS +HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PESRIDDAVERILRVKFVMGLFENPLADPSLVNQLGSEEHRQLAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTVDT  1646
             A++P+LPL KKA+ ILVAG+HADN+GYQCGGWTI WQGL GN  T+GTTIL A+K T+D 
Sbjct  421   AEKPLLPLPKKAANILVAGSHADNLGYQCGGWTITWQGLGGNNHTVGTTILDAVKQTIDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V ++E+PD  FVKS+ FS+AIV+VGE  YAE  GDS NLTI EPGPS I NVC   +
Sbjct  481   ATKVFYKESPDSTFVKSNNFSYAIVIVGEPPYAETLGDSLNLTIAEPGPSTITNVCESIQ  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVLITGRPV+IQPYL +IDALVAAWLPGTEGQGVAD+LFGDYGF+GKL  TWFKTV+Q
Sbjct  541   CVVVLITGRPVMIQPYLSKIDALVAAWLPGTEGQGVADLLFGDYGFTGKLARTWFKTVNQ  600



>ref|XP_008453517.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
 ref|XP_008453518.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis melo]
Length=628

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/588 (73%), Positives = 500/588 (85%), Gaps = 1/588 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             LLCC VV  +A Y+ YKD +QP+G RIKDL+ RMTL+EKIGQMVQIER VA+  VMK Y+
Sbjct  14    LLCCLVVATDATYLKYKDPKQPLGARIKDLMGRMTLEEKIGQMVQIERAVATPDVMKNYF  73

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GSVLS GGSVP  +ASAE WV+MVN  QKGSL+TRLGIPMIYGIDAVHG+NN YNATIF
Sbjct  74    IGSVLSGGGSVPAEKASAETWVNMVNEIQKGSLATRLGIPMIYGIDAVHGHNNVYNATIF  133

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHNVGLG TRDPEL+R IG ATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSED +I
Sbjct  134   PHNVGLGVTRDPELLRRIGEATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSEDHKI  193

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             V+ +TEIIPGLQG  PPN     PFVAG++KVAACAKH+VGDGGT +GIDENNT++D + 
Sbjct  194   VQQLTEIIPGLQGAIPPNSRKGIPFVAGKQKVAACAKHFVGDGGTTRGIDENNTVIDYNG  253

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             L  IHM  YYNSI +GVATVM SYSS NGVRMHANRD++TGFLK  L+F+GFVISD++ I
Sbjct  254   LLKIHMPAYYNSIHKGVATVMVSYSSWNGVRMHANRDLVTGFLKNKLKFKGFVISDWQGI  313

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T   H NY+YS+   + AGIDMVMVP NYTEFI+ LT  VKN  +P+SRIDDAV+RI
Sbjct  314   DRITSPPHANYSYSVQAGVGAGIDMVMVPQNYTEFINELTRQVKNNIIPMSRIDDAVQRI  373

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LR+KF+MGLFE+PL D SLA+ LGS++HR+LAR+AVRKSLVLLKNG +AD+P+LPL KKA
Sbjct  374   LRIKFLMGLFENPLADNSLANQLGSKEHRELAREAVRKSLVLLKNGPSADKPLLPLPKKA  433

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDP  1682
              +ILVAGTHADN+GYQCGGWTI WQGLSGN +T+GTTIL A+KNTVD  TQV++ ENPD 
Sbjct  434   GKILVAGTHADNLGYQCGGWTITWQGLSGNDLTVGTTILNAVKNTVDPVTQVVYNENPDA  493

Query  1683  EFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVV  1862
              FVKS++FS+AIVVVGE  YAE SGDS NL+I EPGPS I NVC + KCVVV+++GRPVV
Sbjct  494   GFVKSNEFSYAIVVVGEPPYAEISGDSMNLSISEPGPSTIKNVCSNVKCVVVVVSGRPVV  553

Query  1863  IQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +QPY+   +ALVAAWLPGTEGQGVAD+LFGDYGF+GKL  TWFKTVDQ
Sbjct  554   MQPYVGVANALVAAWLPGTEGQGVADLLFGDYGFTGKLARTWFKTVDQ  601



>ref|XP_004300933.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=632

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/582 (71%), Positives = 488/582 (84%), Gaps = 1/582 (0%)
 Frame = +3

Query  264   VVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvls  443
             + A A+ M YKD  QP+  RI DLLSRMTL+EKIGQM QI+R VAS +VM KY +GSVLS
Sbjct  23    MTAEAECMKYKDPNQPLNTRINDLLSRMTLEEKIGQMTQIDRSVASPEVMYKYKIGSVLS  82

Query  444   sggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGL  623
              GGSVP   ASAE W+ MVN FQ GSLSTRL IP+IYGIDA+HG+NN Y ATIFPHNVGL
Sbjct  83    GGGSVPAKNASAETWIRMVNDFQNGSLSTRLAIPLIYGIDAIHGHNNVYKATIFPHNVGL  142

Query  624   GATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTE  803
             GATRDP+LV+ IGAATALE+RATGI Y FAPC+AVCRDPRWGRCYESYSEDP +V+AMTE
Sbjct  143   GATRDPDLVKRIGAATALEIRATGIHYTFAPCVAVCRDPRWGRCYESYSEDPRLVQAMTE  202

Query  804   IIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHM  983
             IIPGLQGE P N     P+V+G +KVAACAKHYVGDGGT  GI+ENN ++D H L SIHM
Sbjct  203   IIPGLQGEIPANSRKGVPYVSGNDKVAACAKHYVGDGGTAMGINENNAVIDRHGLLSIHM  262

Query  984   AGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPT  1163
               Y ++II+GVA+VM SYSS NGV+MHANR++ITGFLK TL F+GFVISD++ ID +T  
Sbjct  263   PPYPSAIIKGVASVMISYSSWNGVKMHANRELITGFLKGTLGFKGFVISDWQGIDMITSP  322

Query  1164  VHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFV  1343
              H NY+YSI+  I+AGIDM+MVPYNYTEFI+GLT+ VKNK +P+SRIDDAVKRILRVKF 
Sbjct  323   SHSNYSYSIMKGISAGIDMIMVPYNYTEFIEGLTFRVKNKIIPMSRIDDAVKRILRVKFT  382

Query  1344  MGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVA  1523
             MG FE PL D  L   LGS++HR+LAR+AVR+SLVLLKNG  A++P+LPL KK S+ILVA
Sbjct  383   MGQFEKPLADLRLVSQLGSQEHRELAREAVRRSLVLLKNGECAEKPILPLPKKTSKILVA  442

Query  1524  GTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSS  1700
             GTHAD++GYQCGGWTIEWQG SG N+T GTT+L+AI+NTV  +T+V++++NPD +F+KS+
Sbjct  443   GTHADDLGYQCGGWTIEWQGHSGNNLTQGTTVLSAIRNTVAPETRVVYKKNPDAKFMKSN  502

Query  1701  KFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLP  1880
              FSHAIV+VGE  YAEG+GD+ NLTIP+ G  +I NVC  +KCVV LITGRPVVI+PYL 
Sbjct  503   NFSHAIVIVGEPPYAEGAGDNLNLTIPKSGRRVIRNVCGASKCVVCLITGRPVVIEPYLS  562

Query  1881  QIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
              IDALVAAWLPGTEGQGVADVLFGDYGF+GKLP TWFK+V Q
Sbjct  563   IIDALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTWFKSVHQ  604



>ref|XP_009786310.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
 ref|XP_009786311.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
 ref|XP_009786312.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=628

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/600 (70%), Positives = 502/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S  ++G  +LC W VVA  +Y+ YKD +QPVG RIKDL+ RMTL+EKIGQM QIER
Sbjct  1     MGRMSIPMMGFVVLCLWAVVAEGEYVKYKDPKQPVGARIKDLMKRMTLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VA+A VMK+ ++GSVLS GGSVP P+ASA+ W +MV+  QKGSLSTRLGIPMIYGIDAV
Sbjct  61    KVATADVMKQNFIGSVLSGGGSVPAPKASAQVWTNMVDEIQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDP+LV+ IGAATALEVRATGI Y FAPCIAVCR+PRWG
Sbjct  121   HGHNNVYGATIFPHNVGLGVTRDPDLVKRIGAATALEVRATGIPYAFAPCIAVCRNPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IVR+MTEIIPGLQG+ P       P+V G+ KVAACAKH+VGDGGT+ G
Sbjct  181   RCYESYSEDHRIVRSMTEIIPGLQGDLPAKSKNGVPYVGGKTKVAACAKHFVGDGGTLHG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             +DE+NT++ ++ LFSIHM  YY+S+ +GVATVM SYSS NG +MHANRD++TGFLK  L+
Sbjct  241   VDESNTVISSNSLFSIHMPAYYDSLRKGVATVMVSYSSWNGRKMHANRDLVTGFLKDKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+   I AGIDM+MVP NY EFID LT  VK   +
Sbjct  301   FRGFVISDWQGIDRITDPPHANYSYSVQAGIMAGIDMIMVPENYREFIDTLTSQVKANII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+P+ D SLA+ LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFENPMSDPSLANQLGSQEHRELAREAVRKSLVLLKNGKT  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
               +P+LPL KKA +ILVAGTHADN+GYQCGGWTIEWQG++GN +TIGTTILTAIK TVD 
Sbjct  421   PSQPLLPLPKKAPKILVAGTHADNLGYQCGGWTIEWQGVAGNDLTIGTTILTAIKKTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++++NPD  FVKS+KFS+AIVVVGE  YAE  GDSSNLTI EPGPS I+N+C   K
Sbjct  481   STQVVYQQNPDANFVKSNKFSYAIVVVGEVPYAEMFGDSSNLTIAEPGPSTISNICGAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRPVV++PY+ ++DALVAAWLPGTEGQGVAD LFGDYGF+GKL  TWFK VDQ
Sbjct  541   CVVVVVSGRPVVLEPYVSKMDALVAAWLPGTEGQGVADALFGDYGFTGKLARTWFKRVDQ  600



>ref|XP_002514453.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF47949.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=648

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/597 (68%), Positives = 491/597 (82%), Gaps = 2/597 (0%)
 Frame = +3

Query  222   SRFL-IGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVA  398
             SR L +G+  L  W+ +  A+Y+ YKD +QPVG R+KDL+ RMTL+EKI QMVQI+R +A
Sbjct  2     SRVLAMGILWLWVWIAMVEAEYVKYKDPKQPVGARVKDLMKRMTLEEKIAQMVQIDRLIA  61

Query  399   SAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGN  578
             S  ++K Y +GSVLS GGS P   ASAE WV+M+NGFQ GSLS+RLGIPMIYGIDAVHG+
Sbjct  62    SPDILKTYSIGSVLSGGGSAPLHEASAEDWVNMINGFQNGSLSSRLGIPMIYGIDAVHGH  121

Query  579   NNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCY  758
             NN YNATIFPHN+GLGATRDP LV+ IG+ATALEVRATGI YVFAPCIAVCRDPRWGRCY
Sbjct  122   NNVYNATIFPHNIGLGATRDPNLVKRIGSATALEVRATGIPYVFAPCIAVCRDPRWGRCY  181

Query  759   ESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDE  938
             ESYSED  +V  MTEI+ GLQG+ P       P+V G++KVAACAKH+VGDGGT KGI+E
Sbjct  182   ESYSEDHNVVEEMTEIVLGLQGDIPAKSRKGVPYVGGKKKVAACAKHFVGDGGTTKGINE  241

Query  939   NNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRG  1118
             NNT++D H L S+HM  Y +SII+GV+T+M SYSS NG +MH NR++ITGFLK TL+F+G
Sbjct  242   NNTVIDMHGLLSMHMPAYSDSIIKGVSTIMVSYSSWNGEKMHGNRELITGFLKDTLKFKG  301

Query  1119  FVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVS  1298
             FVISD++ ID +T   H NY+YS+  +I AGIDMVMVP+NYTEF D L YLVKNK +P+ 
Sbjct  302   FVISDWQGIDRITSPPHANYSYSVQAAIQAGIDMVMVPFNYTEFSDDLIYLVKNKVIPMD  361

Query  1299  RIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADE  1478
             RIDDAV RIL VKF MGLFE+PL D SL + LGS++HR LAR+AVRKSLVLLKNG N  +
Sbjct  362   RIDDAVGRILLVKFSMGLFENPLADLSLVNELGSQEHRDLAREAVRKSLVLLKNGKNGTD  421

Query  1479  PVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQ  1655
             P+LPL KKAS++LVAGTHADN+GYQCGGWTIEWQG +G N T GTTIL AIK+ +D  T+
Sbjct  422   PLLPLPKKASKVLVAGTHADNLGYQCGGWTIEWQGFNGNNYTRGTTILAAIKSAIDPDTE  481

Query  1656  VMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVV  1835
             V+F+ENPD  FVKS+KF +AIVVVGE  YAE +GDS +LT+ +PGP++I+NVC   KCVV
Sbjct  482   VVFQENPDSSFVKSNKFDYAIVVVGEPPYAETAGDSLDLTMMDPGPTVISNVCETVKCVV  541

Query  1836  VLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ++++GRP+VI+PY+  +DALVAAWLPGTEGQGV DVLFGDYGF+GKLP TWFK V+Q
Sbjct  542   IIVSGRPLVIEPYVFSMDALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTWFKNVEQ  598



>gb|KHN14336.1| Lysosomal beta glucosidase [Glycine soja]
Length=688

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/604 (69%), Positives = 490/604 (81%), Gaps = 5/604 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVV---ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQ  380
             M +    L+GV  LCCW+     +  +Y+ YKD +QPV  R++DL+SRMTL+EKIGQMVQ
Sbjct  1     MSRALVHLLGVLWLCCWLASTGESQIEYLRYKDPKQPVPTRVRDLMSRMTLEEKIGQMVQ  60

Query  381   IERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGI  560
             I+R VA+A VMK  ++GSVLS GGS P PRA+AE WV+M+N FQKG+L +RLGIPMIYGI
Sbjct  61    IDRSVANANVMKTSFIGSVLSGGGSEPLPRATAEDWVNMINDFQKGALESRLGIPMIYGI  120

Query  561   DAVHGNNNAYNATIFPHNVGLGATR-DPELVREIGAATALEVRATGIQYVFAPCIAVCRD  737
             DAVHG+NN YNATIFPHNVGLG TR DP L + IGAATALEVRATGI YVFAPCIAVCRD
Sbjct  121   DAVHGHNNVYNATIFPHNVGLGCTRQDPNLAQRIGAATALEVRATGIPYVFAPCIAVCRD  180

Query  738   PRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGG  917
             PRWGRCYESYSEDP+IV+ MTEIIPGLQG  P N    FP+V G+ KVAACAKH+VGDGG
Sbjct  181   PRWGRCYESYSEDPKIVQEMTEIIPGLQGSIPANSRKGFPYVGGKTKVAACAKHFVGDGG  240

Query  918   TVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLK  1097
             T KGI+ENNT++D H L SIHM  Y +SII+GV+TVM SYSS NGVRMHANRD++TGFLK
Sbjct  241   TTKGINENNTVIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGVRMHANRDLVTGFLK  300

Query  1098  KTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVK  1277
              TL+F+GFVISD++ ID LT     NYTYS+  SI AG+DMVMVP+ Y +FI  LT LVK
Sbjct  301   NTLKFKGFVISDWQGIDRLTSPPSSNYTYSVQASIEAGVDMVMVPFEYGKFIQDLTLLVK  360

Query  1278  NKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLK  1457
             +  +P+ RIDDAV+RIL VKF MGLFE+PL D SL + LGS++HR LAR+AVRKSLVLLK
Sbjct  361   SNIIPMERIDDAVERILLVKFTMGLFENPLADTSLVNELGSQEHRDLAREAVRKSLVLLK  420

Query  1458  NGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKN  1634
             NG N    +LPL KK  +ILVAG+HADN+GYQCGGWTI+WQG SGN  T GTTIL AIK+
Sbjct  421   NGKNESASLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGFSGNSDTRGTTILNAIKS  480

Query  1635  TVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVC  1814
              VDT T+V+F +NPD EFVKS+ F +AIVVVGE  YAE +GDS+ LT+ E GP++I NVC
Sbjct  481   AVDTSTEVVFRDNPDNEFVKSNNFEYAIVVVGEPPYAETAGDSTTLTMMESGPNVINNVC  540

Query  1815  PHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFK  1994
                KCVVV+I+GRP+VI+PY+  IDALVAAWLPGTEGQG+ DVLFGDYGF+GKL  TWFK
Sbjct  541   GTVKCVVVIISGRPIVIEPYISSIDALVAAWLPGTEGQGMTDVLFGDYGFTGKLARTWFK  600

Query  1995  TVDQ  2006
             +VDQ
Sbjct  601   SVDQ  604



>ref|XP_009342674.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
 ref|XP_009342678.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
 ref|XP_009342686.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=632

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/581 (72%), Positives = 483/581 (83%), Gaps = 2/581 (0%)
 Frame = +3

Query  270   ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssg  449
             + ADY  YKD +QP+  RI+DL+ RMTL EKIGQM QIER VA+  VM KY++GSVLS G
Sbjct  25    SEADYFKYKDPKQPLNARIRDLMKRMTLAEKIGQMTQIERSVATPDVMNKYFIGSVLSGG  84

Query  450   gsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGA  629
             GS P P+ASAEAWV++VNG QKGSLSTRLGIPMIYGIDAVHG+NN YNATIFPHNVGLG 
Sbjct  85    GSEPAPKASAEAWVNLVNGLQKGSLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGV  144

Query  630   TRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEII  809
             TRDP LV+ IG ATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSED +IV+AMTEII
Sbjct  145   TRDPNLVKRIGEATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSEDHKIVQAMTEII  204

Query  810   PGLQGEAPPNYPLSFPFVA-GREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMA  986
             PGLQG+ PP      P+V+  + KVAACAKHYVGDGGT KGI+ENNT++D   L SIHM 
Sbjct  205   PGLQGDMPPTARRGAPYVSTAKGKVAACAKHYVGDGGTTKGINENNTVIDLDGLLSIHMP  264

Query  987   GYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTV  1166
              Y NSI +GVATVM SYSS NG +MHAN++++TG+LK  LRFRGFVISD++ ID +T   
Sbjct  265   AYLNSIRKGVATVMVSYSSWNGNKMHANKELVTGYLKDKLRFRGFVISDWEGIDRITSPP  324

Query  1167  HGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVM  1346
               NY+YS+   + AGIDM+MVPYN+T+FID LTY VKN  +P+SRIDDAV+RILRVKFVM
Sbjct  325   KANYSYSVQAGVGAGIDMIMVPYNFTDFIDDLTYQVKNNIIPMSRIDDAVQRILRVKFVM  384

Query  1347  GLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAG  1526
             GLFE+PL D SLA  LG++ HR LAR+AVRKSLVLLKNG +A +PVLPL KKA +ILVAG
Sbjct  385   GLFENPLADLSLASQLGNKVHRDLAREAVRKSLVLLKNGKSAYKPVLPLPKKAGKILVAG  444

Query  1527  THADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSK  1703
             +HADN+G QCGGWTI WQGL GN  T+GTTIL+A+K+TVD  TQV++ ENPD  FVKS+K
Sbjct  445   SHADNLGNQCGGWTITWQGLEGNDHTMGTTILSAVKSTVDPTTQVVYNENPDANFVKSNK  504

Query  1704  FSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQ  1883
             FS+AIVVVGE  Y+E  GDS NLTIP+PGPS IANVC   KCVVV+I+GRPVV+QPYL  
Sbjct  505   FSYAIVVVGEPPYSETFGDSLNLTIPQPGPSTIANVCGAVKCVVVVISGRPVVLQPYLAG  564

Query  1884  IDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             IDALVAAWLPGTEGQGV D LFGDYGF+GKL  TWFKTVDQ
Sbjct  565   IDALVAAWLPGTEGQGVTDALFGDYGFTGKLAHTWFKTVDQ  605



>ref|XP_006347720.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Solanum 
tuberosum]
Length=630

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/601 (69%), Positives = 493/601 (82%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVA-NADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MGK S     V L+  W  +A   DY+ YKD  QPVG R+KDLL RMTL+EKIGQM+QI+
Sbjct  1     MGKKSWVWWFVTLVLWWNKIAMGEDYIKYKDPEQPVGVRVKDLLGRMTLQEKIGQMIQID  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VA+ Q+MK YY+GSVLS GGS P P+A+A  WV+MVN +Q GS+STRLGIPMIYGIDA
Sbjct  61    RTVATIQIMKDYYIGSVLSGGGSTPLPKATAADWVNMVNDYQNGSMSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN +NATIFPHN+GLGA RDPEL+R IG ATALEVRATGI YVFAPCIAVCRDPRW
Sbjct  121   VHGHNNVFNATIFPHNIGLGAARDPELMRRIGDATALEVRATGIPYVFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP+IV+ MT+II GLQGE P       P++AG++KVAACAKH+VGDGGT K
Sbjct  181   GRCYESYSEDPKIVQEMTDIIIGLQGEIPNGSRKGIPYIAGKKKVAACAKHFVGDGGTTK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             G++ENNT+ D H+L SIHM  Y +SII+GVATVMASYSS NG +MHA+ D++TGFLK TL
Sbjct  241   GVNENNTVTDKHELLSIHMPAYDDSIIKGVATVMASYSSWNGRKMHADHDLVTGFLKGTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +F+GFVISD++ ID LT   H NYTYS+ TSI AG+DMVMVPYN+TEFI+ LTYLVKN F
Sbjct  301   KFKGFVISDWQGIDRLTSPPHANYTYSVETSILAGVDMVMVPYNFTEFINDLTYLVKNNF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P  RIDDAV+RIL VKF MGLFE+P  D+SL + +GS++HR LAR+AVRKSLVLLKNG 
Sbjct  361   IPTDRIDDAVERILSVKFTMGLFENPYTDFSLINEVGSQEHRNLAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVD  1643
              A+ P+LPL KK SRILVAG HADN+GYQCGGWTI WQG SGN  T GTTIL AIK+ VD
Sbjct  421   TANNPLLPLPKKVSRILVAGGHADNLGYQCGGWTITWQGFSGNDATSGTTILGAIKSAVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T+V++ ENPD ++  SS+F +AIVVVGE  YAE +GDS  LT+ +PGP +I NVC   
Sbjct  481   PGTEVIYFENPDSKYATSSRFDYAIVVVGEHPYAESAGDSPTLTVADPGPDVINNVCQSV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVV++I+GRP+V++P+LP IDALVAAWLPGTEGQG+ D+LFGDYGF+GKLP TWF+TVD
Sbjct  541   KCVVIVISGRPLVLEPFLPSIDALVAAWLPGTEGQGITDLLFGDYGFTGKLPRTWFRTVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_006347719.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Solanum 
tuberosum]
Length=662

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/601 (69%), Positives = 493/601 (82%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVA-NADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MGK S     V L+  W  +A   DY+ YKD  QPVG R+KDLL RMTL+EKIGQM+QI+
Sbjct  1     MGKKSWVWWFVTLVLWWNKIAMGEDYIKYKDPEQPVGVRVKDLLGRMTLQEKIGQMIQID  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VA+ Q+MK YY+GSVLS GGS P P+A+A  WV+MVN +Q GS+STRLGIPMIYGIDA
Sbjct  61    RTVATIQIMKDYYIGSVLSGGGSTPLPKATAADWVNMVNDYQNGSMSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN +NATIFPHN+GLGA RDPEL+R IG ATALEVRATGI YVFAPCIAVCRDPRW
Sbjct  121   VHGHNNVFNATIFPHNIGLGAARDPELMRRIGDATALEVRATGIPYVFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP+IV+ MT+II GLQGE P       P++AG++KVAACAKH+VGDGGT K
Sbjct  181   GRCYESYSEDPKIVQEMTDIIIGLQGEIPNGSRKGIPYIAGKKKVAACAKHFVGDGGTTK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             G++ENNT+ D H+L SIHM  Y +SII+GVATVMASYSS NG +MHA+ D++TGFLK TL
Sbjct  241   GVNENNTVTDKHELLSIHMPAYDDSIIKGVATVMASYSSWNGRKMHADHDLVTGFLKGTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +F+GFVISD++ ID LT   H NYTYS+ TSI AG+DMVMVPYN+TEFI+ LTYLVKN F
Sbjct  301   KFKGFVISDWQGIDRLTSPPHANYTYSVETSILAGVDMVMVPYNFTEFINDLTYLVKNNF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P  RIDDAV+RIL VKF MGLFE+P  D+SL + +GS++HR LAR+AVRKSLVLLKNG 
Sbjct  361   IPTDRIDDAVERILSVKFTMGLFENPYTDFSLINEVGSQEHRNLAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVD  1643
              A+ P+LPL KK SRILVAG HADN+GYQCGGWTI WQG SGN  T GTTIL AIK+ VD
Sbjct  421   TANNPLLPLPKKVSRILVAGGHADNLGYQCGGWTITWQGFSGNDATSGTTILGAIKSAVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T+V++ ENPD ++  SS+F +AIVVVGE  YAE +GDS  LT+ +PGP +I NVC   
Sbjct  481   PGTEVIYFENPDSKYATSSRFDYAIVVVGEHPYAESAGDSPTLTVADPGPDVINNVCQSV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVV++I+GRP+V++P+LP IDALVAAWLPGTEGQG+ D+LFGDYGF+GKLP TWF+TVD
Sbjct  541   KCVVIVISGRPLVLEPFLPSIDALVAAWLPGTEGQGITDLLFGDYGFTGKLPRTWFRTVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_006361125.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=628

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/600 (68%), Positives = 485/600 (81%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S  + G  L C W V A A+Y+ YKD +QP+  RIKDL+ RMTL+EKIGQM QIER
Sbjct  1     MGRFSIPMKGFVLFCLWAVSAEAEYLKYKDPKQPMSTRIKDLMKRMTLEEKIGQMSQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + AS  VM +Y++GSVLS  G  P   A+AE WV+MVN  QK +LSTRLGIPMIYGIDA+
Sbjct  61    RFASPDVMNQYFIGSVLSVPGDTPGLNATAEDWVNMVNKIQKAALSTRLGIPMIYGIDAI  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+N+ YNATIFPHN+GLG TRDP+LV+ IGAATALEVRATGI Y FAPC+AVCRDPRWG
Sbjct  121   HGHNDVYNATIFPHNIGLGVTRDPDLVKRIGAATALEVRATGIPYAFAPCVAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IVR MTEIIPGLQG+ P N     PFV G+ KVAACAKHYV DGGT +G
Sbjct  181   RCYESYSEDINIVRTMTEIIPGLQGDVPTNSSKGVPFVGGKSKVAACAKHYVADGGTERG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT+++   L+ IHM  YY+SII+GV+TVM SYSSLNG +MH NRD++T FLK  L+
Sbjct  241   IDENNTVINRTSLYGIHMPAYYDSIIKGVSTVMISYSSLNGEKMHTNRDLVTRFLKDNLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGF+ISD + +D +T     NYTYS+   I AGIDMVM+P NY EFI  LT LVK+  +
Sbjct  301   FRGFIISDSEGLDRITSPPDANYTYSVQAGILAGIDMVMIPNNYAEFIGNLTLLVKDNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV+RILRVKF++ LFEDPL D SL + LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVERILRVKFILDLFEDPLADLSLVNQLGSQEHRELAREAVRKSLVLLKNGKI  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
               +P+LPL KKA +ILVAGTHADN+GYQCGGWT +WQG+SG N  +GTTIL+AIK TVD 
Sbjct  421   TSQPLLPLPKKAPKILVAGTHADNLGYQCGGWTNQWQGVSGNNFIVGTTILSAIKKTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++++NPD  FVKS+KF +AIVVVGE  YAE  GDSSNLTIPEPGPS I NVC   K
Sbjct  481   STQVVYQQNPDANFVKSNKFDYAIVVVGEVPYAEMFGDSSNLTIPEPGPSTINNVCGAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRPVV++PY+ +IDALVAAWLPGTEGQGVADVLFG+YGF+GKL  TWF++VDQ
Sbjct  541   CVVVVISGRPVVLEPYVDKIDALVAAWLPGTEGQGVADVLFGEYGFTGKLARTWFRSVDQ  600



>ref|XP_009368634.1| PREDICTED: lysosomal beta glucosidase-like [Pyrus x bretschneideri]
Length=632

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/579 (72%), Positives = 484/579 (84%), Gaps = 2/579 (0%)
 Frame = +3

Query  276   ADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggs  455
             ADY  YKD +QP+  RI+DL+ RMTL EKIGQM QIER VA+  VM KY++GSVLS GGS
Sbjct  27    ADYFKYKDPKQPLNARIRDLMKRMTLAEKIGQMTQIERTVATPDVMTKYFIGSVLSGGGS  86

Query  456   vpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATR  635
             VP P+ASAE W+++VNG QKGSLSTRLGIPMIYGIDAVHG+NN YNATIFPHNVGLGATR
Sbjct  87    VPAPKASAETWINLVNGLQKGSLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATR  146

Query  636   DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPG  815
             DP LV+ IG ATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSED +IV+AMTEIIPG
Sbjct  147   DPNLVKRIGEATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSEDHKIVQAMTEIIPG  206

Query  816   LQGEAPPNYPLSFPFVA-GREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGY  992
             LQG+ PP      P+V+  + KVAACAKHY+GDGGT  GI+ENNT++D + L  IHM  Y
Sbjct  207   LQGDMPPTAQKGAPYVSTAKGKVAACAKHYLGDGGTTNGINENNTVIDLNGLLRIHMPAY  266

Query  993   YNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHG  1172
              NSI++GVATVM SYSS NG +MHAN++++TG+LK  LRFRGFVISD++ ID +T     
Sbjct  267   LNSILKGVATVMVSYSSWNGKKMHANKELVTGYLKDKLRFRGFVISDWEGIDRITSPPKA  326

Query  1173  NYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGL  1352
             NY+YS+   + AGIDM+MVPYN+T+FID LTY VKN  +P+SRIDDAVKRILRVKFVMGL
Sbjct  327   NYSYSVQAGVGAGIDMIMVPYNFTDFIDELTYQVKNNIIPMSRIDDAVKRILRVKFVMGL  386

Query  1353  FEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTH  1532
             FE+PL D SLA  LGS++HR+LAR+AVRKSLVLLKNG +A +P+LPL KKA +ILVAG+H
Sbjct  387   FENPLADLSLASQLGSKEHRELAREAVRKSLVLLKNGKSAYKPLLPLPKKAGKILVAGSH  446

Query  1533  ADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFS  1709
             A+N+G QCGGWTI WQGL G N T+GTTIL+AIK+TVD  TQV++ ENPD  FVKS+KFS
Sbjct  447   ANNLGNQCGGWTITWQGLEGNNNTMGTTILSAIKSTVDPTTQVVYNENPDANFVKSNKFS  506

Query  1710  HAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQID  1889
             +AIV VGE  YAE  GD+ NLTIP+PGPS IANVC   KCVVV+I+GRPVVIQPYL  ID
Sbjct  507   YAIVAVGEPPYAETFGDNLNLTIPQPGPSTIANVCGAVKCVVVVISGRPVVIQPYLAGID  566

Query  1890  ALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ALVAAWLPGTEGQGV D LFGDYGF+GKL  TWFKTVDQ
Sbjct  567   ALVAAWLPGTEGQGVTDALFGDYGFTGKLARTWFKTVDQ  605



>ref|XP_004230073.1| PREDICTED: lysosomal beta glucosidase [Solanum lycopersicum]
Length=662

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/601 (68%), Positives = 494/601 (82%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVA-NADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MGK S     V ++  W  +A   +Y+ YKD  QPVG R+KDL+ RMTL+EKIGQM+QI+
Sbjct  1     MGKKSWVWWFVTMMLWWSKIAMGEEYIKYKDPEQPVGVRVKDLIGRMTLQEKIGQMIQID  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VA+ Q+MK YY+GSVLS GGS P P+A+A  WV+MVN +Q GS+STRLGIPMIYGIDA
Sbjct  61    RTVATIQIMKDYYIGSVLSGGGSTPLPKATAADWVNMVNDYQNGSMSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN +NATIFPHN+GLGA RDPEL+R IG ATALEVRATGI YVFAPCIAVCRDPRW
Sbjct  121   VHGHNNVFNATIFPHNIGLGAARDPELMRRIGDATALEVRATGIPYVFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP+IV+ MT+II GLQGE P       P++AG++KVAACAKH+VGDGGT K
Sbjct  181   GRCYESYSEDPKIVQEMTDIIIGLQGEIPNGSRKGIPYIAGKKKVAACAKHFVGDGGTTK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             G++ENNT+ D H+L SIHM  Y +SII+GVATVMASYSS NG +MHA+ D++TGFLK TL
Sbjct  241   GVNENNTVTDKHELLSIHMPAYDDSIIKGVATVMASYSSWNGRKMHADHDLVTGFLKGTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             RF+GFVISD++ ID LT   H NYTYS+ TSI AG+DMVMVPYN+TEFI+ LTYLVKN F
Sbjct  301   RFKGFVISDWQGIDRLTSPPHANYTYSVETSILAGVDMVMVPYNFTEFINDLTYLVKNNF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P  RIDDAV+RIL VKF MGLFE+P  D+SL + +GS++HR LAR+AVRKSLVLLKNG 
Sbjct  361   IPTDRIDDAVERILSVKFTMGLFENPYTDFSLINEVGSQEHRNLAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVD  1643
              A+ P+LPL KK SRILVAG+HADN+GYQCGGWTI WQG SGN  T GTTIL AIK+ VD
Sbjct  421   TANNPLLPLPKKVSRILVAGSHADNLGYQCGGWTITWQGFSGNDATSGTTILGAIKSAVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
              +T+V++ ENPD ++  SS F +AIVVVGE  YAE +GDS  LT+ +PGP +I NVC   
Sbjct  481   PRTEVIYFENPDSKYATSSGFDYAIVVVGEHPYAESAGDSPTLTVADPGPDVINNVCQSV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVV++I+GRP+V++PYLP IDALVAAWLPGTEGQG+ D+LFGDYGF+GKLP TWF+TV+
Sbjct  541   KCVVIVISGRPLVLEPYLPSIDALVAAWLPGTEGQGITDLLFGDYGFTGKLPRTWFRTVN  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_009609159.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=659

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/596 (71%), Positives = 508/596 (85%), Gaps = 2/596 (0%)
 Frame = +3

Query  225   RFLIGV-ALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVAS  401
             R+ +G+  L C W VVA A+Y+ YKD +QP+G RI+DL+ RM+L+EKIGQM QIER+VA+
Sbjct  36    RYSMGLFVLFCLWAVVAEAEYLKYKDPKQPLGARIRDLMKRMSLEEKIGQMTQIERKVAT  95

Query  402   AQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNN  581
             A VMK+Y++GSVLS GGSVP P+ASAE W+ MVN  QKG+LSTRLGIPMIYGIDAVHG+N
Sbjct  96    ADVMKQYFIGSVLSGGGSVPAPKASAEDWIKMVNELQKGALSTRLGIPMIYGIDAVHGHN  155

Query  582   NAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYE  761
             N YNATIFPHN+GLG TRDP L++ IGAATALEVRATGIQY F+PCIAVCRDPRWGRCYE
Sbjct  156   NVYNATIFPHNIGLGVTRDPNLLKRIGAATALEVRATGIQYAFSPCIAVCRDPRWGRCYE  215

Query  762   SYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDEN  941
             SYSED +IVRAMT+IIPGLQG+ P N     PFVAG+ KVAACAKH+VGDGGTV GIDEN
Sbjct  216   SYSEDHKIVRAMTDIIPGLQGDLPANSRKGVPFVAGKSKVAACAKHFVGDGGTVNGIDEN  275

Query  942   NTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGF  1121
             NT+++++ LF IHM  YY+SII+GV+TVM SYSS NG +MHANRD++TGFLK  L+FRGF
Sbjct  276   NTVINSNGLFGIHMPAYYDSIIKGVSTVMVSYSSWNGKKMHANRDLVTGFLKDKLKFRGF  335

Query  1122  VISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSR  1301
             VISD++ ID +T   H NYTYS+   ++AGIDM+MVP NYTEFID LT LVK+  +P++R
Sbjct  336   VISDWQGIDRITSPPHANYTYSVQAGVSAGIDMIMVPENYTEFIDTLTQLVKDNIIPMNR  395

Query  1302  IDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEP  1481
             IDDAVKRILRVKF MGLFE+PL D S  + LGS++HR+LAR+AVRKSLVLLKNG +  +P
Sbjct  396   IDDAVKRILRVKFTMGLFENPLADLSYVNQLGSQEHRELAREAVRKSLVLLKNGKSTSQP  455

Query  1482  VLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQV  1658
             +LPL KKA +ILV GTHADN+GYQCGGWTIEWQG++GN +T+GTTIL+AIKNTVD  TQV
Sbjct  456   LLPLPKKAPKILVTGTHADNLGYQCGGWTIEWQGVAGNDLTVGTTILSAIKNTVDPATQV  515

Query  1659  MFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVV  1838
             ++E+NPD  FVKS++FS+AIV+VGE  YAE  GDS+NLTI EPGPS I NVC   KCVVV
Sbjct  516   VYEQNPDSNFVKSNQFSYAIVIVGEVPYAEMFGDSTNLTITEPGPSTINNVCEAVKCVVV  575

Query  1839  LITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +++GRPVV++PY+ +IDALVAAWLPG+EGQGVAD LFGDYGF+GKL  TWFK+VDQ
Sbjct  576   VVSGRPVVLEPYVEKIDALVAAWLPGSEGQGVADALFGDYGFTGKLARTWFKSVDQ  631



>ref|XP_009609160.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=658

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/596 (71%), Positives = 508/596 (85%), Gaps = 2/596 (0%)
 Frame = +3

Query  225   RFLIGV-ALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVAS  401
             R+ +G+  L C W VVA A+Y+ YKD +QP+G RI+DL+ RM+L+EKIGQM QIER+VA+
Sbjct  35    RYSMGLFVLFCLWAVVAEAEYLKYKDPKQPLGARIRDLMKRMSLEEKIGQMTQIERKVAT  94

Query  402   AQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNN  581
             A VMK+Y++GSVLS GGSVP P+ASAE W+ MVN  QKG+LSTRLGIPMIYGIDAVHG+N
Sbjct  95    ADVMKQYFIGSVLSGGGSVPAPKASAEDWIKMVNELQKGALSTRLGIPMIYGIDAVHGHN  154

Query  582   NAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYE  761
             N YNATIFPHN+GLG TRDP L++ IGAATALEVRATGIQY F+PCIAVCRDPRWGRCYE
Sbjct  155   NVYNATIFPHNIGLGVTRDPNLLKRIGAATALEVRATGIQYAFSPCIAVCRDPRWGRCYE  214

Query  762   SYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDEN  941
             SYSED +IVRAMT+IIPGLQG+ P N     PFVAG+ KVAACAKH+VGDGGTV GIDEN
Sbjct  215   SYSEDHKIVRAMTDIIPGLQGDLPANSRKGVPFVAGKSKVAACAKHFVGDGGTVNGIDEN  274

Query  942   NTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGF  1121
             NT+++++ LF IHM  YY+SII+GV+TVM SYSS NG +MHANRD++TGFLK  L+FRGF
Sbjct  275   NTVINSNGLFGIHMPAYYDSIIKGVSTVMVSYSSWNGKKMHANRDLVTGFLKDKLKFRGF  334

Query  1122  VISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSR  1301
             VISD++ ID +T   H NYTYS+   ++AGIDM+MVP NYTEFID LT LVK+  +P++R
Sbjct  335   VISDWQGIDRITSPPHANYTYSVQAGVSAGIDMIMVPENYTEFIDTLTQLVKDNIIPMNR  394

Query  1302  IDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEP  1481
             IDDAVKRILRVKF MGLFE+PL D S  + LGS++HR+LAR+AVRKSLVLLKNG +  +P
Sbjct  395   IDDAVKRILRVKFTMGLFENPLADLSYVNQLGSQEHRELAREAVRKSLVLLKNGKSTSQP  454

Query  1482  VLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQV  1658
             +LPL KKA +ILV GTHADN+GYQCGGWTIEWQG++GN +T+GTTIL+AIKNTVD  TQV
Sbjct  455   LLPLPKKAPKILVTGTHADNLGYQCGGWTIEWQGVAGNDLTVGTTILSAIKNTVDPATQV  514

Query  1659  MFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVV  1838
             ++E+NPD  FVKS++FS+AIV+VGE  YAE  GDS+NLTI EPGPS I NVC   KCVVV
Sbjct  515   VYEQNPDSNFVKSNQFSYAIVIVGEVPYAEMFGDSTNLTITEPGPSTINNVCEAVKCVVV  574

Query  1839  LITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +++GRPVV++PY+ +IDALVAAWLPG+EGQGVAD LFGDYGF+GKL  TWFK+VDQ
Sbjct  575   VVSGRPVVLEPYVEKIDALVAAWLPGSEGQGVADALFGDYGFTGKLARTWFKSVDQ  630



>ref|XP_004135054.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN52155.1| hypothetical protein Csa_5G612840 [Cucumis sativus]
Length=658

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/598 (69%), Positives = 491/598 (82%), Gaps = 5/598 (1%)
 Frame = +3

Query  228   FLIGVALLCC----WVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQV  395
             F+  V +LC     W  + +A+ + YKD +QPVG R+KDLL RMTL+EKIGQMVQI+R V
Sbjct  5     FVQVVVILCLGWLWWATMVDAENLKYKDPKQPVGVRVKDLLGRMTLEEKIGQMVQIDRSV  64

Query  396   ASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHG  575
             A+A VMK Y++GSVLS GGSVP P A AE WV+M+N FQKGSLS+RLGIPM YGIDAVHG
Sbjct  65    ANATVMKDYFIGSVLSGGGSVPLPDARAEDWVNMINDFQKGSLSSRLGIPMFYGIDAVHG  124

Query  576   NNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRC  755
             +NN YNAT+FPHNVGLGATR+P+LVR IGAATALEVRATGI Y FAPC+AVCRDPRWGRC
Sbjct  125   HNNVYNATVFPHNVGLGATRNPDLVRRIGAATALEVRATGISYTFAPCLAVCRDPRWGRC  184

Query  756   YESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGID  935
             YESYSEDP+IV+ MTEII GLQGE P NY    P+V G +KV ACAKH+VGDGGT  GI+
Sbjct  185   YESYSEDPKIVKEMTEIIIGLQGEPPANYRKGTPYVGGTKKVIACAKHFVGDGGTTHGIN  244

Query  936   ENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFR  1115
             ENNT+++ H L SIHM  Y +SII+GV++VMASYSS NGV+MHANR++IT FLK  L+F+
Sbjct  245   ENNTVINRHGLLSIHMPAYLDSIIKGVSSVMASYSSWNGVKMHANRELITDFLKGALKFK  304

Query  1116  GFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPV  1295
             GFVISD++ +D +T T H NYTYS+  SI AGIDMVM+PY Y EFID + +LVKN  +P+
Sbjct  305   GFVISDWEGLDRITSTPHSNYTYSVQASILAGIDMVMIPYKYAEFIDDVKFLVKNNAIPM  364

Query  1296  SRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD  1475
              RIDDAV+RIL VKF MGLFE P+GDYSL + LGS+ HR LAR AVR+SLVLLKNG N  
Sbjct  365   DRIDDAVRRILTVKFTMGLFESPMGDYSLVNELGSQAHRDLARDAVRQSLVLLKNGKNDS  424

Query  1476  EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKT  1652
             +P+LPL KK+ +ILVAGTHADN+GYQCGGWTI WQG SG N T GTTIL +IK+TVD  T
Sbjct  425   KPLLPLSKKSPKILVAGTHADNLGYQCGGWTIAWQGFSGNNATRGTTILASIKSTVDPST  484

Query  1653  QVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCV  1832
             +V+F E+PD +FVKSS FS+AIVV+GE  YAE  GDS+ LT+ +PGPS I NVC + +CV
Sbjct  485   EVVFREDPDSDFVKSSDFSYAIVVIGEAPYAETGGDSTTLTMLDPGPSTIKNVCDYVECV  544

Query  1833  VVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             V++I+GRP+VI+PY+  IDALVAAWLPGTEGQGV D L+GD+GFSGKLP TWFK+VDQ
Sbjct  545   VIVISGRPIVIEPYISSIDALVAAWLPGTEGQGVTDALYGDHGFSGKLPRTWFKSVDQ  602



>ref|XP_004241371.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=628

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/600 (71%), Positives = 504/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S  + G  L C W V+A A+Y+ YKD +QP+  RIKDL+ RM+L+EKIGQM QIER
Sbjct  1     MGRFSIPMKGFVLFCLWAVIAEAEYLKYKDPKQPMVTRIKDLMKRMSLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VA   VMK+Y++GSVLS GGSVP P+ASAE W++MVN  QKG+LSTRLGIPMIYGIDAV
Sbjct  61    KVALPDVMKQYFIGSVLSGGGSVPAPKASAEDWINMVNEIQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHN+GLG TRDP+LV+ IGAATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNIGLGVTRDPDLVKRIGAATALEVRATGIPYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IVR MTEIIPGLQG+ P N     PFV G+ KVAACAKH+VGDGGTVKG
Sbjct  181   RCYESYSEDHNIVRTMTEIIPGLQGDLPANSRKGVPFVEGKLKVAACAKHFVGDGGTVKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT+++++ LF IHM  YYNSII+GV+TVM SYSS NG +MHANRD++TGFLK  L+
Sbjct  241   IDENNTVINSNGLFGIHMPAYYNSIIKGVSTVMVSYSSWNGEKMHANRDLVTGFLKDRLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NYTYS+   ++AGIDM+MVP NY EFID LT LVK+  +
Sbjct  301   FRGFVISDWQGIDRITSPPHANYTYSVQAGVSAGIDMIMVPENYKEFIDALTLLVKDNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKF MGLFE+PL D SL + LGS++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVKRILRVKFTMGLFENPLADLSLVNQLGSQEHRELAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
               +P+LPL KKA +ILVAGTHADN+GYQCGGWTIEWQG++GN +T+GTTIL+AIK TVD 
Sbjct  421   TSQPLLPLPKKAPKILVAGTHADNLGYQCGGWTIEWQGVAGNDLTVGTTILSAIKKTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++++NPD  FV+S+KF +AIVVVGE  YAE  GDSSNLTI EPGPS I NVC   K
Sbjct  481   YTQVVYQQNPDANFVESNKFDYAIVVVGEVPYAEMMGDSSNLTITEPGPSTINNVCGAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRPVV++PY+ +ID LVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  541   CVVVVVSGRPVVLEPYVEKIDGLVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKSVDQ  600



>ref|XP_002311926.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
 gb|EEE89293.2| beta-D-glucan exohydrolase family protein [Populus trichocarpa]
Length=622

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/601 (69%), Positives = 497/601 (83%), Gaps = 7/601 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANAD-YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M K    L+G+  +CCW     A+ ++LYKD  +PV +R+KDLL RMTL+EKIGQMVQ+E
Sbjct  1     MAKAWIALVGLLFICCWSSTMGAEEHVLYKDPTKPVDKRVKDLLKRMTLEEKIGQMVQLE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R   +A++M+KYY+GS+LS GGSVP  RAS + WVDMVN FQKGSLSTRLGIPMIYGIDA
Sbjct  61    RTNMTAEIMRKYYIGSLLSGGGSVPADRASPKQWVDMVNTFQKGSLSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN Y ATIFPHNVGLG TR     ++IGAATALEVRATGI Y FAPCIAVCRDPRW
Sbjct  121   VHGHNNVYKATIFPHNVGLGVTR-----QKIGAATALEVRATGIPYAFAPCIAVCRDPRW  175

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSED +IV+ MTEIIPGLQG+ P N+    PFV+G++KVAACAKH+VGDGGTVK
Sbjct  176   GRCYESYSEDHKIVQMMTEIIPGLQGDVPANFQRGTPFVSGKDKVAACAKHFVGDGGTVK  235

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT+V  ++L+SIHM  Y NS+ +GVATVM SYSS+NG++MHANR ++TGFLK+ L
Sbjct  236   GINENNTIVTHNELYSIHMPAYLNSLDKGVATVMVSYSSINGLKMHANRGLVTGFLKRKL  295

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +FRGFVISD++ ID +T   H NY+YSIL S+NAG+DMVMVPYNYTEFI+GLT LV  K 
Sbjct  296   KFRGFVISDWEGIDRITYPPHKNYSYSILKSVNAGVDMVMVPYNYTEFINGLTDLVNKKA  355

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             + + RIDDAV+RILRVKF MGLFE+PL DYS    LGS++HR+LAR+AVRKSLVLLKNG 
Sbjct  356   IRIQRIDDAVRRILRVKFAMGLFENPLADYSFVDKLGSKEHRELAREAVRKSLVLLKNGK  415

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
             +A  PV+PL KKAS+ILVAGTHADN+G QCGGWTI+WQG  G N+T GTTIL  I+  VD
Sbjct  416   SAKSPVVPLPKKASKILVAGTHADNLGNQCGGWTIKWQGQEGNNLTAGTTILKGIQAAVD  475

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T+V+F+ENP+ ++VKS  FSHAIVVVGE  YAE +GD+ NLT+P PGP II NVC   
Sbjct  476   PSTKVVFKENPNAKYVKSQGFSHAIVVVGEPPYAETAGDNLNLTLPNPGPKIINNVCGAV  535

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVV+++GRP+VI+ Y+P+IDALVAAWLPG+EGQGVADVLFGDYGF+GKL  TWFK VD
Sbjct  536   KCVVVIVSGRPLVIESYVPKIDALVAAWLPGSEGQGVADVLFGDYGFTGKLARTWFKRVD  595

Query  2004  Q  2006
             Q
Sbjct  596   Q  596



>gb|KHN38459.1| Lysosomal beta glucosidase [Glycine soja]
Length=644

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/598 (70%), Positives = 484/598 (81%), Gaps = 18/598 (3%)
 Frame = +3

Query  267   VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlss  446
             V  A+Y+ YKD +QP+  RIK+LL RMTL+EKIGQMVQIER VA+ QVMKKY++GSVLS 
Sbjct  20    VLQAEYLKYKDPKQPLNVRIKNLLKRMTLEEKIGQMVQIERSVATPQVMKKYFIGSVLSG  79

Query  447   ggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLG  626
             G SVP   ASAE W+ MVNG Q GSLSTRLGIPMIYGIDAVHGNNN Y ATIFPHNVGLG
Sbjct  80    GESVPATNASAETWIQMVNGIQNGSLSTRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLG  139

Query  627   ATR----DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRA  794
              TR    DP L+++IG ATALEVRATGIQYVFAPCIAVCRDPRWGRC+ESYSEDP+I +A
Sbjct  140   VTRQVNMDPVLIKKIGDATALEVRATGIQYVFAPCIAVCRDPRWGRCFESYSEDPKIAQA  199

Query  795   MTEIIPGLQGEAPPNYPLSFPFVAG-------------REKVAACAKHYVGDGGTVKGID  935
             MTEIIPGLQG+   N     P+V+G             R KVAACAKHYVGDGGT KGI+
Sbjct  200   MTEIIPGLQGDISSNSRKGVPYVSGKHAIPSTFELLYHRNKVAACAKHYVGDGGTTKGIN  259

Query  936   ENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFR  1115
             ENNT++   +L  IHM  YY+SI++GV+TVM SYSS NG +MHAN  ++T +LK  L+FR
Sbjct  260   ENNTVISYSELLRIHMPPYYDSIVKGVSTVMVSYSSWNGQKMHANHFLVTNYLKNKLKFR  319

Query  1116  GFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPV  1295
             GFVISD+  ID +T   H NY+YSI   + AGIDM+MVP+N+TEFID LTY VKN  +PV
Sbjct  320   GFVISDWLGIDKITSPPHSNYSYSIQVGVGAGIDMIMVPFNFTEFIDVLTYQVKNNIIPV  379

Query  1296  SRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD  1475
             SRIDDAVKRILRVKFVMGLFE+PL D SL + LGS +HR++AR+AVRKSLVLLKNG +A+
Sbjct  380   SRIDDAVKRILRVKFVMGLFENPLADLSLVNQLGSEEHRQIAREAVRKSLVLLKNGKSAE  439

Query  1476  EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKT  1652
             +P+LPL KKA++ILVAG+HADN+GYQCGGWTI WQGL G N+T+GTTIL A+K T+D  T
Sbjct  440   KPLLPLPKKAAKILVAGSHADNLGYQCGGWTITWQGLGGNNLTVGTTILEAVKQTIDPAT  499

Query  1653  QVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCV  1832
             +V+F ENPD  FVKS+ FS AIVVVGE  YA   GDS NLTIPEPGPS I NVC   +CV
Sbjct  500   KVVFNENPDSNFVKSNNFSCAIVVVGEHPYATTFGDSLNLTIPEPGPSTITNVCGSIQCV  559

Query  1833  VVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VVLITGRPVVIQPYL ++DALVAAWLPGTEGQGVAD+LFGDYGF+GKL  TWFKTVDQ
Sbjct  560   VVLITGRPVVIQPYLSKVDALVAAWLPGTEGQGVADLLFGDYGFTGKLARTWFKTVDQ  617



>emb|CAN63654.1| hypothetical protein VITISV_027177 [Vitis vinifera]
Length=607

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/573 (71%), Positives = 473/573 (83%), Gaps = 1/573 (0%)
 Frame = +3

Query  291   YKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpkpR  470
             YKD +QP+G RI+DL+ RMTL EKIGQM QIE + A+ ++MK+Y +GS+LS GGSVP+ +
Sbjct  8     YKDPKQPIGIRIRDLMKRMTLAEKIGQMTQIEIKTATPEIMKEYSIGSLLSGGGSVPRVQ  67

Query  471   ASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPELV  650
             A+AE W+ M+N FQ GSLS+RLGIPMIYGIDAVHGNNN Y ATIFPHNVGLGATRDPEL+
Sbjct  68    ATAEEWIQMINDFQHGSLSSRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGATRDPELM  127

Query  651   REIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEA  830
             R+IGAATALE RATGI Y FAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQG+ 
Sbjct  128   RKIGAATALETRATGITYAFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGDI  187

Query  831   PPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIR  1010
             P N     P+V G++KVAACAKH+VGDGGT+ GI+ENNT++D H L SIHM  YY+SII+
Sbjct  188   PANSRKGIPYVGGKDKVAACAKHFVGDGGTISGINENNTIIDWHGLLSIHMPAYYDSIIK  247

Query  1011  GVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSI  1190
             GVATVM SYSS NG +MHA+  +IT FLK TL+FRGFVISD++ ID +T     NYTYS+
Sbjct  248   GVATVMVSYSSWNGKKMHAHNQLITEFLKNTLKFRGFVISDWQGIDKITSPPGANYTYSV  307

Query  1191  LTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLG  1370
               +INAGIDMVM P+N++EFI  LT LVK     +SRIDDAV RILRVKF MGLFE+PL 
Sbjct  308   EAAINAGIDMVMTPFNHSEFIGDLTDLVKKNVTSMSRIDDAVARILRVKFTMGLFENPLA  367

Query  1371  DYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNIGY  1550
             D S   HLGS+ HR LAR+AVRKSLVLLKNG NAD P+LPL KKA++ILVAGTHA+N+GY
Sbjct  368   DLSFVSHLGSQAHRDLAREAVRKSLVLLKNGENADPPLLPLPKKANKILVAGTHANNLGY  427

Query  1551  QCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVV  1727
             QCGGWTI WQGL G N+T GTTIL+ I   +D  TQV++ ENPD E VKS  FS+AIVVV
Sbjct  428   QCGGWTISWQGLEGNNLTTGTTILSGISAAIDPSTQVVYSENPDVELVKSGNFSYAIVVV  487

Query  1728  GEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAW  1907
             GEK YAE  GD+ NLTIPEPGPS I NVC   KCVVVLI+GRP++IQPYLP IDALVAAW
Sbjct  488   GEKPYAETFGDNLNLTIPEPGPSTITNVCTSIKCVVVLISGRPLLIQPYLPLIDALVAAW  547

Query  1908  LPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             LPG+EGQGVADVLFGDY F+GKL  TWFKTV+ 
Sbjct  548   LPGSEGQGVADVLFGDYEFTGKLAHTWFKTVEH  580



>ref|XP_010651644.1| PREDICTED: lysosomal beta glucosidase-like [Vitis vinifera]
Length=626

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/573 (71%), Positives = 473/573 (83%), Gaps = 1/573 (0%)
 Frame = +3

Query  291   YKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpkpR  470
             YKD +QP+G RI+DL+ RMTL EKIGQM QIE + A+ ++MK+Y +GS+LS GGSVP+ +
Sbjct  27    YKDPKQPIGIRIRDLMKRMTLAEKIGQMTQIEIKTATPEIMKEYSIGSLLSGGGSVPRVQ  86

Query  471   ASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPELV  650
             A+AE W+ M+N FQ GSLS+RLGIPMIYGIDAVHGNNN Y ATIFPHNVGLGATRDPEL+
Sbjct  87    ATAEEWIQMINDFQHGSLSSRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGATRDPELM  146

Query  651   REIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEA  830
             R+IGAATALE RATGI Y FAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQG+ 
Sbjct  147   RKIGAATALETRATGITYAFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGDI  206

Query  831   PPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIR  1010
             P N     P+V G++KVAACAKH+VGDGGT+ GI+ENNT++D H L SIHM  YY+SII+
Sbjct  207   PANSRKGIPYVGGKDKVAACAKHFVGDGGTISGINENNTIIDWHGLLSIHMPAYYDSIIK  266

Query  1011  GVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSI  1190
             GVATVM SYSS NG +MHA+  +IT FLK TL+FRGFVISD++ ID +T     NYTYS+
Sbjct  267   GVATVMVSYSSWNGKKMHAHNQLITEFLKNTLKFRGFVISDWQGIDKITSPPGANYTYSV  326

Query  1191  LTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLG  1370
               +INAGIDMVM P+N++EFI  LT LVK     +SRIDDAV RILRVKF MGLFE+PL 
Sbjct  327   EAAINAGIDMVMTPFNHSEFIGDLTDLVKKNVTSMSRIDDAVARILRVKFTMGLFENPLA  386

Query  1371  DYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNIGY  1550
             D S   HLGS+ HR LAR+AVRKSLVLLKNG NAD P+LPL KKA++ILVAGTHA+N+GY
Sbjct  387   DLSFVSHLGSQAHRDLAREAVRKSLVLLKNGENADPPLLPLPKKANKILVAGTHANNLGY  446

Query  1551  QCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVV  1727
             QCGGWTI WQGL G N+T GTTIL+ I   +D  TQV++ ENPD E VKS  FS+AIVVV
Sbjct  447   QCGGWTISWQGLEGNNLTTGTTILSGISAAIDPSTQVVYSENPDVELVKSGNFSYAIVVV  506

Query  1728  GEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAW  1907
             GEK YAE  GD+ NLTIPEPGPS I NVC   KCVVVLI+GRP++IQPYLP IDALVAAW
Sbjct  507   GEKPYAETFGDNLNLTIPEPGPSTITNVCTSIKCVVVLISGRPLLIQPYLPLIDALVAAW  566

Query  1908  LPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             LPG+EGQGVADVLFGDY F+GKL  TWFKTV+ 
Sbjct  567   LPGSEGQGVADVLFGDYEFTGKLAHTWFKTVEH  599



>gb|AAQ17461.1| beta-D-glucosidase [Gossypium hirsutum]
Length=628

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/600 (70%), Positives = 488/600 (81%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MGK S   +G  LLCC   +  A Y+ YKD +QP+G RIKDL+ RMTL EKIGQM QIER
Sbjct  1     MGKFSIPKLGFLLLCCLAALTEATYVKYKDPKQPLGVRIKDLMRRMTLAEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+   MK Y++GSVLS GGSVP  +A+ E W++MVN  QK SLSTRLGIPMIYGIDAV
Sbjct  61    TVATPDAMKNYFIGSVLSGGGSVPAQKATPETWIEMVNTMQKASLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHN+GLG TRDP LV+ IG ATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNIGLGVTRDPNLVKRIGEATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED +IV+ MTEII GLQG  P +     PFVAG+ KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDHKIVQMMTEIITGLQGGLPVHSKKGVPFVAGKNKVAACAKHYVGDGGTTKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++  + L  IHM  Y+NSI +GVAT+M SYSS NG +MHAN D++T FLK  L+
Sbjct  241   INENNTVISWNGLLGIHMPAYFNSIAKGVATIMTSYSSWNGKKMHANHDLVTDFLKNKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ +D +T   H NY+YS+   + AGIDMVMVPYN+TEFID LTY VKN  +
Sbjct  301   FRGFVISDWQGLDRITSPPHANYSYSVEAGVGAGIDMVMVPYNFTEFIDDLTYQVKNNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+P+ D SL + LGS++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFENPMADNSLVNQLGSQEHRELAREAVRKSLVLLKNGES  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
             AD+P+LPL KKA++ILVAGTHADN+GYQCGGWTI WQGL GN +T GTTIL A+KNTVD+
Sbjct  421   ADKPLLPLPKKATKILVAGTHADNLGYQCGGWTITWQGLGGNDLTTGTTILQAVKNTVDS  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++ ENPD  FVKS +FS+AIVVVGE  YAE  GDS NLTI EPGP  I NVC   K
Sbjct  481   STQVVYSENPDAGFVKSGEFSYAIVVVGEPPYAETYGDSLNLTISEPGPMTIYNVCGSVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRPVV+QP++  +DALVAAWLPGTEGQGV+DVLFGDYGF+GKL  TWFKTVDQ
Sbjct  541   CVVVVISGRPVVVQPFVSSVDALVAAWLPGTEGQGVSDVLFGDYGFTGKLARTWFKTVDQ  600



>ref|XP_008446717.1| PREDICTED: lysosomal beta glucosidase isoform X2 [Cucumis melo]
Length=658

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/598 (68%), Positives = 489/598 (82%), Gaps = 5/598 (1%)
 Frame = +3

Query  228   FLIGVALLCC----WVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQV  395
             F+  V +LC     W  + +A+ + YKD +QPVG R+KDLL RMTL+EKIGQMVQI+R V
Sbjct  5     FVQVVVILCLGWLWWATMVDAENLKYKDPKQPVGVRVKDLLGRMTLEEKIGQMVQIDRSV  64

Query  396   ASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHG  575
             A+A VMK Y++GS+LS GGSVP P A AE WVDM+N FQKGSLS+RLGIPM YGIDAVHG
Sbjct  65    ANATVMKDYFIGSILSGGGSVPLPDARAEDWVDMINDFQKGSLSSRLGIPMFYGIDAVHG  124

Query  576   NNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRC  755
             +NN YNAT+FPHNVGLGATR+P+L R IGAATALEVRATGI Y FAPC+AVCRDPRWGRC
Sbjct  125   HNNVYNATVFPHNVGLGATRNPDLARRIGAATALEVRATGISYTFAPCLAVCRDPRWGRC  184

Query  756   YESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGID  935
             YESYSEDP+IV+ MTEII GLQGE P NY    P+V G +KV ACAKH+VGDGGT  GI+
Sbjct  185   YESYSEDPKIVKEMTEIIIGLQGEPPANYRKGTPYVGGTKKVIACAKHFVGDGGTTHGIN  244

Query  936   ENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFR  1115
             ENNT+++ H L SIHM  Y +SII+GV++VMASYSS NGV+MHANR++IT FLK  L+F+
Sbjct  245   ENNTVINRHGLLSIHMPAYLDSIIKGVSSVMASYSSWNGVKMHANRELITDFLKGALKFK  304

Query  1116  GFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPV  1295
             GFVISD++ +D +T T H NYTYS+  +I AGIDMVM+PY Y EFID L +LVK+  +P+
Sbjct  305   GFVISDWEGLDRITSTPHSNYTYSVQAAILAGIDMVMIPYKYAEFIDDLKFLVKSNVIPM  364

Query  1296  SRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD  1475
              RIDDAV RIL VKF MGLFE P+ DYSL + LGS+ HR LAR AVR+SLVLLKNG N  
Sbjct  365   DRIDDAVGRILTVKFTMGLFESPMADYSLVNELGSQAHRDLARDAVRQSLVLLKNGKNDS  424

Query  1476  EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTVDTKT  1652
             +P+LPL KK+ +ILVAGTHADN+GYQCGGWTI WQG SGN  T GTTIL AIK+TVD  T
Sbjct  425   KPLLPLSKKSPKILVAGTHADNLGYQCGGWTIAWQGFSGNNGTRGTTILAAIKSTVDPST  484

Query  1653  QVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCV  1832
             +V+F E+PD +FVKS+ FS+AIVV+GE  YAE  GDS+ LT+ +PGP+II NVC H +CV
Sbjct  485   EVVFREDPDSDFVKSNDFSYAIVVIGEAPYAETGGDSTTLTMLDPGPNIIKNVCDHVECV  544

Query  1833  VVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             V+LI+GRP+VI+PY+  IDALVAAWLPGTEGQGV D L+GD+GFSGKLP TWFK+VDQ
Sbjct  545   VILISGRPIVIEPYISSIDALVAAWLPGTEGQGVTDALYGDHGFSGKLPRTWFKSVDQ  602



>ref|XP_003535075.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Glycine 
max]
 ref|XP_006586833.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Glycine 
max]
Length=662

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/604 (68%), Positives = 488/604 (81%), Gaps = 6/604 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVV----ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMV  377
             M +    L+GV L  CW +     A  +Y+ YKD +Q V  R++DL+SRMTL EKIGQMV
Sbjct  1     MSRALFHLLGV-LWLCWCLTSIGEAQIEYLRYKDPKQSVQTRVRDLMSRMTLDEKIGQMV  59

Query  378   QIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYG  557
             QI+R VA+A VMK  ++GSVLS GGS P PRA+AE WV+M+N FQKG+L +RLGIPMIYG
Sbjct  60    QIDRSVANANVMKTSFIGSVLSGGGSEPLPRATAEDWVNMINDFQKGALESRLGIPMIYG  119

Query  558   IDAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRD  737
             IDAVHG+NN YNATIFPHNVGLG TRDP L + IGAATALEVRATGI YVFAPCIAVCRD
Sbjct  120   IDAVHGHNNVYNATIFPHNVGLGCTRDPNLAQRIGAATALEVRATGIPYVFAPCIAVCRD  179

Query  738   PRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGG  917
             PRWGRCYESYSEDP+IV+ MTEIIPGLQG  P N    FP+V G+ KVAACAKH+VGDGG
Sbjct  180   PRWGRCYESYSEDPKIVQEMTEIIPGLQGSIPANSRKGFPYVGGKTKVAACAKHFVGDGG  239

Query  918   TVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLK  1097
             T KGI+ENNT++D H L SIHM  Y +SII+GV+TVM SYSS NGVRMHANRD++TGFLK
Sbjct  240   TTKGINENNTVIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGVRMHANRDLVTGFLK  299

Query  1098  KTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVK  1277
              TL+F+GFVISD++ ID LT     NYTYS+  SI AG+DMVMVP+ Y +FI  LT LVK
Sbjct  300   NTLKFKGFVISDWQGIDRLTSPPSSNYTYSVQASIEAGVDMVMVPFEYDKFIQDLTLLVK  359

Query  1278  NKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLK  1457
             +  +P+ RIDDAV+RIL VKF MGLFE+PL D SL + LGS++HR LAR+AVRKSLVLLK
Sbjct  360   SNIIPMERIDDAVERILLVKFTMGLFENPLADTSLVNELGSQEHRDLAREAVRKSLVLLK  419

Query  1458  NGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKN  1634
             NG N   P+LPL KK  +ILVAG+HADN+GYQCGGWTI+WQG SGN  T GTTIL+AIK+
Sbjct  420   NGKNESAPLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGFSGNSDTRGTTILSAIKS  479

Query  1635  TVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVC  1814
              VDT T+V+F +NPD EFV+S+ F +AIVVVGE  YAE +GDS+ L + E GP++I NVC
Sbjct  480   AVDTSTEVVFRDNPDNEFVRSNNFEYAIVVVGEPPYAETAGDSTTLAMMESGPNVINNVC  539

Query  1815  PHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFK  1994
                KCVVV+I+GRP+VI+PY+  IDALVAAWLPGTEGQGV DVLFGDYGF+GKL  TWFK
Sbjct  540   GTVKCVVVIISGRPIVIEPYVSSIDALVAAWLPGTEGQGVTDVLFGDYGFTGKLARTWFK  599

Query  1995  TVDQ  2006
             +VDQ
Sbjct  600   SVDQ  603



>ref|XP_009801866.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Nicotiana 
sylvestris]
Length=653

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/588 (71%), Positives = 501/588 (85%), Gaps = 1/588 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             L C W V   A+Y+ YKD +QP+G RI+DL+ RM+L+EKIGQM QIER+VA+A VMK+Y+
Sbjct  38    LFCLWAVAVEAEYLKYKDPKQPLGARIRDLMKRMSLEEKIGQMTQIERKVATADVMKQYF  97

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GSVLS GGSVP P+ASAE W++MVN  QKG+LSTRLGIPMIYGIDAVHG+NN YNATIF
Sbjct  98    IGSVLSGGGSVPAPKASAEDWINMVNELQKGALSTRLGIPMIYGIDAVHGHNNVYNATIF  157

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHN+GLG TRDP L++ IGAATALEVRATGIQY F+PCIAVCRDPRWGRCYESYSED +I
Sbjct  158   PHNIGLGVTRDPNLLKRIGAATALEVRATGIQYAFSPCIAVCRDPRWGRCYESYSEDHKI  217

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             VRAMT+IIPGLQG+ P N     PFVAG+ KVAACAKH+VGDGGTV GIDENNT+++++ 
Sbjct  218   VRAMTDIIPGLQGDLPANSRKGVPFVAGKSKVAACAKHFVGDGGTVNGIDENNTVINSNG  277

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             LF IHM  YY+SII+GV+TVM SYSS NG +MHANRD++TGFLK  L+FRGFVISD++ I
Sbjct  278   LFGIHMPAYYDSIIKGVSTVMVSYSSWNGKKMHANRDLVTGFLKDKLKFRGFVISDWQGI  337

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T   H NYTYS+   ++AGIDM+MVP NYTEFID LT LVK+  +P+SRIDDAVKR 
Sbjct  338   DRITSPPHANYTYSVQAGVSAGIDMIMVPENYTEFIDTLTQLVKDNIIPISRIDDAVKRT  397

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LRVKF+MGLFE+PL D S  + LG ++HR+LAR+AVRKSLVLLKNG +  +P+LPL KKA
Sbjct  398   LRVKFIMGLFENPLADLSYVNQLGCQEHRELAREAVRKSLVLLKNGKSTSQPLLPLPKKA  457

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDP  1682
              +ILVAGTHADN+GYQCGGWTIEWQG++GN +T+GTTIL+AIKNTVD  TQV++E+NPD 
Sbjct  458   PKILVAGTHADNLGYQCGGWTIEWQGVAGNDLTVGTTILSAIKNTVDPATQVVYEQNPDS  517

Query  1683  EFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVV  1862
              FVKS++FS+AIV+VGE  YAE  GDS+NLTI EPGPS I NVC   KCVVV+++GRPVV
Sbjct  518   NFVKSNEFSYAIVIVGEVPYAEMFGDSTNLTITEPGPSTINNVCGAVKCVVVVVSGRPVV  577

Query  1863  IQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ++PY+ +IDAL+AAW PGTEGQGVAD LFGDYGFSGKL  TWFK+VDQ
Sbjct  578   LEPYVEKIDALMAAWFPGTEGQGVADALFGDYGFSGKLARTWFKSVDQ  625



>ref|XP_009801863.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Nicotiana 
sylvestris]
Length=654

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/588 (71%), Positives = 501/588 (85%), Gaps = 1/588 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             L C W V   A+Y+ YKD +QP+G RI+DL+ RM+L+EKIGQM QIER+VA+A VMK+Y+
Sbjct  39    LFCLWAVAVEAEYLKYKDPKQPLGARIRDLMKRMSLEEKIGQMTQIERKVATADVMKQYF  98

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GSVLS GGSVP P+ASAE W++MVN  QKG+LSTRLGIPMIYGIDAVHG+NN YNATIF
Sbjct  99    IGSVLSGGGSVPAPKASAEDWINMVNELQKGALSTRLGIPMIYGIDAVHGHNNVYNATIF  158

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHN+GLG TRDP L++ IGAATALEVRATGIQY F+PCIAVCRDPRWGRCYESYSED +I
Sbjct  159   PHNIGLGVTRDPNLLKRIGAATALEVRATGIQYAFSPCIAVCRDPRWGRCYESYSEDHKI  218

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             VRAMT+IIPGLQG+ P N     PFVAG+ KVAACAKH+VGDGGTV GIDENNT+++++ 
Sbjct  219   VRAMTDIIPGLQGDLPANSRKGVPFVAGKSKVAACAKHFVGDGGTVNGIDENNTVINSNG  278

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             LF IHM  YY+SII+GV+TVM SYSS NG +MHANRD++TGFLK  L+FRGFVISD++ I
Sbjct  279   LFGIHMPAYYDSIIKGVSTVMVSYSSWNGKKMHANRDLVTGFLKDKLKFRGFVISDWQGI  338

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T   H NYTYS+   ++AGIDM+MVP NYTEFID LT LVK+  +P+SRIDDAVKR 
Sbjct  339   DRITSPPHANYTYSVQAGVSAGIDMIMVPENYTEFIDTLTQLVKDNIIPISRIDDAVKRT  398

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LRVKF+MGLFE+PL D S  + LG ++HR+LAR+AVRKSLVLLKNG +  +P+LPL KKA
Sbjct  399   LRVKFIMGLFENPLADLSYVNQLGCQEHRELAREAVRKSLVLLKNGKSTSQPLLPLPKKA  458

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDP  1682
              +ILVAGTHADN+GYQCGGWTIEWQG++GN +T+GTTIL+AIKNTVD  TQV++E+NPD 
Sbjct  459   PKILVAGTHADNLGYQCGGWTIEWQGVAGNDLTVGTTILSAIKNTVDPATQVVYEQNPDS  518

Query  1683  EFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVV  1862
              FVKS++FS+AIV+VGE  YAE  GDS+NLTI EPGPS I NVC   KCVVV+++GRPVV
Sbjct  519   NFVKSNEFSYAIVIVGEVPYAEMFGDSTNLTITEPGPSTINNVCGAVKCVVVVVSGRPVV  578

Query  1863  IQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ++PY+ +IDAL+AAW PGTEGQGVAD LFGDYGFSGKL  TWFK+VDQ
Sbjct  579   LEPYVEKIDALMAAWFPGTEGQGVADALFGDYGFSGKLARTWFKSVDQ  626



>ref|XP_004137360.1| PREDICTED: lysosomal beta glucosidase-like [Cucumis sativus]
 gb|KGN63896.1| hypothetical protein Csa_1G025780 [Cucumis sativus]
Length=628

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/588 (73%), Positives = 499/588 (85%), Gaps = 1/588 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             LLCC VV  +A Y+ YKD +QP+G RIKDL+ RMTL+EKIGQMVQIER VA+  VMK Y+
Sbjct  14    LLCCLVVATDATYLKYKDPKQPLGARIKDLMGRMTLEEKIGQMVQIERAVATPDVMKNYF  73

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GSVLS GGSVP  +ASAE WV+MVN  QKGSL+TRLGIPMIYGIDAVHG+NN YNATIF
Sbjct  74    IGSVLSGGGSVPAEKASAETWVNMVNEIQKGSLATRLGIPMIYGIDAVHGHNNVYNATIF  133

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHNVGLG TRDPEL+R IG ATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSED +I
Sbjct  134   PHNVGLGVTRDPELLRRIGEATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSEDHKI  193

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             V+ +TEIIPGLQG  P N     PFVAG++KVAACAKH+VGDGGT +GIDENNT++D + 
Sbjct  194   VQQLTEIIPGLQGAIPSNSRKGIPFVAGKQKVAACAKHFVGDGGTTRGIDENNTVIDYNG  253

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             L +IHM  YYNSI +GVATVM SYSS NGVRMHANRD++TGFLK  LRF+GFVISD++ I
Sbjct  254   LLNIHMPAYYNSIQKGVATVMVSYSSWNGVRMHANRDLVTGFLKTKLRFKGFVISDWQGI  313

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T   H NY+YS+   + AGIDMVMVP NYTEFID LT  VKN  +P+SRI+DAV+RI
Sbjct  314   DRITSPPHANYSYSVQAGVGAGIDMVMVPQNYTEFIDELTRQVKNNIIPMSRINDAVQRI  373

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LR+KF+MGLFE+PL D SLA+ LGS++HR++AR+AVRKSLVLLKNG +AD+P+LPL KKA
Sbjct  374   LRIKFLMGLFENPLADNSLANQLGSKEHREVAREAVRKSLVLLKNGPSADKPLLPLPKKA  433

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDP  1682
              +ILVAGTHADN+GYQCGGWTI WQG SGN +T+GTTIL A+KNTVD  TQV++ ENPD 
Sbjct  434   GKILVAGTHADNLGYQCGGWTITWQGQSGNDLTVGTTILNAVKNTVDPSTQVVYNENPDA  493

Query  1683  EFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVV  1862
              FVKS++FS+AIVVVGE  YAE SGDS+NL+I EPGPS I NVC +  CVVV+++GRPVV
Sbjct  494   GFVKSNEFSYAIVVVGEPPYAEISGDSTNLSISEPGPSTIKNVCSNVNCVVVVVSGRPVV  553

Query  1863  IQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +QPY+   +ALVAAWLPGTEGQGVAD+LFGDYGF+GKL  TWFKTVDQ
Sbjct  554   MQPYVGVANALVAAWLPGTEGQGVADLLFGDYGFTGKLARTWFKTVDQ  601



>ref|XP_007147489.1| hypothetical protein PHAVU_006G128800g [Phaseolus vulgaris]
 gb|ESW19483.1| hypothetical protein PHAVU_006G128800g [Phaseolus vulgaris]
Length=661

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/596 (69%), Positives = 487/596 (82%), Gaps = 4/596 (1%)
 Frame = +3

Query  231   LIGVALLCCWVVV---ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVAS  401
             L+GV  +C W+     A  +Y+ YKD +QPV  RIKDL+SRMTL+EKIGQMVQI+R VA+
Sbjct  8     LLGVLWVCWWLASTGEAQIEYLRYKDPKQPVATRIKDLMSRMTLEEKIGQMVQIDRSVAN  67

Query  402   AQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNN  581
             A+VMK  ++GSVLS GGS P P+A+AE WV+M+N FQKG+L +RLGIPMIYGIDAVHG+N
Sbjct  68    AKVMKTSFIGSVLSGGGSEPLPKATAEDWVNMINEFQKGALESRLGIPMIYGIDAVHGHN  127

Query  582   NAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYE  761
             N YNATIFPHNVGLG TRDP+L + IGAATALEVRATGI YVFAPCIAVCRDPRWGRCYE
Sbjct  128   NVYNATIFPHNVGLGCTRDPDLAQRIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYE  187

Query  762   SYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDEN  941
             SYSED +IV+ MTEII GLQG  P N    FP+V G+ KVAACAKH+VGDGGT KG++EN
Sbjct  188   SYSEDAKIVQEMTEIISGLQGSIPVNSRKGFPYVGGKTKVAACAKHFVGDGGTAKGVNEN  247

Query  942   NTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGF  1121
             NTL+D H L SIHM  Y +SII+GV+TVM SYSS NG +MHANRD++TGFLK TL+F+GF
Sbjct  248   NTLIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGAKMHANRDLVTGFLKNTLKFKGF  307

Query  1122  VISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSR  1301
             VISD++ ID +T     NYTYS+  SI AG+DMVMVPY Y EFI  LT LVK+  +P+ R
Sbjct  308   VISDWQGIDRITAPPDSNYTYSVQASIEAGVDMVMVPYKYDEFIQDLTLLVKSNIIPMER  367

Query  1302  IDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEP  1481
             IDDAV+RIL VKF MGLFE+PL D SL + LGS++HR LAR+AVRKSLVLLKNG N   P
Sbjct  368   IDDAVERILLVKFTMGLFENPLADTSLVNELGSQEHRDLAREAVRKSLVLLKNGKNESTP  427

Query  1482  VLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTVDTKTQV  1658
             +LPL KK  +ILVAG+HADN+GYQCGGWTI+WQG SGN  T GTTIL+AIK+TVD  T+V
Sbjct  428   LLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGFSGNSDTRGTTILSAIKSTVDPSTEV  487

Query  1659  MFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVV  1838
             +F +NPD EFVKS+ F +A+VVVGE  YAE +GDS  LT+ E GP++I NVC   +CVVV
Sbjct  488   VFRDNPDNEFVKSNNFEYAVVVVGEPPYAETAGDSLALTMMESGPNVINNVCGTVRCVVV  547

Query  1839  LITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +I+GRP+VI+PY+  IDALVAAWLPGTEGQGV DVLFGDYGF+GKL  TWFK+VDQ
Sbjct  548   IISGRPIVIEPYVSTIDALVAAWLPGTEGQGVTDVLFGDYGFTGKLARTWFKSVDQ  603



>gb|KDO54374.1| hypothetical protein CISIN_1g038523mg [Citrus sinensis]
Length=631

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/595 (69%), Positives = 493/595 (83%), Gaps = 4/595 (1%)
 Frame = +3

Query  234   IGVALLCCWVVVANAD---YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASA  404
             +G  LLCC     +A    YM ++D +QP+ +RI+DL++RMTL+EKIGQMVQ++R  A+A
Sbjct  9     LGFLLLCCMAFAIHASDPGYMKFRDPQQPLSKRIRDLMNRMTLEEKIGQMVQLDRAAATA  68

Query  405   QVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNN  584
             ++M+ Y +GS+LS GGSVP+ +A+ + W+DMVN FQKGSLS+RLGIPMIYGIDAVHG+NN
Sbjct  69    EIMRDYSIGSLLSGGGSVPRLQATPQEWIDMVNDFQKGSLSSRLGIPMIYGIDAVHGHNN  128

Query  585   AYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYES  764
              Y ATIFPHNVGLGATRDP+LVR IGAATALEVRATGI Y FAPCIAVCRDPRWGRC+ES
Sbjct  129   VYKATIFPHNVGLGATRDPDLVRRIGAATALEVRATGINYAFAPCIAVCRDPRWGRCFES  188

Query  765   YSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENN  944
             YSEDP+IV+ MTEIIPGLQG+ P + P   P+VAGR+KVAACAKHYVGDGGT +GI+ENN
Sbjct  189   YSEDPKIVKLMTEIIPGLQGDIPSDLPKGIPYVAGRDKVAACAKHYVGDGGTTRGINENN  248

Query  945   TLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFV  1124
             T++D H L SIHM  Y ++II+GV+TVM SYSS NG++MHANRD++T FLK TL+FRGFV
Sbjct  249   TVIDRHGLMSIHMPAYNDAIIKGVSTVMVSYSSWNGLKMHANRDLVTNFLKGTLKFRGFV  308

Query  1125  ISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRI  1304
             ISD++ ID +T   H NY+YS+L  +NAGIDM M+P+N+T+FID LT  V+ K VP+SRI
Sbjct  309   ISDWQGIDRITTPEHANYSYSVLAGVNAGIDMFMLPFNHTDFIDILTDFVERKIVPMSRI  368

Query  1305  DDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPV  1484
             DDAV+RILRVKF MGLFE P+ D +    LGS+ HR LAR+AVRKSLVLLKNG NAD   
Sbjct  369   DDAVRRILRVKFTMGLFEKPMADQTFIDQLGSQAHRDLAREAVRKSLVLLKNGENADGAA  428

Query  1485  LPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVM  1661
             LPL K A+RILVAGTHA+N+GYQCGGWTI WQGLSG N T+GTTIL  I  TVD+ T+++
Sbjct  429   LPLPKNAARILVAGTHANNLGYQCGGWTIAWQGLSGNNNTVGTTILNGISATVDSDTEII  488

Query  1662  FEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVL  1841
             F ENP  ++VK+S  S+AIVVVGE+ YAE  GDS NLTI EPGPS I NVC   KCVVVL
Sbjct  489   FSENPSMDYVKASNVSYAIVVVGEQPYAETQGDSLNLTISEPGPSTITNVCAAVKCVVVL  548

Query  1842  ITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ++GRPV + PYLPQ+DALVAAWLPGTEGQGVADVLFGDYGF+G+LP TWFKTVDQ
Sbjct  549   VSGRPVTVGPYLPQVDALVAAWLPGTEGQGVADVLFGDYGFTGRLPRTWFKTVDQ  603



>ref|XP_007145577.1| hypothetical protein PHAVU_007G250300g [Phaseolus vulgaris]
 gb|ESW17571.1| hypothetical protein PHAVU_007G250300g [Phaseolus vulgaris]
Length=627

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/600 (71%), Positives = 494/600 (82%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S   +GV LL C V  + A+Y+ YKD +  +  RI DL+ RM+L+EKIGQM QIER
Sbjct  1     MGRYSLPFVGVLLLFCLVSSSEAEYLKYKDPKVQLNVRISDLMKRMSLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VA+  V+KKY++GSVLS GGSVP P+ASAE W  MV   QK +LSTRLGIPMIYGIDAV
Sbjct  61    EVATPDVLKKYFIGSVLSGGGSVPAPKASAETWQKMVTEMQKAALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHNVGLG TRDP L+++IG ATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNVGLGVTRDPVLIKKIGDATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP+IVR MTEIIPGLQG+ P N     PFVAG+ KVAACAKHYVGDGGT KG
Sbjct  181   RCYESYSEDPKIVRNMTEIIPGLQGDIPANSVKGVPFVAGKNKVAACAKHYVGDGGTNKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNTL+  + L  IHM  YYNSII+GV+TVM SYSS NGV+MHANR +IT +LK  LR
Sbjct  241   INENNTLISYNGLLGIHMPAYYNSIIKGVSTVMISYSSWNGVKMHANRKLITDYLKNKLR  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+   ++AGIDM+MVP+NYTEFID LT  VKN  +
Sbjct  301   FRGFVISDWQGIDRITSPPHANYSYSVQAGVSAGIDMIMVPFNYTEFIDELTRQVKNNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV RILRVKFVMGLFE+PL D SL + LG ++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVARILRVKFVMGLFENPLPDSSLVNQLGKQEHRELAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
               +P+LPL KK+++ILVAGTHADN+GYQCGGWTI WQGL   N+T GTTIL+A+K TVD 
Sbjct  421   YKKPLLPLPKKSAKILVAGTHADNLGYQCGGWTITWQGLDAKNLTSGTTILSAVKQTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V+F ENPD  F+KS+KFS+AIVVVGE TYAE  GDS NLTIPEPGPS I NVC   +
Sbjct  481   ATEVVFNENPDVNFLKSNKFSYAIVVVGEHTYAETFGDSLNLTIPEPGPSTITNVCGAIR  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRPVVIQPYLP+IDALVAAWLPGTEGQGVADVLFGDY F+GKL  TWFK VDQ
Sbjct  541   CVVVVISGRPVVIQPYLPKIDALVAAWLPGTEGQGVADVLFGDYEFTGKLARTWFKRVDQ  600



>ref|XP_004159282.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal beta glucosidase-like 
[Cucumis sativus]
Length=658

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/598 (68%), Positives = 490/598 (82%), Gaps = 5/598 (1%)
 Frame = +3

Query  228   FLIGVALLCC----WVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQV  395
             F+  V +LC     W  + +A+ + YKD +QPVG R+KDLL RMTL+EKIGQMVQI+R V
Sbjct  5     FVQVVVILCLGWLWWATMVDAENLKYKDPKQPVGVRVKDLLGRMTLEEKIGQMVQIDRSV  64

Query  396   ASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHG  575
             A+A VMK Y++GSVLS GGSVP P A AE WV+M+N FQKGSLS+RLGIPM YGIDAVHG
Sbjct  65    ANATVMKDYFIGSVLSGGGSVPLPDARAEDWVNMINDFQKGSLSSRLGIPMFYGIDAVHG  124

Query  576   NNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRC  755
             +NN YNAT+FPHNVGLGATR+P+LVR IGAATALEVRATGI Y FAPC+AVCRDPRWGRC
Sbjct  125   HNNVYNATVFPHNVGLGATRNPDLVRRIGAATALEVRATGISYTFAPCLAVCRDPRWGRC  184

Query  756   YESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGID  935
             YESYSEDP+IV+ MTEII GLQGE P NY    P+V G +KV ACAKH+VGDGGT  GI+
Sbjct  185   YESYSEDPKIVKEMTEIIIGLQGEPPANYRKGTPYVGGTKKVIACAKHFVGDGGTTHGIN  244

Query  936   ENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFR  1115
             ENNT+++ H L SIHM  Y +SII+GV++VMASYSS NGV+MHANR++IT FLK  L+F+
Sbjct  245   ENNTVINRHGLLSIHMPAYLDSIIKGVSSVMASYSSWNGVKMHANRELITDFLKGALKFK  304

Query  1116  GFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPV  1295
             GFVISD++ +D +T T H NYTYS+  SI AGIDMVM+PY Y EFID + +LVKN  +P+
Sbjct  305   GFVISDWEGLDRITSTPHSNYTYSVQASILAGIDMVMIPYKYAEFIDDVKFLVKNNAIPM  364

Query  1296  SRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD  1475
              RIDDAV+RIL VKF MGLFE P+GDYSL + LGS+ HR LAR AVR+SLVLLKNG N  
Sbjct  365   DRIDDAVRRILTVKFTMGLFESPMGDYSLVNELGSQAHRDLARDAVRQSLVLLKNGKNDS  424

Query  1476  EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKT  1652
             +P+LPL KK+ +ILVAGTHADN+GYQCGGWTI WQG SG N T GTTIL +IK+TVD  T
Sbjct  425   KPLLPLSKKSPKILVAGTHADNLGYQCGGWTIAWQGFSGNNATRGTTILASIKSTVDPST  484

Query  1653  QVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCV  1832
             +V+F E+PD +FVKSS FS+AIVV+GE  YAE  GDS+ LT+ +PGPS I NV  + +CV
Sbjct  485   EVVFREDPDSDFVKSSDFSYAIVVIGEAPYAETGGDSTTLTMLDPGPSTIKNVGDYVECV  544

Query  1833  VVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             V++I+GRP+VI+PY+  IDALVAAWLPGTEGQGV D L+GD+GFSGKLP TWFK+VDQ
Sbjct  545   VIVISGRPIVIEPYISSIDALVAAWLPGTEGQGVTDALYGDHGFSGKLPRTWFKSVDQ  602



>ref|XP_008355265.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=632

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/579 (72%), Positives = 481/579 (83%), Gaps = 2/579 (0%)
 Frame = +3

Query  276   ADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggs  455
             ADY  YKD +QP+  RI+DL+ RMTL EKIGQM QIER VA+  VM KY++GSVLS GGS
Sbjct  27    ADYFKYKDPKQPLNARIRDLMKRMTLAEKIGQMTQIERSVATPDVMNKYFIGSVLSGGGS  86

Query  456   vpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATR  635
              P P+ASAEAWV++VNG QKGSLSTRLGIPMIYGIDAVHG+NN YNATIFPHNVGLG TR
Sbjct  87    EPAPKASAEAWVNLVNGLQKGSLSTRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGVTR  146

Query  636   DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPG  815
             DP LV+ IG ATALEVRATGI YVFAPCIAVC DPRWGRCYESYSED +IV+AMTEIIPG
Sbjct  147   DPNLVKRIGEATALEVRATGIPYVFAPCIAVCXDPRWGRCYESYSEDHKIVQAMTEIIPG  206

Query  816   LQGEAPPNYPLSFPFVA-GREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGY  992
             LQG+ PP      P+V+  + KVAACAKHYVGDGGT KGI+ENNT +D + L SIHM  Y
Sbjct  207   LQGDMPPTARKGAPYVSTAKGKVAACAKHYVGDGGTTKGINENNTXIDLNGLLSIHMPAY  266

Query  993   YNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHG  1172
              NSI +GVATVM SYSS NG +MHAN++++TG+LK  LRFRGFVISD++ ID +T     
Sbjct  267   LNSIRKGVATVMVSYSSWNGNKMHANKELVTGYLKDKLRFRGFVISDWEGIDRITSPPKA  326

Query  1173  NYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGL  1352
             NY+YS+   + AGIDM+MVPYN+T+FID LTY VKN  +P+SRI+DAV+RILRVKFVMGL
Sbjct  327   NYSYSVQAGVGAGIDMIMVPYNFTDFIDDLTYQVKNNIIPMSRINDAVQRILRVKFVMGL  386

Query  1353  FEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTH  1532
             FE+PL D SLA  LG++ HR+LAR+AVRKSLVLLKNG +A +PVLPL KKA +ILVAG+H
Sbjct  387   FENPLADLSLASQLGNKVHRELAREAVRKSLVLLKNGKSAYKPVLPLPKKAGKILVAGSH  446

Query  1533  ADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFS  1709
             ADN+G QCGGWTI WQGL GN  T+G TIL+A+K+TVD  TQV++ ENPD  FVKS+KFS
Sbjct  447   ADNLGNQCGGWTITWQGLEGNDHTMGXTILSAVKSTVDPTTQVVYNENPDANFVKSNKFS  506

Query  1710  HAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQID  1889
             +AIVVVGE  YAE  GDS NLTIP+PGPS IANVC   KCVVV+I+GRP+V+QPYL  ID
Sbjct  507   YAIVVVGEPPYAETFGDSLNLTIPQPGPSTIANVCGAVKCVVVVISGRPLVLQPYLAGID  566

Query  1890  ALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ALVAAWLPGTEGQGV D LFGDYGF+GKL  TWFKTVDQ
Sbjct  567   ALVAAWLPGTEGQGVTDALFGDYGFTGKLAHTWFKTVDQ  605



>gb|EYU38726.1| hypothetical protein MIMGU_mgv1a002845mg [Erythranthe guttata]
Length=631

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/604 (70%), Positives = 488/604 (81%), Gaps = 30/604 (5%)
 Frame = +3

Query  285   MLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpk  464
             M YKD +QP+ +RI+DL+ RMTL+EKIGQM QIER VA+  V++KY +GS+LS GGSVP 
Sbjct  1     MKYKDPKQPINKRIRDLMKRMTLEEKIGQMTQIERTVAADHVLQKYSIGSILSGGGSVPA  60

Query  465   pRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATR---  635
               ASAE W+DMVN FQK +L  RLGIPMIYGIDAVHGNNN Y ATIFPHNVGLGATR   
Sbjct  61    VHASAETWIDMVNHFQKNALMQRLGIPMIYGIDAVHGNNNVYKATIFPHNVGLGATRQVI  120

Query  636   ---------------------------DPELVREIGAATALEVRATGIQYVFAPCIAVCR  734
                                        DPELV+ IGAATALEVRATGIQY FAP IAVCR
Sbjct  121   IHAFLVYLLTKFDLINSTNECNSLFNRDPELVKRIGAATALEVRATGIQYAFAPVIAVCR  180

Query  735   DPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDG  914
             DPRWGRCYESYSEDP+IVR+MTEIIPGLQG+ P  +P   P+V G +KV ACAKHYVGDG
Sbjct  181   DPRWGRCYESYSEDPKIVRSMTEIIPGLQGDVPAGFPKGVPYVGGPDKVMACAKHYVGDG  240

Query  915   GTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFL  1094
             GTVKGI+ENNT+   H+L  IHM  YY+S+I+GV+TVMASYSS NGV+MHANRD+ITGFL
Sbjct  241   GTVKGINENNTVATWHELLGIHMPAYYDSVIKGVSTVMASYSSWNGVKMHANRDLITGFL  300

Query  1095  KKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLV  1274
             KK   FRGFVI+D++AID +T   H NYTYSI  SINAGID+VMVPYNYTEFIDGLTYLV
Sbjct  301   KKAQGFRGFVITDWQAIDKMTTPPHANYTYSIEASINAGIDVVMVPYNYTEFIDGLTYLV  360

Query  1275  KNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLL  1454
              N FV +SRIDDAVKRILRVKF MGLFE+P+ DYS+A HLGS+++R++AR+AVRKSLVLL
Sbjct  361   NNNFVSMSRIDDAVKRILRVKFTMGLFENPMADYSMAKHLGSQENREVAREAVRKSLVLL  420

Query  1455  KNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKN  1634
             KNG   D+P+LPL KKAS+ILVAGTHAD+IG QCGGWTIEW G SGN T GTTIL+A++N
Sbjct  421   KNGKAGDKPLLPLPKKASKILVAGTHADDIGNQCGGWTIEWHGKSGNTTAGTTILSAVRN  480

Query  1635  TVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVC  1814
             TVD +T+V F + PD EFVKS KF +A+VVVGE  Y+E  GD+ NLT+P+PG SII NVC
Sbjct  481   TVDPETEVSFRQEPDAEFVKSGKFEYAVVVVGEVPYSETYGDNLNLTLPDPGYSIIKNVC  540

Query  1815  PHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFK  1994
                KCVVVL+TGRPVVI+PYL  +DA+VAAWLPG+EGQGVADVLFGDYGF+GKLP TWFK
Sbjct  541   SSVKCVVVLVTGRPVVIEPYLAGMDAVVAAWLPGSEGQGVADVLFGDYGFTGKLPITWFK  600

Query  1995  TVDQ  2006
              VDQ
Sbjct  601   NVDQ  604



>ref|XP_009799725.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
 ref|XP_009799726.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=661

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/601 (69%), Positives = 491/601 (82%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYML-YKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MGK S  L  V LL CW  +A A   + YKD +QPV  R+KDLL RMTL EKIGQM QI+
Sbjct  1     MGKKSWILWVVTLLLCWSKIAMAKKNIKYKDPKQPVEVRVKDLLGRMTLAEKIGQMTQID  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R  A+ QVMK YY+GSVLS GGS P P+A+A  WV+MVN +Q GS+STRLGIPMIYGIDA
Sbjct  61    RSSATIQVMKDYYIGSVLSGGGSEPLPKATAADWVNMVNDYQNGSMSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             +HG+NN +NATIFPHNVGLGA RDPEL+R IGAATALEVRATGI Y FAPCIAVCRDPRW
Sbjct  121   IHGHNNVFNATIFPHNVGLGAARDPELMRRIGAATALEVRATGIPYAFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP+IV+ MT+II GLQGE P       P+VAG+ KVAACAKH+VGDGGT K
Sbjct  181   GRCYESYSEDPKIVQEMTDIIIGLQGEIPYESRKGIPYVAGKNKVAACAKHFVGDGGTTK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT+ + H+L SIHM  Y ++II+GVATVMASYSS NG +MHAN D++TGFLK TL
Sbjct  241   GINENNTVTNMHELLSIHMPAYDDAIIKGVATVMASYSSWNGQKMHANHDLVTGFLKGTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +F+GFVISD++ ID +T   H NYTYS+ +SI AGIDMVMVPYN+TEFI+ LTYLVKN F
Sbjct  301   KFKGFVISDWEGIDRITSPPHANYTYSVESSILAGIDMVMVPYNFTEFINDLTYLVKNNF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P++RIDDAV+RIL VKF MGLFE+P  D+SL   +GS++HR LAR+AVRKSLVLLKNG 
Sbjct  361   IPMARIDDAVERILLVKFTMGLFENPYTDFSLIKEVGSQEHRNLAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVD  1643
              A++P+LPL KK S+ILVAG+HADN+G+QCGGWTI WQG SGN  T GTTIL AIK+ VD
Sbjct  421   TANDPLLPLPKKVSKILVAGSHADNLGFQCGGWTIAWQGFSGNDDTGGTTILGAIKSAVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T+V + ENPD ++  S  F +AIVVVGE+ YAE +GDS  LTI + GP +I +VCP  
Sbjct  481   PGTEVTYVENPDSKYASSGGFDYAIVVVGERPYAETAGDSPTLTIADSGPDVINHVCPSV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVV++I+GRP+VI+PYLP IDALVAAWLPG+EGQG+ D+LFGDYGF+GKLP TWFKTVD
Sbjct  541   KCVVIIISGRPLVIEPYLPSIDALVAAWLPGSEGQGITDILFGDYGFTGKLPRTWFKTVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_008231857.1| PREDICTED: lysosomal beta glucosidase isoform X1 [Prunus mume]
Length=688

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/617 (67%), Positives = 498/617 (81%), Gaps = 12/617 (2%)
 Frame = +3

Query  192   LKFEEKMGKG-------SRFLIGVALLCCWV--VVANADYMLYKDHRQPVGRRIKDLLSR  344
             ++ +E++G G       S  ++G+ L+  WV     NADY+ YKD  QPV  R+ DLLSR
Sbjct  18    IRVKEELGSGRVRMAWVSLPVVGMLLVWWWVGFSAVNADYIKYKDANQPVAARVGDLLSR  77

Query  345   MTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSL  524
             MTL+EKIGQMVQI+R VA+   M+ Y++GSVLS GGS P P ASAE WV+M+N FQKG+L
Sbjct  78    MTLEEKIGQMVQIDRSVANVDTMRTYFIGSVLSGGGSAPLPEASAEDWVNMINEFQKGAL  137

Query  525   STRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQY  704
             ++RLGIPMIYGIDAVHG+NN YNATIFPHNVGLGATRDPELVR IG+ATALE RATGI Y
Sbjct  138   ASRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGATRDPELVRRIGSATALEARATGIPY  197

Query  705   VFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVA  884
             VFAPCIAVCRDPRWGRCYESYSED +IV+ MTEII GLQG+ P N     P+V G +KVA
Sbjct  198   VFAPCIAVCRDPRWGRCYESYSEDHKIVQEMTEIISGLQGDIPANSRKGVPYVGGNKKVA  257

Query  885   ACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMH  1064
             ACAKH+VGDGGT +GI+ENNT+VD H+L SIHM  Y +SII+GVATVM SYSS NG +MH
Sbjct  258   ACAKHFVGDGGTTRGINENNTVVDRHELLSIHMPAYSDSIIKGVATVMISYSSWNGEKMH  317

Query  1065  ANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYT  1244
             AN D++TGFLK TL+F+GFVISD++ +D +T   H NY+YS+  SI AG+DM+M+P+ Y 
Sbjct  318   ANHDLVTGFLKGTLKFKGFVISDWEGVDRITSPPHANYSYSVQASILAGLDMIMIPFKYI  377

Query  1245  EFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLAR  1424
             EFID L  LVKN  VP+ RIDDAV RIL VKF MGLFE+PL D SL + LGS+ HR LAR
Sbjct  378   EFIDDLISLVKNNVVPMDRIDDAVGRILLVKFTMGLFENPLADLSLVNELGSQAHRDLAR  437

Query  1425  KAVRKSLVLLKNGANAD--EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-N  1595
             +AVRKSLVLLKNG N     PV+PL KK S+ILVAG+HADN+GYQCGGWT+EWQG SG N
Sbjct  438   EAVRKSLVLLKNGKNGTNPNPVIPLPKKVSKILVAGSHADNLGYQCGGWTMEWQGFSGNN  497

Query  1596  ITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLT  1775
              T GTTIL+AIK+TVD+ T++++ ENPD  FVKS+ F++AIVVVGE  YAE SGDS NLT
Sbjct  498   YTRGTTILSAIKSTVDSSTEIIYRENPDGNFVKSNNFAYAIVVVGEHPYAETSGDSMNLT  557

Query  1776  IPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGD  1955
             + EPGPS+I+NVC   KC+V++I+GRP+VI+PY+  IDALVAAWLPGTEGQG+ DVLFGD
Sbjct  558   MAEPGPSVISNVCESVKCIVIVISGRPIVIEPYISSIDALVAAWLPGTEGQGITDVLFGD  617

Query  1956  YGFSGKLPFTWFKTVDQ  2006
             + FSGKLP TWF+TVDQ
Sbjct  618   HEFSGKLPRTWFRTVDQ  634



>gb|EPS66823.1| hypothetical protein M569_07949, partial [Genlisea aurea]
Length=627

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/597 (69%), Positives = 480/597 (80%), Gaps = 11/597 (2%)
 Frame = +3

Query  246   LLCCW---VVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMK  416
              LCC+      AN+++ +Y+D  QP+G R++DLL RMTL+EKIGQM QI+R VAS +VM 
Sbjct  5     FLCCYSSMAAAANSEHPIYRDPNQPIGARVRDLLDRMTLEEKIGQMTQIDRTVASPEVMN  64

Query  417   kyylgsvlssgg-------svpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHG  575
             +Y++GS+L  GG       SVP  ++S E W+DMVN FQ GSLSTRLGIPMIYGIDAVHG
Sbjct  65    RYFIGSLLGGGGSLYPNLPSVPAAKSSPETWIDMVNAFQNGSLSTRLGIPMIYGIDAVHG  124

Query  576   NNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRC  755
             N+  Y ATIFPHNVGLGATRDPELVR IGAATALE RATGI Y FAPCIAVCRDPRWGRC
Sbjct  125   NSFVYKATIFPHNVGLGATRDPELVRRIGAATALETRATGIPYAFAPCIAVCRDPRWGRC  184

Query  756   YESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGID  935
             YESYSEDP +V+ MTEII GLQGE P N     PF+A ++ VAACAKHYVGDGGT KGI+
Sbjct  185   YESYSEDPTVVKTMTEIINGLQGEIPSNSMKGVPFLASQKHVAACAKHYVGDGGTTKGIN  244

Query  936   ENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFR  1115
             ENNT+   HDL SIHM  Y++SII+GV++VM SYSS NGV+MHANRD+ITGFLK T RFR
Sbjct  245   ENNTVASRHDLLSIHMPAYFDSIIKGVSSVMISYSSWNGVKMHANRDLITGFLKGTQRFR  304

Query  1116  GFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPV  1295
             GFVISD+  ID +T   H NYTYSILT++NAGIDM+MVPYNYTEFI+G+T LVK   +P+
Sbjct  305   GFVISDWLGIDRITSPPHLNYTYSILTAVNAGIDMIMVPYNYTEFINGITELVKTNSIPM  364

Query  1296  SRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD  1475
             SRIDDAV RILRVKF MGLFE P GDYSL   LGS++HR +AR+AVRKSLVLLKNG   +
Sbjct  365   SRIDDAVTRILRVKFTMGLFEHPFGDYSLTKQLGSQEHRDIAREAVRKSLVLLKNGG-TE  423

Query  1476  EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQ  1655
             EP LPL K AS+ILVAGTHADNI YQCGGWTI WQG SG  T GTTIL  IKN V  +T 
Sbjct  424   EPFLPLSKSASKILVAGTHADNIAYQCGGWTINWQGGSGATTEGTTILEGIKNAVSKETT  483

Query  1656  VMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVV  1835
             V+F E+P  ++V+S+ FS+AIV VGE  YAE  GD+ NLT+P PGP II +VC   KCV+
Sbjct  484   VVFNESPSSDYVRSNNFSYAIVAVGEFPYAETLGDNLNLTLPSPGPGIIRDVCGSVKCVL  543

Query  1836  VLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VLI+GRP+VI+PY+ Q+DALVAAWLPG+EGQGVADVLFGDYGF+GKL  TWF++VDQ
Sbjct  544   VLISGRPLVIEPYISQVDALVAAWLPGSEGQGVADVLFGDYGFTGKLSRTWFRSVDQ  600



>ref|XP_009595457.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=630

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/601 (69%), Positives = 491/601 (82%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANAD-YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MGK S  L  V LL CW  +A A  +M YKD +QPV  R+KDLL RMTL EKIGQM QI+
Sbjct  1     MGKKSWILWVVTLLLCWSKIAMAKKHMKYKDPKQPVEVRVKDLLGRMTLAEKIGQMTQID  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R  A+ ++MK YY+GSVLS GGS P P+A+A  WV+MVN +Q GS+STRLGIPMIYGIDA
Sbjct  61    RSSATIKIMKDYYIGSVLSGGGSEPLPKATAADWVNMVNDYQNGSMSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             +HG+NN +NATIFPHNVGLGA RDPEL+R IGAATALEVRATGI Y FAPCIAVCRDPRW
Sbjct  121   IHGHNNVFNATIFPHNVGLGAARDPELMRRIGAATALEVRATGIPYAFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP+IV+ MT+II GLQGE P       P+VAG+ KVAACAKH+VGDGGT K
Sbjct  181   GRCYESYSEDPKIVQEMTDIIIGLQGEIPNESRKGIPYVAGKNKVAACAKHFVGDGGTTK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT+ + H+L SIHM  Y +SII+GVATVMASYSS NG +MHAN +++T FLK TL
Sbjct  241   GINENNTVTNMHELLSIHMPAYDDSIIKGVATVMASYSSWNGQKMHANHELVTTFLKGTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +F+GFVISD++ ID +T   H NYTYS+ +SI AGIDMVMVPYN+TEFI+ LTYLVKN F
Sbjct  301   KFKGFVISDWEGIDRITSPPHANYTYSVESSILAGIDMVMVPYNFTEFINDLTYLVKNNF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P++RIDDAV+RIL VKF MGLFE+P  D+SL   +GS++HR LAR+AVRKSLVLLKNG 
Sbjct  361   IPMARIDDAVERILLVKFTMGLFENPYTDFSLIKEVGSQEHRNLAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVD  1643
              A++ +LPL KKAS+ILVAG+HADN+G+QCGGWTI WQG SGN  T GTTIL AIK+ VD
Sbjct  421   TANDSLLPLPKKASKILVAGSHADNLGFQCGGWTIAWQGFSGNDDTGGTTILGAIKSAVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T+V + ENPD ++  S  F +AIVVVGE  YAE +GDS  LTI +PGP +I +VCP  
Sbjct  481   AGTEVTYVENPDSKYASSGGFDYAIVVVGEHPYAETAGDSPTLTIADPGPDVINHVCPSV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVV++I+GRP+VI+PYLP IDALVAAWLPG+EGQG+ D+LFGDYGF+GKLP TWFKTVD
Sbjct  541   KCVVIIISGRPLVIEPYLPSIDALVAAWLPGSEGQGITDLLFGDYGFTGKLPRTWFKTVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>gb|KEH25597.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=609

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/581 (71%), Positives = 479/581 (82%), Gaps = 1/581 (0%)
 Frame = +3

Query  267   VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlss  446
             +A A+   YKD +Q +  RIKDL+ RMTL+EKIGQMVQI+  VASA VMKKY++GS+LS 
Sbjct  1     MAEAENFKYKDPKQLLNTRIKDLMDRMTLEEKIGQMVQIDCTVASADVMKKYFIGSILSG  60

Query  447   ggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLG  626
             GG  PK  A+A  WVD VN FQKG+LSTRLGIPMIYGIDAVHG+NN Y ATIFPHNVGLG
Sbjct  61    GGHTPKQNATANEWVDFVNEFQKGALSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLG  120

Query  627   ATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEI  806
             ATRDP+LVR IG ATALE RATGI YVFAPCIAVCRDPRWGRCYESYSED +IV++MTE+
Sbjct  121   ATRDPQLVRRIGEATALEARATGIPYVFAPCIAVCRDPRWGRCYESYSEDHKIVQSMTEL  180

Query  807   IPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMA  986
             IPGLQG+ P N+    P+V G +KVAACAKH+VGDGGT KGI+ENNT+ + H ++ IHM 
Sbjct  181   IPGLQGDLPANWSKGVPYVGGSKKVAACAKHFVGDGGTTKGINENNTVANRHQIYGIHMP  240

Query  987   GYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTV  1166
              YYNSII+GVATVM SYSSLNG +MHAN D++TGFLK  LRFRGF ISD++ ID +T   
Sbjct  241   AYYNSIIKGVATVMISYSSLNGHKMHANHDLVTGFLKNKLRFRGFTISDWEGIDRITSPP  300

Query  1167  HGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVM  1346
             H NYTYSI  S+NAG+DM+MVP NYTEFIDGLT LVK   +P+SRIDDAVKRILRVKFVM
Sbjct  301   HANYTYSIEASVNAGLDMIMVPMNYTEFIDGLTSLVKKNAIPMSRIDDAVKRILRVKFVM  360

Query  1347  GLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAG  1526
             GLFE+PL DYSLA  +GS +HR+LAR+AVRKSLVLLKNG ++D+P+LPL KKA +ILVAG
Sbjct  361   GLFENPLADYSLADQIGSPEHRELAREAVRKSLVLLKNGKSSDKPILPLPKKAPKILVAG  420

Query  1527  THADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSK  1703
             +HADNIG QCGGWTI WQG SG N+T GTTIL AIKNTVD +T V ++E P  ++VKS+ 
Sbjct  421   SHADNIGNQCGGWTITWQGQSGNNMTTGTTILNAIKNTVDKETVVEYKEQPTQDYVKSNG  480

Query  1704  FSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQ  1883
             FS+AIVVVGEK YAE  GDS NLT+P  G   I NVC   KCVVVLI+GRPVVIQP+L  
Sbjct  481   FSYAIVVVGEKPYAETDGDSLNLTLPAHGIETIKNVCGAVKCVVVLISGRPVVIQPFLHN  540

Query  1884  IDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ID LVAAWLPG+EG GVADVLFGDYGF+GKL  TWFKTV Q
Sbjct  541   IDGLVAAWLPGSEGTGVADVLFGDYGFTGKLSRTWFKTVHQ  581



>ref|XP_009412935.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=628

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/592 (69%), Positives = 482/592 (81%), Gaps = 0/592 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             L+GV LL CW  V+ A+Y  YKD  QPV  RI+DL+ RMTL EKIGQM QIER+VA+ Q+
Sbjct  8     LLGVHLLLCWAAVSGAEYAKYKDPNQPVKWRIRDLMQRMTLAEKIGQMTQIERKVATPQI  67

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             MK +++GSVLS GGSVP PRASAEAWVDM+N FQ+GSLSTRLGIPMIYGIDAVHGNNN Y
Sbjct  68    MKDFFIGSVLSGGGSVPAPRASAEAWVDMINEFQRGSLSTRLGIPMIYGIDAVHGNNNVY  127

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
             NAT+FPHN+GLGATRDPELV+ IGAATALEVRATGI Y FAPCIAVCRDPRWGRC+ESYS
Sbjct  128   NATMFPHNIGLGATRDPELVKRIGAATALEVRATGIPYAFAPCIAVCRDPRWGRCFESYS  187

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED  IV+AMT+II GLQG+ P N+   FP+V+G  KV A AKH+VGDGGT KGI+EN+T+
Sbjct  188   EDHRIVQAMTDIILGLQGDVPENHAKGFPYVSGERKVVASAKHFVGDGGTQKGINENDTI  247

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             +D + LF IHM  Y ++I +GV+TVM SYSS NGV+MH NRD+ITG LK  L F+G VIS
Sbjct  248   IDPNGLFGIHMPAYVDAIAKGVSTVMISYSSWNGVKMHTNRDLITGVLKNKLGFKGLVIS  307

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ +D +T     NYTYS+   INAGIDMVMVP  Y EFI  LT+LVKNKF+ +SRIDD
Sbjct  308   DWEGLDRITSPPGANYTYSVEAGINAGIDMVMVPKRYKEFIGNLTFLVKNKFISMSRIDD  367

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV+RILRVKF +GLF+ PL D+SLA  LG ++HR+LAR+AVRKSLVLLKNG + D P+LP
Sbjct  368   AVRRILRVKFALGLFDKPLADHSLADQLGKKEHRELAREAVRKSLVLLKNGNSDDGPLLP  427

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEE  1670
             L KKA RILVAG+HA NIGYQCGGWTIEW G SG IT GTTIL AI++TVD  T+V F E
Sbjct  428   LPKKAPRILVAGSHAHNIGYQCGGWTIEWYGGSGRITAGTTILEAIRSTVDPATEVAFSE  487

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
             NPD + ++   FS+A+VVVGE  YAE  GDS NLT+  PGP+ I  VC   KC VVL+TG
Sbjct  488   NPDADLLRDHDFSYAVVVVGEHPYAETFGDSLNLTLAAPGPTTIQTVCGAVKCAVVLVTG  547

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RPVVI+PYLP +DALVAAWLPG+EGQGVADVLFGDY F+G+LP TWF++VDQ
Sbjct  548   RPVVIEPYLPGMDALVAAWLPGSEGQGVADVLFGDYEFTGRLPSTWFRSVDQ  599



>ref|XP_008231858.1| PREDICTED: lysosomal beta glucosidase isoform X2 [Prunus mume]
Length=658

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/597 (69%), Positives = 489/597 (82%), Gaps = 5/597 (1%)
 Frame = +3

Query  231   LIGVALLCCWV--VVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASA  404
             ++G+ L+  WV     NADY+ YKD  QPV  R+ DLLSRMTL+EKIGQMVQI+R VA+ 
Sbjct  8     VVGMLLVWWWVGFSAVNADYIKYKDANQPVAARVGDLLSRMTLEEKIGQMVQIDRSVANV  67

Query  405   QVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNN  584
               M+ Y++GSVLS GGS P P ASAE WV+M+N FQKG+L++RLGIPMIYGIDAVHG+NN
Sbjct  68    DTMRTYFIGSVLSGGGSAPLPEASAEDWVNMINEFQKGALASRLGIPMIYGIDAVHGHNN  127

Query  585   AYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYES  764
              YNATIFPHNVGLGATRDPELVR IG+ATALE RATGI YVFAPCIAVCRDPRWGRCYES
Sbjct  128   VYNATIFPHNVGLGATRDPELVRRIGSATALEARATGIPYVFAPCIAVCRDPRWGRCYES  187

Query  765   YSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENN  944
             YSED +IV+ MTEII GLQG+ P N     P+V G +KVAACAKH+VGDGGT +GI+ENN
Sbjct  188   YSEDHKIVQEMTEIISGLQGDIPANSRKGVPYVGGNKKVAACAKHFVGDGGTTRGINENN  247

Query  945   TLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFV  1124
             T+VD H+L SIHM  Y +SII+GVATVM SYSS NG +MHAN D++TGFLK TL+F+GFV
Sbjct  248   TVVDRHELLSIHMPAYSDSIIKGVATVMISYSSWNGEKMHANHDLVTGFLKGTLKFKGFV  307

Query  1125  ISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRI  1304
             ISD++ +D +T   H NY+YS+  SI AG+DM+M+P+ Y EFID L  LVKN  VP+ RI
Sbjct  308   ISDWEGVDRITSPPHANYSYSVQASILAGLDMIMIPFKYIEFIDDLISLVKNNVVPMDRI  367

Query  1305  DDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD--E  1478
             DDAV RIL VKF MGLFE+PL D SL + LGS+ HR LAR+AVRKSLVLLKNG N     
Sbjct  368   DDAVGRILLVKFTMGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVLLKNGKNGTNPN  427

Query  1479  PVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQ  1655
             PV+PL KK S+ILVAG+HADN+GYQCGGWT+EWQG SG N T GTTIL+AIK+TVD+ T+
Sbjct  428   PVIPLPKKVSKILVAGSHADNLGYQCGGWTMEWQGFSGNNYTRGTTILSAIKSTVDSSTE  487

Query  1656  VMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVV  1835
             +++ ENPD  FVKS+ F++AIVVVGE  YAE SGDS NLT+ EPGPS+I+NVC   KC+V
Sbjct  488   IIYRENPDGNFVKSNNFAYAIVVVGEHPYAETSGDSMNLTMAEPGPSVISNVCESVKCIV  547

Query  1836  VLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ++I+GRP+VI+PY+  IDALVAAWLPGTEGQG+ DVLFGD+ FSGKLP TWF+TVDQ
Sbjct  548   IVISGRPIVIEPYISSIDALVAAWLPGTEGQGITDVLFGDHEFSGKLPRTWFRTVDQ  604



>emb|CAA07070.1| beta-D-glucosidase [Tropaeolum majus]
Length=654

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/599 (69%), Positives = 490/599 (82%), Gaps = 5/599 (1%)
 Frame = +3

Query  225   RFLIGVA----LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQ  392
             RFL+ +     LL C      A+YM YKD ++P+  RIKDL+SRMTL EKIGQM QIER+
Sbjct  3     RFLLPILGWFLLLSCLSAFTEAEYMRYKDPKKPLNVRIKDLMSRMTLAEKIGQMTQIERK  62

Query  393   VASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVH  572
              A+  V+ KY++GSVLS GGSVP P+AS EAWVD+VNG QK +LSTRLGIPMIYGIDAVH
Sbjct  63    EATPDVISKYFIGSVLSGGGSVPAPKASPEAWVDLVNGMQKAALSTRLGIPMIYGIDAVH  122

Query  573   GNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGR  752
             G+NN YNATIFPHNVGLG TRDP L++ IG ATALE RATGI Y FAPCIAVCRDPRWGR
Sbjct  123   GHNNVYNATIFPHNVGLGVTRDPALIKRIGEATALECRATGIPYAFAPCIAVCRDPRWGR  182

Query  753   CYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGI  932
             CYESYSED  IV+AMTEIIPGLQG+ PP+     PFV G+ KVAACAKH+VGDGGT KGI
Sbjct  183   CYESYSEDHTIVQAMTEIIPGLQGDVPPDVKKGVPFVGGKTKVAACAKHFVGDGGTTKGI  242

Query  933   DENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRF  1112
             DENNT++D+  LFSIHM  Y++SI +GVATVM SYSS NG+RMHANRD++TG+LK  L+F
Sbjct  243   DENNTVIDSRGLFSIHMPAYHDSIKKGVATVMVSYSSWNGLRMHANRDLVTGYLKNKLKF  302

Query  1113  RGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVP  1292
             RGFVISD++ ID +T     NY+YS+   + AGIDM+MVP ++T+F++ LT  VK   +P
Sbjct  303   RGFVISDWEGIDRITDPPGRNYSYSVEAGVGAGIDMIMVPEDFTKFLNELTSQVKKNIIP  362

Query  1293  VSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANA  1472
             +SRIDDAVKRILRVKFVMGLFE PL DYSLA+ LGS++HR LAR+AVRKSLVLLKNG +A
Sbjct  363   MSRIDDAVKRILRVKFVMGLFESPLADYSLANQLGSQEHRDLAREAVRKSLVLLKNGESA  422

Query  1473  DEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTK  1649
             D+P +PL K A +ILVAG+HADN+G QCGGWTIEWQG++GN +T GTTIL AIK TVD  
Sbjct  423   DKPFVPLPKNAKKILVAGSHADNLGRQCGGWTIEWQGVNGNDLTTGTTILNAIKKTVDPT  482

Query  1650  TQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKC  1829
             TQV++ ENPD  +VK++ F +AIVVVGE  YAE  GDS NLTIPEPGP+ I++VC   KC
Sbjct  483   TQVIYNENPDSNYVKTNSFDYAIVVVGEPPYAEMQGDSFNLTIPEPGPTTISSVCGAVKC  542

Query  1830  VVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VVV+I+GRPVV+QPY+  +DALVAAWLPGTEGQGV DVLFGDYGF+GKL  TWFKTVDQ
Sbjct  543   VVVVISGRPVVLQPYVSYMDALVAAWLPGTEGQGVTDVLFGDYGFTGKLARTWFKTVDQ  601



>ref|XP_006487879.1| PREDICTED: lysosomal beta glucosidase-like [Citrus sinensis]
Length=631

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/595 (69%), Positives = 492/595 (83%), Gaps = 4/595 (1%)
 Frame = +3

Query  234   IGVALLCCWVVVANAD---YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASA  404
             +G  LLCC     +A    YM ++D +QP+ +R +DL++RMTL+EKIGQMVQ++R  A+A
Sbjct  9     LGFLLLCCMAFAIHASDPGYMKFRDPQQPLSKRTRDLMNRMTLEEKIGQMVQLDRAAATA  68

Query  405   QVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNN  584
             ++M+ Y +GS+LS GGSVP+ +A+ + W+DMVN FQKGSLS+RLGIPMIYGIDAVHG+NN
Sbjct  69    EIMRDYSIGSLLSGGGSVPRLQATPQEWIDMVNDFQKGSLSSRLGIPMIYGIDAVHGHNN  128

Query  585   AYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYES  764
              Y ATIFPHNVGLGATRDP+LVR IGAATALEVRATGI Y FAPCIAVCRDPRWGRC+ES
Sbjct  129   VYKATIFPHNVGLGATRDPDLVRRIGAATALEVRATGINYAFAPCIAVCRDPRWGRCFES  188

Query  765   YSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENN  944
             YSEDP+IV+ MTEIIPGLQG+ P + P   P+VAGR+KVAACAKHYVGDGGT +GI+ENN
Sbjct  189   YSEDPKIVKLMTEIIPGLQGDIPSDLPKGIPYVAGRDKVAACAKHYVGDGGTTRGINENN  248

Query  945   TLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFV  1124
             T++D H L SIHM  Y ++II+GV+TVM SYSS NG++MHANRD++T FLK TL+FRGFV
Sbjct  249   TVIDRHGLMSIHMPAYNDAIIKGVSTVMVSYSSWNGLKMHANRDLVTNFLKGTLKFRGFV  308

Query  1125  ISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRI  1304
             ISD++ ID +T   H NY+YS+L  +NAGIDM M+P+N+T+FID LT  V+ K VP+SRI
Sbjct  309   ISDWQGIDRITTPEHANYSYSVLAGVNAGIDMFMLPFNHTDFIDILTDFVERKIVPMSRI  368

Query  1305  DDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPV  1484
             DDAV+RILRVKF MGLFE P+ D +    LGS+ HR LAR+AVRKSLVLLKNG NAD   
Sbjct  369   DDAVRRILRVKFTMGLFEKPMADQTFIDQLGSQAHRDLAREAVRKSLVLLKNGENADGAA  428

Query  1485  LPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVM  1661
             LPL K A+RILVAGTHA+N+GYQCGGWTI WQGLSG N T+GTTIL  I  TVD+ T+++
Sbjct  429   LPLPKNAARILVAGTHANNLGYQCGGWTIAWQGLSGNNNTVGTTILNGISATVDSDTEII  488

Query  1662  FEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVL  1841
             F ENP  ++VK+S  S+AIVVVGE+ YAE  GDS NLTI EPGPS I NVC   KCVVVL
Sbjct  489   FSENPSMDYVKASNVSYAIVVVGEQPYAETQGDSLNLTISEPGPSTITNVCAAVKCVVVL  548

Query  1842  ITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ++GRPV + PYLPQ+DALVAAWLPGTEGQGVADVLFGDYGF+G+LP TWFKTVDQ
Sbjct  549   VSGRPVTVGPYLPQVDALVAAWLPGTEGQGVADVLFGDYGFTGRLPRTWFKTVDQ  603



>gb|AAR14129.1| exo-beta-glucanase [Lilium longiflorum]
Length=626

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/589 (69%), Positives = 491/589 (83%), Gaps = 0/589 (0%)
 Frame = +3

Query  240   VALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKk  419
             V  L CW  +  A+Y+ YKD  + V  RIKDL+ RMTL+EKIGQM QIER+VASA+V+K 
Sbjct  10    VLCLLCWFSIGKAEYLKYKDPSRTVDTRIKDLMKRMTLEEKIGQMTQIERKVASAEVVKD  69

Query  420   yylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNAT  599
             Y++GS+LS GGSVP P ASA+ WVDMVN FQKG+L+TRLGIPMIYGIDAVHG+NN YNAT
Sbjct  70    YFIGSLLSGGGSVPAPNASAQQWVDMVNEFQKGALATRLGIPMIYGIDAVHGHNNVYNAT  129

Query  600   IFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDP  779
             IFPHNVGLGATRDP+LV+ IGAATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSED 
Sbjct  130   IFPHNVGLGATRDPDLVKRIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSEDH  189

Query  780   EIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDT  959
              +V+AM EIIPGLQG+ P  +    P+V G++KVAAC+KH+VGDGGT  GI+ENNT++  
Sbjct  190   TVVQAMIEIIPGLQGDVPAKHKKGNPYVGGKDKVAACSKHFVGDGGTHDGINENNTIISA  249

Query  960   HDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFK  1139
               LFSIHM  YYNSI +GV+TVM SYSS NG +MHAN ++ITGFLKK L+FRGFVISD++
Sbjct  250   KGLFSIHMPAYYNSIDKGVSTVMISYSSWNGKKMHANHELITGFLKKKLKFRGFVISDWE  309

Query  1140  AIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVK  1319
              ID +T     NYTYS+  SI+AG+DM+MVP NY +FI  LTYLVK   +P+SRI+DAV+
Sbjct  310   GIDRITSPPGANYTYSVQASISAGLDMIMVPNNYQDFIGNLTYLVKKNVIPMSRINDAVR  369

Query  1320  RILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRK  1499
             RILRVKFV GLFE+PL DYSLA  LG+++HR+LAR+AVRKSLVLLKNG + ++P+LPL K
Sbjct  370   RILRVKFVAGLFENPLADYSLADQLGNKEHRELAREAVRKSLVLLKNGKSINQPLLPLPK  429

Query  1500  KASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPD  1679
             KA +ILVAG+HA +IG QCGGWT+EWQG  GNIT+GTTIL  IK TVD  T V++EENPD
Sbjct  430   KAPKILVAGSHAHDIGLQCGGWTMEWQGKIGNITVGTTILDGIKATVDPTTNVIYEENPD  489

Query  1680  PEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPV  1859
               FV+++ FS+AIVVVGE  YAE +GD+ NLT+P PGPS+I +VC   KCVVV+++GRP+
Sbjct  490   ATFVENNNFSYAIVVVGEIPYAETAGDNLNLTLPAPGPSMIKDVCGAVKCVVVIVSGRPL  549

Query  1860  VIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VI+P+L  +DA+VAAWLPG+EGQGV+DVLFGDYGF+GKLP TWFK+VDQ
Sbjct  550   VIEPFLGSMDAVVAAWLPGSEGQGVSDVLFGDYGFTGKLPRTWFKSVDQ  598



>ref|XP_008672746.1| PREDICTED: uncharacterized protein LOC100280148 isoform X1 [Zea 
mays]
 ref|XP_008672747.1| PREDICTED: uncharacterized protein LOC100280148 isoform X1 [Zea 
mays]
Length=673

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/587 (69%), Positives = 483/587 (82%), Gaps = 0/587 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             LL C+V +A+A+YM YKD +QP+  RI+DL+ RMTL EKIGQM QIERQVASA VMK+Y+
Sbjct  30    LLLCFVSMADAEYMKYKDPKQPINSRIRDLIGRMTLAEKIGQMTQIERQVASANVMKQYF  89

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GS+LS GGSVP P+AS   WV+MVN FQKG+LSTRLGIP+IYGIDAVHGNNN YNAT+F
Sbjct  90    IGSILSGGGSVPSPQASPAIWVNMVNEFQKGALSTRLGIPLIYGIDAVHGNNNVYNATLF  149

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHN+GLGATRDP L++ IG ATALEVRATGIQY FAPCIAVCRDPRWGRCYESYSED ++
Sbjct  150   PHNIGLGATRDPGLIKRIGEATALEVRATGIQYTFAPCIAVCRDPRWGRCYESYSEDHKV  209

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             V+ MT+II GLQGE P N+    P+VAG++KVAACAKHYVGDGGT  GI+ENNT++D H 
Sbjct  210   VQQMTDIILGLQGEIPVNHTKGVPYVAGKDKVAACAKHYVGDGGTHNGINENNTIIDEHG  269

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             L SIHM  YY+SII+GVATVM SYSSLNGV+MHAN D++TG+LK  L FRGFVISD+  +
Sbjct  270   LLSIHMPPYYDSIIKGVATVMVSYSSLNGVKMHANHDLVTGYLKSKLHFRGFVISDWLGV  329

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T     NYTYS+   INAGIDMVMVPYNYT++I+ LT LV    + +SRIDDAVKRI
Sbjct  330   DRITSPPGANYTYSVQAGINAGIDMVMVPYNYTDYINDLTSLVHKGVINISRIDDAVKRI  389

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LRVKF MGLFE+PL D S A  LG ++HR+LAR+AVRKSLVLLKNG + D+  LPL K+A
Sbjct  390   LRVKFTMGLFENPLADLSFAEQLGKKEHRELAREAVRKSLVLLKNGNSPDQQFLPLPKRA  449

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPE  1685
               ILVAG+HA N+GYQCGGW+I+W G SGNIT GTTIL AIK+TV   T V++ ENPD  
Sbjct  450   RSILVAGSHASNLGYQCGGWSIQWMGDSGNITTGTTILDAIKSTVADSTSVVYSENPDDS  509

Query  1686  FVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVI  1865
             F+K + FS AIVVVGE  YAE  GDS++LT+ +PGP  I  VC   KC VV+I+GRP+VI
Sbjct  510   FMKHNDFSFAIVVVGEPPYAETVGDSTDLTMLDPGPDTIRTVCAAVKCAVVIISGRPIVI  569

Query  1866  QPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +PY+P ++ALVAAWLPGTEGQGVADVLFGDYGF+GKLP TWFK+VDQ
Sbjct  570   EPYVPLVEALVAAWLPGTEGQGVADVLFGDYGFTGKLPHTWFKSVDQ  616



>ref|XP_009595456.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=661

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/601 (69%), Positives = 491/601 (82%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANAD-YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MGK S  L  V LL CW  +A A  +M YKD +QPV  R+KDLL RMTL EKIGQM QI+
Sbjct  1     MGKKSWILWVVTLLLCWSKIAMAKKHMKYKDPKQPVEVRVKDLLGRMTLAEKIGQMTQID  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R  A+ ++MK YY+GSVLS GGS P P+A+A  WV+MVN +Q GS+STRLGIPMIYGIDA
Sbjct  61    RSSATIKIMKDYYIGSVLSGGGSEPLPKATAADWVNMVNDYQNGSMSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             +HG+NN +NATIFPHNVGLGA RDPEL+R IGAATALEVRATGI Y FAPCIAVCRDPRW
Sbjct  121   IHGHNNVFNATIFPHNVGLGAARDPELMRRIGAATALEVRATGIPYAFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP+IV+ MT+II GLQGE P       P+VAG+ KVAACAKH+VGDGGT K
Sbjct  181   GRCYESYSEDPKIVQEMTDIIIGLQGEIPNESRKGIPYVAGKNKVAACAKHFVGDGGTTK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT+ + H+L SIHM  Y +SII+GVATVMASYSS NG +MHAN +++T FLK TL
Sbjct  241   GINENNTVTNMHELLSIHMPAYDDSIIKGVATVMASYSSWNGQKMHANHELVTTFLKGTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +F+GFVISD++ ID +T   H NYTYS+ +SI AGIDMVMVPYN+TEFI+ LTYLVKN F
Sbjct  301   KFKGFVISDWEGIDRITSPPHANYTYSVESSILAGIDMVMVPYNFTEFINDLTYLVKNNF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P++RIDDAV+RIL VKF MGLFE+P  D+SL   +GS++HR LAR+AVRKSLVLLKNG 
Sbjct  361   IPMARIDDAVERILLVKFTMGLFENPYTDFSLIKEVGSQEHRNLAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVD  1643
              A++ +LPL KKAS+ILVAG+HADN+G+QCGGWTI WQG SGN  T GTTIL AIK+ VD
Sbjct  421   TANDSLLPLPKKASKILVAGSHADNLGFQCGGWTIAWQGFSGNDDTGGTTILGAIKSAVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T+V + ENPD ++  S  F +AIVVVGE  YAE +GDS  LTI +PGP +I +VCP  
Sbjct  481   AGTEVTYVENPDSKYASSGGFDYAIVVVGEHPYAETAGDSPTLTIADPGPDVINHVCPSV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVV++I+GRP+VI+PYLP IDALVAAWLPG+EGQG+ D+LFGDYGF+GKLP TWFKTVD
Sbjct  541   KCVVIIISGRPLVIEPYLPSIDALVAAWLPGSEGQGITDLLFGDYGFTGKLPRTWFKTVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_010103976.1| Lysosomal beta glucosidase [Morus notabilis]
 gb|EXB97679.1| Lysosomal beta glucosidase [Morus notabilis]
Length=669

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/594 (68%), Positives = 489/594 (82%), Gaps = 2/594 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANA-DYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             L+ +  +  W  +A   +YM YKD +QPV  R++DLLSRMTL+EKIGQM QI++ VA+  
Sbjct  9     LVALVWVSWWAAMAEEIEYMKYKDPKQPVAVRVRDLLSRMTLEEKIGQMTQIDKSVANVL  68

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
              ++ Y +GSVLS GGS P P ASAE W++M+N FQKG+LS+RLGIPMIYGIDAVHG+NN 
Sbjct  69    TLRTYSIGSVLSGGGSAPLPDASAEDWINMINEFQKGALSSRLGIPMIYGIDAVHGHNNV  128

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             YNATIFPHN+GLGATRDP+L R IG ATALEVRATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  129   YNATIFPHNIGLGATRDPDLARRIGVATALEVRATGIPYVFAPCIAVCRDPRWGRCYESY  188

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SED +IV+ MTEIIPGLQG+ P N     P+V G+ KVAACAKH+VGDGGTVKGI+ENNT
Sbjct  189   SEDHKIVQEMTEIIPGLQGDIPANSRKGVPYVGGKTKVAACAKHFVGDGGTVKGINENNT  248

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             L+D H L SIHM  Y ++II+GV+TVMASYSS NG +MHANR++ITGFLK TL+F+GFVI
Sbjct  249   LLDMHGLLSIHMPAYSDAIIKGVSTVMASYSSWNGEKMHANRELITGFLKDTLKFKGFVI  308

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NY+YS+  ++ AGIDMVMVP+NY+EFI+ LT LVKN  +P+ RI+
Sbjct  309   SDWEGIDRITSPPHSNYSYSVQAAVEAGIDMVMVPFNYSEFINDLTNLVKNNVIPIDRIN  368

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAV RIL VKF +GLFE+PL D+SL + LGS+ HR LAR+AVRKSLVLLKNG N   P+L
Sbjct  369   DAVGRILLVKFTLGLFENPLADFSLVNELGSQAHRDLAREAVRKSLVLLKNGKNETTPLL  428

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMF  1664
             PL KKA +ILVAG+HA+N+GYQCGGWTI W+G SG N T GTTIL AIK+TVD  T+ ++
Sbjct  429   PLYKKAHKILVAGSHANNLGYQCGGWTISWEGFSGNNSTRGTTILDAIKSTVDPSTETVY  488

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
              ENPD +FVKS+ F++A++VVGE TY E  GDS  LT+ +PGP++I+NVC   KCVVV+I
Sbjct  489   NENPDADFVKSNNFAYAVIVVGEHTYVETLGDSITLTMEDPGPTVISNVCQSVKCVVVII  548

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRP+VI+PYL  +DALVAAWLPGTEGQG+ADVLFGDYGF+GKLP TWF+TVDQ
Sbjct  549   SGRPIVIEPYLSPVDALVAAWLPGTEGQGIADVLFGDYGFTGKLPMTWFRTVDQ  602



>gb|KHN22996.1| Lysosomal beta glucosidase [Glycine soja]
Length=689

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/605 (68%), Positives = 488/605 (81%), Gaps = 7/605 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVV----ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMV  377
             M +    L+GV L  CW +     A  +Y+ YKD +Q V  R++DL+SRMTL EKIGQMV
Sbjct  1     MSRALFHLLGV-LWLCWCLTSIGEAQIEYLRYKDPKQSVQTRVRDLMSRMTLDEKIGQMV  59

Query  378   QIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYG  557
             QI+R VA+A VMK  ++GSVLS GGS P PRA+AE WV+M+N FQKG+L +RLGIPMIYG
Sbjct  60    QIDRSVANANVMKTSFIGSVLSGGGSEPLPRATAEDWVNMINDFQKGALESRLGIPMIYG  119

Query  558   IDAVHGNNNAYNATIFPHNVGLGATR-DPELVREIGAATALEVRATGIQYVFAPCIAVCR  734
             IDAVHG+NN YNATIFPHNVGLG TR DP L + IGAATALEVRATGI YVFAPCIAVCR
Sbjct  120   IDAVHGHNNVYNATIFPHNVGLGCTRQDPNLAQRIGAATALEVRATGIPYVFAPCIAVCR  179

Query  735   DPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDG  914
             DPRWGRCYESYSEDP+IV+ MTEIIPGLQG  P N    FP+V G+ KVAACAKH+VGDG
Sbjct  180   DPRWGRCYESYSEDPKIVQEMTEIIPGLQGSIPANSRKGFPYVGGKTKVAACAKHFVGDG  239

Query  915   GTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFL  1094
             GT KGI+ENNT++D H L SIHM  Y +SII+GV+TVM SYSS NGVRMHANRD++TGFL
Sbjct  240   GTTKGINENNTVIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGVRMHANRDLVTGFL  299

Query  1095  KKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLV  1274
             K TL+F+GFVISD++ ID LT     NYTYS+  SI AG+DMVMVP+ Y +FI  LT LV
Sbjct  300   KNTLKFKGFVISDWQGIDRLTSPPSSNYTYSVQASIEAGVDMVMVPFEYDKFIQDLTLLV  359

Query  1275  KNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLL  1454
             K+  +P+ RIDDAV+RIL VKF MGLFE+PL D SL + LGS++HR LAR+AVRKSLVLL
Sbjct  360   KSNIIPMERIDDAVERILLVKFTMGLFENPLADTSLVNELGSQEHRDLAREAVRKSLVLL  419

Query  1455  KNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIK  1631
             KNG N   P+LPL KK  +ILVAG+HADN+GYQCGGWTI+WQG SGN  T GTTIL+AIK
Sbjct  420   KNGKNESAPLLPLPKKVPKILVAGSHADNLGYQCGGWTIKWQGFSGNSDTRGTTILSAIK  479

Query  1632  NTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANV  1811
             + VDT T+V+F +NPD EFV+S+ F +AIVVVGE  YAE +GDS+ L + E GP++I NV
Sbjct  480   SAVDTSTEVVFRDNPDNEFVRSNNFEYAIVVVGEPPYAETAGDSTTLAMMESGPNVINNV  539

Query  1812  CPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWF  1991
             C   KCVVV+I+GRP+VI+PY+  IDALVAAWLPGTEGQGV DVLFGDYGF+GKL  TWF
Sbjct  540   CGTVKCVVVIISGRPIVIEPYVSSIDALVAAWLPGTEGQGVTDVLFGDYGFTGKLARTWF  599

Query  1992  KTVDQ  2006
             K+VDQ
Sbjct  600   KSVDQ  604



>ref|XP_009400035.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400036.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400037.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400039.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400040.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400041.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=630

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/585 (70%), Positives = 485/585 (83%), Gaps = 1/585 (0%)
 Frame = +3

Query  255   CWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgs  434
             C   +  A+Y+ YKD +QP+  RI DLL RMTL EKIGQM QIER+ A+A V+K Y++GS
Sbjct  18    CRGTLGGAEYLKYKDPKQPLNARINDLLKRMTLAEKIGQMSQIERENATADVLKTYFIGS  77

Query  435   vlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHN  614
             VLS GGSVP P+AS E WV+MVNG QK +LSTRLGIP+IYGIDAVHG++N Y AT+FPHN
Sbjct  78    VLSGGGSVPAPQASIETWVNMVNGMQKAALSTRLGIPIIYGIDAVHGHSNVYKATVFPHN  137

Query  615   VGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRA  794
             VGLGATRDP LV++IGAATALEVRATGI YVFAPC+AVCRDPRWGRCYESYSEDP++V+ 
Sbjct  138   VGLGATRDPALVKKIGAATALEVRATGIPYVFAPCVAVCRDPRWGRCYESYSEDPKLVKE  197

Query  795   MTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFS  974
             MTEIIPGLQG+ P N     PFVAG+  VAACAKHYVGDGGT KGI+ENNT++  H L S
Sbjct  198   MTEIIPGLQGDIPANSRKGVPFVAGKRNVAACAKHYVGDGGTYKGINENNTIISQHGLLS  257

Query  975   IHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNL  1154
             IHM  YY+++I+GV+TVM S+SS NGV+MHAN  ++T FLK  L FRGFVISD++ ID +
Sbjct  258   IHMPPYYSAVIKGVSTVMVSFSSWNGVKMHANHYLVTDFLKNKLHFRGFVISDWQGIDRI  317

Query  1155  TPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRV  1334
             T   H NY+YSI   I+AGIDMVM+P+ YTEFI  LTY V+N  +P+SRI+DAV+RILRV
Sbjct  318   TSPPHANYSYSIQAGIHAGIDMVMIPFAYTEFIKDLTYQVQNNVIPMSRINDAVRRILRV  377

Query  1335  KFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRI  1514
             KF +GLFE+P  D SLA  LG ++HR LAR+AVRKSLVLLKNG +A++P+LPL KKA +I
Sbjct  378   KFTVGLFENPYADPSLADQLGKKEHRDLAREAVRKSLVLLKNGKSANDPMLPLPKKAKKI  437

Query  1515  LVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFV  1691
             LVAG+HADN+GYQCGGWTI WQGLSG N TIGTT+L A+K+TVD  T+V+F ENPDPEFV
Sbjct  438   LVAGSHADNLGYQCGGWTITWQGLSGNNNTIGTTVLDAVKSTVDPSTEVIFSENPDPEFV  497

Query  1692  KSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQP  1871
             K S FS+AIVVVGE  YAE  GD+ NLTIP PGPS+I NVC   KCVV++I+GRP+VI+P
Sbjct  498   KQSMFSYAIVVVGEHPYAETDGDNLNLTIPYPGPSVIQNVCSCIKCVVIIISGRPIVIEP  557

Query  1872  YLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             Y+  ID+LVAAWLPGTEGQGVADVLFGDYGFSGKL  TWFK+V+Q
Sbjct  558   YIGMIDSLVAAWLPGTEGQGVADVLFGDYGFSGKLSRTWFKSVEQ  602



>dbj|BAD13764.1| exo-1,3-beta-glucanase [Lilium longiflorum]
Length=626

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/589 (70%), Positives = 495/589 (84%), Gaps = 0/589 (0%)
 Frame = +3

Query  240   VALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKk  419
             V  L CW  +  A+Y+ YKD  QP+G RI+DL+ RMTL+EKIGQM QIER+V SA+V+K 
Sbjct  10    VLCLLCWFSIGKAEYLKYKDPNQPLGARIRDLMKRMTLEEKIGQMTQIERKVGSAKVVKD  69

Query  420   yylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNAT  599
             Y++GS+LS GGSVP P+A+A+ WVDMVN FQKG+L+TRLGIPMIYGIDAVHG+NN YNAT
Sbjct  70    YFIGSLLSGGGSVPAPKATAKEWVDMVNEFQKGALATRLGIPMIYGIDAVHGHNNVYNAT  129

Query  600   IFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDP  779
             IFPHN+GLGATRDP LV+ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSED 
Sbjct  130   IFPHNIGLGATRDPFLVKRIGAATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDH  189

Query  780   EIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDT  959
              IV+AMTE+IPGLQG+ P NY    P+V G++KV ACAKHYVGDGGT +GI+ENNT++++
Sbjct  190   TIVQAMTELIPGLQGDLPANYRKGTPYVGGKDKVVACAKHYVGDGGTYEGINENNTIINS  249

Query  960   HDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFK  1139
             H LFSIHM  YYNSII+GV+TVM SYSS NG +MHANR +ITGFLK TL+FRGFVISD++
Sbjct  250   HGLFSIHMPAYYNSIIKGVSTVMVSYSSWNGKKMHANRALITGFLKNTLKFRGFVISDWQ  309

Query  1140  AIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVK  1319
              ID +T     NYTYS+  SI+AG+DMVMVP NYTEFID LT LVK   +P+SRIDDAVK
Sbjct  310   GIDRITSPPDANYTYSVQASIHAGLDMVMVPNNYTEFIDDLTLLVKKNVIPMSRIDDAVK  369

Query  1320  RILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRK  1499
             RILRVKFV GLFE+PL DYSL   LG+++HR+LAR+AVR+SLVLLKNG  A++P+LPL K
Sbjct  370   RILRVKFVSGLFENPLADYSLTDQLGNKEHRELAREAVRRSLVLLKNGKPANQPLLPLPK  429

Query  1500  KASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPD  1679
              A +ILVAG HA++IG QCGGWTI+WQG  GNIT GTTIL AIK TVD  T V+++E PD
Sbjct  430   NAPKILVAGRHANDIGLQCGGWTIKWQGEIGNITAGTTILEAIKATVDPTTDVVYKEKPD  489

Query  1680  PEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPV  1859
               FVK++ FS+AIVVVGE  YAE +GD+ NLT+P PGPS+I +VC   KCVVV+I+GRP+
Sbjct  490   ATFVKNNDFSYAIVVVGETPYAETAGDNLNLTLPAPGPSMIKHVCGVVKCVVVIISGRPL  549

Query  1860  VIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VI+P+L  +DA+VAAWLPG+EGQGV+DVLFGDYGF+GKLP TWFK+VDQ
Sbjct  550   VIEPFLGSMDAVVAAWLPGSEGQGVSDVLFGDYGFTGKLPRTWFKSVDQ  598



>ref|XP_008446716.1| PREDICTED: lysosomal beta glucosidase isoform X1 [Cucumis melo]
Length=777

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/603 (68%), Positives = 491/603 (81%), Gaps = 6/603 (1%)
 Frame = +3

Query  216   KGSRFLIGVALLCC-----WVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQ  380
             K ++  + V ++ C     W  + +A+ + YKD +QPVG R+KDLL RMTL+EKIGQMVQ
Sbjct  119   KMAKIFVQVVVILCLGWLWWATMVDAENLKYKDPKQPVGVRVKDLLGRMTLEEKIGQMVQ  178

Query  381   IERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGI  560
             I+R VA+A VMK Y++GS+LS GGSVP P A AE WVDM+N FQKGSLS+RLGIPM YGI
Sbjct  179   IDRSVANATVMKDYFIGSILSGGGSVPLPDARAEDWVDMINDFQKGSLSSRLGIPMFYGI  238

Query  561   DAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDP  740
             DAVHG+NN YNAT+FPHNVGLGATR+P+L R IGAATALEVRATGI Y FAPC+AVCRDP
Sbjct  239   DAVHGHNNVYNATVFPHNVGLGATRNPDLARRIGAATALEVRATGISYTFAPCLAVCRDP  298

Query  741   RWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGT  920
             RWGRCYESYSEDP+IV+ MTEII GLQGE P NY    P+V G +KV ACAKH+VGDGGT
Sbjct  299   RWGRCYESYSEDPKIVKEMTEIIIGLQGEPPANYRKGTPYVGGTKKVIACAKHFVGDGGT  358

Query  921   VKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKK  1100
               GI+ENNT+++ H L SIHM  Y +SII+GV++VMASYSS NGV+MHANR++IT FLK 
Sbjct  359   THGINENNTVINRHGLLSIHMPAYLDSIIKGVSSVMASYSSWNGVKMHANRELITDFLKG  418

Query  1101  TLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKN  1280
              L+F+GFVISD++ +D +T T H NYTYS+  +I AGIDMVM+PY Y EFID L +LVK+
Sbjct  419   ALKFKGFVISDWEGLDRITSTPHSNYTYSVQAAILAGIDMVMIPYKYAEFIDDLKFLVKS  478

Query  1281  KFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKN  1460
               +P+ RIDDAV RIL VKF MGLFE P+ DYSL + LGS+ HR LAR AVR+SLVLLKN
Sbjct  479   NVIPMDRIDDAVGRILTVKFTMGLFESPMADYSLVNELGSQAHRDLARDAVRQSLVLLKN  538

Query  1461  GANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNT  1637
             G N  +P+LPL KK+ +ILVAGTHADN+GYQCGGWTI WQG SGN  T GTTIL AIK+T
Sbjct  539   GKNDSKPLLPLSKKSPKILVAGTHADNLGYQCGGWTIAWQGFSGNNGTRGTTILAAIKST  598

Query  1638  VDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCP  1817
             VD  T+V+F E+PD +FVKS+ FS+AIVV+GE  YAE  GDS+ LT+ +PGP+II NVC 
Sbjct  599   VDPSTEVVFREDPDSDFVKSNDFSYAIVVIGEAPYAETGGDSTTLTMLDPGPNIIKNVCD  658

Query  1818  HTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKT  1997
             H +CVV+LI+GRP+VI+PY+  IDALVAAWLPGTEGQGV D L+GD+GFSGKLP TWFK+
Sbjct  659   HVECVVILISGRPIVIEPYISSIDALVAAWLPGTEGQGVTDALYGDHGFSGKLPRTWFKS  718

Query  1998  VDQ  2006
             VDQ
Sbjct  719   VDQ  721


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  267  VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMK  416
            + +AD + Y+D RQPV  R+KDLL  MTL+EKI QM QI+R VA+A V K
Sbjct  1    MVDADSLKYEDPRQPVFVRVKDLLGPMTLEEKISQMAQIDRSVANATVTK  50



>dbj|BAA33065.1| beta-D-glucan exohydrolase [Nicotiana tabacum]
Length=628

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/600 (70%), Positives = 502/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S  ++G  +LC W VVA  +Y+ YKD +QPVG RIKDL+ RMTL+EKIGQM QIER
Sbjct  1     MGRMSIPMMGFVVLCLWAVVAEGEYVKYKDPKQPVGARIKDLMKRMTLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VA+A VMK+ ++GSVLS GGSVP P+ASA+ W +MV+  QKGSLSTRLGIPMIYGIDAV
Sbjct  61    KVATADVMKQNFIGSVLSGGGSVPAPKASAQVWTNMVDEIQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDP+LV+ IGAATALEVRATGI Y FAPCIAVCR+PRWG
Sbjct  121   HGHNNVYGATIFPHNVGLGVTRDPDLVKRIGAATALEVRATGIPYAFAPCIAVCRNPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IVR+MTEIIPGLQG+ P       P+V G+ KVAACAKH+VGDGGT+ G
Sbjct  181   RCYESYSEDHRIVRSMTEIIPGLQGDLPAKSKNGVPYVGGKTKVAACAKHFVGDGGTLHG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             +DE+NT++ ++ LFSIHM  YY+S+ +GVATVM SYSS NG +MHANRD++TGFLK  L+
Sbjct  241   VDESNTVISSNSLFSIHMPAYYDSLRKGVATVMVSYSSWNGRKMHANRDLVTGFLKDKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+   I AGIDM+MVP NY EFID LT  VK   +
Sbjct  301   FRGFVISDWQGIDRITDPPHANYSYSVQAGIMAGIDMIMVPENYREFIDTLTSQVKANII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+P+ D SLA+ LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFENPMSDPSLANQLGSQEHRELAREAVRKSLVLLKNGKT  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
               +P+LPL KKA +ILVAGTHADN+GYQCGGWTIEWQG++GN +TIGTTILTAIK TVD 
Sbjct  421   PSQPLLPLPKKAPKILVAGTHADNLGYQCGGWTIEWQGVAGNDLTIGTTILTAIKKTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++++NPD  FVKS+KFS+AIVVVGE  YAE  GDSSNLTI EPGPS I+N+C   K
Sbjct  481   STQVVYQQNPDANFVKSNKFSYAIVVVGEVPYAEMFGDSSNLTIAEPGPSTISNICGSVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRPVV++PY+ ++DALVAAWLPGTEGQGVAD LFGDYGF+GKL  TWFK VDQ
Sbjct  541   CVVVVVSGRPVVLEPYVSKMDALVAAWLPGTEGQGVADALFGDYGFTGKLARTWFKRVDQ  600



>ref|XP_006424026.1| hypothetical protein CICLE_v10030270mg [Citrus clementina]
 gb|ESR37266.1| hypothetical protein CICLE_v10030270mg [Citrus clementina]
Length=631

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/595 (69%), Positives = 492/595 (83%), Gaps = 4/595 (1%)
 Frame = +3

Query  234   IGVALLCCWVVVANAD---YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASA  404
             +G  LLCC     +A    YM ++D +QP+ +RI+DL++RMTL+EKIGQMVQ++R  A+A
Sbjct  9     LGFLLLCCMAFAIHASDPGYMKFRDPQQPLSKRIRDLMNRMTLEEKIGQMVQLDRAAATA  68

Query  405   QVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNN  584
             ++M+ Y +GS+LS GGSVP+ +A+ + W+ MVN FQKGSLS+RLGIPMIYGIDAVHG+NN
Sbjct  69    EIMRDYSIGSLLSGGGSVPRLQATPQEWIGMVNDFQKGSLSSRLGIPMIYGIDAVHGHNN  128

Query  585   AYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYES  764
              Y ATIFPHNVGLGATRDP+LVR IGAATALEVRATGI Y FAPCIAVCRDPRWGRC+ES
Sbjct  129   VYKATIFPHNVGLGATRDPDLVRRIGAATALEVRATGINYAFAPCIAVCRDPRWGRCFES  188

Query  765   YSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENN  944
             YSEDP+IV+ MTEIIPGLQG+ P + P   P+VAGR+KVAACAKHYVGDGGT +GI+ENN
Sbjct  189   YSEDPKIVKLMTEIIPGLQGDIPSDLPKGIPYVAGRDKVAACAKHYVGDGGTTRGINENN  248

Query  945   TLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFV  1124
             T++D H L SIHM  Y ++II+GV+TVM SYSS NG++MHANRD++T FLK TL+FRGFV
Sbjct  249   TVIDRHGLMSIHMPAYNDAIIKGVSTVMVSYSSWNGLKMHANRDLVTNFLKGTLKFRGFV  308

Query  1125  ISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRI  1304
             ISD++ ID +T   H NY+YS+L  +NAGIDM M+P+N+T+FID LT  V+ K VP+SRI
Sbjct  309   ISDWQGIDRITTPEHANYSYSVLAGVNAGIDMFMLPFNHTDFIDILTDFVERKIVPMSRI  368

Query  1305  DDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPV  1484
             DDAV+RILRVKF MGLFE P+ D +    LGS+ HR LAR+AVRKSLVLLKNG NAD   
Sbjct  369   DDAVRRILRVKFTMGLFEKPMADQTFIDKLGSQAHRDLAREAVRKSLVLLKNGENADGAA  428

Query  1485  LPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVM  1661
             LPL K A+RILVAGTHA+N+GYQCGGWTI WQGLSG N T+GTTIL  I  TVD+ T+++
Sbjct  429   LPLPKNAARILVAGTHANNLGYQCGGWTIAWQGLSGNNNTVGTTILNGISATVDSDTEII  488

Query  1662  FEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVL  1841
             F ENP  ++VK+S  S+AIVVVGE+ YAE  GDS NLTI EPGPS + NVC   KCVVVL
Sbjct  489   FSENPSMDYVKASNVSYAIVVVGEQPYAETQGDSLNLTISEPGPSTLTNVCAAVKCVVVL  548

Query  1842  ITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ++GRPV + PYLPQ+DALVAAWLPGTEGQGVADVLFGDYGF+G+LP TWFKTVDQ
Sbjct  549   VSGRPVTVGPYLPQVDALVAAWLPGTEGQGVADVLFGDYGFTGRLPRTWFKTVDQ  603



>ref|XP_004242118.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum]
Length=628

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/588 (69%), Positives = 478/588 (81%), Gaps = 1/588 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             L C WVV A A+Y+ YKD +Q +  RIKDL+ RMTL+EKIGQM QIER+ AS  VMK+Y+
Sbjct  13    LFCLWVVSAEAEYLKYKDPKQSMSTRIKDLMKRMTLEEKIGQMSQIERRFASTDVMKQYF  72

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GSVLS  G  P   A+AE W++MVN  QK +LSTRLGIPMIYGIDA+HG+NN YNATIF
Sbjct  73    IGSVLSVPGDTPGLNAAAEDWINMVNDIQKAALSTRLGIPMIYGIDAIHGHNNVYNATIF  132

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHN+GLG TRDP+L++ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSED  +
Sbjct  133   PHNIGLGVTRDPDLLKRIGAATALEVRATGIPYAFAPCIAVCRDPRWGRCYESYSEDINV  192

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             VR MTEIIPGLQG+ P N     PFVAG+ KVAACAKHYV DGGT +GIDENNT+++   
Sbjct  193   VRTMTEIIPGLQGDVPANSSKGVPFVAGKSKVAACAKHYVADGGTERGIDENNTVINRTS  252

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             L+SIHM  YY+SII+GV+TVM SYSSLNG +MH NRD++T FLK  L+FRGF+ISD + +
Sbjct  253   LYSIHMPAYYDSIIKGVSTVMISYSSLNGEKMHTNRDLVTHFLKDNLKFRGFIISDSEGL  312

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T     NYTYS+   I AGIDMVM+P NY EFI  LT LVK+  +P+SRIDDAV+RI
Sbjct  313   DRITSPPDANYTYSVQAGILAGIDMVMIPNNYAEFIGNLTLLVKDNIIPMSRIDDAVERI  372

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LRVKF++ LFEDPL D SL + LGS++HR+LAR+AVRKSLVLLKNG    +P+LPL KKA
Sbjct  373   LRVKFILDLFEDPLADLSLVNQLGSQEHRELAREAVRKSLVLLKNGKITSQPLLPLPKKA  432

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDP  1682
              +ILVAGTHADN+GYQCGGWT +WQG+SG N  +GTTIL+AIK TV+  TQV+++ NPD 
Sbjct  433   PKILVAGTHADNLGYQCGGWTNQWQGVSGNNFIVGTTILSAIKKTVNPSTQVVYQLNPDA  492

Query  1683  EFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVV  1862
              FVKS+KF +AIVVVGE  YAE  GDSSNLTIPEPG S I NVC    CVVV+I+GRPVV
Sbjct  493   NFVKSNKFDYAIVVVGEVPYAEMLGDSSNLTIPEPGSSTINNVCGAVTCVVVIISGRPVV  552

Query  1863  IQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ++PY+ +ID LVAAWLPGTEGQGVADVLFG+YGF+GKL  TWFK+VDQ
Sbjct  553   LEPYVDKIDGLVAAWLPGTEGQGVADVLFGNYGFTGKLARTWFKSVDQ  600



>ref|XP_004970125.1| PREDICTED: lysosomal beta glucosidase-like [Setaria italica]
Length=669

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/587 (70%), Positives = 481/587 (82%), Gaps = 0/587 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             LL C+  + NA+YM YKD +QP+  RIKDL+ RMTL EKIGQM QIERQVASA VMKKY+
Sbjct  12    LLLCFASIGNAEYMKYKDPKQPINTRIKDLIGRMTLAEKIGQMTQIERQVASADVMKKYF  71

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GS+LS GGSVP P+AS   WV MVN FQKG+LSTRLGIPMIYGIDAVHGNNN YNAT+F
Sbjct  72    IGSILSGGGSVPAPQASPSIWVSMVNEFQKGALSTRLGIPMIYGIDAVHGNNNVYNATLF  131

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHNVGLGATRDP+L++ IG ATALEVRATGIQY FAPCIAVCRDPRWGRCYESYSED  +
Sbjct  132   PHNVGLGATRDPDLIKRIGEATALEVRATGIQYTFAPCIAVCRDPRWGRCYESYSEDHTV  191

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             V+ MT+II GLQGE P N+    P+VAG++KVAACAKH+VGDGGT  GI+ENNT++D H 
Sbjct  192   VQQMTDIILGLQGEIPVNHTKGVPYVAGKDKVAACAKHFVGDGGTHNGINENNTIIDEHG  251

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             L SIHM  YY+SII+GVAT+M SYSSLNGV+MHAN D++TG+LK  L FRGFVISD+  I
Sbjct  252   LLSIHMPPYYDSIIKGVATIMVSYSSLNGVKMHANHDLVTGYLKSKLHFRGFVISDWLGI  311

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T     NYTYS+   INAGIDMVMVPYNYT++ID LT LV    V ++RIDDAV+RI
Sbjct  312   DRITSPPGENYTYSVQAGINAGIDMVMVPYNYTDYIDDLTSLVHKGIVNMNRIDDAVRRI  371

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LRVKF MGLFE+PL D S A  LG ++HR+LAR+AVRKSLVLLKNG   ++  LPL KKA
Sbjct  372   LRVKFTMGLFENPLADLSFADQLGKKEHRELAREAVRKSLVLLKNGNPPNQQFLPLPKKA  431

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPE  1685
              RILVAG+HA N+GYQCGGW+I+W G SG+IT GTTIL AIK+TV   T V++ ENPD  
Sbjct  432   RRILVAGSHASNLGYQCGGWSIQWMGSSGDITTGTTILDAIKSTVADSTPVVYSENPDES  491

Query  1686  FVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVI  1865
             F+K + FS AIVVVGE  Y+E  GDS++LTI +PGP  I  VC   KCVVV+++GRPVVI
Sbjct  492   FMKHNDFSFAIVVVGEPPYSETVGDSTDLTILDPGPDTIRTVCSAVKCVVVIVSGRPVVI  551

Query  1866  QPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +PY+P ++ALVAAWLPGTEGQGVADVLFGDYGF+GKLP TWFK+VDQ
Sbjct  552   EPYVPLMEALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTWFKSVDQ  598



>ref|XP_004306422.1| PREDICTED: lysosomal beta glucosidase-like [Fragaria vesca subsp. 
vesca]
Length=659

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/600 (68%), Positives = 485/600 (81%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M + S  L+    +  W     A+Y+ YKD  Q    R+ DL++RMTL+EKIGQMVQI+R
Sbjct  1     MARVSLSLLVAMFVVLWWWEVKAEYVKYKDPNQQPAARVADLVARMTLQEKIGQMVQIDR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+   MK Y++GSVLS GGS P P ASAE WV+M+NGFQKGSL++RLGIPMIYGIDAV
Sbjct  61    SVANFDTMKTYFIGSVLSGGGSAPLPEASAEDWVNMINGFQKGSLASRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHN+GLGATRDPEL + IG+ATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNIGLGATRDPELAKRIGSATALEVRATGIPYAFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IV+AMTEIIPGLQG+ P N    FP+V G +KVAACAKH+VGDGGT++G
Sbjct  181   RCYESYSEDHRIVQAMTEIIPGLQGDIPANSRKGFPYVGGNKKVAACAKHFVGDGGTIRG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT+ D HDL SIHM  Y +SII+GV+TVM SYSS NG +MHANRD++TGFLK TL+
Sbjct  241   INENNTITDRHDLLSIHMPAYSDSIIKGVSTVMISYSSWNGEKMHANRDLVTGFLKDTLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISD++ ID +T   H NYTYS+  SI AGIDMVMVP NY EFI+ LTYLVKN  +
Sbjct  301   FKGFVISDWEGIDRITSPPHSNYTYSVQASILAGIDMVMVPVNYKEFINDLTYLVKNNVI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+ RIDDAV RIL VKF MGLFE+P GD SL + LGS+ HR LAR+AVRKSLVLLKNG N
Sbjct  361   PMDRIDDAVGRILLVKFTMGLFENPFGDLSLVNELGSQAHRDLAREAVRKSLVLLKNGKN  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
                PVLPL KK  +ILVAG+HADN+GYQCGGWT+ WQG SG N T GTTIL AIK+TVD+
Sbjct  421   GTIPVLPLPKKVPKILVAGSHADNLGYQCGGWTMAWQGFSGNNKTRGTTILGAIKSTVDS  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V++ ENPD + VKS+ F +AIVVVGE  YAE  GDS NLT+ +PGPS+I +VC   K
Sbjct  481   STEVVYLENPDSDSVKSNNFEYAIVVVGEHPYAETDGDSMNLTMADPGPSVITSVCEAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             C+V++I+GRPVVI+PY+  IDALVAAWLPGTEGQG+ DVL+G++GFSGKLP TWF++VDQ
Sbjct  541   CIVIIISGRPVVIEPYVSSIDALVAAWLPGTEGQGITDVLYGEHGFSGKLPRTWFRSVDQ  600



>gb|KHG09998.1| Lysosomal beta glucosidase [Gossypium arboreum]
Length=686

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/594 (68%), Positives = 487/594 (82%), Gaps = 2/594 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVA-NADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQ  407
             L+ + +   W+ +A  A+Y+ YKD +QPV  RIKDL+S+MTL EKIGQM QI+R VA+ Q
Sbjct  5     LVKLVVWISWLAMAVGAEYVKYKDPKQPVAARIKDLMSKMTLAEKIGQMAQIDRSVATEQ  64

Query  408   VMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNA  587
             +++ Y +GSVLS GGS P P A AE W++MVN FQ GSLS+RLGIPMIYGIDA+HG+NN 
Sbjct  65    ILRDYSVGSVLSGGGSEPLPEAKAEDWINMVNAFQNGSLSSRLGIPMIYGIDAIHGHNNV  124

Query  588   YNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESY  767
             YNATIFPHNVGLGAT DPELV++IGAATALEVRATGI YVFAPCIAVCRDPRWGRCYESY
Sbjct  125   YNATIFPHNVGLGATGDPELVKKIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYESY  184

Query  768   SEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNT  947
             SED ++V  MT+II GLQG+ P  +    P+V G+ KVAACAKH+VGDGGT +GI+ENNT
Sbjct  185   SEDHKVVEQMTDIILGLQGDPPSTWRKGVPYVGGKAKVAACAKHFVGDGGTTRGINENNT  244

Query  948   LVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVI  1127
             ++D H L S++M  Y  SII+GV+TVM SYSS NG +MHANR++I+GFLK TL+F+GFVI
Sbjct  245   VIDMHGLLSMYMPAYSQSIIKGVSTVMVSYSSWNGQKMHANRELISGFLKNTLKFKGFVI  304

Query  1128  SDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRID  1307
             SD++ ID +T   H NYTYS+  +I AGIDMVMVP+N TEF+D LTYLV +K +P+ RID
Sbjct  305   SDWQGIDRITSPPHANYTYSVQAAIQAGIDMVMVPFNLTEFVDDLTYLVDSKVIPMDRID  364

Query  1308  DAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVL  1487
             DAV+RIL+VKF MGLFE P+ D+SL + LGS+ HR LAR+AVRKSLVLLKNG     P+L
Sbjct  365   DAVQRILQVKFTMGLFETPMADFSLVNELGSQAHRDLAREAVRKSLVLLKNGKPGSTPLL  424

Query  1488  PLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMF  1664
             PL KKAS+ILVAGTHADN+GYQCGGWTI WQG +G N T GTTIL AIK+TVD  T+++F
Sbjct  425   PLPKKASKILVAGTHADNLGYQCGGWTINWQGFNGNNSTRGTTILGAIKSTVDQSTEIVF  484

Query  1665  EENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLI  1844
              E+PD  FVKS+KF +AIVVVGE  YAE +GDS+NLT+ +PGPS I NVC   KCVVV+I
Sbjct  485   RESPDANFVKSNKFDYAIVVVGEPPYAETAGDSTNLTMIDPGPSAINNVCGTVKCVVVII  544

Query  1845  TGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +GRP+VI+PY+  IDALVAAWLPGTEGQGV DVL+GDY FSGKLP TWFKTVDQ
Sbjct  545   SGRPIVIEPYVSAIDALVAAWLPGTEGQGVTDVLYGDYRFSGKLPRTWFKTVDQ  598



>ref|XP_006826367.1| hypothetical protein AMTR_s00004p00129620 [Amborella trichopoda]
 gb|ERM93604.1| hypothetical protein AMTR_s00004p00129620 [Amborella trichopoda]
Length=605

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/573 (71%), Positives = 478/573 (83%), Gaps = 3/573 (1%)
 Frame = +3

Query  288   LYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpkp  467
             +YKD +  + +RI DL+S+MTL EKIGQM QIERQVA+  VMK+Y +GS+LS GGSVP P
Sbjct  9     VYKDPKASLNKRIHDLMSQMTLAEKIGQMTQIERQVANYSVMKEYAIGSILSGGGSVPSP  68

Query  468   RASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPEL  647
             +ASA  WV+MVN FQ+G+L++RL IPMIYGIDAVHG+NN Y +TIFPHNVGLG TRDP+L
Sbjct  69    QASAAVWVNMVNEFQRGALASRLQIPMIYGIDAVHGHNNVYGSTIFPHNVGLGVTRDPDL  128

Query  648   VREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGE  827
             ++ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSEDPEIV AMTEIIPGLQG+
Sbjct  129   LKRIGAATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDPEIVEAMTEIIPGLQGD  188

Query  828   APPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSII  1007
             AP       PFVAG+ KVAACAKH+VGDGGT  GI+ENNT++D H L +IHMAGYY++II
Sbjct  189   APKK---GVPFVAGKTKVAACAKHFVGDGGTHNGINENNTIIDRHGLLAIHMAGYYHAII  245

Query  1008  RGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYS  1187
             +GV+TVM SYSS NG +MHANRD++T FLKKTL FRGFVISD++ ID +T     NY YS
Sbjct  246   KGVSTVMVSYSSWNGEKMHANRDLVTNFLKKTLHFRGFVISDWQGIDRITSPAGSNYPYS  305

Query  1188  ILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPL  1367
             +   +NAGIDM+MVPYN+TEFI+ LT  V +K +P+SRIDDAV+RILRVKF MGLFE+PL
Sbjct  306   VHAGVNAGIDMIMVPYNFTEFINDLTEQVNSKSIPMSRIDDAVRRILRVKFQMGLFENPL  365

Query  1368  GDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNIG  1547
              D SLA  LGS++HR+LAR+AVRKSLVLLKNG   D+P+LPL KKA +ILVAGTHADN+G
Sbjct  366   ADLSLADQLGSQEHRELAREAVRKSLVLLKNGKEGDKPLLPLDKKAPKILVAGTHADNLG  425

Query  1548  YQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVV  1727
             YQCGGWTI+WQG SGN T GTTILTAIK+TV   TQV+FEENP    +K   + +A+VVV
Sbjct  426   YQCGGWTIQWQGQSGNTTKGTTILTAIKSTVSPSTQVVFEENPSASSLKGQDYDYAVVVV  485

Query  1728  GEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAW  1907
             GE  YAE +GDS NLT+PEPGP+II NVC   KCVVV+I+GRP+V+QP+L  IDALVAAW
Sbjct  486   GETPYAETNGDSMNLTMPEPGPTIIKNVCGSVKCVVVVISGRPIVLQPFLQYIDALVAAW  545

Query  1908  LPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             LPGTEGQGVAD LFGDY F+GKL  TWFK+VDQ
Sbjct  546   LPGTEGQGVADNLFGDYPFTGKLARTWFKSVDQ  578



>ref|XP_008375543.1| PREDICTED: lysosomal beta glucosidase [Malus domestica]
Length=658

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/597 (69%), Positives = 484/597 (81%), Gaps = 5/597 (1%)
 Frame = +3

Query  231   LIGVALLCCWV--VVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASA  404
             L+G+ L+  W+  V   ADY+ YKD  QP   R+ DLLSRMTL+EKIGQMVQI+R VAS 
Sbjct  8     LVGLLLVWWWMGFVTVKADYIKYKDPSQPPAARVGDLLSRMTLEEKIGQMVQIDRSVASV  67

Query  405   QVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNN  584
               MK Y +GSVLS GGS P P ASAE WV+M+N FQKG+LS+RLGIPMIYGIDAVHG+NN
Sbjct  68    DTMKTYSIGSVLSGGGSAPLPEASAEDWVNMINEFQKGALSSRLGIPMIYGIDAVHGHNN  127

Query  585   AYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYES  764
              YNATIFPHNVGLGATRDP+LVR IG+ATALE RATGI YVFAPCIAVCRDPRWGRCYES
Sbjct  128   VYNATIFPHNVGLGATRDPDLVRRIGSATALEARATGIPYVFAPCIAVCRDPRWGRCYES  187

Query  765   YSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENN  944
             YSED +IV  MTEIIPGLQG+ P N     P+V G++KVAACAKH+VGDGGT +GI+ENN
Sbjct  188   YSEDHKIVEEMTEIIPGLQGDIPANSRKGVPYVGGKKKVAACAKHFVGDGGTSRGINENN  247

Query  945   TLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFV  1124
             T+ D H+L SIHM  Y +SII+GV+TVM SYSS NG +MHANRD+IT FLK TL+F+GFV
Sbjct  248   TVTDRHELLSIHMPAYSDSIIKGVSTVMISYSSWNGDKMHANRDLITNFLKGTLKFKGFV  307

Query  1125  ISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRI  1304
             ISD++ ID +T   H NYTYS+  S+ AGIDMVMVP+NY EFI+ L  LVK   VP+ RI
Sbjct  308   ISDWEGIDRITSPPHSNYTYSVQASVLAGIDMVMVPFNYKEFINDLINLVKTNVVPMDRI  367

Query  1305  DDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG--ANADE  1478
             DDAV RIL VKF MGLFE+PL D SL + LGS+ HR LAR+AVRKSLVLLKNG   N  +
Sbjct  368   DDAVGRILLVKFTMGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVLLKNGKSKNNTD  427

Query  1479  PVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQ  1655
             PV+PL KK S+ILVAG+HADN+GYQCGGWT+ WQG SG N T GTTIL AI +TVD+ T+
Sbjct  428   PVIPLPKKVSKILVAGSHADNLGYQCGGWTMAWQGFSGNNYTSGTTILGAINSTVDSSTE  487

Query  1656  VMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVV  1835
             V++ ENPD  FVKS+ F++AIVVVGE  YAE  GDS+NLT+ E GPS+I+NVC   KC+V
Sbjct  488   VVYRENPDGNFVKSNNFAYAIVVVGEHPYAETLGDSTNLTMAEXGPSVISNVCESVKCIV  547

Query  1836  VLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +LITGRP+VI+PY+  IDALVAAWLPG+EGQG+ DVLFGD+GFSGKL  TWF+TVDQ
Sbjct  548   ILITGRPIVIEPYISSIDALVAAWLPGSEGQGITDVLFGDHGFSGKLARTWFRTVDQ  604



>ref|XP_008230855.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=632

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/598 (67%), Positives = 487/598 (81%), Gaps = 3/598 (1%)
 Frame = +3

Query  222   SRFLIGVALLCCWVVVANA--DYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQV  395
             S  L+G+  L CW  +A A  +YM YKD +QP+ RRIKDL+ RM L+EKIGQM Q++R  
Sbjct  7     SVLLVGLLWLYCWGAMAQAGEEYMAYKDPKQPLNRRIKDLMGRMMLEEKIGQMTQLDRAN  66

Query  396   ASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHG  575
              +A++M+ + LGSVLS GGSVP+ +AS + W++M N FQKG+LS+RLGIPMIYGIDAVHG
Sbjct  67    VTAEIMRDFSLGSVLSGGGSVPREQASPQDWINMFNEFQKGALSSRLGIPMIYGIDAVHG  126

Query  576   NNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRC  755
             +NN Y ATIFPHNVGLGATRDPELV++IGAATALEVRATGI Y FAPCIAVCRDPRWGRC
Sbjct  127   HNNVYKATIFPHNVGLGATRDPELVKKIGAATALEVRATGINYAFAPCIAVCRDPRWGRC  186

Query  756   YESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGID  935
             YESYSEDP +V  MT++I GLQGE P       P+V G++KVAACAKH+VGDGGT +GI+
Sbjct  187   YESYSEDPAVVIQMTDVILGLQGEIPAGSRKGVPYVGGKDKVAACAKHFVGDGGTTRGIN  246

Query  936   ENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFR  1115
             ENNT++D H L SIHM  YY+SII+GV+T+M SYSSLNG +MHA+ +++T FLK TL+FR
Sbjct  247   ENNTVIDRHGLLSIHMPAYYHSIIKGVSTIMVSYSSLNGKKMHAHHELVTKFLKDTLKFR  306

Query  1116  GFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPV  1295
             GFVISD++ +D +   +H NY  ++L  + AGIDMVMVP+N+TEFI  +T  V NK +P+
Sbjct  307   GFVISDWQGVDKINYPLHSNYPEAVLAGVQAGIDMVMVPFNHTEFIGIVTDHVNNKRIPM  366

Query  1296  SRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD  1475
             SRIDDAV+RILRVKFVMGLFE+PL D S    LGS+ HR LAR+AVRKSLVLLKNG NAD
Sbjct  367   SRIDDAVRRILRVKFVMGLFENPLADESFVDKLGSQAHRDLAREAVRKSLVLLKNGENAD  426

Query  1476  EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKT  1652
              PVLPL KK  RILVAGTHA+N+GYQCGGW++ WQG+SG N T GTTIL+AI   VD  T
Sbjct  427   TPVLPLPKKTKRILVAGTHANNLGYQCGGWSLTWQGVSGNNYTAGTTILSAITAAVDPST  486

Query  1653  QVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCV  1832
             +++F ENPD +F+KS+ FS+AIVVVGE+ YAE  GDS NLTI EPGP  I NVC   KCV
Sbjct  487   EIVFSENPDADFLKSNNFSYAIVVVGEQPYAETKGDSLNLTIAEPGPQTITNVCGEVKCV  546

Query  1833  VVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VV+I+GRP+VI+PY+  +DALVAAWLPGTEGQGV+DVLFGDYGFSGKLP TWFKTVDQ
Sbjct  547   VVVISGRPLVIEPYVSSMDALVAAWLPGTEGQGVSDVLFGDYGFSGKLPRTWFKTVDQ  604



>ref|XP_009620993.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
 ref|XP_009620994.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
 ref|XP_009620995.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
 ref|XP_009620996.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
 ref|XP_009620997.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=628

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/600 (70%), Positives = 502/600 (84%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S  ++G  +LC W VVA  +Y+ YKD +QPVG RIKDL+ RMTL+EKIGQM QIER
Sbjct  1     MGRMSIPMMGFVVLCLWAVVAEGEYVKYKDPKQPVGARIKDLMKRMTLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             +VA+A VMK+ ++GSVLS GGSVP P+ASA+ W +MV+  QKGSLSTRLGIPMIYGIDAV
Sbjct  61    KVATADVMKQNFIGSVLSGGGSVPAPKASAQVWTNMVDEIQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDP+LV+ IGAATALEVRATGI Y FAPCIAVCR+PRWG
Sbjct  121   HGHNNVYGATIFPHNVGLGVTRDPDLVKRIGAATALEVRATGIPYAFAPCIAVCRNPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IVR+MTEIIPGLQG+ P       P+V G+ KVAACAKH+VGDGGT++G
Sbjct  181   RCYESYSEDHRIVRSMTEIIPGLQGDLPAKSKNGVPYVGGKTKVAACAKHFVGDGGTLQG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             +DE+NT++ ++ LFSIHM  YY+S+ +GVATVM SYSS NG +MHANRD++TGFLK  L+
Sbjct  241   VDESNTVISSNSLFSIHMPAYYDSLRKGVATVMVSYSSWNGRKMHANRDLVTGFLKDKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ +D +T   H NY+YS+   I AGIDM+MVP NY EFID LT  VK   +
Sbjct  301   FRGFVISDWQGLDRITDPPHANYSYSVQAGIMAGIDMIMVPENYREFIDTLTSQVKANII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+P+ D SLA+ LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFENPMSDPSLANQLGSKEHRELAREAVRKSLVLLKNGKT  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
               +P+LPL KKA +ILV GTHADN+GYQCGGWTIEWQG++GN +T+GTTILTAIK TVD 
Sbjct  421   PSQPLLPLPKKAPKILVTGTHADNLGYQCGGWTIEWQGVAGNDLTVGTTILTAIKKTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++++NPD  FVKS+KFS+AIVVVGE  YAE  GDSSNLTI EPGPS I+NVC   K
Sbjct  481   STQVVYQQNPDANFVKSNKFSYAIVVVGEVPYAEMFGDSSNLTIAEPGPSTISNVCGAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRPVV++PY+ ++DALVAAWLPGTEGQGVAD LFGDYGF+GKL  TWFK VDQ
Sbjct  541   CVVVVVSGRPVVMEPYVSKMDALVAAWLPGTEGQGVADALFGDYGFTGKLARTWFKRVDQ  600



>ref|XP_002271545.1| PREDICTED: lysosomal beta glucosidase [Vitis vinifera]
Length=627

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/574 (71%), Positives = 471/574 (82%), Gaps = 1/574 (0%)
 Frame = +3

Query  288   LYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpkp  467
             +YKD  QP+  RIKDL+ RM+L EKIGQM QI+R VA+ ++MK++ +GS+LS GGSVP P
Sbjct  26    IYKDPTQPIYMRIKDLMGRMSLAEKIGQMTQIDRSVATPEIMKEFSIGSLLSGGGSVPLP  85

Query  468   RASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPEL  647
             +A+AE W+ MVN FQKGSLS+RLGIPMIYGIDAVHG+N+ Y ATIFPHNVGLGATRDPEL
Sbjct  86    QATAEDWIHMVNDFQKGSLSSRLGIPMIYGIDAVHGHNSVYKATIFPHNVGLGATRDPEL  145

Query  648   VREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGE  827
             V+ IGAATALEVRATGIQY FAPCIAVCRDPRWGRCYESYSEDP+IV+AMT II GLQGE
Sbjct  146   VKRIGAATALEVRATGIQYAFAPCIAVCRDPRWGRCYESYSEDPKIVKAMTTIITGLQGE  205

Query  828   APPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSII  1007
              P N     P+V G+ KVAACAKH+VGDGGT  GI+ENNT++D   L  IHM  Y+ SI 
Sbjct  206   IPTNSRAGMPYVGGKNKVAACAKHFVGDGGTTHGINENNTVIDWKGLMKIHMPAYHPSIG  265

Query  1008  RGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYS  1187
             RGVATVM SYSS NG +MHAN  +ITGFLK  L+F+GFVISD++ ID +T   H NYTYS
Sbjct  266   RGVATVMVSYSSWNGKKMHANHQLITGFLKNNLKFKGFVISDWEGIDRITSPPHANYTYS  325

Query  1188  ILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPL  1367
             +   I AGIDMVMVP+N+ EFI  LT LV++K +P+SRIDDAV RILRVKF MGLFE+PL
Sbjct  326   VQAGIQAGIDMVMVPFNHIEFIGILTKLVESKVIPMSRIDDAVSRILRVKFTMGLFENPL  385

Query  1368  GDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNIG  1547
              D SL   LGS+ HR LAR+AVRKS+VLLKNG  AD P+LP  KKA RILVAGTHADN+G
Sbjct  386   ADLSLVDQLGSQAHRDLAREAVRKSMVLLKNGETADAPLLPFPKKADRILVAGTHADNLG  445

Query  1548  YQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVV  1724
             YQCGGWTI WQGL G N T GTTIL+AI   +D  T++++ ENPD EFVKS  FS+AIVV
Sbjct  446   YQCGGWTITWQGLDGNNHTQGTTILSAISAAIDPSTELVYRENPDAEFVKSGNFSYAIVV  505

Query  1725  VGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAA  1904
             VGE  YAE +GD+SNLTIPEPGPS I NVC   KCVVV+I+GRP+VIQPYLP I ALVAA
Sbjct  506   VGEHPYAETAGDNSNLTIPEPGPSTITNVCGGIKCVVVVISGRPLVIQPYLPSISALVAA  565

Query  1905  WLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             WLPG+EGQGVADVLFGDYGF+GKLP TWFKTV+Q
Sbjct  566   WLPGSEGQGVADVLFGDYGFTGKLPRTWFKTVEQ  599



>ref|XP_008245228.1| PREDICTED: lysosomal beta glucosidase-like [Prunus mume]
Length=632

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/598 (67%), Positives = 487/598 (81%), Gaps = 3/598 (1%)
 Frame = +3

Query  222   SRFLIGVALLCCWVVVANA--DYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQV  395
             S  L+G+  L CW  +A A  +YM YKD +QP+ RRIKDL+ RM L+EKIGQM Q++R  
Sbjct  7     SVLLVGLLWLYCWGAMAQAGEEYMAYKDPKQPLNRRIKDLMGRMMLEEKIGQMTQLDRAN  66

Query  396   ASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHG  575
              +A++M+ + LGSVLS GGSVP+ +AS + W++M N FQKG+LS+RLGIPMIYGIDAVHG
Sbjct  67    VTAEIMRDFSLGSVLSGGGSVPREQASPQDWINMFNEFQKGALSSRLGIPMIYGIDAVHG  126

Query  576   NNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRC  755
             +NN Y ATIFPHNVGLGATRDPELV++IGAATALEVRATGI Y FAPCIAVCRDPRWGRC
Sbjct  127   HNNVYKATIFPHNVGLGATRDPELVKKIGAATALEVRATGINYAFAPCIAVCRDPRWGRC  186

Query  756   YESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGID  935
             YESYSEDP +V  MT++I GLQGE P       P+V G++KVAACAKH+VGDGGT +GI+
Sbjct  187   YESYSEDPAVVIQMTDVILGLQGEIPAGSRKGVPYVGGKDKVAACAKHFVGDGGTTRGIN  246

Query  936   ENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFR  1115
             ENNT++D H L SIHM  YY+SII+GV+T+M SYSSLNG +MHA+ +++T FLK TL+FR
Sbjct  247   ENNTVIDRHGLLSIHMPAYYHSIIKGVSTIMVSYSSLNGKKMHAHHELVTKFLKDTLKFR  306

Query  1116  GFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPV  1295
             GFVISD++ +D +   +H NY  ++L  + AGIDMVMVP+N+TEFI  +T  V NK +P+
Sbjct  307   GFVISDWQGVDKINYPLHSNYPEAVLAGVQAGIDMVMVPFNHTEFIGIVTDHVNNKRIPM  366

Query  1296  SRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD  1475
             SRIDDAV+RILRVKFVMGLFE+PL D S    LGS+ HR LAR+AVRKSLVLLKNG NAD
Sbjct  367   SRIDDAVRRILRVKFVMGLFENPLADESFVDKLGSQAHRDLAREAVRKSLVLLKNGENAD  426

Query  1476  EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKT  1652
              PVLPL KK  RILVAGTHA+N+GYQCGGW++ WQG+SG N T GTTIL+AI   VD  T
Sbjct  427   TPVLPLPKKTKRILVAGTHANNLGYQCGGWSLTWQGVSGNNYTAGTTILSAITAAVDPST  486

Query  1653  QVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCV  1832
             +++F ENPDP+F+KS+ FS+AI+VVGE+ YAE  G S NLTI EPGP  I NVC   KCV
Sbjct  487   EIVFSENPDPDFLKSNNFSYAIIVVGEQPYAETKGYSLNLTIAEPGPQTITNVCGAVKCV  546

Query  1833  VVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VV+I+GRPVVI+PY+  +DALVAAWLPGTEGQGV+DVLFGDYGFSGKLP TWFKTVDQ
Sbjct  547   VVVISGRPVVIEPYVSSMDALVAAWLPGTEGQGVSDVLFGDYGFSGKLPRTWFKTVDQ  604



>gb|KHG30203.1| Lysosomal beta glucosidase [Gossypium arboreum]
Length=630

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/601 (68%), Positives = 488/601 (81%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANAD-YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MGK S  L+G       V V   D Y  Y D   P+ +RI+DL+ RM+L EKIGQMVQI+
Sbjct  1     MGKTSVLLVGFLFSFLVVTVQAGDKYKKYNDPSLPINKRIRDLMRRMSLDEKIGQMVQID  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R+VA+ +VM+ Y +GS+LS GGSVP  +A+ + W++MVNGFQ GSLSTRLGIPMIYGIDA
Sbjct  61    RKVATPEVMRDYKIGSILSGGGSVPHLQATPQEWLNMVNGFQNGSLSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN Y ATIFPHN+GLGATRDPELV+ IG+ATA EVRATGI YVFAPCIAVCRDPRW
Sbjct  121   VHGHNNVYKATIFPHNIGLGATRDPELVKRIGSATAREVRATGINYVFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRC+ESYSEDP+IV+ MTEII GLQGE P +     P+V+G++KV ACAKH+VGDGGT +
Sbjct  181   GRCFESYSEDPDIVKEMTEIINGLQGEIPKDSRKGVPYVSGKDKVVACAKHFVGDGGTTR  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++D H L SIHM GY  +II+GV TVM SYSS NGV+MHAN D++T FLK  L
Sbjct  241   GINENNTVIDKHGLLSIHMPGYNAAIIKGVGTVMVSYSSWNGVKMHANHDLVTNFLKGAL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             RFRGFVISD++AID +T  VH NYTYS+LT + AG+DM+MVPYNYTEFID LT LVKNKF
Sbjct  301   RFRGFVISDWQAIDRMTYPVHANYTYSVLTGVQAGLDMIMVPYNYTEFIDTLTGLVKNKF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P++RIDDAV+RILRVKF +GLFE+PL D S    LG + HR LAR+AVRKSLVLLKNG 
Sbjct  361   IPMNRIDDAVRRILRVKFQLGLFENPLSDESFIDQLGHQAHRDLAREAVRKSLVLLKNGE  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
             NADEP+LPL KK+S+ILVAG+HAD++G QCGGWTI WQG SG N+T GTTIL  I   VD
Sbjct  421   NADEPMLPLPKKSSKILVAGSHADDLGNQCGGWTINWQGGSGNNLTSGTTILKGIAEAVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T++++EENP+ ++VKS+ FS+ IVVVGE  YAE +GD+ NLTIP  G   + NVC + 
Sbjct  481   PSTEIVYEENPEFDYVKSNNFSYGIVVVGEPPYAETNGDNLNLTIPLQGQYTLYNVCANI  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVVLI+GRP+VI P+L Q+DALVAAWLPGTEG+GVADVLFGDYGFSGKLP TWFKT +
Sbjct  541   KCVVVLISGRPLVIMPHLEQVDALVAAWLPGTEGKGVADVLFGDYGFSGKLPRTWFKTAE  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>gb|AFS50097.1| beta-D-glucan exohydolase [Elaeis guineensis]
Length=629

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/601 (68%), Positives = 488/601 (81%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M +  R +     LC W+ +  A+Y+ YKD +QP+  RI DLLSRMTL EK+GQM QI R
Sbjct  1     MEQSLRLIFIPVFLCSWMAMGGAEYLKYKDPKQPLNVRINDLLSRMTLAEKVGQMSQIAR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + A+++V+ KY++GSVLS GGSVP P+ASAE WV+MVN  QK +LSTRLGIPMIYGIDAV
Sbjct  61    ENATSEVINKYFIGSVLSGGGSVPAPKASAETWVNMVNEMQKAALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y AT+FPHN+GLGATR+P LV+ IGAATALEVRATGI YVFAPC+AVCRDPRWG
Sbjct  121   HGHNNVYKATVFPHNIGLGATREPALVKRIGAATALEVRATGIPYVFAPCVAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAG-REKVAACAKHYVGDGGTVK  926
             RCYESYSEDP+IV+ MTEIIPGLQGE P N     PFVAG +  VAACAKHYVGDGGT K
Sbjct  181   RCYESYSEDPKIVQEMTEIIPGLQGEIPANSRKGVPFVAGLKRNVAACAKHYVGDGGTYK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++  H L SIHM  YY++II+GV+TVM SYSS NGV+MHAN  ++T FLK  L
Sbjct  241   GINENNTIIGLHGLLSIHMPPYYDAIIKGVSTVMISYSSWNGVKMHANHYLVTDFLKNKL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              FRGFVISD++ ID +T   H NY+YSI   ++AGIDMVM+PY+Y EFID LTY VKN  
Sbjct  301   HFRGFVISDWQGIDRITSPPHANYSYSIQVGVHAGIDMVMIPYDYPEFIDDLTYQVKNNI  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAV+RILRVKF MGLFE P  D SLA  LG ++HR+LAR+AVRKSLVLLKNG 
Sbjct  361   IPMSRIDDAVRRILRVKFTMGLFEKPYADLSLAGELGKKEHRELAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
             + ++P+LPL KKA +ILVAG+HADN+G QCGGWTI WQGLSG N+T GTTIL A+KNTV+
Sbjct  421   STNDPLLPLPKKAKKILVAGSHADNLGCQCGGWTITWQGLSGNNLTTGTTILDAVKNTVE  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T+V++ ENP  +FV   +FS+AIV VGE+ YAE  GD+  LTIP+PGPS+I NVC   
Sbjct  481   PTTEVVYSENPASDFVNHGQFSYAIVAVGEQPYAETFGDNLELTIPDPGPSVIQNVCKSI  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             +CVV++I+GRP+VI+PY+  IDALVAAWLPGTEGQGVADVLFGDYGFSGKL  TWFK+VD
Sbjct  541   RCVVIIISGRPLVIEPYVHMIDALVAAWLPGTEGQGVADVLFGDYGFSGKLSRTWFKSVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_010031608.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 ref|XP_010031610.1| PREDICTED: lysosomal beta glucosidase-like [Eucalyptus grandis]
 gb|KCW50976.1| hypothetical protein EUGRSUZ_J00605 [Eucalyptus grandis]
Length=637

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/601 (68%), Positives = 489/601 (81%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWV-VVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MG+ S  +    L+CC   V   A+Y+ Y+D +QP+G R++DL+ RMTL EKIGQM QIE
Sbjct  4     MGRYSVPIKAFLLICCLAAVTTEAEYVKYRDAKQPMGARVRDLMRRMTLAEKIGQMTQIE  63

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VA+  VMK Y++GSVLS GGSVP P+AS E WV+ VN  QK +LSTRLGIPMIYGIDA
Sbjct  64    RSVATPDVMKNYFIGSVLSGGGSVPAPKASPETWVNAVNEIQKAALSTRLGIPMIYGIDA  123

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN YNATIFPHNVGLG TRDP L+++IG ATALEVRATGI Y FAPCIAVCRDPRW
Sbjct  124   VHGHNNVYNATIFPHNVGLGVTRDPVLLKKIGDATALEVRATGIPYAFAPCIAVCRDPRW  183

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSED  IVR +TEIIPGLQG+ P N P   PFVAG+ KVAACAKH+VGDGGT K
Sbjct  184   GRCYESYSEDHRIVRMLTEIIPGLQGDLPANSPKGVPFVAGKNKVAACAKHFVGDGGTTK  243

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++D + L SIHM  Y ++I +GVATVM SYSS NG +MHAN D++TGFLK  L
Sbjct  244   GINENNTVIDYNGLLSIHMPAYLDAIRKGVATVMVSYSSWNGKKMHANGDLVTGFLKNKL  303

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +F+GFVISD++ ID +T   H NY+YS+   + AGIDMVMVPY  TEF+D LT  V+N  
Sbjct  304   KFKGFVISDWEGIDRITSPPHANYSYSVQAGVGAGIDMVMVPYKVTEFLDDLTKQVQNNV  363

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAVKRILRVKFVMGLF++PL D SLA+ +GS +HR+LAR+AVRKSLVLLKNG 
Sbjct  364   IPMSRIDDAVKRILRVKFVMGLFDNPLADNSLANQVGSPEHRELAREAVRKSLVLLKNGK  423

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVD  1643
             ++ +P++PL KKA +ILVAG+HADN+G QCGGWTI WQGL+GN +T GTTIL A+K+TV 
Sbjct  424   SSGKPLIPLPKKAQKILVAGSHADNLGNQCGGWTIAWQGLNGNDLTTGTTILNAVKSTVH  483

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               TQV++ ENPD  FVKS+ F++AIVVVGE  YAE  GDS NLTIPEPGPS I NVC   
Sbjct  484   PDTQVVYNENPDANFVKSNNFAYAIVVVGEPPYAETFGDSLNLTIPEPGPSTIRNVCGSV  543

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVV+I+GRPVVI+PY+  IDALVAAWLPGTEGQGVAD+LFGDYGF+GKL  TWF++VD
Sbjct  544   KCVVVVISGRPVVIEPYVSNIDALVAAWLPGTEGQGVADLLFGDYGFTGKLARTWFRSVD  603

Query  2004  Q  2006
             Q
Sbjct  604   Q  604



>ref|XP_009588263.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana tomentosiformis]
Length=627

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/600 (68%), Positives = 491/600 (82%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MGK +  ++   LL     V  A YM YKD +QP+  RI+DL++RM+L+EKIGQM QIER
Sbjct  1     MGKFAATMMSFLLLFLCAGVTEAVYMKYKDPKQPLNVRIRDLMNRMSLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+ ++MKKY++GSVLS GGS P P+A+A  WV MVN  QKGSLSTRLGIPMIYGIDAV
Sbjct  61    HVAAPEIMKKYFIGSVLSGGGSAPAPKATAADWVKMVNEIQKGSLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDP+LV+ IGAATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNVGLGVTRDPQLVKRIGAATALEVRATGIPYTFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED +IVRAMTEIIPGLQG+ P N     PFVAG+ KVAACAKH+VGDGGTVKG
Sbjct  181   RCYESYSEDHKIVRAMTEIIPGLQGDIPANSRKGVPFVAGKTKVAACAKHFVGDGGTVKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT+++ + L +IHM  Y +SI++GV+T+M SYSS NG++MHANR +ITGFLK  L+
Sbjct  241   IDENNTVINVNGLINIHMPAYIDSIVKGVSTIMVSYSSWNGMKMHANRGLITGFLKGKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++AID +T     NY+YSI   + AGIDM+M   N TEF+D L + V+N  +
Sbjct  301   FRGFVISDWEAIDKITDPPRANYSYSIQAGVLAGIDMIMGQENLTEFLDDLAFQVRNNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+PL D SLA+ LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFENPLADLSLANQLGSQEHRELAREAVRKSLVLLKNGKV  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
               +P+LPL KK ++ILVAG+HADN+GYQCGGWTI WQG+ GN +T GTTIL+A+KNTV  
Sbjct  421   TSQPLLPLPKKVAKILVAGSHADNLGYQCGGWTIGWQGIGGNDLTTGTTILSAVKNTVHP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++ +NPD  FVK++ FS+AIVVVGE  YAE  GDS+ LTI EPGPS I N+C   K
Sbjct  481   STQVVYRDNPDANFVKANHFSYAIVVVGETPYAEMFGDSAKLTIAEPGPSTINNICGFVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRPVVI+PYL  I+ALVAAWLPG+EGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  541   CVVVVMSGRPVVIEPYLANIEALVAAWLPGSEGQGVADVLFGDYGFTGKLARTWFKSVDQ  600



>ref|XP_009395659.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395660.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395661.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=624

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/599 (69%), Positives = 492/599 (82%), Gaps = 0/599 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG     ++G+  L CW     A+YM YKD  QPV  R+KDL+ RMTL EKIGQM QIER
Sbjct  1     MGTWRTQMLGILFLMCWAATIQAEYMKYKDPNQPVNVRVKDLMKRMTLAEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + AS QV+K Y +GS+LS GGSVP P+ASA+ WV+M+N +QK  LSTRLGIPMIYGIDAV
Sbjct  61    KDASPQVLKDYLIGSILSGGGSVPAPQASAKDWVNMINEYQKACLSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHNVGLGATRDP+LV+ IG ATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNVGLGATRDPDLVKRIGVATALEVRATGIPYTFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  +V+AMT+II GLQG+ P NY  +FP+V+G++ VAACAKH+VGDGGT KG
Sbjct  181   RCYESYSEDHRVVQAMTQIILGLQGDIPANYTKNFPYVSGKKHVAACAKHFVGDGGTQKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++D H L SIHM  YY+S+ +GV+T+MASYSS NG++MHANR +IT FLKK L 
Sbjct  241   INENNTIIDFHGLLSIHMPAYYDSVAKGVSTIMASYSSWNGIKMHANRYLITDFLKKKLG  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISD++ ID +T     NYTYS+  S+NAGIDMVMVP +Y  F + LT LV  K +
Sbjct  301   FKGFVISDWQGIDRITTPPDANYTYSVQVSVNAGIDMVMVPDDYPGFFNTLTTLVNAKVI  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV+RILRVKFVMGLF++PL DY+L   LG ++HR+LAR+AVRKSLVLLKNG +
Sbjct  361   PMSRIDDAVRRILRVKFVMGLFDNPLADYNLVDQLGKKEHRELAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTK  1649
             + +P+LPL KKA +ILVAG+HADN+GYQCGGWTIEWQG SG IT GTTIL AIK+TVD  
Sbjct  421   SKKPLLPLPKKAGKILVAGSHADNLGYQCGGWTIEWQGSSGRITGGTTILEAIKSTVDPS  480

Query  1650  TQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKC  1829
             T V F ENPD  FVKS+ FS+AIVVVGE  Y+E +GDS NLTIPEPGPS I +VC   KC
Sbjct  481   TNVAFSENPDAGFVKSNNFSYAIVVVGEPPYSETAGDSLNLTIPEPGPSTIQSVCGAVKC  540

Query  1830  VVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VVV+I+GRPVV++ Y+P +DALVAAWLPG+EGQGVADVLFGD+GF+GKLP TWFK+VDQ
Sbjct  541   VVVIISGRPVVVESYVPLMDALVAAWLPGSEGQGVADVLFGDFGFTGKLPRTWFKSVDQ  599



>ref|XP_010677827.1| PREDICTED: lysosomal beta glucosidase-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010677828.1| PREDICTED: lysosomal beta glucosidase-like [Beta vulgaris subsp. 
vulgaris]
Length=629

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/601 (71%), Positives = 503/601 (84%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVV-VANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M K S + + + L  C+   +A+A+Y+ YKD +QP+G RI+DL+SRMTL+EKIGQMVQIE
Sbjct  1     MAKYSIYWVAILLSLCYCTSMADAEYLKYKDPKQPLGARIRDLMSRMTLEEKIGQMVQIE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VAS +VMK Y++GSVLS GGSVP  +AS E+W++MVN FQ GSLSTRLGIPMIYGIDA
Sbjct  61    RSVASGEVMKNYFIGSVLSGGGSVPAEKASPESWINMVNEFQTGSLSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN Y ATIFPHNVGLGATRDPELV+ IGAATALEVRATGI YVFAPCIAVCRDPRW
Sbjct  121   VHGHNNVYKATIFPHNVGLGATRDPELVKRIGAATALEVRATGIPYVFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSE+P+IV+ MT+II GLQGE P N     PFV+G+ KVAACAKHYVGDGGT  
Sbjct  181   GRCYESYSEEPKIVQEMTQIISGLQGEIPHNSRKGVPFVSGQNKVAACAKHYVGDGGTTT  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++D H L SIHM GYYN+II GV+T+M SYSS NGV+MHAN +++TGFLK TL
Sbjct  241   GINENNTVIDFHGLLSIHMPGYYNAIINGVSTIMVSYSSWNGVKMHANHNLVTGFLKNTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +FRGFVISD++ +D +T   H NY+ S+   I AGIDMVMVP+NYTEFID LT+ VK K 
Sbjct  301   KFRGFVISDWEGLDRITSPPHTNYSMSVQAGIYAGIDMVMVPHNYTEFIDDLTFHVKEKH  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAVKRILRVKF MGLFE PL D SL H LGS++HR++AR+AVRKSLVLLKN  
Sbjct  361   IPMSRIDDAVKRILRVKFQMGLFEHPLADTSLVHQLGSQEHREIAREAVRKSLVLLKNEK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
               ++P+LPL KKA++ILVAG+HADN+GYQCGGWTI+WQGL G N+T GTTILTAIKNTVD
Sbjct  421   VGEKPMLPLPKKAAKILVAGSHADNLGYQCGGWTIQWQGLDGNNLTQGTTILTAIKNTVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
              KT+V++++NPD  FVKS+KFS+AIVVVGE  YAE  GDS NLTI +PG S I NVC   
Sbjct  481   PKTEVVYQQNPDTNFVKSNKFSYAIVVVGEHPYAETFGDSLNLTIADPGYSTITNVCGAV  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVV+++GRPVVI+PY+ ++ ALVAAWLPGTEGQGVAD LFGDYGF+GK   TWFKTVD
Sbjct  541   KCVVVVVSGRPVVIEPYVSKMTALVAAWLPGTEGQGVADALFGDYGFTGKSTRTWFKTVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_007010542.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
 gb|EOY19352.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
Length=662

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/601 (68%), Positives = 490/601 (82%), Gaps = 5/601 (1%)
 Frame = +3

Query  210   MGKGS-RFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MG+G  + ++GV  L    +V  A+Y+ YKD  QPV  RIKDL+S+MTL EKIGQMVQI+
Sbjct  1     MGRGLLKLVVGVLWLG---MVVGAEYVKYKDPNQPVAARIKDLMSKMTLAEKIGQMVQID  57

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VA+ Q+++ Y +GSVLS GGS P P+ASAE WV+M+N +Q GSL++RLGIPMIYGIDA
Sbjct  58    RTVATEQILRDYSIGSVLSGGGSAPLPQASAEDWVNMINAYQNGSLASRLGIPMIYGIDA  117

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN YNATIFPHNVGLGATRDP LV++IGAATALEVRATGI YVFAPCIAVCRDPRW
Sbjct  118   VHGHNNVYNATIFPHNVGLGATRDPALVKKIGAATALEVRATGIPYVFAPCIAVCRDPRW  177

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSED +IV  MT+II GLQG+ P       P+V G++KVAACAKH+VGDGGT +
Sbjct  178   GRCYESYSEDHKIVEEMTDIIFGLQGDIPSGSRKGVPYVGGKDKVAACAKHFVGDGGTTR  237

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++D H L S++M  Y  S+I+GV+T+M SYSS NG +MHAN ++ITGFLK TL
Sbjct  238   GINENNTVIDVHGLLSMYMPAYSYSVIKGVSTIMVSYSSWNGEKMHANHELITGFLKNTL  297

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +F+GFVISD++ ID +T   H NYTYS+  +I AGIDMVMVP+N+TEF+D LTYLV +K 
Sbjct  298   KFKGFVISDWQGIDRITSPPHLNYTYSVQAAIQAGIDMVMVPFNHTEFVDDLTYLVNSKV  357

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+ RIDDAV+RIL VKF MGLFE+P  D+SL H LGS+ HR LAR+AVRKSLVLLKNG 
Sbjct  358   IPMDRIDDAVERILLVKFTMGLFENPFADFSLVHELGSQAHRDLAREAVRKSLVLLKNGK  417

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
                 P+LPL KKAS+ILVAGTHADN+GYQCGGWTI WQG SG N T GTTIL AI +TVD
Sbjct  418   GGTTPLLPLSKKASKILVAGTHADNLGYQCGGWTINWQGFSGNNYTRGTTILGAINSTVD  477

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T++++ ENPD +FVKS+ F +AIV VGE  YAE +GDS+ LT+ +PGPS+I NVC   
Sbjct  478   PSTEIVYRENPDADFVKSNNFDYAIVAVGEPPYAETAGDSTTLTMMDPGPSVITNVCGAV  537

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVV+I+GRP+VI+PY+  IDALVAAWLPGTEGQGV D L+GDYGFSGKLP TWFKTVD
Sbjct  538   KCVVVIISGRPIVIEPYVSTIDALVAAWLPGTEGQGVIDALYGDYGFSGKLPRTWFKTVD  597

Query  2004  Q  2006
             Q
Sbjct  598   Q  598



>ref|XP_007010543.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY19353.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
Length=661

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/601 (68%), Positives = 490/601 (82%), Gaps = 5/601 (1%)
 Frame = +3

Query  210   MGKGS-RFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             MG+G  + ++GV  L    +V  A+Y+ YKD  QPV  RIKDL+S+MTL EKIGQMVQI+
Sbjct  1     MGRGLLKLVVGVLWLG---MVVGAEYVKYKDPNQPVAARIKDLMSKMTLAEKIGQMVQID  57

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R VA+ Q+++ Y +GSVLS GGS P P+ASAE WV+M+N +Q GSL++RLGIPMIYGIDA
Sbjct  58    RTVATEQILRDYSIGSVLSGGGSAPLPQASAEDWVNMINAYQNGSLASRLGIPMIYGIDA  117

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN YNATIFPHNVGLGATRDP LV++IGAATALEVRATGI YVFAPCIAVCRDPRW
Sbjct  118   VHGHNNVYNATIFPHNVGLGATRDPALVKKIGAATALEVRATGIPYVFAPCIAVCRDPRW  177

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSED +IV  MT+II GLQG+ P       P+V G++KVAACAKH+VGDGGT +
Sbjct  178   GRCYESYSEDHKIVEEMTDIIFGLQGDIPSGSRKGVPYVGGKDKVAACAKHFVGDGGTTR  237

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++D H L S++M  Y  S+I+GV+T+M SYSS NG +MHAN ++ITGFLK TL
Sbjct  238   GINENNTVIDVHGLLSMYMPAYSYSVIKGVSTIMVSYSSWNGEKMHANHELITGFLKNTL  297

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +F+GFVISD++ ID +T   H NYTYS+  +I AGIDMVMVP+N+TEF+D LTYLV +K 
Sbjct  298   KFKGFVISDWQGIDRITSPPHLNYTYSVQAAIQAGIDMVMVPFNHTEFVDDLTYLVNSKV  357

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+ RIDDAV+RIL VKF MGLFE+P  D+SL H LGS+ HR LAR+AVRKSLVLLKNG 
Sbjct  358   IPMDRIDDAVERILLVKFTMGLFENPFADFSLVHELGSQAHRDLAREAVRKSLVLLKNGK  417

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
                 P+LPL KKAS+ILVAGTHADN+GYQCGGWTI WQG SG N T GTTIL AI +TVD
Sbjct  418   GGTTPLLPLSKKASKILVAGTHADNLGYQCGGWTINWQGFSGNNYTRGTTILGAINSTVD  477

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T++++ ENPD +FVKS+ F +AIV VGE  YAE +GDS+ LT+ +PGPS+I NVC   
Sbjct  478   PSTEIVYRENPDADFVKSNNFDYAIVAVGEPPYAETAGDSTTLTMMDPGPSVITNVCGAV  537

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVV+I+GRP+VI+PY+  IDALVAAWLPGTEGQGV D L+GDYGFSGKLP TWFKTVD
Sbjct  538   KCVVVIISGRPIVIEPYVSTIDALVAAWLPGTEGQGVIDALYGDYGFSGKLPRTWFKTVD  597

Query  2004  Q  2006
             Q
Sbjct  598   Q  598



>ref|XP_007015581.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOY33200.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=627

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/579 (69%), Positives = 474/579 (82%), Gaps = 0/579 (0%)
 Frame = +3

Query  270   ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssg  449
             A  ++M YKD   P   RI+DL+ RMT++EKIGQM QI+R VA+ ++M+ Y +GS+LS G
Sbjct  24    ARTEHMKYKDPSLPTNIRIRDLMKRMTVEEKIGQMAQIDRAVATPKIMRDYGIGSILSGG  83

Query  450   gsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGA  629
             GSVP+P+A+ + W+ MVN FQ GSLSTRLGIPMIYGIDAVHG NN Y ATIFPHN+GLGA
Sbjct  84    GSVPRPKATPQDWIKMVNNFQNGSLSTRLGIPMIYGIDAVHGQNNVYKATIFPHNIGLGA  143

Query  630   TRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEII  809
             TRDPELVR IGAATALEVRATGI Y FAPC+AVCRDPRWGRCYESYSEDPEIVR MTEII
Sbjct  144   TRDPELVRRIGAATALEVRATGINYAFAPCVAVCRDPRWGRCYESYSEDPEIVREMTEII  203

Query  810   PGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAG  989
              GLQGE P N     P++ G++KVAACAKH+VGDGGT  GI+ENNT++D H L SIHM G
Sbjct  204   NGLQGEIPQNSRKGVPYIGGKDKVAACAKHFVGDGGTTNGINENNTVIDRHGLLSIHMPG  263

Query  990   YYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVH  1169
             YY SII+GV+TVM SYSS NG +MHA+ D+IT FLK TLRFRGFVI+D++ ID +T T H
Sbjct  264   YYESIIKGVSTVMVSYSSWNGEKMHAHHDLITNFLKGTLRFRGFVITDWEGIDKITATPH  323

Query  1170  GNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMG  1349
              NYTYS+L  + AGIDM M+P+N+TEFI  LT LV++KF+P+SRIDDAV+RILRVK+ +G
Sbjct  324   SNYTYSVLAGVQAGIDMFMIPFNHTEFIHTLTKLVRDKFIPMSRIDDAVRRILRVKYKLG  383

Query  1350  LFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGT  1529
             LFE+P+ D S    LGS+ HR+LAR+AVRKSLVLLKNG NAD+ VLPL KKASRILVAG+
Sbjct  384   LFENPMADESFVAELGSQAHRELAREAVRKSLVLLKNGENADDAVLPLPKKASRILVAGS  443

Query  1530  HADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFS  1709
             HA+++G QCGGWTI WQGLSGN T GTTIL  I   VD  T++ F+ENPD +FVKS  FS
Sbjct  444   HANDLGNQCGGWTISWQGLSGNHTAGTTILEGISAAVDPDTKIAFKENPDMDFVKSKNFS  503

Query  1710  HAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQID  1889
             +AIVVVGE  YAEG GDS NLTIPE     I NVC + KCVVVLI+GRP+ + P+L Q+D
Sbjct  504   YAIVVVGEPPYAEGQGDSMNLTIPEQSQYTIYNVCANIKCVVVLISGRPLEVMPHLDQVD  563

Query  1890  ALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             A VAAWLPG+EGQGVADVLFGDYGF+GKLP TWFKTVDQ
Sbjct  564   AFVAAWLPGSEGQGVADVLFGDYGFTGKLPRTWFKTVDQ  602



>ref|XP_003535890.1| PREDICTED: lysosomal beta glucosidase [Glycine max]
Length=627

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/600 (69%), Positives = 493/600 (82%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S   +GV LL C V  + A+Y+ YKD + P+  RI DLL RM+L+EKIGQM QIER
Sbjct  1     MGRYSIPFMGVLLLFCLVSSSEAEYLKYKDPKAPLNVRISDLLKRMSLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+  VM KY++GSVLS GGSVP  +ASA +W  MVN  QK +LSTRLGIPMIYGIDAV
Sbjct  61    SVATPDVMNKYFIGSVLSGGGSVPATKASAASWQQMVNQMQKAALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNAT+FPHNVGLG TRDP L+++IG ATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATVFPHNVGLGVTRDPVLIKKIGEATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP+IV+ MTEIIPGLQG+ P N     PFVAG+ KVAACAKHY+GDGGT KG
Sbjct  181   RCYESYSEDPKIVKTMTEIIPGLQGDIPGNSIKGVPFVAGKNKVAACAKHYLGDGGTNKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNTL+  + L SIHM  YY+SII+GV+TVM SYSS NG++MHAN+ +ITG+LK  L 
Sbjct  241   INENNTLISYNGLLSIHMPAYYDSIIKGVSTVMISYSSWNGMKMHANKKLITGYLKNKLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISD++ ID +T   H NY+YS+   ++AGIDM+MVP+NYTEFID LT  VKN  +
Sbjct  301   FKGFVISDWQGIDRITSPPHANYSYSVQAGVSAGIDMIMVPFNYTEFIDELTRQVKNNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV RILRVKFVMGLFE+P  D SLA+ LGS++HR++AR+AVRKSLVLLKNG +
Sbjct  361   PISRIDDAVARILRVKFVMGLFENPYADPSLANQLGSKEHREIAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
               +P+LPL KK+++ILVAG+HA+N+GYQCGGWTI WQGL GN +T GTTIL A+K TVD 
Sbjct  421   YKKPLLPLPKKSTKILVAGSHANNLGYQCGGWTITWQGLGGNDLTSGTTILDAVKQTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V+F ENPD  FVKS KF +AIVVVGE TYAE  GDS NLT+ +PGPS I NVC   +
Sbjct  481   ATEVVFNENPDKNFVKSYKFDYAIVVVGEHTYAETFGDSLNLTMADPGPSTITNVCGAIR  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVL+TGRPVVI+PYLP+IDALVAAWLPGTEGQGVADVL+GDY F+GKL  TWFKTVDQ
Sbjct  541   CVVVLVTGRPVVIKPYLPKIDALVAAWLPGTEGQGVADVLYGDYEFTGKLARTWFKTVDQ  600



>ref|XP_011089012.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=658

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/601 (70%), Positives = 500/601 (83%), Gaps = 1/601 (0%)
 Frame = +3

Query  207   KMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             K+ + SR ++ + +LC       A+Y+ YKD +QP+  RIKDL+ RMTL+EKIGQM QIE
Sbjct  26    KVRRFSRPMMFLMILCLSAAFTEAEYLKYKDPKQPLNVRIKDLMGRMTLEEKIGQMTQIE  85

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R++AS  VMKKY++GSVLS GGSVP P+ASAEAWV+MVN  QKG+LSTRLGIPMIYGIDA
Sbjct  86    RKIASPDVMKKYFIGSVLSGGGSVPAPKASAEAWVNMVNDLQKGALSTRLGIPMIYGIDA  145

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NN Y ATIFPHNVGLGATRDPELV+ IGAATALEVRATGIQY FAPCIAVCRDPRW
Sbjct  146   VHGHNNVYKATIFPHNVGLGATRDPELVKRIGAATALEVRATGIQYAFAPCIAVCRDPRW  205

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSED +IV+AMTE+IPGLQG+ P N     PFVAG+ KVAACAKH+VGDGGTV+
Sbjct  206   GRCYESYSEDHKIVQAMTELIPGLQGDLPANSRKGVPFVAGKTKVAACAKHFVGDGGTVR  265

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GIDENNT++D   L SIHM  Y +SI +GVATVM SYSS NG +MHAN+D++TGFLK  L
Sbjct  266   GIDENNTVIDYKGLLSIHMPAYLDSIRKGVATVMVSYSSWNGKKMHANQDLVTGFLKNKL  325

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
             +FRGFVISD++ ID +T   H NYTYS+   I AGIDM+M+P ++T FID LT  VKN  
Sbjct  326   KFRGFVISDWQGIDRITDPPHANYTYSVQEGILAGIDMIMLPEDFTAFIDDLTLQVKNNI  385

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRI+DAV+R+LRVKFVMGLFEDPL D SLA+ LGS++HR+LAR+AVRKSLVLLKNG 
Sbjct  386   IPMSRINDAVRRVLRVKFVMGLFEDPLADPSLANQLGSQEHRELAREAVRKSLVLLKNGK  445

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVD  1643
             +A  P+LPL KKA +ILVAGTHADN+GYQCGGWTIEWQG+ GN +T+GTTIL A+K TVD
Sbjct  446   SAKNPLLPLPKKAPKILVAGTHADNLGYQCGGWTIEWQGVHGNDLTVGTTILGAVKETVD  505

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               TQV++ ENPD  FVK++ FS+AIVVVGE  YAE  GDS+NLT+ EPGPS I NVC   
Sbjct  506   PSTQVVYMENPDANFVKTNGFSYAIVVVGELPYAEMFGDSTNLTMIEPGPSTIRNVCGAV  565

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVV+++GRP+V++PY+ Q+DA+VAAWLPGTEG GV D LFG+YGF+GKL  TWFK+VD
Sbjct  566   KCVVVVVSGRPIVLEPYVSQVDAVVAAWLPGTEGLGVTDALFGNYGFTGKLARTWFKSVD  625

Query  2004  Q  2006
             Q
Sbjct  626   Q  626



>ref|XP_010908054.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Elaeis 
guineensis]
Length=614

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/554 (73%), Positives = 465/554 (84%), Gaps = 0/554 (0%)
 Frame = +3

Query  345   MTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSL  524
             MTL EKIGQM QIER+VASA+VMK Y++GSVLS GGSVP  +ASAE WV+MVN FQKGSL
Sbjct  1     MTLAEKIGQMTQIERKVASAKVMKDYFIGSVLSGGGSVPASQASAEDWVNMVNEFQKGSL  60

Query  525   STRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQY  704
             STRLGIPMIYGIDAVHGNNN Y ATIFPHN+GLGATRDPELV++IG ATALEVRATGIQY
Sbjct  61    STRLGIPMIYGIDAVHGNNNVYGATIFPHNIGLGATRDPELVKKIGEATALEVRATGIQY  120

Query  705   VFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVA  884
              FAPCIAVCRDPRWGRCYES+SED  IVR MTEIIPGLQG+ P NY    P+VAG+ KVA
Sbjct  121   AFAPCIAVCRDPRWGRCYESFSEDYHIVREMTEIIPGLQGDLPANYSKGVPYVAGKNKVA  180

Query  885   ACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMH  1064
             ACAKHYVGDGGT  GI+ENNT++D H L SIHM  Y  SII+GV+TVM SYSS NG +MH
Sbjct  181   ACAKHYVGDGGTHDGINENNTVIDYHGLLSIHMPAYDISIIKGVSTVMVSYSSWNGAKMH  240

Query  1065  ANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYT  1244
             AN D++TGFLK TL FRGFVISD++ ID +T     NYTYS+   INAGIDMVMVPYNYT
Sbjct  241   ANHDLVTGFLKNTLHFRGFVISDWQGIDRITTPPGANYTYSVQAGINAGIDMVMVPYNYT  300

Query  1245  EFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLAR  1424
             +FI+ LT LV    +P+SRIDDAV+RIL VKF MGLFE+PL D SL   LG ++HR+LAR
Sbjct  301   DFINDLTSLVHKNIIPMSRIDDAVRRILLVKFTMGLFENPLADLSLVDQLGKKEHRELAR  360

Query  1425  KAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITI  1604
             +AVRKSLVLLKNG + +E +LPL KKA +ILVAG+HADN+GYQCGGWTIEWQG SGNIT+
Sbjct  361   EAVRKSLVLLKNGKSINESLLPLPKKARKILVAGSHADNLGYQCGGWTIEWQGDSGNITV  420

Query  1605  GTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPE  1784
             GTTIL AIK+TVD  T +++ ENPD   VK++ FSHAIVVVGE  Y E +GDS NLT+P+
Sbjct  421   GTTILDAIKSTVDPSTTIIYSENPDASSVKNNDFSHAIVVVGEPPYTETAGDSLNLTLPD  480

Query  1785  PGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGF  1964
             PGPS +  VC   KCVVV+I+GRPVVI+PY+P +DALVAAWLPG+EGQGVADVLFGDYGF
Sbjct  481   PGPSTVQTVCGSVKCVVVVISGRPVVIEPYVPLMDALVAAWLPGSEGQGVADVLFGDYGF  540

Query  1965  SGKLPFTWFKTVDQ  2006
             SGKLP TWFK+VDQ
Sbjct  541   SGKLPRTWFKSVDQ  554



>ref|NP_001051275.1| Os03g0749300 [Oryza sativa Japonica Group]
 gb|AAL58966.1|AC091811_15 putative exoglucanase precursor [Oryza sativa Japonica Group]
 gb|ABF98882.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98883.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98884.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13189.1| Os03g0749300 [Oryza sativa Japonica Group]
 gb|EAY91868.1| hypothetical protein OsI_13515 [Oryza sativa Indica Group]
 gb|EAZ28591.1| hypothetical protein OsJ_12577 [Oryza sativa Japonica Group]
 dbj|BAG89337.1| unnamed protein product [Oryza sativa Japonica Group]
Length=625

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/600 (69%), Positives = 485/600 (81%), Gaps = 3/600 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG   +F + + L+ C+  + +A Y+ YKD +QPV  R+KDLL RMTL EKIGQM QIER
Sbjct  1     MGSLHKFSV-ILLMLCFATLGSAQYVKYKDPKQPVSVRVKDLLGRMTLAEKIGQMTQIER  59

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + A+A+ + KY++GSVLS GGSVP P+ASA+AW  MVN  QKG+LSTRLGIPMIYGIDAV
Sbjct  60    ENATAEQIAKYFIGSVLSGGGSVPAPQASAQAWASMVNEMQKGALSTRLGIPMIYGIDAV  119

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLGATRDP+LV+ IG ATALEVRATGI YVFAPC+AVCRDPRWG
Sbjct  120   HGHNNVYKATIFPHNVGLGATRDPDLVKRIGEATALEVRATGIPYVFAPCVAVCRDPRWG  179

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP++V+++T +I GLQG+ P N  +  P+V G +KVAACAKHYVGDGGTVKG
Sbjct  180   RCYESYSEDPKVVQSLTTLISGLQGDVPSN-DVGRPYVGGSKKVAACAKHYVGDGGTVKG  238

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++DTH L +IHM  YYNSIIRGV+TVM SYSS NGV+MHAN  +IT FLK  LR
Sbjct  239   INENNTIIDTHGLLTIHMPPYYNSIIRGVSTVMVSYSSWNGVKMHANHHLITDFLKNKLR  298

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YSI   I AGIDM+MVPY YTEFID LT  V NK +
Sbjct  299   FRGFVISDWQGIDRITSPPHKNYSYSIEAGIGAGIDMIMVPYTYTEFIDDLTEQVNNKII  358

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV RILRVKF MGLFE P  D SLA  LG ++HR+LAR+AVRKSLVLLKNG +
Sbjct  359   PMSRIDDAVYRILRVKFTMGLFESPFADSSLADELGKQEHRELAREAVRKSLVLLKNGKS  418

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             +  PVLPL KKA +ILVAG+HAD++G QCGGWTI WQG  G NIT GTTIL+AIK TVD 
Sbjct  419   SYSPVLPLPKKAGKILVAGSHADDLGRQCGGWTITWQGQPGNNITAGTTILSAIKATVDP  478

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T V++ ENPD   V   K+ +AIVVVGE  YAEG GD+ NLTIPEPGP++I  VC   K
Sbjct  479   STTVVYSENPDSSVVTGDKYDYAIVVVGEPPYAEGFGDNLNLTIPEPGPTVIQTVCKSIK  538

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVLI+GRP+V++PY+  IDA VAAWLPGTEGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  539   CVVVLISGRPLVVEPYIGGIDAFVAAWLPGTEGQGVADVLFGDYGFTGKLSRTWFKSVDQ  598



>ref|XP_011087395.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum]
Length=700

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/592 (69%), Positives = 483/592 (82%), Gaps = 1/592 (0%)
 Frame = +3

Query  234   IGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVM  413
             I V L      V   +YM YKD +QPVG R+KDLL RM+L+EKIGQMVQI+R  AS  +M
Sbjct  14    IAVVLCSRRGAVGKEEYMKYKDPKQPVGVRVKDLLGRMSLEEKIGQMVQIDRIAASPDIM  73

Query  414   KkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYN  593
             K YY+GS+LS GGS P PRA+A  WV+MVN FQ GSLSTRLGIPMIYGIDAVHG+NN YN
Sbjct  74    KDYYIGSLLSGGGSTPLPRATAADWVNMVNDFQNGSLSTRLGIPMIYGIDAVHGHNNVYN  133

Query  594   ATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSE  773
             ATIFPHN+GLGATRDPEL++ IG ATA EVRATGI YVFAPCIAVCRDPRWGRCYESYSE
Sbjct  134   ATIFPHNIGLGATRDPELLQRIGDATAAEVRATGIPYVFAPCIAVCRDPRWGRCYESYSE  193

Query  774   DPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLV  953
             DP++VR MT+II GLQGE P       P+VAG+ KVAACAKH+VGDGGT KGI+ENNTL 
Sbjct  194   DPKVVREMTDIILGLQGEIPNGLRKGVPYVAGKNKVAACAKHFVGDGGTTKGINENNTLT  253

Query  954   DTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISD  1133
               H L SIHM  YY+SII+GV+TVM SYSS NG +MHANR++ITGFLK TL+F+GFVISD
Sbjct  254   SMHGLLSIHMPAYYDSIIKGVSTVMVSYSSWNGQKMHANRELITGFLKGTLKFKGFVISD  313

Query  1134  FKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDA  1313
             ++ +D +T   H NYTYS+L  + AGIDM+MVPYN+TEFI+ LTYLVKN+F+ + RIDDA
Sbjct  314   WQGLDRITSPPHSNYTYSVLAGVLAGIDMIMVPYNFTEFINDLTYLVKNRFISMDRIDDA  373

Query  1314  VKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPL  1493
             V+RIL VKF +GLFE+PL D SL + +GS+ HR LAR+AVRKSLVLLKNG  A++ +LPL
Sbjct  374   VQRILLVKFNLGLFENPLADLSLVNEVGSQAHRDLAREAVRKSLVLLKNGKTANDSLLPL  433

Query  1494  RKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEE  1670
              KKAS+ILVAGTHADN+GYQCGGWTI WQG SG N T GTTIL AI +TVD  T V++ E
Sbjct  434   PKKASKILVAGTHADNLGYQCGGWTIAWQGFSGNNDTSGTTILGAINSTVDKDTDVVYLE  493

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
             NPD E+VKS+ FS+AIVVVGE  Y E +GDS  LT+ +PGP +I NVC   KCVV++I+G
Sbjct  494   NPDSEYVKSNDFSYAIVVVGEPPYTETAGDSQTLTMVDPGPDVINNVCGAVKCVVIMISG  553

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RPVV++PY+  IDALVAAWLPGTEG GV DVLFGDYGF+GKLP TWFKTV+Q
Sbjct  554   RPVVMEPYMSTIDALVAAWLPGTEGLGVTDVLFGDYGFTGKLPRTWFKTVNQ  605



>ref|XP_004493181.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Cicer 
arietinum]
 ref|XP_004493182.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Cicer 
arietinum]
Length=632

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/601 (67%), Positives = 493/601 (82%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWV-VVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M K   F +G  LLC W  ++     M YKD  + +  R++DL++RMTL+EKIGQM+QIE
Sbjct  1     MTKIPIFFVGFWLLCNWAGLLETGSMMKYKDPNESIDIRVEDLINRMTLEEKIGQMLQIE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R+ AS  V+ KY++GSV+S GGS+P P+ASAE W++M+N FQK +LSTRLGIP+ YGIDA
Sbjct  61    RKYASDDVLNKYFIGSVMSEGGSIPVPQASAEDWINMLNEFQKDALSTRLGIPIFYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+N+ Y ATIFPHN+GLGATRDPELV+ IGAATALEVRATGIQYV+APC+AVCRDPRW
Sbjct  121   VHGHNSVYKATIFPHNIGLGATRDPELVKRIGAATALEVRATGIQYVYAPCVAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP+IV+AMTEII GLQGE PPN P   PF+AG+EKV ACAKHYVGDGGT  
Sbjct  181   GRCYESYSEDPKIVQAMTEIISGLQGEIPPNMPKGVPFIAGKEKVIACAKHYVGDGGTTN  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GIDE+NT++D  +L  IHM GY++SI +GVAT+M SYSS NGV+MHAN D+ITGFLK TL
Sbjct  241   GIDESNTVIDRDELMGIHMPGYFSSIDKGVATIMVSYSSWNGVKMHANHDLITGFLKNTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              F+G VI+DF+ ID +T     N TYS+   ++AG+DM MVP  Y EFID LT LV NKF
Sbjct  301   HFQGLVITDFEGIDRITDPPRANCTYSVQAGVSAGMDMFMVPKFYREFIDDLTILVNNKF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAVKRILRVKF+MG+FE+P  DYSL ++LG ++HR+LAR+AVRKS+VLLKNG 
Sbjct  361   IPMSRIDDAVKRILRVKFMMGIFENPFADYSLVNYLGIKEHRELAREAVRKSMVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVD  1643
             +A+ P+LPL KK  +ILVAG+HA+N+GYQCGGWTI+WQG+SGN I  GTTIL A+KNTVD
Sbjct  421   SAEMPLLPLPKKVPKILVAGSHANNLGYQCGGWTIKWQGISGNDILKGTTILNAVKNTVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
              +T V+++ENPD EFV+S+ FS+AIVVVGE  YAE  GD+ NLTIP PGP  I NVC   
Sbjct  481   PETIVIYKENPDKEFVESNGFSYAIVVVGEHPYAEMHGDNMNLTIPNPGPETITNVCGAI  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVV+I+GRP+VI PY+  ID LVA WLPG+EGQGVADVL+GDYGF+GKLP TWFK+VD
Sbjct  541   KCVVVIISGRPLVITPYVDLIDGLVAGWLPGSEGQGVADVLYGDYGFTGKLPRTWFKSVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>gb|AIO11756.1| beta-glucosidase [Glycine max]
Length=627

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/600 (69%), Positives = 492/600 (82%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S   +GV LL C V  + A+Y+ YKD + P+  RI DLL RM+L+EKIGQM QIER
Sbjct  1     MGRYSIPFMGVLLLFCLVSSSEAEYLKYKDPKAPLNVRISDLLKRMSLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+  VM KY++GSVLS GGSVP  +ASA  W  MVN  QK +LSTRLGIPMIYGIDAV
Sbjct  61    SVATPDVMNKYFIGSVLSGGGSVPATKASAATWQQMVNQMQKAALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNAT+FPHNVGLG TRDP L+++IG ATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATVFPHNVGLGVTRDPVLIKKIGEATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP+IV+ MTEIIPGLQG+ P N     PFVAG+ KVAACAKHY+GDGGT KG
Sbjct  181   RCYESYSEDPKIVKTMTEIIPGLQGDIPGNSIKGVPFVAGKNKVAACAKHYLGDGGTNKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNTL+  + L SIHM  YY+SII+GV+TVM SYSS NG++MHAN+ +ITG+LK  L 
Sbjct  241   INENNTLISYNGLLSIHMPAYYDSIIKGVSTVMISYSSWNGMKMHANKKLITGYLKNKLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISD++ ID +T   H NY+YS+   ++AGIDM+MVP+NYTEFID LT  VKN  +
Sbjct  301   FKGFVISDWQGIDRITSPPHANYSYSVQAGVSAGIDMIMVPFNYTEFIDELTRQVKNNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV RILRVKFVMGLFE+P  D SLA+ LGS++HR++AR+AVRKSLVLLKNG +
Sbjct  361   PISRIDDAVARILRVKFVMGLFENPYADPSLANQLGSKEHREIAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
               +P+LPL KK+++ILVAG+HA+N+GYQCGGWTI WQGL GN +T GTTIL A+K TVD 
Sbjct  421   YKKPLLPLPKKSTKILVAGSHANNLGYQCGGWTITWQGLGGNDLTSGTTILDAVKQTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V+F ENPD  FVKS KF +AIVVVGE TYAE  GDS NLT+ +PGPS I NVC   +
Sbjct  481   ATEVVFNENPDKNFVKSYKFDYAIVVVGEHTYAETFGDSLNLTMADPGPSTITNVCGAIR  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVVL+TGRPVVI+PYLP+IDALVAAWLPGTEGQGVADVL+GDY F+GKL  TWFKTVDQ
Sbjct  541   CVVVLVTGRPVVIKPYLPKIDALVAAWLPGTEGQGVADVLYGDYEFTGKLARTWFKTVDQ  600



>ref|XP_008363217.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=703

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/597 (69%), Positives = 484/597 (81%), Gaps = 5/597 (1%)
 Frame = +3

Query  231   LIGVALLCCWVVVAN--ADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASA  404
             ++G+ L+  W+ +A   ADY++YKD  QP   R+ DLLSRMTL+EKIGQMVQI+R VAS 
Sbjct  35    VVGLFLVWWWMGLATVKADYIMYKDPTQPAAARVGDLLSRMTLEEKIGQMVQIDRSVASI  94

Query  405   QVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNN  584
               MK Y++GSVLS GGS P P ASAE WV+M+NGFQKG+LS+RLGIPMIYGIDAVHG+NN
Sbjct  95    DTMKTYFIGSVLSGGGSTPLPEASAEDWVNMINGFQKGALSSRLGIPMIYGIDAVHGHNN  154

Query  585   AYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYES  764
              YNATIFPHNVGLGATRDPELVR IG+ATALE RATGI YVFAPCIAVCRDPRWGRCYES
Sbjct  155   VYNATIFPHNVGLGATRDPELVRRIGSATALEARATGIPYVFAPCIAVCRDPRWGRCYES  214

Query  765   YSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENN  944
             YSED  IV+ MTEIIPGLQG+ P N     P+V G +KVAACAKH+VGDGGT KGI+E N
Sbjct  215   YSEDHTIVQEMTEIIPGLQGDIPANSQKGVPYVGGNKKVAACAKHFVGDGGTSKGINEYN  274

Query  945   TLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFV  1124
             T+VD  +L SIHM  Y ++II+GV+TVM SYSS NG +MHANRD+IT +LK TL+F+GFV
Sbjct  275   TVVDQQELLSIHMPAYSDAIIKGVSTVMISYSSWNGKKMHANRDLITDYLKGTLQFKGFV  334

Query  1125  ISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRI  1304
             ISD++ ID +T   H NYTYS+  S+ AGIDMVMVP NY EFI+ L  LVKN  VP+ RI
Sbjct  335   ISDWEGIDRITSPPHSNYTYSVQDSVLAGIDMVMVPINYKEFINDLINLVKNNVVPMDRI  394

Query  1305  DDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD--E  1478
             DDA  RIL VKF MGLFE+PL D+SL + LGS+ HR LAR+AVRKS+VLLKNG N +  +
Sbjct  395   DDAAGRILLVKFTMGLFENPLADFSLVNELGSQDHRDLAREAVRKSVVLLKNGKNGNITD  454

Query  1479  PVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQ  1655
             PV+PL KK S+ILVAG+HADN+GYQCGGWTI WQG SGN  T GTTIL AIK+ VD+ T+
Sbjct  455   PVIPLPKKVSKILVAGSHADNLGYQCGGWTIAWQGFSGNKYTSGTTILGAIKSAVDSSTE  514

Query  1656  VMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVV  1835
             V++ ENPD  FVKS+ F +AIVVVGE  YAE +GDS NL + EPGPS+ +NVC   KC+V
Sbjct  515   VIYSENPDGNFVKSNNFXYAIVVVGEHXYAETAGDSPNLMMAEPGPSVXSNVCESVKCIV  574

Query  1836  VLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
              LITGRP+VI+PY+  IDALVAAWLPG+EGQG+ DVLFGD GFSGKLP TWF+TVDQ
Sbjct  575   XLITGRPIVIEPYISSIDALVAAWLPGSEGQGITDVLFGDXGFSGKLPRTWFRTVDQ  631



>ref|XP_003624652.1| Periplasmic beta-glucosidase [Medicago truncatula]
 gb|ABD28427.1| Glycoside hydrolase, family 3, N-terminal; Glycoside hydrolase, 
family 3, C-terminal [Medicago truncatula]
 gb|AES80870.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=632

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/601 (67%), Positives = 494/601 (82%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWV-VVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M K   FL+G  LL  W  ++   D M YK+  + +  R++DL+SRMTL+EKIGQM+QIE
Sbjct  1     MAKIPIFLVGFWLLSNWAGLLETEDMMKYKNPNESIDIRVEDLISRMTLEEKIGQMLQIE  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R+ AS  V+ KY++GSV+S GGS P P+ASAE W+DM+N FQK +LSTRLGIP+ YGIDA
Sbjct  61    RKYASDNVLNKYFIGSVMSEGGSTPVPQASAENWIDMLNEFQKDALSTRLGIPIFYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHGN+  Y ATIFPHN+GLGATRDPELV+ IGAATALEVRATG+QYV+APCIAVCRDPRW
Sbjct  121   VHGNSPVYKATIFPHNIGLGATRDPELVKRIGAATALEVRATGMQYVYAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP++V+AMTEIIPG+QG+ P N P+  PF+AG EKV ACAKHYVGDGGT  
Sbjct  181   GRCYESYSEDPKVVQAMTEIIPGMQGDVPDNMPMGVPFIAGNEKVIACAKHYVGDGGTTN  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GIDE++T++D   L  IHM GY +SI +GVAT+M SYSS NG +MHA+ D+ITGFLK TL
Sbjct  241   GIDESDTVIDRDGLMEIHMPGYLSSISKGVATIMVSYSSWNGDKMHAHHDLITGFLKNTL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              F+GFVISDF+ ID +T     N TYS+   ++AGIDM MVP  YTEFID LT LV NKF
Sbjct  301   HFQGFVISDFEGIDRITSPFRANCTYSVQAGVSAGIDMFMVPKFYTEFIDDLTTLVNNKF  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAV+RILRVKF+MG+FE+P  DYSL  +LG ++H++LAR+AVRKS+VLLKNG 
Sbjct  361   IPMSRIDDAVRRILRVKFMMGIFENPFADYSLVKYLGIKEHKELAREAVRKSMVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITI-GTTILTAIKNTVD  1643
             +A++P+LPL KK  +ILVAG+HA+N+GYQCGGWTIEWQG++GN  I GTTIL A+KNTVD
Sbjct  421   SAEKPLLPLPKKVPKILVAGSHANNLGYQCGGWTIEWQGVNGNDDIKGTTILNAVKNTVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
              +T V+++ENPD EF++S++F +AIVVVGE  YAE  GD+ NLTIP PGP II NVC   
Sbjct  481   PETTVIYKENPDKEFLESNEFCYAIVVVGEHPYAEMHGDNMNLTIPNPGPEIITNVCGAM  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVV++I+GRP+VI+PY+  IDA+VA WLPG+EGQGVADVLFGDYGF+GKLP TWFK+VD
Sbjct  541   KCVVIIISGRPLVIEPYVGLIDAVVAGWLPGSEGQGVADVLFGDYGFTGKLPRTWFKSVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_002523935.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF38422.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=632

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/577 (73%), Positives = 487/577 (84%), Gaps = 2/577 (0%)
 Frame = +3

Query  282   YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvp  461
             Y+ YKD +Q +G RIKDL+ RMTL+EKIGQMVQIER VA+  VM+KY++GSVLS GGSVP
Sbjct  29    YLKYKDPKQRLGVRIKDLMKRMTLEEKIGQMVQIERAVATPDVMEKYFIGSVLSGGGSVP  88

Query  462   kpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDP  641
              P+ASAE W++ VN  QKG+LSTRLGIPMIYGIDAVHG+NN Y ATIFPHNVGLG TRDP
Sbjct  89    APKASAETWINAVNTIQKGALSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGVTRDP  148

Query  642   ELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQ  821
             +LV+ IG ATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSED  IV+AMTEIIPGLQ
Sbjct  149   QLVKRIGEATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSEDHRIVQAMTEIIPGLQ  208

Query  822   GEAPPNYPLSFPFVA-GREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYN  998
             G+ P N     PFVA G+ KVAACAKHYVGDGGT +GI+ENNT++  + L +IHM  Y+N
Sbjct  209   GDLPANSKKGIPFVATGKTKVAACAKHYVGDGGTTRGINENNTVISLNGLLNIHMPAYFN  268

Query  999   SIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNY  1178
             +I +GVATVM SYSS NG +MHAN D++TGFLK  L+FRGF+ISD++ ID +T   H NY
Sbjct  269   AISKGVATVMVSYSSWNGKKMHANHDLVTGFLKNKLKFRGFMISDWQGIDRITSPPHANY  328

Query  1179  TYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFE  1358
             +YS+   + AGIDMVMVPYN+TEFID LTY VKNK +P+SRI+DAV+RILRVKF MGLFE
Sbjct  329   SYSVEAGVGAGIDMVMVPYNFTEFIDDLTYQVKNKIIPMSRINDAVQRILRVKFTMGLFE  388

Query  1359  DPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHAD  1538
             +PL D SL + LGS++HR+LAR+AVRKSLVLLKNG +AD+P+LPL KKA +ILVAGTHAD
Sbjct  389   NPLADLSLVNQLGSQEHRELAREAVRKSLVLLKNGESADKPLLPLPKKAPKILVAGTHAD  448

Query  1539  NIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHA  1715
             N+G QCGGWTI WQGL+GN +T GTTIL A+K+TVD  TQV++ ENPDP FVKS+KFS+A
Sbjct  449   NLGNQCGGWTITWQGLNGNDLTSGTTILNAVKHTVDHTTQVVYSENPDPNFVKSNKFSYA  508

Query  1716  IVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDAL  1895
             IVVVGE  YAE  GDS NLTIPEPG S I NVC   KCVVV+I+GRPVV+QPYL  IDAL
Sbjct  509   IVVVGEPPYAETFGDSLNLTIPEPGRSTINNVCVFVKCVVVVISGRPVVVQPYLSNIDAL  568

Query  1896  VAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VAAWLPGTEGQGVAD+LFGDYGF+GKL  TWFKTVDQ
Sbjct  569   VAAWLPGTEGQGVADLLFGDYGFTGKLARTWFKTVDQ  605



>emb|CDP15622.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/603 (68%), Positives = 483/603 (80%), Gaps = 4/603 (1%)
 Frame = +3

Query  210   MGKGSRF-LIGVALLCCWVVVA-NADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             MG    F  +G+  L  W  VA   +Y+LYKD +QP  RRI DL+SRMTL+EKIGQM Q+
Sbjct  1     MGSSGFFPTVGILFLFAWGAVAEQGEYILYKDPKQPAFRRINDLMSRMTLEEKIGQMTQL  60

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             +R   + +++K Y +GS+LS GGSVP P A+ + WVDM+N FQKGSLS+RLGIPM+YGID
Sbjct  61    DRVYTTPEILKNYSIGSLLSGGGSVPLPNATPKDWVDMINNFQKGSLSSRLGIPMVYGID  120

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN Y ATIFPHN+GLG+TRDPELVR IGAATALEVRATGIQY FAPCIAVCRDPR
Sbjct  121   AVHGHNNVYKATIFPHNIGLGSTRDPELVRRIGAATALEVRATGIQYAFAPCIAVCRDPR  180

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSEDP+IV+ MTEII GLQGE PP      P+V G +KVAACAKH+VGDGGT 
Sbjct  181   WGRCYESYSEDPQIVKEMTEIIKGLQGEIPPGGRKGVPYVGGPDKVAACAKHFVGDGGTT  240

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
             KGI+ENNT+ D H L SIHM GY  SII+GV+TVM SYSS NG++MHANR+++T FLK  
Sbjct  241   KGINENNTVTDWHRLMSIHMPGYDASIIKGVSTVMVSYSSYNGLKMHANRNLVTDFLKGR  300

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             +RFRGFVISD++ ID +T   H NYT S+L  I+AGIDM+MVP N+T+FID LTYLVKN 
Sbjct  301   MRFRGFVISDWQGIDKITTPAHANYTLSVLDGISAGIDMIMVPDNHTDFIDSLTYLVKNN  360

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
             ++PVSRIDDAV+RILRVKF +GLFE P  DY+    LGS+ HR LAR+AVRKSLVLLKNG
Sbjct  361   YIPVSRIDDAVRRILRVKFTLGLFEKPYADYTYIDQLGSQAHRDLAREAVRKSLVLLKNG  420

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTV  1640
              NADEP +PL KKA +ILV GTHA N+GYQCGGWTI WQGLSG N T GTTIL  I   V
Sbjct  421   NNADEPFIPLSKKARKILVTGTHAHNLGYQCGGWTIAWQGLSGNNHTTGTTILNGIIAAV  480

Query  1641  DTKTQVMFEENPD-PEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCP  1817
             D  T+V+++E+ D  +FV  + F +AIVVVGE  YAE +GD++NLTIPEPGPS I NVC 
Sbjct  481   DHGTEVVYKESIDGSDFVTDNNFDYAIVVVGEPPYAETAGDNANLTIPEPGPSTITNVCS  540

Query  1818  HTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKT  1997
               KC VV+++GRP+V++PYL  IDALVAAWLPGTEGQGVADVLFGDYGF+GK   TWFKT
Sbjct  541   SVKCAVVVVSGRPLVVEPYLSSIDALVAAWLPGTEGQGVADVLFGDYGFTGKTSRTWFKT  600

Query  1998  VDQ  2006
             V+Q
Sbjct  601   VEQ  603



>ref|XP_010067089.1| PREDICTED: lysosomal beta glucosidase [Eucalyptus grandis]
 ref|XP_010067090.1| PREDICTED: lysosomal beta glucosidase [Eucalyptus grandis]
 gb|KCW65161.1| hypothetical protein EUGRSUZ_G02657 [Eucalyptus grandis]
Length=669

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/602 (69%), Positives = 494/602 (82%), Gaps = 6/602 (1%)
 Frame = +3

Query  219   GSRFLIGVALLCCWVVVAN-----ADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             G  FL  + +L  W  VA+     ADY+ YKD +QPV  R+KDLLSRMTL+EKIGQM QI
Sbjct  2     GGAFLRTLGVLTLWWFVASVMAQSADYVAYKDPKQPVAARVKDLLSRMTLEEKIGQMTQI  61

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             +R VA+   MK Y +GSVLS GGS P P ASAE WV+M+NG+QKG+LS+RLGIPMIYGID
Sbjct  62    DRMVATDDFMKTYSIGSVLSGGGSTPLPEASAEDWVNMINGYQKGALSSRLGIPMIYGID  121

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN YNATIFPHN+GLGATRDP+LV++IGAATALEVRATGI YVFAPCIAVCRDPR
Sbjct  122   AVHGHNNVYNATIFPHNIGLGATRDPKLVKKIGAATALEVRATGIPYVFAPCIAVCRDPR  181

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSE+ +IVR MTEIIPGLQG+ P       P+V G+ KVAACAKH+VGDGGT 
Sbjct  182   WGRCYESYSENEDIVRQMTEIIPGLQGDIPSGSRKGVPYVDGKNKVAACAKHFVGDGGTS  241

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
             KGI+E+NT+VD H L SIHM  Y ++II+GV+TVM SYSS NG +MHANRD++TGFLK T
Sbjct  242   KGINEDNTVVDMHGLLSIHMPAYTDAIIKGVSTVMVSYSSWNGEKMHANRDLVTGFLKNT  301

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L+F+GFVISD++ ID +T   H NYTYS+   I AGIDMVMVP+N+TEFI+ LTYLVK K
Sbjct  302   LKFKGFVISDWQGIDRITSPPHANYTYSVEAGILAGIDMVMVPFNFTEFINDLTYLVKEK  361

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+ RIDDAV RIL VKF MGLFE+PL D SL + LGS+ HR+LAR+AVR SLVLLKNG
Sbjct  362   VIPMDRIDDAVGRILFVKFTMGLFENPLADLSLVNELGSQAHRELAREAVRNSLVLLKNG  421

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTV  1640
              N  +P+LPL KK  +ILVAG+HADN+GYQCGGWTI WQG SG N T GTTIL+AI +TV
Sbjct  422   KNETDPLLPLPKKPKKILVAGSHADNLGYQCGGWTITWQGFSGNNYTRGTTILSAINSTV  481

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  T+V+++ENPD +FVKS+ F +AIVVVGE  YAE +GDS+ LT+ +PGP+ I NVC  
Sbjct  482   DLSTEVVYQENPDKDFVKSTDFDYAIVVVGEHPYAETAGDSTTLTMADPGPTTITNVCEA  541

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVV++++GRP+VI+PY+  IDALVAAWLPGTEGQGVADVLFGDYGFSGKLP TWFK+V
Sbjct  542   MKCVVIVVSGRPLVIEPYISSIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPRTWFKSV  601

Query  2001  DQ  2006
             DQ
Sbjct  602   DQ  603



>ref|XP_010313473.1| PREDICTED: lysosomal beta glucosidase isoform X3 [Solanum lycopersicum]
Length=641

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/602 (69%), Positives = 498/602 (83%), Gaps = 1/602 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             EKMG+ S  ++G  +LC W VVA   YM YKD +QP+G RIKDLL RMTL+EKIGQM QI
Sbjct  11    EKMGRMSIPMMGFVVLCLWAVVAEGGYMKYKDPKQPLGVRIKDLLKRMTLEEKIGQMTQI  70

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             ER VA+A VMK+ ++GSVLS GGSVP P+A+A+ W +MV+G QKG+LSTRLGIPMIYGID
Sbjct  71    ERAVATADVMKQNFIGSVLSGGGSVPAPKATAQVWTNMVDGIQKGALSTRLGIPMIYGID  130

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN Y ATIFPHNVGLG TRDP+LV+ IGAATALEVRATGI Y FAPCIAVCR+PR
Sbjct  131   AVHGHNNVYGATIFPHNVGLGVTRDPDLVKRIGAATALEVRATGIPYAFAPCIAVCRNPR  190

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSED  IV+ MTEIIPGLQG+ P       P+V G+ KVAACAKH+VGDGGT 
Sbjct  191   WGRCYESYSEDYRIVKTMTEIIPGLQGDLPAKSKNGVPYVGGKTKVAACAKHFVGDGGTK  250

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
              G+DE+NT++ ++DLF IHM  YY+S+ +GV+TVM SYSS NG +MHANRD+ITGFLK  
Sbjct  251   NGVDESNTIISSNDLFDIHMPAYYDSLRKGVSTVMVSYSSWNGRKMHANRDLITGFLKNK  310

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L+FRGFVISD++ +D +T   H NY+YS+   I AGIDM+MVP NY EFID LT  VK  
Sbjct  311   LKFRGFVISDWQGLDRITDPPHANYSYSVQAGITAGIDMIMVPENYREFIDTLTSQVKAN  370

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAVKRILRVKFVMGLFE+P+ D SLA+ LGS++HR LAR+AVRKSLVLLKNG
Sbjct  371   IIPMSRIDDAVKRILRVKFVMGLFENPMSDPSLANQLGSQEHRDLAREAVRKSLVLLKNG  430

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTV  1640
                  P+LPL KKA +ILVAGTHADN+GYQCGGWTI+WQG++GN +T+GTTIL+AIK TV
Sbjct  431   KTPSHPLLPLPKKAPKILVAGTHADNLGYQCGGWTIQWQGVAGNDLTVGTTILSAIKKTV  490

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  T+V++++NPD  FVKS+KFS+AIVVVGE  YAE  GDSSNLTI EPGPS I NVC  
Sbjct  491   DPSTEVVYQQNPDANFVKSNKFSYAIVVVGEVPYAEMFGDSSNLTITEPGPSTINNVCGA  550

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVVV+++GRPVV++PY+ ++DALVAAWLPGTEGQGV D LFGDYGF+GKL  TWFK+V
Sbjct  551   VKCVVVVVSGRPVVMEPYVAKMDALVAAWLPGTEGQGVTDALFGDYGFTGKLARTWFKSV  610

Query  2001  DQ  2006
             DQ
Sbjct  611   DQ  612



>ref|XP_006379440.1| hypothetical protein POPTR_0008s01410g [Populus trichocarpa]
 gb|ERP57237.1| hypothetical protein POPTR_0008s01410g [Populus trichocarpa]
Length=654

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/600 (68%), Positives = 491/600 (82%), Gaps = 10/600 (2%)
 Frame = +3

Query  222   SRFLIGVALLCCWVVV----ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             +R L+ +  +  W++V    A  + + YKD +QPV  RIKDL+SRMTL+EKIGQMVQI+R
Sbjct  2     ARILMKMMGIMLWLMVLIEMAVGEDVKYKDPKQPVAVRIKDLMSRMTLEEKIGQMVQIDR  61

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
               AS  +M+ Y +GSVLS GGS P P ASAE WV+M+NGFQ GSLS+RLGIPMIYGIDAV
Sbjct  62    LTASPDIMQTYCIGSVLSGGGSAPLPNASAEDWVNMINGFQHGSLSSRLGIPMIYGIDAV  121

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN +NATIFPHN+GLGATR     + IG+ATALEVRATGI YVFAPCIAVC+DPRWG
Sbjct  122   HGHNNVFNATIFPHNIGLGATR-----QRIGSATALEVRATGIPYVFAPCIAVCKDPRWG  176

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED ++V+AMTEIIPGLQG+ P N     P+V G++KVAACAKH+VGDGGT KG
Sbjct  177   RCYESYSEDHKVVQAMTEIIPGLQGDIPVNSRKGVPYVGGKKKVAACAKHFVGDGGTTKG  236

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++D H L SIHM  Y +SII+GV+T+M SYSS NG +MHANR++ITGFLK TL+
Sbjct  237   INENNTVIDKHGLLSIHMPAYSDSIIKGVSTIMVSYSSWNGEKMHANRELITGFLKNTLK  296

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISD++ ID +T     NY+YS+  +I AGIDMVM+P+N+TEFID LTYLVK   +
Sbjct  297   FKGFVISDWQGIDRITSPPRANYSYSVQAAIQAGIDMVMLPFNHTEFIDDLTYLVKTNVI  356

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             PV RIDDAV RIL VKF +GLFE+PL D SL + LGS+ HR LAR+AVRKSLVLLKNG N
Sbjct  357   PVDRIDDAVGRILLVKFTLGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVLLKNGKN  416

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
               +P+LPL +K S+ILVAGTHADN+GYQCGGWTI+WQG SGN  T GTTIL AIK+TVD 
Sbjct  417   ETDPLLPLPRKVSKILVAGTHADNLGYQCGGWTIQWQGFSGNGYTRGTTILGAIKSTVDP  476

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V+F+ENPD +F+K + F++AI+VVGE  YAE +GDS +LT+ +PGPS+I+NVC   K
Sbjct  477   STEVVFQENPDSKFIKDNNFAYAIIVVGEAPYAETAGDSMDLTMIDPGPSVISNVCETVK  536

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+I+GRP+VI+PYL  IDALVAAWLPGTEGQGVAD LFGDYGF+GKLP TWFK VDQ
Sbjct  537   CVVVVISGRPIVIEPYLSSIDALVAAWLPGTEGQGVADALFGDYGFTGKLPRTWFKNVDQ  596



>ref|XP_007161966.1| hypothetical protein PHAVU_001G112700g [Phaseolus vulgaris]
 gb|ESW33960.1| hypothetical protein PHAVU_001G112700g [Phaseolus vulgaris]
Length=631

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/579 (68%), Positives = 489/579 (84%), Gaps = 1/579 (0%)
 Frame = +3

Query  273   NADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssgg  452
             +A+YM YKD +Q V  R++DL+SRMTL+EKIGQM+QIER+ ASA ++KKY++GSV+S GG
Sbjct  22    DAEYMKYKDPKQSVDTRVEDLVSRMTLEEKIGQMLQIERKYASADLVKKYFIGSVMSEGG  81

Query  453   svpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGAT  632
             S+P P+ASAE W++MVN FQKG+LSTRLGIPM YGIDAVHG++  Y ATIFPHN+GLGAT
Sbjct  82    SIPAPQASAETWINMVNEFQKGALSTRLGIPMFYGIDAVHGHSTIYKATIFPHNIGLGAT  141

Query  633   RDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIP  812
             RDPELV+ IGAATALEVRATGIQY +APCIAVCRDPRWGRCYESYSEDP++V+ MTEIIP
Sbjct  142   RDPELVKRIGAATALEVRATGIQYAYAPCIAVCRDPRWGRCYESYSEDPKLVQVMTEIIP  201

Query  813   GLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGY  992
             GLQG+ P N P   PF+ G+EKV ACAKHYVGDGGT+ G+DENNT+++  +L  IHM  Y
Sbjct  202   GLQGDIPDNLPKGVPFITGKEKVLACAKHYVGDGGTINGVDENNTVINRDELMKIHMPAY  261

Query  993   YNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHG  1172
             +NSI +GVAT+M SYSS NGV+MHAN ++ITGFLK TL F+GFVISDF+ ID +T   H 
Sbjct  262   FNSISKGVATIMVSYSSWNGVKMHANHELITGFLKNTLHFKGFVISDFEGIDRITSPPHS  321

Query  1173  NYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGL  1352
             N+TYS+   ++AGIDM M P  Y EFI+ LT LVKNK +P+SRIDDAV+RIL VKF+MG+
Sbjct  322   NFTYSVEAGVSAGIDMFMNPKLYIEFINDLTMLVKNKHIPMSRIDDAVRRILWVKFMMGI  381

Query  1353  FEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTH  1532
             FE+P  DYSLA +LG ++HR LAR+AVRKS+VL+KNG +AD+P+LPL KK  +ILVAG+H
Sbjct  382   FENPFADYSLAKYLGIQEHRNLAREAVRKSMVLVKNGESADKPLLPLPKKVPKILVAGSH  441

Query  1533  ADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFS  1709
             ADN+GYQCGGWTIEWQG++G N+  GTTIL A+KNTVD +T+V++++NPD EFVKS+ FS
Sbjct  442   ADNLGYQCGGWTIEWQGVNGNNLLKGTTILNAVKNTVDPETKVVYKKNPDAEFVKSNGFS  501

Query  1710  HAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQID  1889
             +AIVVVGE  YAE  GD+ NLTI + GP  I NVC   KCVV++I+GRP+VI+PY+  ID
Sbjct  502   YAIVVVGEHPYAEMHGDNMNLTISDFGPETITNVCGAIKCVVIIISGRPLVIEPYVGIID  561

Query  1890  ALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             ALVA WLPG+EGQGVADVL+G+YGF+GKLP TWFK+VDQ
Sbjct  562   ALVAGWLPGSEGQGVADVLYGEYGFTGKLPRTWFKSVDQ  600



>ref|XP_007205098.1| hypothetical protein PRUPE_ppa014607mg [Prunus persica]
 gb|EMJ06297.1| hypothetical protein PRUPE_ppa014607mg [Prunus persica]
Length=602

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/575 (69%), Positives = 474/575 (82%), Gaps = 1/575 (0%)
 Frame = +3

Query  285   MLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpk  464
             M YKD  +P+  RIKDL+ RMTL EKIGQM Q++RQ  +A++M+ Y +GS+LS GGSVP+
Sbjct  1     MAYKDPNKPINIRIKDLMDRMTLAEKIGQMTQLDRQNVTAEIMRDYSIGSLLSGGGSVPR  60

Query  465   pRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPE  644
              RA+ + W++MVN FQ GSLSTRLGIPMIYGIDAVHG+NN Y ATIFPHNVGLGATRDPE
Sbjct  61    LRANPQDWINMVNDFQNGSLSTRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGATRDPE  120

Query  645   LVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQG  824
             LV++IGAATALE+RATGI Y FAPCIAVCRDPRWGRCYESYSEDPEIV+ MT+II GLQG
Sbjct  121   LVKKIGAATALELRATGITYAFAPCIAVCRDPRWGRCYESYSEDPEIVKQMTDIILGLQG  180

Query  825   EAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSI  1004
             + P       P+V G++KV ACAKH+VGDGGT+KGI+ENNT++D H L SIHM  YY+SI
Sbjct  181   DIPAGSRKGVPYVGGKDKVVACAKHFVGDGGTIKGINENNTVIDMHGLMSIHMPAYYHSI  240

Query  1005  IRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTY  1184
             I+GV+T+M SYSS NG +MHAN +++T FLK TL+F+GFVISD++ ID ++  +H +Y  
Sbjct  241   IKGVSTIMVSYSSWNGKKMHANHELVTRFLKDTLKFKGFVISDWQGIDKISYPLHSDYPN  300

Query  1185  SILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDP  1364
             S+L  I AGIDMVMVPYNYTEFI  +T  V NK +P+SRIDDAV+RILRVKF+MGLFE+P
Sbjct  301   SVLVGIQAGIDMVMVPYNYTEFIGIVTDHVNNKRIPISRIDDAVRRILRVKFMMGLFENP  360

Query  1365  LGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNI  1544
             L D S    LGS+ HR LAR+AVRKSLVLLKNG NAD PVLPL KKASRILVAGTHA+N+
Sbjct  361   LADQSFVDQLGSQAHRDLAREAVRKSLVLLKNGENADTPVLPLPKKASRILVAGTHANNL  420

Query  1545  GYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIV  1721
             GYQCGGW++ WQG+SG N T GTTIL AI + V+  T ++F  NPDP FV +S F +A+V
Sbjct  421   GYQCGGWSLTWQGVSGNNYTAGTTILGAIASAVNETTDIVFSINPDPNFVTASNFDYAVV  480

Query  1722  VVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVA  1901
              VGE  YAE  GDS NLTIPEPGPSII NVC   KCVV++++GRPVVI+PYL  IDALVA
Sbjct  481   AVGEVPYAETRGDSLNLTIPEPGPSIITNVCGAVKCVVIVVSGRPVVIEPYLSSIDALVA  540

Query  1902  AWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             AWLPGTEGQG++DVLFGDYGFSGKLP TWFKTVDQ
Sbjct  541   AWLPGTEGQGISDVLFGDYGFSGKLPRTWFKTVDQ  575



>ref|XP_006445671.1| hypothetical protein CICLE_v10014537mg [Citrus clementina]
 ref|XP_006485522.1| PREDICTED: lysosomal beta glucosidase-like [Citrus sinensis]
 gb|ESR58911.1| hypothetical protein CICLE_v10014537mg [Citrus clementina]
Length=659

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/600 (67%), Positives = 484/600 (81%), Gaps = 3/600 (1%)
 Frame = +3

Query  216   KGSRFLIGVALL--CCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             K  R L+   LL     +  ANA+Y  YKD +QPV  R+KDLL RM+L+EKIGQMVQI+R
Sbjct  2     KTVRILMRAVLLGMVSLLSFANAEYAKYKDPKQPVAVRVKDLLGRMSLEEKIGQMVQIDR  61

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              +A+ Q +K Y +GSVLS GGS P P+ASA  W++M+N FQ+GSL++RLGIPMIYGIDAV
Sbjct  62    TIATVQFLKDYSIGSVLSGGGSTPLPQASAADWINMINDFQRGSLASRLGIPMIYGIDAV  121

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHNVGLGATRDPELV+ IGAATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  122   HGHNNVYNATIFPHNVGLGATRDPELVKRIGAATALEVRATGIPYVFAPCIAVCRDPRWG  181

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED +IV+ MT++I GLQG+ P N     P+V G++KVAACAKH+VGDGGT  G
Sbjct  182   RCYESYSEDHKIVQEMTDVILGLQGDPPSNLRKGVPYVGGKDKVAACAKHFVGDGGTTNG  241

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++D H L SIHM  Y +SII+GV+T+M SYSS NG +MHANR+++TGFLK TL+
Sbjct  242   INENNTVIDMHGLLSIHMPAYSDSIIKGVSTIMVSYSSWNGEKMHANRELVTGFLKGTLK  301

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+GFVISD++ ID +T   H NYTYS+   I AGIDMVM+P+N TEFID LT LVKN  +
Sbjct  302   FKGFVISDWQGIDRITSPPHSNYTYSVQAGIQAGIDMVMIPFNLTEFIDDLTDLVKNNVI  361

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
              + RIDDAV RIL VKF MGLFE+PL D SL + LGS+ HR LAR+AVRKSLVLLKNG N
Sbjct  362   TMDRIDDAVGRILLVKFSMGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVLLKNGKN  421

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
                P++PL KKA +ILVAG+HADN+GYQCGGWTI WQG SG N T GTTIL AI++ VD+
Sbjct  422   ESHPLIPLPKKAPKILVAGSHADNLGYQCGGWTINWQGFSGNNYTRGTTILGAIRSAVDS  481

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V++ +NPD +FVKS+ F +AIV VGE  YAE +GDS  LT+ +P PS+I NVC   K
Sbjct  482   STEVVYRDNPDSDFVKSNNFDYAIVAVGEAPYAESAGDSMTLTMLDPDPSVITNVCEAVK  541

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVV++I+GRP+VI+PY+  +DALVAAWLPGTEGQGV DVLFGDYGFSGKLP +WFKTVDQ
Sbjct  542   CVVIIISGRPIVIEPYISSVDALVAAWLPGTEGQGVTDVLFGDYGFSGKLPRSWFKTVDQ  601



>ref|XP_002523937.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF38424.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=625

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/600 (68%), Positives = 497/600 (83%), Gaps = 4/600 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M + S  L+G+ L+ C    A+A+Y+ YKD  QP+  RI+D++ RMTL EKIGQMVQ++R
Sbjct  1     MARISIPLLGLFLVLCCFAAADAEYLKYKDPSQPLNVRIRDVMKRMTLAEKIGQMVQLDR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              V + ++M+ Y +GS+LS GGSVPK +A+ + W+DMVN FQ GSLS+RLGIPMIYGIDAV
Sbjct  61    SVVTPEIMRDYSIGSILSGGGSVPKEQATPQEWIDMVNSFQNGSLSSRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y AT+FPHNVGLGATRDPELV+ IGAATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYKATLFPHNVGLGATRDPELVKRIGAATALEVRATGINYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RC+ESYSE+P +V++MTEIIPGLQG++P       P+V G +KVAACAKH+VGDGGT KG
Sbjct  181   RCFESYSENPSVVKSMTEIIPGLQGDSPNK---GVPYVGGNDKVAACAKHFVGDGGTTKG  237

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++D H L SIHM GY +S+I+GV+TVM SYSS NG++MHANRD++TGFLK+TL 
Sbjct  238   INENNTVIDYHGLLSIHMPGYLHSVIKGVSTVMVSYSSWNGIKMHANRDLVTGFLKETLN  297

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+L  ++AGIDMVMVP+N+T+FID LT  VKN  +
Sbjct  298   FRGFVISDWQGIDRITSPAHANYSYSVLKGVSAGIDMVMVPFNHTDFIDILTGFVKNNVI  357

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRI+DAV+RILRVKF MGLFE+ L D S  HHLGS+ HR LAR+AVRKSLVLLKNG N
Sbjct  358   PMSRINDAVRRILRVKFAMGLFENSLADQSFVHHLGSQAHRDLAREAVRKSLVLLKNGQN  417

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             AD P+LPL KKA RILVAGTHA+N+GYQCGGWT+ WQGL G N T+GTTIL AI   VDT
Sbjct  418   ADTPLLPLSKKAGRILVAGTHANNLGYQCGGWTLTWQGLGGNNNTVGTTILNAISTAVDT  477

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T++++ E+PD +FVK++ FS+AIVVVGE  YAE  GD  NLTI EPGP++I NVC   K
Sbjct  478   STEIVYSEDPDADFVKANNFSYAIVVVGELPYAETFGDRLNLTIAEPGPTVITNVCGSVK  537

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRP+VI+P++  IDALVAAWLPG+EGQGVADVLFGDYGF+GKLP TWFK VDQ
Sbjct  538   CVVVVVSGRPLVIEPHISPIDALVAAWLPGSEGQGVADVLFGDYGFTGKLPRTWFKYVDQ  597



>ref|XP_004251206.1| PREDICTED: lysosomal beta glucosidase isoform X2 [Solanum lycopersicum]
Length=670

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/602 (69%), Positives = 498/602 (83%), Gaps = 1/602 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             EKMG+ S  ++G  +LC W VVA   YM YKD +QP+G RIKDLL RMTL+EKIGQM QI
Sbjct  40    EKMGRMSIPMMGFVVLCLWAVVAEGGYMKYKDPKQPLGVRIKDLLKRMTLEEKIGQMTQI  99

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             ER VA+A VMK+ ++GSVLS GGSVP P+A+A+ W +MV+G QKG+LSTRLGIPMIYGID
Sbjct  100   ERAVATADVMKQNFIGSVLSGGGSVPAPKATAQVWTNMVDGIQKGALSTRLGIPMIYGID  159

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN Y ATIFPHNVGLG TRDP+LV+ IGAATALEVRATGI Y FAPCIAVCR+PR
Sbjct  160   AVHGHNNVYGATIFPHNVGLGVTRDPDLVKRIGAATALEVRATGIPYAFAPCIAVCRNPR  219

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSED  IV+ MTEIIPGLQG+ P       P+V G+ KVAACAKH+VGDGGT 
Sbjct  220   WGRCYESYSEDYRIVKTMTEIIPGLQGDLPAKSKNGVPYVGGKTKVAACAKHFVGDGGTK  279

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
              G+DE+NT++ ++DLF IHM  YY+S+ +GV+TVM SYSS NG +MHANRD+ITGFLK  
Sbjct  280   NGVDESNTIISSNDLFDIHMPAYYDSLRKGVSTVMVSYSSWNGRKMHANRDLITGFLKNK  339

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L+FRGFVISD++ +D +T   H NY+YS+   I AGIDM+MVP NY EFID LT  VK  
Sbjct  340   LKFRGFVISDWQGLDRITDPPHANYSYSVQAGITAGIDMIMVPENYREFIDTLTSQVKAN  399

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAVKRILRVKFVMGLFE+P+ D SLA+ LGS++HR LAR+AVRKSLVLLKNG
Sbjct  400   IIPMSRIDDAVKRILRVKFVMGLFENPMSDPSLANQLGSQEHRDLAREAVRKSLVLLKNG  459

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTV  1640
                  P+LPL KKA +ILVAGTHADN+GYQCGGWTI+WQG++GN +T+GTTIL+AIK TV
Sbjct  460   KTPSHPLLPLPKKAPKILVAGTHADNLGYQCGGWTIQWQGVAGNDLTVGTTILSAIKKTV  519

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  T+V++++NPD  FVKS+KFS+AIVVVGE  YAE  GDSSNLTI EPGPS I NVC  
Sbjct  520   DPSTEVVYQQNPDANFVKSNKFSYAIVVVGEVPYAEMFGDSSNLTITEPGPSTINNVCGA  579

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVVV+++GRPVV++PY+ ++DALVAAWLPGTEGQGV D LFGDYGF+GKL  TWFK+V
Sbjct  580   VKCVVVVVSGRPVVMEPYVAKMDALVAAWLPGTEGQGVTDALFGDYGFTGKLARTWFKSV  639

Query  2001  DQ  2006
             DQ
Sbjct  640   DQ  641



>ref|XP_010313472.1| PREDICTED: lysosomal beta glucosidase isoform X1 [Solanum lycopersicum]
Length=671

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/602 (69%), Positives = 498/602 (83%), Gaps = 1/602 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             EKMG+ S  ++G  +LC W VVA   YM YKD +QP+G RIKDLL RMTL+EKIGQM QI
Sbjct  41    EKMGRMSIPMMGFVVLCLWAVVAEGGYMKYKDPKQPLGVRIKDLLKRMTLEEKIGQMTQI  100

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             ER VA+A VMK+ ++GSVLS GGSVP P+A+A+ W +MV+G QKG+LSTRLGIPMIYGID
Sbjct  101   ERAVATADVMKQNFIGSVLSGGGSVPAPKATAQVWTNMVDGIQKGALSTRLGIPMIYGID  160

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN Y ATIFPHNVGLG TRDP+LV+ IGAATALEVRATGI Y FAPCIAVCR+PR
Sbjct  161   AVHGHNNVYGATIFPHNVGLGVTRDPDLVKRIGAATALEVRATGIPYAFAPCIAVCRNPR  220

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSED  IV+ MTEIIPGLQG+ P       P+V G+ KVAACAKH+VGDGGT 
Sbjct  221   WGRCYESYSEDYRIVKTMTEIIPGLQGDLPAKSKNGVPYVGGKTKVAACAKHFVGDGGTK  280

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
              G+DE+NT++ ++DLF IHM  YY+S+ +GV+TVM SYSS NG +MHANRD+ITGFLK  
Sbjct  281   NGVDESNTIISSNDLFDIHMPAYYDSLRKGVSTVMVSYSSWNGRKMHANRDLITGFLKNK  340

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L+FRGFVISD++ +D +T   H NY+YS+   I AGIDM+MVP NY EFID LT  VK  
Sbjct  341   LKFRGFVISDWQGLDRITDPPHANYSYSVQAGITAGIDMIMVPENYREFIDTLTSQVKAN  400

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDAVKRILRVKFVMGLFE+P+ D SLA+ LGS++HR LAR+AVRKSLVLLKNG
Sbjct  401   IIPMSRIDDAVKRILRVKFVMGLFENPMSDPSLANQLGSQEHRDLAREAVRKSLVLLKNG  460

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTV  1640
                  P+LPL KKA +ILVAGTHADN+GYQCGGWTI+WQG++GN +T+GTTIL+AIK TV
Sbjct  461   KTPSHPLLPLPKKAPKILVAGTHADNLGYQCGGWTIQWQGVAGNDLTVGTTILSAIKKTV  520

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  T+V++++NPD  FVKS+KFS+AIVVVGE  YAE  GDSSNLTI EPGPS I NVC  
Sbjct  521   DPSTEVVYQQNPDANFVKSNKFSYAIVVVGEVPYAEMFGDSSNLTITEPGPSTINNVCGA  580

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVVV+++GRPVV++PY+ ++DALVAAWLPGTEGQGV D LFGDYGF+GKL  TWFK+V
Sbjct  581   VKCVVVVVSGRPVVMEPYVAKMDALVAAWLPGTEGQGVTDALFGDYGFTGKLARTWFKSV  640

Query  2001  DQ  2006
             DQ
Sbjct  641   DQ  642



>gb|KHN45535.1| Lysosomal beta glucosidase [Glycine soja]
Length=628

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/601 (69%), Positives = 492/601 (82%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S   +GV LL C V  + A+Y+ YKD + P+  RI DLL RM+L+EKIGQM QIER
Sbjct  1     MGRYSIPFMGVLLLFCLVSSSEAEYLKYKDPKAPLNVRISDLLKRMSLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+  VM KY++GSVLS GGSVP  +ASA  W  MVN  QK +LSTRLGIPMIYGIDAV
Sbjct  61    SVATPDVMNKYFIGSVLSGGGSVPATKASAATWQQMVNQMQKAALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATR-DPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             HG+NN YNAT+FPHNVGLG TR DP L+++IG ATALEVRATGI YVFAPCIAVCRDPRW
Sbjct  121   HGHNNVYNATVFPHNVGLGVTRQDPVLIKKIGEATALEVRATGIPYVFAPCIAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP+IV+ MTEIIPGLQG+ P N     PFVAG+ KVAACAKHY+GDGGT K
Sbjct  181   GRCYESYSEDPKIVKTMTEIIPGLQGDIPGNSIKGVPFVAGKNKVAACAKHYLGDGGTNK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNTL+  + L SIHM  YY+SII+GV+TVM SYSS NG++MHAN+ +ITG+LK  L
Sbjct  241   GINENNTLISYNGLLSIHMPAYYDSIIKGVSTVMISYSSWNGMKMHANKKLITGYLKNKL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              F+GFVISD++ ID +T   H NY+YS+   ++AGIDM+MVP+NYTEFID LT  VKN  
Sbjct  301   HFKGFVISDWQGIDRITSPPHANYSYSVQAGVSAGIDMIMVPFNYTEFIDELTRQVKNNI  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAV RILRVKFVMGLFE+P  D SLA+ LGS++HR++AR+AVRKSLVLLKNG 
Sbjct  361   IPISRIDDAVARILRVKFVMGLFENPYADPSLANQLGSKEHREIAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVD  1643
             +  +P+LPL KK+++ILVAG+HA+N+GYQCGGWTI WQGL GN +T GTTIL A+K TVD
Sbjct  421   SYKKPLLPLPKKSTKILVAGSHANNLGYQCGGWTITWQGLGGNDLTSGTTILDAVKQTVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T+V+F ENPD  FVKS KF +AIVVVGE TYAE  GDS NLT+ +PGPS I NVC   
Sbjct  481   PATEVVFNENPDKNFVKSYKFDYAIVVVGEHTYAETFGDSLNLTMADPGPSTITNVCGAI  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             +CVVVL+TGRPVVI+PYLP+IDALVAAWLPGTEGQGVADVL+GDY F+GKL  TWFKTVD
Sbjct  541   RCVVVLVTGRPVVIKPYLPKIDALVAAWLPGTEGQGVADVLYGDYEFTGKLARTWFKTVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_002456420.1| hypothetical protein SORBIDRAFT_03g035970 [Sorghum bicolor]
 gb|EES01540.1| hypothetical protein SORBIDRAFT_03g035970 [Sorghum bicolor]
Length=675

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/587 (69%), Positives = 481/587 (82%), Gaps = 0/587 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             LL C+V +A+A+YM YKD +QP+  RI+DL+ RMTL EKIGQM QIERQVASA VMKKY+
Sbjct  32    LLLCFVSMADAEYMKYKDPKQPINSRIRDLIGRMTLAEKIGQMTQIERQVASANVMKKYF  91

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GS+LS GGSVP P+AS   WV+MVN FQKG+LSTRLGIP+IYGIDAVHGNNN YNAT+F
Sbjct  92    IGSILSGGGSVPAPQASPAIWVNMVNEFQKGALSTRLGIPLIYGIDAVHGNNNVYNATLF  151

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHN+GLGATRDP L++ IG ATALEVRATGIQY FAPCIAVCRDPRWGRCYESYSED ++
Sbjct  152   PHNIGLGATRDPGLIKRIGEATALEVRATGIQYTFAPCIAVCRDPRWGRCYESYSEDHKV  211

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             V+ MT+II GLQGE P N+    P+VAG++KVAACAKHYVGDGGT  GI+ENNT++D H 
Sbjct  212   VQQMTDIILGLQGEIPVNHTKGVPYVAGKDKVAACAKHYVGDGGTHNGINENNTIIDEHG  271

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             L SIHM  YY+SII+GVATVM SYSSLNGV+MHAN  +ITG+LK  L FRGFVISD+  +
Sbjct  272   LLSIHMPPYYDSIIKGVATVMVSYSSLNGVKMHANHHLITGYLKSKLHFRGFVISDWLGV  331

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T     NYTYS+   INAGIDMVMVPYNYT++I+ LT LV    + +SRIDDAV+RI
Sbjct  332   DRITSPPGANYTYSVQAGINAGIDMVMVPYNYTDYINDLTSLVHKGVINMSRIDDAVRRI  391

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LRVKF MGLFE+PL D S A  LG ++HR+LAR+AVRKSLVLLKNG   ++  LPL K+A
Sbjct  392   LRVKFTMGLFENPLADLSFAEQLGKKEHRELAREAVRKSLVLLKNGNPPEQQFLPLPKRA  451

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPE  1685
               ILVAG+HA N+GYQCGGW+I+W G SG+IT GTTIL AIK+TV   T V++ ENPD  
Sbjct  452   RSILVAGSHASNLGYQCGGWSIKWMGGSGDITTGTTILGAIKSTVADSTSVVYSENPDDS  511

Query  1686  FVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVI  1865
             F+K + FS AI++VGE  YAE  GDS++LT+ +PGP  I  VC   KC VV+I+GRP+VI
Sbjct  512   FMKHNDFSFAIIIVGEPPYAETVGDSTDLTMLDPGPDTIRTVCSAVKCAVVIISGRPIVI  571

Query  1866  QPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +PY+P ++ALVAAWLPGTEGQGVADVLFGDYGF+GKLP TWFK+VDQ
Sbjct  572   EPYVPLMEALVAAWLPGTEGQGVADVLFGDYGFTGKLPQTWFKSVDQ  618



>ref|XP_009395658.1| PREDICTED: lysosomal beta glucosidase-like [Musa acuminata subsp. 
malaccensis]
Length=623

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/592 (69%), Positives = 487/592 (82%), Gaps = 0/592 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             ++G+  L CW     A+YM YKD  QPV  R+KDLL RMTL EKIGQM QIER+V++ QV
Sbjct  1     MLGILFLLCWTATIQAEYMKYKDPNQPVNVRVKDLLKRMTLAEKIGQMTQIEREVSTPQV  60

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             +K Y++GS+LS GGSVP PRASA+ WVDM+  FQK  LSTRLGIPMIYGIDAVHGNNN Y
Sbjct  61    LKDYFIGSILSGGGSVPSPRASAKDWVDMIYKFQKVCLSTRLGIPMIYGIDAVHGNNNVY  120

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
             NATIFPHN+GLGATRDP+LV++IG ATALE+RATGI Y FAPCIAVCRDPRWGRC+ESYS
Sbjct  121   NATIFPHNIGLGATRDPDLVKKIGVATALEIRATGIPYAFAPCIAVCRDPRWGRCFESYS  180

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED  +V+AMT+II GLQG+ P NY   FP+VAG+  VAACAKH+VGDGGT KGI+EN+TL
Sbjct  181   EDHRVVQAMTQIILGLQGDVPANYTKKFPYVAGKNNVAACAKHFVGDGGTHKGINENDTL  240

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             VD   L  IHM  YY+SI  GV+TVM S+SS  GV+MHA+R ++T FLKK L F+GFVIS
Sbjct  241   VDFSGLLRIHMPAYYDSIKMGVSTVMLSFSSWKGVKMHAHRFLVTDFLKKKLGFKGFVIS  300

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D+  ID LT     NYTYS+  SINAG+DMVMVP +Y  FI+ LT LV  K +P SRI+D
Sbjct  301   DWTGIDKLTTPTKANYTYSVEKSINAGLDMVMVPDDYLGFINNLTTLVNAKVIPKSRIND  360

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV+RILRVKF MGLFE+PL DYSL   LG ++HR+L+R+AVRKSLVLLKNG ++ +P+LP
Sbjct  361   AVRRILRVKFAMGLFENPLPDYSLVDQLGKKEHRELSREAVRKSLVLLKNGKSSKKPLLP  420

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEE  1670
             L KKA +ILVAG+HADN+GYQCGGWTIEW G SGNIT+GTTIL A++ TVD  T+V+F E
Sbjct  421   LPKKAGKILVAGSHADNLGYQCGGWTIEWHGSSGNITVGTTILEAVRATVDPSTKVVFSE  480

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
             NPD  FVKS+ FS+AIVVVGE +Y+E +GDS NLTIPEPGPS I +VC   KCVVV+I+G
Sbjct  481   NPDAGFVKSNNFSYAIVVVGEPSYSETAGDSLNLTIPEPGPSTIQSVCGAVKCVVVIISG  540

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RPVVI+PY+P +DALVAAWLPG+EGQGVADVLFGD+GF+GKLP TWFK+VDQ
Sbjct  541   RPVVIEPYVPSMDALVAAWLPGSEGQGVADVLFGDFGFTGKLPRTWFKSVDQ  592



>ref|XP_011094173.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Sesamum 
indicum]
Length=552

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/512 (75%), Positives = 443/512 (87%), Gaps = 0/512 (0%)
 Frame = +3

Query  471   ASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPELV  650
             AS + W+DMVNG+QKGSLSTRL IPM++GIDAVHGN+  Y ATIFPHNVGLGATRDPELV
Sbjct  13    ASPQTWIDMVNGYQKGSLSTRLKIPMLFGIDAVHGNSAVYRATIFPHNVGLGATRDPELV  72

Query  651   REIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEA  830
             + IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSEDP+IVRAMTEIIPGLQG+ 
Sbjct  73    KRIGAATALEVRATGIPYAFAPCIAVCRDPRWGRCYESYSEDPKIVRAMTEIIPGLQGDI  132

Query  831   PPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIR  1010
             P N     PF+AG++KV A AKHYVGDGGT KGI+ENNT+   HDL  IHM  YY+SII+
Sbjct  133   PANSRKGVPFLAGQQKVLATAKHYVGDGGTTKGINENNTVASRHDLLRIHMPAYYDSIIK  192

Query  1011  GVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSI  1190
             GV T+M SYSS NGV+MHANRD+ITGFLK TLRFRGFVISD++ +D +T   H NYTYSI
Sbjct  193   GVGTIMISYSSWNGVKMHANRDLITGFLKNTLRFRGFVISDWQGLDRITSPPHANYTYSI  252

Query  1191  LTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLG  1370
             +  + AGIDM+MVPYNYTEFIDGLT LVKN F+P+SRIDDAVKRILRVKF +GLFE PL 
Sbjct  253   IAGVGAGIDMIMVPYNYTEFIDGLTSLVKNNFIPMSRIDDAVKRILRVKFTIGLFEHPLA  312

Query  1371  DYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNIGY  1550
             DYS+  +LGS++HR+LAR+AVRKSLVLLKNG +A++P++PL KKAS+ILVAGTHADNIG 
Sbjct  313   DYSMTKYLGSQEHRELAREAVRKSLVLLKNGESANKPLIPLPKKASKILVAGTHADNIGN  372

Query  1551  QCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVG  1730
             QCGGWTI+ QG  GN+T+GTTILTAI+NTV  +T+++F ENP P +VKS++FS+AI+VVG
Sbjct  373   QCGGWTIQLQGQPGNVTVGTTILTAIRNTVHPETKIVFNENPHPGYVKSNEFSYAIIVVG  432

Query  1731  EKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWL  1910
             E  Y+   GD++NLTIP+PGPSII NVC   KCVVVLITGRPVVIQPYL QIDALVAAWL
Sbjct  433   EPPYSLTFGDNTNLTIPDPGPSIITNVCASVKCVVVLITGRPVVIQPYLAQIDALVAAWL  492

Query  1911  PGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             PGTEGQGVADVLFGDYGF+G LP TWFKTVDQ
Sbjct  493   PGTEGQGVADVLFGDYGFTGTLPRTWFKTVDQ  524



>ref|XP_006286473.1| hypothetical protein CARUB_v10000466mg [Capsella rubella]
 gb|EOA19371.1| hypothetical protein CARUB_v10000466mg [Capsella rubella]
Length=624

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/600 (69%), Positives = 488/600 (81%), Gaps = 4/600 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG  S+ L  + LLCC V  A    + YKD +QP+G RI+DL++RMTL+EKIGQMVQIER
Sbjct  1     MGTLSKVLC-LVLLCCAVAAAEGT-LKYKDPKQPLGARIRDLMNRMTLQEKIGQMVQIER  58

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+ +VM+KY++GSVLS GGSVP  +A+ E WV+MVNG QK SLSTRLGIPMIYGIDAV
Sbjct  59    SVATPEVMQKYFIGSVLSGGGSVPSEKATPETWVNMVNGIQKASLSTRLGIPMIYGIDAV  118

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDP L++ IG ATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  119   HGHNNVYGATIFPHNVGLGVTRDPNLLKRIGEATALEVRATGIPYAFAPCIAVCRDPRWG  178

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IV+ MTEIIPGLQG+ P       PFV G+ KVAACAKH+VGDGGTV+G
Sbjct  179   RCYESYSEDYRIVQQMTEIIPGLQGDLPTKR-RGVPFVGGKSKVAACAKHFVGDGGTVRG  237

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT++D   LF IHM GYYN++ +GVAT+M SYS+ NG+RMHAN++++TGFLK  L+
Sbjct  238   IDENNTVIDAKGLFGIHMPGYYNAVNKGVATIMVSYSAWNGLRMHANKELVTGFLKNKLK  297

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+   I+AGIDM+MVPYNYTEFID +   ++ K +
Sbjct  298   FRGFVISDWQGIDRITNPAHLNYSYSVYAGISAGIDMIMVPYNYTEFIDEINSQIQKKLI  357

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKF MGLFE+PL D S A+ LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  358   PISRIDDAVKRILRVKFTMGLFEEPLADLSFANQLGSKEHRELAREAVRKSLVLLKNGKK  417

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTVDT  1646
               +P+LPL KK  +ILVAGTHADN+GYQCGGWTI WQGL GN  T+GTTIL A+KNTV  
Sbjct  418   GAKPLLPLPKKTGKILVAGTHADNLGYQCGGWTITWQGLKGNDHTVGTTILAAVKNTVAP  477

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV+F ENPD  FVKS KF +AIVVVGE  YAE  GDS+NLTI +PGPS I NVC   K
Sbjct  478   TTQVVFNENPDANFVKSGKFDYAIVVVGEPPYAEMFGDSTNLTISDPGPSTIRNVCGSMK  537

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRPVVIQPY+  IDALVAAWLPGTEGQGVAD LFGDYGF+GKL  TWFK+V Q
Sbjct  538   CVVVVVSGRPVVIQPYVSTIDALVAAWLPGTEGQGVADALFGDYGFTGKLARTWFKSVKQ  597



>ref|XP_006340297.1| PREDICTED: lysosomal beta glucosidase-like [Solanum tuberosum]
Length=629

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/600 (69%), Positives = 497/600 (83%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG+ S  ++G  +LC W VVA    + YKD +QP+G RIKDLL RMTL+EKIGQM QIER
Sbjct  1     MGRMSIPMMGFVVLCLWTVVAEGGSIKYKDRKQPLGVRIKDLLKRMTLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+A VMK+ ++GSVLS GGSVP P+A+A+ W +MV+G QKG+LSTRLGIPMIYGIDAV
Sbjct  61    AVATADVMKQNFIGSVLSGGGSVPAPKATAQVWTNMVDGIQKGALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDPELV+ IGAATALEVRATGI YVFAPCIAVCR+PRWG
Sbjct  121   HGHNNVYGATIFPHNVGLGVTRDPELVKRIGAATALEVRATGIPYVFAPCIAVCRNPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED  IV++MTEIIPGLQG+ P       P+V G+ KVAACAKH+VGDGGT  G
Sbjct  181   RCYESYSEDYRIVKSMTEIIPGLQGDLPAKSRKGVPYVGGKTKVAACAKHFVGDGGTKNG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             +DE+NT++ ++DLF IHM  YY+S+ +GV+TVM SYSS NG +MHANRD+ITGFLK  L+
Sbjct  241   VDESNTIISSNDLFDIHMPAYYDSLRKGVSTVMVSYSSWNGRKMHANRDLITGFLKNKLK  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ +D +T   H NY+YS+   I AGIDM+MVP NY EFID LT  VK   +
Sbjct  301   FRGFVISDWQGLDRITDPPHANYSYSVQAGITAGIDMIMVPENYREFIDTLTSQVKANII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKFVMGLFE+P+ D SLA+ LGS++HR LAR+AVRKSLVLLKNG  
Sbjct  361   PMSRIDDAVKRILRVKFVMGLFENPMSDPSLANQLGSQEHRDLAREAVRKSLVLLKNGKT  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
                P+LPL KKA +ILVAGTHADN+GYQCGGWTI+WQG++GN +T+GTTIL+AIK TVD 
Sbjct  421   PSYPLLPLPKKAPKILVAGTHADNLGYQCGGWTIQWQGVAGNDLTVGTTILSAIKKTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++++NPD  FVKS+KFS+AIVVVGE  YAE  GDSSNLTI EPGPS I NVC   K
Sbjct  481   STQVVYQQNPDANFVKSNKFSYAIVVVGEVPYAEMFGDSSNLTITEPGPSTINNVCGAVK  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRPVV++P++ ++DALVAAWLPGTEGQGV D LFGDYGF+GKL  TWFK+VDQ
Sbjct  541   CVVVVVSGRPVVMEPHIAKMDALVAAWLPGTEGQGVTDALFGDYGFTGKLARTWFKSVDQ  600



>gb|EYU26866.1| hypothetical protein MIMGU_mgv1a002476mg [Erythranthe guttata]
Length=668

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/608 (66%), Positives = 484/608 (80%), Gaps = 14/608 (2%)
 Frame = +3

Query  225   RFLIGVALLCCWVVV-------------ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKI  365
             RF+  V +   WV+V              N +   YKD +QPVG R+KDL+ RMTL+EKI
Sbjct  3     RFVGRVRIQWVWVMVVMLWCFGGAILGTGNENIAKYKDPKQPVGVRVKDLIGRMTLQEKI  62

Query  366   GQMVQIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIP  545
             GQM+QI+R  A+  +M K ++GS+LS GGS P+PRASA  WV+MVN FQKG LSTRLGIP
Sbjct  63    GQMIQIDRIAATPHLMTKSFIGSLLSGGGSTPRPRASAADWVNMVNDFQKGCLSTRLGIP  122

Query  546   MIYGIDAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIA  725
             MIYGIDAVHG+NN YNATIFPHN+GLGATRDPELVR IG ATA+EVRATGIQY FAPCIA
Sbjct  123   MIYGIDAVHGHNNVYNATIFPHNIGLGATRDPELVRRIGDATAIEVRATGIQYAFAPCIA  182

Query  726   VCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYV  905
             VCRDPRWGRCYESYSEDP++V+ MT+II GLQG+ P       P+V G+ KVAACAKH+V
Sbjct  183   VCRDPRWGRCYESYSEDPKVVQEMTDIILGLQGDIPSGSRKGVPYVIGKNKVAACAKHFV  242

Query  906   GDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMIT  1085
             GDGGT +GI+ENNTL D H L SIHM  YY+SII+GV+TVM SYSS NG +MH NR+MIT
Sbjct  243   GDGGTTRGINENNTLTDVHGLLSIHMPAYYDSIIKGVSTVMVSYSSWNGKKMHENREMIT  302

Query  1086  GFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLT  1265
             GFLK TL+F+GFVISD+  +D +T   H NYTYS+L  + AGIDM+M+PYN TEF++ LT
Sbjct  303   GFLKGTLKFKGFVISDWAGLDRITSPPHANYTYSVLAGVQAGIDMIMLPYNVTEFVNDLT  362

Query  1266  YLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSL  1445
             YLVKNKF+ + RIDDAV+RIL +KF +GLFE+P+ D SL + +GS+ HR +AR+AVRKSL
Sbjct  363   YLVKNKFISMDRIDDAVERILLIKFNLGLFENPMADLSLVNEIGSQAHRNIAREAVRKSL  422

Query  1446  VLLKNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILT  1622
             VLLKNG    EP+LPL KKAS+ILVAG+HADN+GYQCGGWTI WQG  G N T GTTIL 
Sbjct  423   VLLKNGKRESEPLLPLPKKASKILVAGSHADNLGYQCGGWTIAWQGFRGNNETSGTTILD  482

Query  1623  AIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSII  1802
             AIK++VD KT+V++ ENPD +++KS+ F +AIV VGE  Y E  GDS  LT+ +PGP +I
Sbjct  483   AIKSSVDKKTEVIYSENPDTQYLKSNHFDYAIVAVGEHPYTETVGDSQTLTMADPGPDVI  542

Query  1803  ANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPF  1982
              NVC   KCVVV+I+GRP+VI+PY+  IDALVAAWLPGTEGQGV DVLFGDYGF+GKLP 
Sbjct  543   NNVCGSFKCVVVVISGRPIVIEPYMSVIDALVAAWLPGTEGQGVTDVLFGDYGFTGKLPR  602

Query  1983  TWFKTVDQ  2006
             TWF++VDQ
Sbjct  603   TWFRSVDQ  610



>ref|XP_010086714.1| Lysosomal beta glucosidase [Morus notabilis]
 gb|EXB23130.1| Lysosomal beta glucosidase [Morus notabilis]
Length=619

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/577 (68%), Positives = 474/577 (82%), Gaps = 2/577 (0%)
 Frame = +3

Query  282   YMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvp  461
             Y+ YKD + P+ RRI DLL RMTL EKIGQM Q++ +  +A  M+ Y +GS+LS GG VP
Sbjct  13    YLKYKDPKLPINRRINDLLGRMTLAEKIGQMAQLDLENLTATTMRDYSIGSILSGGGHVP  72

Query  462   kpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDP  641
             + RA+A  W++ VN  Q+ SLS+RLGIPMIYG+DAVHG+NN Y ATIFPHNVGLGATRD 
Sbjct  73    RLRATAGDWINKVNELQRASLSSRLGIPMIYGVDAVHGHNNVYKATIFPHNVGLGATRDK  132

Query  642   ELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQ  821
             ELV+ IGAATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSEDP +V  MT+II GLQ
Sbjct  133   ELVKRIGAATALEVRATGINYAFAPCIAVCRDPRWGRCYESYSEDPNVVIEMTDIILGLQ  192

Query  822   GEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNS  1001
             GE P N     P++ GR+KVAACAKH+VGDGGT KGI+ENNT++D H L SIHM  YY++
Sbjct  193   GEPPANARKGVPYLGGRDKVAACAKHFVGDGGTTKGINENNTVIDWHGLLSIHMPAYYHA  252

Query  1002  IIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYT  1181
             II+GV TVM SYSSLNG +MHANRD++TGFLK TL+FRGFVISD++ +D +T   H NY+
Sbjct  253   IIKGVNTVMVSYSSLNGKKMHANRDLVTGFLKNTLKFRGFVISDWQGVDKITDLPHSNYS  312

Query  1182  YSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFED  1361
              S+L +I AGIDMVM+P+N+TEFID LT  V N  +PVSRIDDAV+RILRVKFVMGLFE+
Sbjct  313   DSLLAAIQAGIDMVMIPHNHTEFIDILTDHVNNNRIPVSRIDDAVQRILRVKFVMGLFEE  372

Query  1362  PLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADN  1541
             PL D +  + LGS++HR LAR+AVRKSLVLLKNG  +D P++PL KKASRILVAGTHA+N
Sbjct  373   PLADQTFVNQLGSQEHRDLAREAVRKSLVLLKNGETSDRPIIPLPKKASRILVAGTHANN  432

Query  1542  IGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAI  1718
             +GYQCGGW++ WQG SG N TIG+TIL+ I+  VD  T++++ ENPDP FVKSS FS+AI
Sbjct  433   LGYQCGGWSLTWQGFSGDNQTIGSTILSGIEEAVDPSTEILYSENPDPAFVKSSNFSYAI  492

Query  1719  VVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALV  1898
             VVVGE  YAE +GDS NLTI EPGPS+IA+VC   KCVVVL++GRP+VI+PYLP +DA V
Sbjct  493   VVVGEPPYAETNGDSLNLTIAEPGPSVIADVCGQVKCVVVLVSGRPLVIEPYLPSVDAFV  552

Query  1899  AAWLPGTE-GQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             AAWLPG+E G GVADVLFGDYGF+GKL  TWF+TVDQ
Sbjct  553   AAWLPGSEAGHGVADVLFGDYGFTGKLSMTWFRTVDQ  589



>ref|XP_010452390.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=665

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/598 (66%), Positives = 486/598 (81%), Gaps = 4/598 (1%)
 Frame = +3

Query  222   SRFLIGVAL-LCCWVVV-ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQV  395
             SR  + + L +C WV    + DY+LYKD +Q V  R++DL  RMTL+EKIGQMVQI+R V
Sbjct  2     SRVFVAILLWMCVWVCCYGDGDYVLYKDPKQTVSDRVEDLFGRMTLEEKIGQMVQIDRSV  61

Query  396   ASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHG  575
             A+  +M+ Y++GSVLS GGS P P A+A+ WVDM+NG+QKG+L +RLGIPMIYGIDAVHG
Sbjct  62    ATVNIMRDYFIGSVLSGGGSAPLPEATAQNWVDMINGYQKGALVSRLGIPMIYGIDAVHG  121

Query  576   NNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRC  755
             +NN YNATIFPHNVGLGATRDP+LV+ IGAATA+EVRATGI Y FAPCIAVCRDPRWGRC
Sbjct  122   HNNVYNATIFPHNVGLGATRDPDLVKRIGAATAVEVRATGIPYTFAPCIAVCRDPRWGRC  181

Query  756   YESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGID  935
             YESYSED ++V  MT++I GLQGE P NY    PFV GR+KVAACAKHYVGDGGT +G++
Sbjct  182   YESYSEDHKVVEDMTDVILGLQGEPPSNYKHGIPFVGGRDKVAACAKHYVGDGGTTRGVN  241

Query  936   ENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFR  1115
             ENNT+ D H L S+HM  Y ++I +GV+TVM SYSS NG +MHAN ++ITG+LK TL+F+
Sbjct  242   ENNTVTDLHGLLSVHMPAYADAIYKGVSTVMVSYSSWNGEKMHANTELITGYLKGTLKFK  301

Query  1116  GFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPV  1295
             GFVISD++ +D ++   H NYT S+  +I AGIDMVMVP+N+TEF++ L  LVKNK +PV
Sbjct  302   GFVISDWQGVDKISSPPHTNYTASVRAAIQAGIDMVMVPFNFTEFVNDLMSLVKNKVIPV  361

Query  1296  SRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD  1475
             +RIDDAV+RIL VKF MGLFE+PL DYS A+ LGS+ HR LAR+AVRKSLVLLKNG N  
Sbjct  362   TRIDDAVRRILLVKFTMGLFENPLADYSFANELGSQAHRDLAREAVRKSLVLLKNG-NKT  420

Query  1476  EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTVDTKT  1652
              P+LPL +K S+ILVAGTHADN+GYQCGGWT+ WQG SGN  T GTT+L A+K+ VD  T
Sbjct  421   NPMLPLPRKTSKILVAGTHADNLGYQCGGWTMTWQGFSGNKNTRGTTLLGAVKSAVDQST  480

Query  1653  QVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCV  1832
             +V+F ENPD EF+KS+ F++AIV VGE+TYAE  GDS  LT+ +PGP+II++ C   KCV
Sbjct  481   EVVFRENPDAEFIKSNNFAYAIVAVGERTYAETDGDSEKLTMLDPGPAIISSTCQAVKCV  540

Query  1833  VVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VV+I+GRP+V++PY+  I+ALVAAWLPGTEGQG+ D LFGD+GFSGKLP TWF+  +Q
Sbjct  541   VVVISGRPLVMEPYVASIEALVAAWLPGTEGQGITDALFGDHGFSGKLPVTWFRNTEQ  598



>ref|NP_001044387.1| Os01g0771900 [Oryza sativa Japonica Group]
 dbj|BAB56084.2| putative exo-1,3-beta-glucanase [Oryza sativa Japonica Group]
 dbj|BAB89846.1| putative exo-1,3-beta-glucanase [Oryza sativa Japonica Group]
 dbj|BAF06301.1| Os01g0771900 [Oryza sativa Japonica Group]
Length=663

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/592 (69%), Positives = 476/592 (80%), Gaps = 0/592 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             L  V LL  +    +A YM Y D +QP   RIKDL+SRMTL EKIGQM QIER VASA V
Sbjct  8     LACVLLLLWFTSTGDAAYMKYLDPKQPTNTRIKDLISRMTLAEKIGQMTQIERGVASADV  67

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             MK Y++GSVLS GGSVP P+A+   WV+MVN FQKG+LSTRLGIPMIYGIDAVHGNNN Y
Sbjct  68    MKNYFIGSVLSGGGSVPAPQATPAVWVNMVNEFQKGALSTRLGIPMIYGIDAVHGNNNVY  127

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
             NAT+FPHN+GLGATRDP+LVR IG ATALEVRATGI Y FAPCIAVCRDPRWGRCYESYS
Sbjct  128   NATLFPHNIGLGATRDPDLVRRIGEATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYS  187

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED  +V+ MT+II GLQG+ P N+    P++AG++KVAACAKH+VGDGGT  GI+ENNT+
Sbjct  188   EDHRVVQQMTDIILGLQGDIPINHTKGVPYIAGKDKVAACAKHFVGDGGTHNGINENNTI  247

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
              D H L  IHM  YY+SII+GVATVM SYSSLNGV+MHAN D++TG+LK  L FRGFVIS
Sbjct  248   TDEHGLLGIHMPPYYDSIIKGVATVMVSYSSLNGVKMHANHDLVTGYLKSKLHFRGFVIS  307

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D+  ID +T     NYTYS+   INAGIDMVMVP+NYT++ID +T LVK   + +SRIDD
Sbjct  308   DWLGIDRITSPPDANYTYSVQAGINAGIDMVMVPFNYTQYIDDVTSLVKKGIINMSRIDD  367

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV+RILRVKF+MGLFE+PL D S A  LG ++HR LAR+AVRKSLVLLKNG + ++  LP
Sbjct  368   AVRRILRVKFIMGLFENPLADLSFADQLGKKEHRDLAREAVRKSLVLLKNGNSPNQQFLP  427

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEE  1670
             L KKA  ILVAG+HA N+GYQCGGW+IEW G SG+IT+GTTIL AIK+TV   T V++ E
Sbjct  428   LPKKARSILVAGSHASNLGYQCGGWSIEWIGGSGDITVGTTILEAIKSTVADSTHVVYSE  487

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
             NPD  F+K++ FS AIVVVGE+TYAE +GD   LTI +PG   I  VC   KC VV+I+G
Sbjct  488   NPDESFMKNNDFSFAIVVVGERTYAETTGDDPELTILDPGTDTIRTVCSTAKCAVVIISG  547

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RPVVI+PYLP ++ALVAAWLPGTEGQGVADVLFGDYGF+GKLP TWFK+VDQ
Sbjct  548   RPVVIEPYLPMMEALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTWFKSVDQ  599



>ref|XP_003519089.1| PREDICTED: lysosomal beta glucosidase-like [Glycine max]
Length=627

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/600 (69%), Positives = 487/600 (81%), Gaps = 1/600 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG  S   +GV LL C V  + A+Y+ YKD + P   RI DLL RM+L+EKIGQM QIER
Sbjct  1     MGIYSMPFVGVLLLFCLVSSSEAEYLKYKDPKVPPNVRISDLLKRMSLEEKIGQMTQIER  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+  VMKKY++GSVLS GGSVP  +ASAE W  MVN  QK +LSTR GIPMIYGIDAV
Sbjct  61    SVATPDVMKKYFIGSVLSGGGSVPATKASAETWQQMVNQLQKAALSTRHGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN YNATIFPHNVGLG TRDP L+++IG ATALEVRATGI YVFAPCIAVCRDPRWG
Sbjct  121   HGHNNVYNATIFPHNVGLGVTRDPVLIKKIGEATALEVRATGIPYVFAPCIAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP+IV+ MTEIIPGLQG+ P N     PFVAG+ KVAAC KHY+GDGGT KG
Sbjct  181   RCYESYSEDPKIVKTMTEIIPGLQGDIPGNSIKGVPFVAGKNKVAACVKHYLGDGGTNKG  240

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNTL+  + L SIHM  YY+SII+GV+TVM SYSS NG++MHANR +ITG+LK  L 
Sbjct  241   INENNTLISYNGLLSIHMPAYYDSIIKGVSTVMVSYSSWNGMKMHANRKLITGYLKNKLH  300

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             F+G VISD++ ID +T   H NY+YS+  S++AGIDM+MVPYNYTEFID LT+ VKN  +
Sbjct  301   FKGLVISDWQGIDRITSPPHANYSYSVQASVSAGIDMIMVPYNYTEFIDELTHQVKNNII  360

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
              +SRIDDAV RILRVKFVMGLFE+P  D SL + LGS++HR++AR+AVRKSLVLLKNG +
Sbjct  361   SMSRIDDAVARILRVKFVMGLFENPYADPSLVNQLGSKEHREIAREAVRKSLVLLKNGKS  420

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDT  1646
               +P+LPL KK+++ILVAG+HA+N+GYQCGGWTI WQGL GN +T  TTIL A+K TVD 
Sbjct  421   YKKPLLPLPKKSAKILVAGSHANNLGYQCGGWTITWQGLGGNDLTSSTTILDAVKQTVDP  480

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T+V+F ENPD  FVKS KF +A+VVVGE TYAE  GDS NLTI +PGPS I NVC   +
Sbjct  481   TTEVVFNENPDRNFVKSFKFDYALVVVGEHTYAETFGDSLNLTIADPGPSTITNVCGAIR  540

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             C+VVL+TGRPVVI+PYL +IDALVAAWLPGTEGQGVADVL+GDY F+GKL  TWFKTVDQ
Sbjct  541   CIVVLVTGRPVVIKPYLSKIDALVAAWLPGTEGQGVADVLYGDYEFTGKLARTWFKTVDQ  600



>ref|XP_006644778.1| PREDICTED: lysosomal beta glucosidase-like [Oryza brachyantha]
Length=663

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/586 (69%), Positives = 477/586 (81%), Gaps = 0/586 (0%)
 Frame = +3

Query  249   LCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyyl  428
             L  +  +A++ YM YKD +QP+  RIKDL+SRMTL EKIGQM QIER VASA VMK Y++
Sbjct  14    LLWFASMADSAYMKYKDPKQPINTRIKDLISRMTLAEKIGQMTQIERGVASADVMKNYFI  73

Query  429   gsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFP  608
             GSVLS GGSVP P+A+   WV+MVN FQ+G+LSTRLGIPMIYGIDAVHGNNN YNAT+FP
Sbjct  74    GSVLSGGGSVPAPQATPAMWVNMVNEFQRGALSTRLGIPMIYGIDAVHGNNNVYNATLFP  133

Query  609   HNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIV  788
             HN+GLGATRDP+L+R IG ATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSED  +V
Sbjct  134   HNIGLGATRDPDLIRRIGEATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDHRVV  193

Query  789   RAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDL  968
             + MT+II GLQGE P N+    PF+ G++KVAACAKH+VGDGGT  GI+ENNT++D H L
Sbjct  194   QQMTDIILGLQGEIPINHTKGVPFIGGKDKVAACAKHFVGDGGTHNGINENNTIIDEHGL  253

Query  969   FSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAID  1148
               IHM  YY+SII+GVATVM SYSSLNGV+MHAN D++TG+LK  L FRGFVISD++ ID
Sbjct  254   LGIHMPPYYDSIIKGVATVMVSYSSLNGVKMHANHDLVTGYLKSKLHFRGFVISDWQGID  313

Query  1149  NLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRIL  1328
              +T     NYTYS+  SINAGIDMVMVP+NYT +ID +T LV    + +SRIDDAV+RIL
Sbjct  314   RITSPRDANYTYSVQASINAGIDMVMVPFNYTYYIDVITSLVNKGIINMSRIDDAVRRIL  373

Query  1329  RVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKAS  1508
             RVKF MGLFE+PL D S +  LG ++HR+LAR+AVRKSLVLLKNG + ++  LPL KKA 
Sbjct  374   RVKFTMGLFENPLADLSFSDQLGKKEHRELAREAVRKSLVLLKNGNSPNQQFLPLPKKAK  433

Query  1509  RILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPEF  1688
              ILVAG+HA N+GYQCGGW+I+W G SG+IT+GTTIL AI +TV   T V++ ENPD  F
Sbjct  434   SILVAGSHASNLGYQCGGWSIQWNGGSGDITVGTTILDAINSTVADSTHVVYSENPDESF  493

Query  1689  VKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQ  1868
             +K + FS AIVVVGE TYAE  GD++ LTI +PG   I NVC   KCVVV+I+GRPVVI+
Sbjct  494   MKGNDFSFAIVVVGELTYAETLGDNAELTIEDPGTDTIRNVCSTVKCVVVIISGRPVVIE  553

Query  1869  PYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             PYLP ++ALVAAWLPGTEGQGVADVLFGDYGF+GKLP TWFK+VDQ
Sbjct  554   PYLPVMEALVAAWLPGTEGQGVADVLFGDYGFTGKLPRTWFKSVDQ  599



>ref|XP_011032947.1| PREDICTED: lysosomal beta glucosidase [Populus euphratica]
Length=662

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/603 (67%), Positives = 498/603 (83%), Gaps = 2/603 (0%)
 Frame = +3

Query  204   EKMGKGSRFLIGVAL-LCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQ  380
             E M +    ++G+ L L   + +A  + + YKD +QPV  RIKDL+SRMTL+EKIGQMVQ
Sbjct  2     EAMARILMKMMGIMLWLMVLIAMAVGEDVKYKDPKQPVAVRIKDLMSRMTLEEKIGQMVQ  61

Query  381   IERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGI  560
             I+R  AS  +M+ Y +GSVLS GGS P P+ASAE WV+M+NGFQ GSLS+RLGIPMIYGI
Sbjct  62    IDRLTASPDIMQTYCIGSVLSGGGSAPLPKASAEDWVNMINGFQNGSLSSRLGIPMIYGI  121

Query  561   DAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDP  740
             DAVHG+NN +NATIFPHN+GLGATRDP+LV+ IG+ATALEVRATGI YVFAPCIAVC+DP
Sbjct  122   DAVHGHNNVFNATIFPHNIGLGATRDPDLVKRIGSATALEVRATGIPYVFAPCIAVCKDP  181

Query  741   RWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGT  920
             RWGRCYESYSED ++V AMTE+IPGLQG+ P N     P+V G++KVAACAKH+VGDGGT
Sbjct  182   RWGRCYESYSEDHKVVEAMTEMIPGLQGDIPVNSRKGVPYVGGKKKVAACAKHFVGDGGT  241

Query  921   VKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKK  1100
              KGI+ENNT++D H L SIHM  Y +SII+GV+T+M SYSS NG +MHAN ++ITGFLK 
Sbjct  242   TKGINENNTVIDKHGLLSIHMPAYSDSIIKGVSTIMVSYSSWNGEKMHANHELITGFLKN  301

Query  1101  TLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKN  1280
             TL+F+GFVISD++ ID +T   H NY+YS+  +I AGIDMVM+P+N+TEFID LTYLVK+
Sbjct  302   TLKFKGFVISDWQGIDRITSPPHANYSYSVQAAIQAGIDMVMLPFNHTEFIDDLTYLVKS  361

Query  1281  KFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKN  1460
               +P+ RI+DAV RIL VKF +GLFE+PL D SL + LGS+ HR LAR+AVRKSLVLLKN
Sbjct  362   NVIPMDRINDAVGRILLVKFTLGLFENPLADLSLVNELGSQAHRDLAREAVRKSLVLLKN  421

Query  1461  GANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNT  1637
             G N  +P+LPL +K S+ILVAGTHADN+GYQCGGWTI+WQG SGN  T GTTIL AIK+T
Sbjct  422   GKNETDPLLPLPRKVSKILVAGTHADNLGYQCGGWTIQWQGFSGNGYTRGTTILGAIKST  481

Query  1638  VDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCP  1817
             VD  T+V+F+ENPD +F+K + F++AI+VVGE  YAE +GDS +LT+ +PGPS+I+NVC 
Sbjct  482   VDPSTEVVFQENPDSKFIKDNNFAYAIIVVGEPPYAETAGDSMDLTMLDPGPSVISNVCK  541

Query  1818  HTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKT  1997
               KCVVV+I+GRP+VI+PYL  IDALVAAWLPGTEGQG+AD LFGDYGF+GKLP TWFK 
Sbjct  542   TVKCVVVVISGRPIVIEPYLSSIDALVAAWLPGTEGQGLADALFGDYGFTGKLPRTWFKN  601

Query  1998  VDQ  2006
             VDQ
Sbjct  602   VDQ  604



>ref|XP_004493183.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Cicer 
arietinum]
Length=630

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/582 (68%), Positives = 484/582 (83%), Gaps = 1/582 (0%)
 Frame = +3

Query  264   VVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvls  443
             ++     M YKD  + +  R++DL++RMTL+EKIGQM+QIER+ AS  V+ KY++GSV+S
Sbjct  18    LLETGSMMKYKDPNESIDIRVEDLINRMTLEEKIGQMLQIERKYASDDVLNKYFIGSVMS  77

Query  444   sggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGL  623
              GGS+P P+ASAE W++M+N FQK +LSTRLGIP+ YGIDAVHG+N+ Y ATIFPHN+GL
Sbjct  78    EGGSIPVPQASAEDWINMLNEFQKDALSTRLGIPIFYGIDAVHGHNSVYKATIFPHNIGL  137

Query  624   GATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTE  803
             GATRDPELV+ IGAATALEVRATGIQYV+APC+AVCRDPRWGRCYESYSEDP+IV+AMTE
Sbjct  138   GATRDPELVKRIGAATALEVRATGIQYVYAPCVAVCRDPRWGRCYESYSEDPKIVQAMTE  197

Query  804   IIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHM  983
             II GLQGE PPN P   PF+AG+EKV ACAKHYVGDGGT  GIDE+NT++D  +L  IHM
Sbjct  198   IISGLQGEIPPNMPKGVPFIAGKEKVIACAKHYVGDGGTTNGIDESNTVIDRDELMGIHM  257

Query  984   AGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPT  1163
              GY++SI +GVAT+M SYSS NGV+MHAN D+ITGFLK TL F+G VI+DF+ ID +T  
Sbjct  258   PGYFSSIDKGVATIMVSYSSWNGVKMHANHDLITGFLKNTLHFQGLVITDFEGIDRITDP  317

Query  1164  VHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFV  1343
                N TYS+   ++AG+DM MVP  Y EFID LT LV NKF+P+SRIDDAVKRILRVKF+
Sbjct  318   PRANCTYSVQAGVSAGMDMFMVPKFYREFIDDLTILVNNKFIPMSRIDDAVKRILRVKFM  377

Query  1344  MGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVA  1523
             MG+FE+P  DYSL ++LG ++HR+LAR+AVRKS+VLLKNG +A+ P+LPL KK  +ILVA
Sbjct  378   MGIFENPFADYSLVNYLGIKEHRELAREAVRKSMVLLKNGKSAEMPLLPLPKKVPKILVA  437

Query  1524  GTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSS  1700
             G+HA+N+GYQCGGWTI+WQG+SGN I  GTTIL A+KNTVD +T V+++ENPD EFV+S+
Sbjct  438   GSHANNLGYQCGGWTIKWQGISGNDILKGTTILNAVKNTVDPETIVIYKENPDKEFVESN  497

Query  1701  KFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLP  1880
              FS+AIVVVGE  YAE  GD+ NLTIP PGP  I NVC   KCVVV+I+GRP+VI PY+ 
Sbjct  498   GFSYAIVVVGEHPYAEMHGDNMNLTIPNPGPETITNVCGAIKCVVVIISGRPLVITPYVD  557

Query  1881  QIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
              ID LVA WLPG+EGQGVADVL+GDYGF+GKLP TWFK+VDQ
Sbjct  558   LIDGLVAGWLPGSEGQGVADVLYGDYGFTGKLPRTWFKSVDQ  599



>ref|XP_004493184.1| PREDICTED: lysosomal beta glucosidase-like isoform X4 [Cicer 
arietinum]
Length=625

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/575 (69%), Positives = 482/575 (84%), Gaps = 1/575 (0%)
 Frame = +3

Query  285   MLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpk  464
             M YKD  + +  R++DL++RMTL+EKIGQM+QIER+ AS  V+ KY++GSV+S GGS+P 
Sbjct  20    MKYKDPNESIDIRVEDLINRMTLEEKIGQMLQIERKYASDDVLNKYFIGSVMSEGGSIPV  79

Query  465   pRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPE  644
             P+ASAE W++M+N FQK +LSTRLGIP+ YGIDAVHG+N+ Y ATIFPHN+GLGATRDPE
Sbjct  80    PQASAEDWINMLNEFQKDALSTRLGIPIFYGIDAVHGHNSVYKATIFPHNIGLGATRDPE  139

Query  645   LVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQG  824
             LV+ IGAATALEVRATGIQYV+APC+AVCRDPRWGRCYESYSEDP+IV+AMTEII GLQG
Sbjct  140   LVKRIGAATALEVRATGIQYVYAPCVAVCRDPRWGRCYESYSEDPKIVQAMTEIISGLQG  199

Query  825   EAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSI  1004
             E PPN P   PF+AG+EKV ACAKHYVGDGGT  GIDE+NT++D  +L  IHM GY++SI
Sbjct  200   EIPPNMPKGVPFIAGKEKVIACAKHYVGDGGTTNGIDESNTVIDRDELMGIHMPGYFSSI  259

Query  1005  IRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTY  1184
              +GVAT+M SYSS NGV+MHAN D+ITGFLK TL F+G VI+DF+ ID +T     N TY
Sbjct  260   DKGVATIMVSYSSWNGVKMHANHDLITGFLKNTLHFQGLVITDFEGIDRITDPPRANCTY  319

Query  1185  SILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDP  1364
             S+   ++AG+DM MVP  Y EFID LT LV NKF+P+SRIDDAVKRILRVKF+MG+FE+P
Sbjct  320   SVQAGVSAGMDMFMVPKFYREFIDDLTILVNNKFIPMSRIDDAVKRILRVKFMMGIFENP  379

Query  1365  LGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNI  1544
               DYSL ++LG ++HR+LAR+AVRKS+VLLKNG +A+ P+LPL KK  +ILVAG+HA+N+
Sbjct  380   FADYSLVNYLGIKEHRELAREAVRKSMVLLKNGKSAEMPLLPLPKKVPKILVAGSHANNL  439

Query  1545  GYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIV  1721
             GYQCGGWTI+WQG+SGN I  GTTIL A+KNTVD +T V+++ENPD EFV+S+ FS+AIV
Sbjct  440   GYQCGGWTIKWQGISGNDILKGTTILNAVKNTVDPETIVIYKENPDKEFVESNGFSYAIV  499

Query  1722  VVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVA  1901
             VVGE  YAE  GD+ NLTIP PGP  I NVC   KCVVV+I+GRP+VI PY+  ID LVA
Sbjct  500   VVGEHPYAEMHGDNMNLTIPNPGPETITNVCGAIKCVVVIISGRPLVITPYVDLIDGLVA  559

Query  1902  AWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
              WLPG+EGQGVADVL+GDYGF+GKLP TWFK+VDQ
Sbjct  560   GWLPGSEGQGVADVLYGDYGFTGKLPRTWFKSVDQ  594



>gb|KEH23536.1| beta-D-glucoside glucohydrolase [Medicago truncatula]
Length=607

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/575 (68%), Positives = 482/575 (84%), Gaps = 1/575 (0%)
 Frame = +3

Query  285   MLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpk  464
             M YK+  + +  R++DL+SRMTL+EKIGQM+QIER+ AS  V+ KY++GSV+S GGS P 
Sbjct  2     MKYKNPNESIDIRVEDLISRMTLEEKIGQMLQIERKYASDNVLNKYFIGSVMSEGGSTPV  61

Query  465   pRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPE  644
             P+ASAE W+DM+N FQK +LSTRLGIP+ YGIDAVHGN+  Y ATIFPHN+GLGATRDPE
Sbjct  62    PQASAENWIDMLNEFQKDALSTRLGIPIFYGIDAVHGNSPVYKATIFPHNIGLGATRDPE  121

Query  645   LVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQG  824
             LV+ IGAATALEVRATG+QYV+APCIAVCRDPRWGRCYESYSEDP++V+AMTEIIPG+QG
Sbjct  122   LVKRIGAATALEVRATGMQYVYAPCIAVCRDPRWGRCYESYSEDPKVVQAMTEIIPGMQG  181

Query  825   EAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSI  1004
             + P N P+  PF+AG EKV ACAKHYVGDGGT  GIDE++T++D   L  IHM GY +SI
Sbjct  182   DVPDNMPMGVPFIAGNEKVIACAKHYVGDGGTTNGIDESDTVIDRDGLMEIHMPGYLSSI  241

Query  1005  IRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTY  1184
              +GVAT+M SYSS NG +MHA+ D+ITGFLK TL F+GFVISDF+ ID +T     N TY
Sbjct  242   SKGVATIMVSYSSWNGDKMHAHHDLITGFLKNTLHFQGFVISDFEGIDRITSPFRANCTY  301

Query  1185  SILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDP  1364
             S+   ++AGIDM MVP  YTEFID LT LV NKF+P+SRIDDAV+RILRVKF+MG+FE+P
Sbjct  302   SVQAGVSAGIDMFMVPKFYTEFIDDLTTLVNNKFIPMSRIDDAVRRILRVKFMMGIFENP  361

Query  1365  LGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNI  1544
               DYSL  +LG ++H++LAR+AVRKS+VLLKNG +A++P+LPL KK  +ILVAG+HA+N+
Sbjct  362   FADYSLVKYLGIKEHKELAREAVRKSMVLLKNGKSAEKPLLPLPKKVPKILVAGSHANNL  421

Query  1545  GYQCGGWTIEWQGLSGNITI-GTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIV  1721
             GYQCGGWTIEWQG++GN  I GTTIL A+KNTVD +T V+++ENPD EF++S++F +AIV
Sbjct  422   GYQCGGWTIEWQGVNGNDDIKGTTILNAVKNTVDPETTVIYKENPDKEFLESNEFCYAIV  481

Query  1722  VVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVA  1901
             VVGE  YAE  GD+ NLTIP PGP II NVC   KCVV++I+GRP+VI+PY+  IDA+VA
Sbjct  482   VVGEHPYAEMHGDNMNLTIPNPGPEIITNVCGAMKCVVIIISGRPLVIEPYVGLIDAVVA  541

Query  1902  AWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
              WLPG+EGQGVADVLFGDYGF+GKLP TWFK+VDQ
Sbjct  542   GWLPGSEGQGVADVLFGDYGFTGKLPRTWFKSVDQ  576



>ref|XP_010917869.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917870.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917871.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010917872.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Elaeis 
guineensis]
Length=629

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/601 (67%), Positives = 482/601 (80%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             M +  R +     LC W+ +  A+Y+ YKD +QP+  RI DLL RMTL EK+GQM QI R
Sbjct  1     MEQSLRLIFIPVFLCSWMAMGGAEYLKYKDPKQPLNVRINDLLRRMTLAEKVGQMSQIAR  60

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + A+++V+ KY++GSVLS GGSVP P+AS E WV+MVN  QK +LSTRLGIPMIYGIDAV
Sbjct  61    ENATSEVINKYFIGSVLSGGGSVPAPKASVETWVNMVNEMQKAALSTRLGIPMIYGIDAV  120

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHN+GLGATR+P LV+ IGAATALEVRATGI YVFAPC+AVCRDPRWG
Sbjct  121   HGHNNVYKATIFPHNIGLGATREPALVKRIGAATALEVRATGIPYVFAPCVAVCRDPRWG  180

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAG-REKVAACAKHYVGDGGTVK  926
             RCYESYSEDP+IV+ MTEIIPGLQGE P N     PFV G +  VAACAKHYVGDGGT K
Sbjct  181   RCYESYSEDPKIVQEMTEIIPGLQGEIPKNSRKGVPFVTGLKRNVAACAKHYVGDGGTYK  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ NNT++  H L SIHM  YY++II+GV+TVM SYSS NGV+MHAN  ++T FLK  L
Sbjct  241   GINANNTIISLHGLLSIHMPPYYDAIIKGVSTVMVSYSSWNGVKMHANHYLVTDFLKNKL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              FRGFVISD++ ID++T   H NY+YSI   ++AGIDMVM+P++Y EFID LTY VK+  
Sbjct  301   HFRGFVISDWQGIDSITTPQHANYSYSIQAGVHAGIDMVMIPHDYPEFIDDLTYQVKHNI  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRI+DAV+RILRVKF MGLFE P  D SLA  LG ++HR+LAR+AVRKSLVLLKNG 
Sbjct  361   IPMSRINDAVRRILRVKFTMGLFEKPYADLSLADELGKKEHRELAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
             + ++ +LPL KKA +ILV G+HADN+GYQCGGWTI WQGLSG N+T GTTIL A+K TVD
Sbjct  421   SINDTLLPLPKKAKKILVGGSHADNLGYQCGGWTITWQGLSGNNLTTGTTILDAVKATVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
               T+V++ ENPD +FV    FS+AIV VGE+ YAE  GD+  LTIP+PGPS+I NVC   
Sbjct  481   PTTEVVYSENPDSDFVNHGHFSYAIVAVGEQPYAEMIGDNLQLTIPDPGPSVIQNVCRTI  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVV++I+GRP+VI+PY+  IDALVAAWLPGTEGQGVAD+LFGDYGFSGKL  TWFK VD
Sbjct  541   KCVVIIISGRPLVIEPYMHMIDALVAAWLPGTEGQGVADMLFGDYGFSGKLSRTWFKFVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_008385616.1| PREDICTED: lysosomal beta glucosidase-like [Malus domestica]
Length=633

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/580 (69%), Positives = 468/580 (81%), Gaps = 1/580 (0%)
 Frame = +3

Query  270   ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssg  449
             A A+YM YKD +QPV  RIKDL+ RM L EKIGQM Q++R   +A +M+ + LGS+LS G
Sbjct  25    AEAEYMAYKDPKQPVNHRIKDLMGRMKLAEKIGQMTQLDRANVTADIMRDFSLGSILSGG  84

Query  450   gsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGA  629
             GSVP+ +AS + W+ M N FQ GSLS+RLGIPMIYGIDAVHG+NN Y ATIFPHNVGLGA
Sbjct  85    GSVPRLQASPQDWIKMFNEFQNGSLSSRLGIPMIYGIDAVHGHNNVYRATIFPHNVGLGA  144

Query  630   TRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEII  809
             TRDPELV+ IG ATALEV ATGI YVFAPCIAVCRDPRWGRCYESYSEDP IV  MT+II
Sbjct  145   TRDPELVKNIGXATALEVXATGINYVFAPCIAVCRDPRWGRCYESYSEDPAIVEQMTDII  204

Query  810   PGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAG  989
              GLQGE P       P+V G++KVAACAKH+VGDGGTVKGI+ENNT++D H L SIHM G
Sbjct  205   LGLQGEPPAGLRKGVPYVGGKDKVAACAKHFVGDGGTVKGINENNTVIDRHGLLSIHMPG  264

Query  990   YYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVH  1169
             YY+SII+GV+T+M SYSS+NG +MHAN + +T FLK TL+FRGFVISD++ +D +T   H
Sbjct  265   YYHSIIKGVSTIMVSYSSVNGKKMHANHEXVTKFLKGTLKFRGFVISDWQGVDKITYPPH  324

Query  1170  GNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMG  1349
              +Y  S+L  I AGIDMVMVP+N+TEFID +T  V  K +P+SRIDDAVKRILRVKFVMG
Sbjct  325   SDYPNSVLAGIQAGIDMVMVPFNHTEFIDIVTTHVNXKLIPMSRIDDAVKRILRVKFVMG  384

Query  1350  LFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGT  1529
             LFE+PL D S    LGS+ HR LAR+AVRKSLVLLKNG NAD PVLPL KKA  ILVAGT
Sbjct  385   LFENPLADQSFVDKLGSQTHRDLAREAVRKSLVLLKNGENADSPVLPLSKKAKXILVAGT  444

Query  1530  HADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKF  1706
             HA+N+G QCG W++ WQGL+G N T GTTIL+AI   VD  T++MF ENPD +FVKS+ F
Sbjct  445   HANNLGXQCGXWSLTWQGLTGNNNTAGTTILSAITAAVDPSTEIMFSENPDADFVKSNNF  504

Query  1707  SHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQI  1886
             S+AIV VGE  YAE +GDS NLTI EPGPS I NVC   KCVV++++GRPVVI+P +  I
Sbjct  505   SYAIVAVGEPPYAETNGDSLNLTIAEPGPSTITNVCGGVKCVVIVVSGRPVVIEPXVSSI  564

Query  1887  DALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             DALVAAWLPGTEG GV+DVLFGDYGF+GKLP TWFKTVDQ
Sbjct  565   DALVAAWLPGTEGXGVSDVLFGDYGFTGKLPRTWFKTVDQ  604



>ref|XP_010553801.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=643

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/577 (69%), Positives = 472/577 (82%), Gaps = 1/577 (0%)
 Frame = +3

Query  279   DYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsv  458
             +Y+ YKD ++    RI+DLL RMTL+EKIGQM QIER +AS  VM++Y++GSVLS GGSV
Sbjct  28    EYVKYKDPKETKENRIRDLLGRMTLEEKIGQMAQIERSIASPHVMQQYFIGSVLSGGGSV  87

Query  459   pkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRD  638
             P   A+ EAW++MVNG Q+GSLSTRLGIPM+YGIDAVHG+N  + ATIFPHNVGLGA RD
Sbjct  88    PAANATPEAWIEMVNGLQRGSLSTRLGIPMLYGIDAVHGHNTVHRATIFPHNVGLGAGRD  147

Query  639   PELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGL  818
             P LVR IGAATALE     I Y FAPC+AVCRDPRWGRCYESYSEDP IV  MTEIIPGL
Sbjct  148   PLLVRRIGAATALEXXXXXIPYTFAPCVAVCRDPRWGRCYESYSEDPRIVEEMTEIIPGL  207

Query  819   QGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYN  998
             QGE P N P   PF+A + KV ACAKHYVGDGGTV+GI+ENNT++D   L  IHM GY+ 
Sbjct  208   QGELPSNLPPGTPFMADKTKVVACAKHYVGDGGTVRGINENNTIIDKKGLLDIHMPGYHR  267

Query  999   SIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNY  1178
             ++ +GV+TVMASYSS NG++MHAN D+IT FLKK LRF+GFVISD++ ID +T   H NY
Sbjct  268   ALAKGVSTVMASYSSWNGLKMHANYDLITSFLKKKLRFQGFVISDWEGIDRITYPPHANY  327

Query  1179  TYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFE  1358
             TYSI  +INAGIDMVM+PYNYTEFID L +LVK++++P+SRIDDAV RILRVKF MGLFE
Sbjct  328   TYSIQEAINAGIDMVMIPYNYTEFIDILNFLVKHEYIPMSRIDDAVTRILRVKFTMGLFE  387

Query  1359  DPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHAD  1538
             +P  D S  H LG + HR+LAR+AVRKSLVLLKNG +AD P+LPL KKA +ILVAG+HAD
Sbjct  388   EPFADTSFVHKLGCQDHRELAREAVRKSLVLLKNGESADTPLLPLPKKARKILVAGSHAD  447

Query  1539  NIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHA  1715
             N+GYQCGGWTI WQG +G N T GTTIL A+KNTVD +T+V++ ENP  +FVKS++FSHA
Sbjct  448   NLGYQCGGWTITWQGHNGNNFTEGTTILKAVKNTVDPETRVIYSENPSADFVKSNEFSHA  507

Query  1716  IVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDAL  1895
             IVVVGE  YAE  GDS++LTI +PGP  I NVC   KCVV++I+GRPVV+QPY+  +D++
Sbjct  508   IVVVGEHPYAESDGDSTSLTIADPGPRTIMNVCGVMKCVVIVISGRPVVLQPYISTMDSV  567

Query  1896  VAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VAAWLPG+EGQG+ADVLFGDYGF GK P TWFK VDQ
Sbjct  568   VAAWLPGSEGQGIADVLFGDYGFKGKSPRTWFKNVDQ  604



>ref|XP_007161964.1| hypothetical protein PHAVU_001G112600g [Phaseolus vulgaris]
 ref|XP_007161965.1| hypothetical protein PHAVU_001G112600g [Phaseolus vulgaris]
 gb|ESW33958.1| hypothetical protein PHAVU_001G112600g [Phaseolus vulgaris]
 gb|ESW33959.1| hypothetical protein PHAVU_001G112600g [Phaseolus vulgaris]
Length=606

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/575 (69%), Positives = 482/575 (84%), Gaps = 1/575 (0%)
 Frame = +3

Query  285   MLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpk  464
             M YKD  QP+  R++DL+SRMTL+EKIGQM+Q+ER+ ASA ++ KY++GSV+S GGS+P 
Sbjct  1     MKYKDPNQPIDTRVEDLVSRMTLEEKIGQMLQVERKHASADLVNKYFIGSVMSEGGSIPA  60

Query  465   pRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATRDPE  644
             P+ASAE WVDMVN FQKG++STRLGIPM YG+DAVHG+N  +NATIFPHN+GLGATR+PE
Sbjct  61    PQASAETWVDMVNEFQKGAVSTRLGIPMFYGVDAVHGHNTVHNATIFPHNIGLGATREPE  120

Query  645   LVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQG  824
             LV+ IGAATALEVRATGIQY +APCIAVCRDPRWGRCYESY ED E+V+AMTEIIPGLQG
Sbjct  121   LVKRIGAATALEVRATGIQYAYAPCIAVCRDPRWGRCYESYGEDTELVQAMTEIIPGLQG  180

Query  825   EAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSI  1004
             + P N P   PF+AG+EKV  CAKHYVGDGGT+ GI+E++T++D   L  IHM  Y  SI
Sbjct  181   DIPHNLPKGVPFIAGKEKVLGCAKHYVGDGGTIDGINEHDTVIDRDGLMKIHMPAYLTSI  240

Query  1005  IRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTY  1184
              +GVAT+M SYSS NGV+MHA+ D+IT FLK TL F+GFVISDF+ ID +T     N TY
Sbjct  241   SKGVATIMVSYSSWNGVKMHAHHDLITAFLKNTLHFKGFVISDFEGIDRITSPHRANITY  300

Query  1185  SILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDP  1364
             SI   ++AGIDM M P  YTEFIDGL+ LVKN  +P+SRIDDAV+RIL VKF+MG+FE+P
Sbjct  301   SIEAGVSAGIDMFMFPKLYTEFIDGLSMLVKNNRIPMSRIDDAVRRILWVKFMMGIFENP  360

Query  1365  LGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNI  1544
               DYSLA +LG ++HR LAR+AVRKS+VLLKNG +AD+P+LPL KK  +ILVAG+HADN+
Sbjct  361   FADYSLAKYLGIQEHRNLAREAVRKSMVLLKNGESADKPLLPLPKKVPKILVAGSHADNL  420

Query  1545  GYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIV  1721
             GYQCGGWTI WQG+SG N+  GTTIL A+KNTVD +T+V+++ENPD EFVKS+ FS+AIV
Sbjct  421   GYQCGGWTIGWQGVSGNNLLEGTTILKAVKNTVDPETKVVYKENPDAEFVKSNGFSYAIV  480

Query  1722  VVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVA  1901
             V+GE  YAE  GD+ NL IP+PGP II N+C  TKCVV++I+GRP+VI+PY+  IDALVA
Sbjct  481   VLGEHPYAETHGDNMNLAIPDPGPEIIRNICGVTKCVVIVISGRPLVIEPYVGIIDALVA  540

Query  1902  AWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             AWLPG+EGQGVADVL+GDYGF+G+LP TWFK+VDQ
Sbjct  541   AWLPGSEGQGVADVLYGDYGFTGRLPRTWFKSVDQ  575



>ref|XP_002262992.1| PREDICTED: lysosomal beta glucosidase [Vitis vinifera]
Length=658

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/593 (69%), Positives = 486/593 (82%), Gaps = 1/593 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             L+ + LL  W+ +A A+Y+ YKD +QP+  RI DL+SRMTL+EKIGQMVQI+R VA+ ++
Sbjct  8     LVSIVLLWWWIAIAEAEYIKYKDPKQPLKVRITDLMSRMTLEEKIGQMVQIDRIVATPEI  67

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             MK Y +GSVLS GGS P P ASA  WV+MVN FQKGSLSTRLGIPMIYGIDAVHG+NN Y
Sbjct  68    MKNYSIGSVLSGGGSTPLPEASAADWVNMVNMFQKGSLSTRLGIPMIYGIDAVHGHNNVY  127

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
             NATIFPHN+GLGAT DPELVR IGAATALEVRATGI Y+FAPCIAVCRDPRWGRCYESYS
Sbjct  128   NATIFPHNIGLGATGDPELVRRIGAATALEVRATGIPYIFAPCIAVCRDPRWGRCYESYS  187

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED +IV  MT+II GLQGE P     + P+V G+ KVAACAKH+VGDGGT KGI+ENNT+
Sbjct  188   EDHKIVEEMTDIILGLQGEVPAGSRKAVPYVGGKNKVAACAKHFVGDGGTTKGINENNTV  247

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             +D H L SIHM  Y +SI +GV+T+M SYSS NG++MHAN  ++T FLK+TL+F+GFVIS
Sbjct  248   IDMHGLLSIHMPAYADSIFKGVSTIMVSYSSWNGIKMHANHYLVTRFLKETLKFKGFVIS  307

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ ID +T   H NY+YS+   I AGIDMVMVP+NY EFID LTY+VK+K +P+ RIDD
Sbjct  308   DWEGIDRITSPPHSNYSYSVQAGIQAGIDMVMVPFNYIEFIDDLTYMVKHKIIPMERIDD  367

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV RIL VKF MGLFE+PL D SL + LG ++HR LAR+AVRKSLVLLKNG NA++P+LP
Sbjct  368   AVGRILLVKFTMGLFENPLADLSLVNELGKQEHRDLAREAVRKSLVLLKNGKNANDPLLP  427

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFE  1667
             L KK S+ILVAGTHADN+GYQCGGWTI WQG +G N T GTTIL AI +TVD  T+V++ 
Sbjct  428   LPKKTSKILVAGTHADNLGYQCGGWTINWQGFNGNNYTSGTTILGAITSTVDPSTKVVYR  487

Query  1668  ENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLIT  1847
             ENPD +FVKS+ F+ AIVVVGE  YAE  GDS +LT+ +PG ++I+NVC   KCVVV+I+
Sbjct  488   ENPDGDFVKSNNFAFAIVVVGEYPYAESIGDSVSLTMVDPGTNVISNVCKAVKCVVVIIS  547

Query  1848  GRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             GRPVVI+PY+  IDALVAAWLPGTEGQG+ DVLFGDYGFSGKL  TWFK VDQ
Sbjct  548   GRPVVIEPYMSLIDALVAAWLPGTEGQGLTDVLFGDYGFSGKLSRTWFKNVDQ  600



>ref|XP_010541670.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
 ref|XP_010541671.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=630

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/587 (71%), Positives = 490/587 (83%), Gaps = 3/587 (1%)
 Frame = +3

Query  252   CCWVVVANA-DYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyyl  428
             CC V   +   Y  YKD +QP+G RI+DL+ RMT +EKIGQMVQIER VA+ +VMKKY++
Sbjct  17    CCAVAAEDPLKYAKYKDPQQPLGARIRDLMKRMTFEEKIGQMVQIERSVATPEVMKKYFI  76

Query  429   gsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFP  608
             GSVLS GGSVP P+ASA+ WVDMVN  QKG+LST L IPMIYGIDAVHG+NN YNATIFP
Sbjct  77    GSVLSGGGSVPSPKASAKTWVDMVNELQKGALSTPLRIPMIYGIDAVHGHNNVYNATIFP  136

Query  609   HNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIV  788
             HNVGLG TRDP L++ IG ATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSED  IV
Sbjct  137   HNVGLGVTRDPMLLKRIGEATALEVRATGIPYAFAPCIAVCRDPRWGRCYESYSEDHRIV  196

Query  789   RAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDL  968
             + MTEIIPGLQG+ P       PFVAG+ +VAACAKH+VGDGGT +GIDENNT++D   L
Sbjct  197   QQMTEIIPGLQGDLPGKLK-GVPFVAGKTRVAACAKHFVGDGGTTRGIDENNTVIDAKGL  255

Query  969   FSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAID  1148
             F IHM GYY++I +GVATVM SYS+ NG+RMHAN++++TGFLK  L+FRGFVISD++ +D
Sbjct  256   FGIHMPGYYSAIQKGVATVMVSYSAWNGLRMHANQNLVTGFLKNKLKFRGFVISDWQGLD  315

Query  1149  NLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRIL  1328
              +T   H NY+YS+   +NAGIDM+MVPYNYTEFID +T  VK  F+P+SRIDDAVKRIL
Sbjct  316   RITTPPHANYSYSVYAGVNAGIDMIMVPYNYTEFIDEITSQVKRNFIPMSRIDDAVKRIL  375

Query  1329  RVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKAS  1508
             RVKF MGLFE+PL D SLA+HLGS++HR+LAR+AVRKSLVLLKNG  AD+P+LPL KKA 
Sbjct  376   RVKFTMGLFENPLADLSLANHLGSKEHRELAREAVRKSLVLLKNGEKADKPLLPLSKKAG  435

Query  1509  RILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDPE  1685
             +ILVAGTHADN+GYQCGGWTI WQGL+GN +T+GTTI TA+KNTV   TQV++ +NPD  
Sbjct  436   KILVAGTHADNLGYQCGGWTITWQGLNGNDLTVGTTIFTAVKNTVAPTTQVVYNQNPDTN  495

Query  1686  FVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVI  1865
             ++KS+KF +AIVVVGE  YAE  GDS+NLT+ EPGPS I NVC   KCVVV+++GRPVV+
Sbjct  496   YLKSNKFDYAIVVVGEPAYAEMFGDSTNLTMMEPGPSTITNVCGSVKCVVVVVSGRPVVM  555

Query  1866  QPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             QPY+  +DALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  556   QPYISNMDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  602



>ref|XP_003569924.1| PREDICTED: lysosomal beta glucosidase-like [Brachypodium distachyon]
 ref|XP_010232399.1| PREDICTED: lysosomal beta glucosidase-like [Brachypodium distachyon]
Length=661

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/587 (69%), Positives = 474/587 (81%), Gaps = 1/587 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             LL C+  + +A+YM YKD +QPV  RIKDL+ RMTL EKIGQM QIER VASA VMKKY+
Sbjct  13    LLLCFAWMGDAEYMKYKDPKQPVNTRIKDLIRRMTLAEKIGQMTQIERSVASADVMKKYF  72

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GS+LS GGSVP P+A+   WV+MVN FQKG+LSTRLGIPMIYGIDAVHGNNN YNATIF
Sbjct  73    IGSILSGGGSVPAPQATPAIWVNMVNEFQKGALSTRLGIPMIYGIDAVHGNNNVYNATIF  132

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHNVGLGATRDP+LV+ IG ATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSED +I
Sbjct  133   PHNVGLGATRDPDLVKRIGDATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDHKI  192

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             V+ MT+II GLQGE P N+    P++AG++KV ACAKH+VGDGGT  G++ENNT+VD H 
Sbjct  193   VQEMTDIIIGLQGEIPENHTKGVPYIAGKDKVVACAKHFVGDGGTHNGVNENNTIVDEHG  252

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             L  IHM  YY+SII+GVATVM SYSSLNG +MHAN D++TG+LK  L FRGFVISD+  I
Sbjct  253   LLGIHMPPYYDSIIKGVATVMVSYSSLNGAKMHANHDLVTGYLKSKLHFRGFVISDWLGI  312

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T     NYTYS+   INAGIDMVMVPYNYTE+ID  T LV    + +SRIDDAV RI
Sbjct  313   DRITSPPGANYTYSVQAGINAGIDMVMVPYNYTEYIDDATSLVNKHIISMSRIDDAVSRI  372

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LRVKF MGLFE+PL D S A  LG ++HR+LAR+AVRKSLVLLKNG   ++  LPL KKA
Sbjct  373   LRVKFTMGLFENPLADLSFADQLGKKEHRELAREAVRKSLVLLKNGNTPNQQFLPLPKKA  432

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPE  1685
              RILVAG+HA N+GYQCGGW+I+W G SG+IT GTT+L AIK+TV   T V++ ENPD  
Sbjct  433   RRILVAGSHASNLGYQCGGWSIQWMGGSGDITAGTTVLDAIKSTVG-DTPVVYSENPDNS  491

Query  1686  FVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVI  1865
             F+K++ FS AIVVVGE  YAE  GD ++LTI +PGP  I  VC   KC VV+I+GRPVVI
Sbjct  492   FMKTNDFSFAIVVVGETPYAETVGDDTDLTILDPGPDTIRTVCSTVKCAVVIISGRPVVI  551

Query  1866  QPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +PYLP ++ALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  552   EPYLPLMEALVAAWLPGTEGQGVADVLFGDYGFTGKLSRTWFKSVDQ  598



>ref|XP_010423524.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Camelina 
sativa]
Length=646

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/602 (65%), Positives = 488/602 (81%), Gaps = 4/602 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVAL-LCCWVVV-ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             + K SR  + + L +C WV    + DY+LYKD +Q V  R++DL  RMTL+EKIGQMVQI
Sbjct  15    LTKMSRVFVAILLWMCVWVSCNGDGDYVLYKDPKQTVSDRVEDLFGRMTLEEKIGQMVQI  74

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             +R+VA+  +M+ Y++GSVLS G S P P A+A+ WVDM+N +QKG+L +RLGIPMIYGID
Sbjct  75    DRKVATVNIMRDYFIGSVLSGGESAPLPEATAQNWVDMINEYQKGALVSRLGIPMIYGID  134

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN YNATIFPHNVGLGATRDP+LV+ IGAATA+EVRATGI Y FAPCIAVCRDPR
Sbjct  135   AVHGHNNVYNATIFPHNVGLGATRDPDLVKRIGAATAVEVRATGIPYTFAPCIAVCRDPR  194

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSED ++V  MT++I GLQGE P NY    PFV GR+KVAACAKHYVGDGGT 
Sbjct  195   WGRCYESYSEDHKVVEDMTDVILGLQGEPPANYKHGIPFVGGRDKVAACAKHYVGDGGTT  254

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
             +G++ENNT+ D H L S+HM  Y ++I +GV+TVM SYSS NG +MHAN ++ITG+LK T
Sbjct  255   RGVNENNTVTDLHGLLSVHMPAYADAIYKGVSTVMVSYSSWNGEKMHANTELITGYLKGT  314

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L+F+GFVISD++ +D ++   H NYT S+  +I AGIDMVMVP+N+TEF++ LT LVKNK
Sbjct  315   LKFKGFVISDWQGVDKISSPPHTNYTASVRAAIQAGIDMVMVPFNFTEFVNDLTSLVKNK  374

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +PV+RIDDAV+RIL VKF MGLFE+PL DYS ++ LGS+ HR LAR+AVRKSLVLLKNG
Sbjct  375   VIPVTRIDDAVRRILLVKFTMGLFENPLADYSFSNELGSQAHRDLAREAVRKSLVLLKNG  434

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTV  1640
              N   P+LPL +K S+ILVAGTHA+N+GYQCGGWT+ WQG SGN  T GTT+L A+K+ V
Sbjct  435   -NKTNPMLPLPRKTSKILVAGTHANNLGYQCGGWTMTWQGFSGNKNTRGTTLLGAVKSAV  493

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  T+V+F E+PD EF+KS+ F++AIV VGE TYAE +GDS  LT+ EPGP+II++ C  
Sbjct  494   DQSTEVVFREDPDAEFIKSNNFAYAIVAVGEPTYAETAGDSDKLTMLEPGPAIISSTCQA  553

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVVV+I+GRP+V++PY+  I+ALVAAWLPGTEGQG+ D LFGD+GFSGKLP TWF+  
Sbjct  554   VKCVVVVISGRPLVMEPYIASIEALVAAWLPGTEGQGITDALFGDHGFSGKLPVTWFRNT  613

Query  2001  DQ  2006
             +Q
Sbjct  614   EQ  615



>ref|XP_010535769.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
 ref|XP_010535770.1| PREDICTED: lysosomal beta glucosidase-like [Tarenaya hassleriana]
Length=630

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/587 (71%), Positives = 489/587 (83%), Gaps = 3/587 (1%)
 Frame = +3

Query  252   CCWVVVANA-DYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyyl  428
             CC V   +   Y  YKD +QP+G RIKDL+ RMTL+EKIGQMVQIER VA+ + MKKY++
Sbjct  17    CCAVAAEDPLKYAKYKDLKQPLGARIKDLMKRMTLEEKIGQMVQIERSVATPEAMKKYFV  76

Query  429   gsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFP  608
             GSVLS GGSVP P+AS E WV+MVN  QKG+LSTRLGIPMIYGIDAVHG+NN YNATIFP
Sbjct  77    GSVLSGGGSVPAPKASPETWVNMVNEIQKGALSTRLGIPMIYGIDAVHGHNNVYNATIFP  136

Query  609   HNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIV  788
             HNVGLG TRDP L++ IG ATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSED  IV
Sbjct  137   HNVGLGVTRDPMLLKRIGEATALEVRATGIPYAFAPCIAVCRDPRWGRCYESYSEDYRIV  196

Query  789   RAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDL  968
             + MTEIIPGLQG+ P       PFV G+ KVAACAKH+VGDGGTV+GIDENNT++D   L
Sbjct  197   QQMTEIIPGLQGDLPGKRK-GVPFVDGKAKVAACAKHFVGDGGTVRGIDENNTVIDAKGL  255

Query  969   FSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAID  1148
             F IHM  YYN++ +GVATVM SYS+ NG+RMHAN+D++TGFLK  L+FRGFVISD++ +D
Sbjct  256   FGIHMPAYYNAVNKGVATVMVSYSAWNGLRMHANKDLVTGFLKNKLKFRGFVISDWQGLD  315

Query  1149  NLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRIL  1328
              +T   H NY+YS+   +NAGIDM+MVPYNYTEFID LT   K   +P+SRIDDAVKRIL
Sbjct  316   RITTPPHANYSYSVYAGVNAGIDMIMVPYNYTEFIDELTSQTKRNLIPMSRIDDAVKRIL  375

Query  1329  RVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKAS  1508
             RVKF MGLFE+P+ D SLA+ LGS++HR+LAR+AVRKSLVLLKNG +AD+P+LPL KKA 
Sbjct  376   RVKFTMGLFENPIADLSLANQLGSKEHRELAREAVRKSLVLLKNGKSADKPLLPLPKKAG  435

Query  1509  RILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFEENPDPE  1685
             +ILV+GTHADN+GYQCGGWTI WQGL+GN +T+GTTILTA+KNTV   TQV++ +NPD  
Sbjct  436   KILVSGTHADNLGYQCGGWTITWQGLNGNDLTVGTTILTAVKNTVAPTTQVVYNQNPDTN  495

Query  1686  FVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVI  1865
             F+KS+KF +AIVVVGE  YAE  GDS+NLTI EPGPS I NVC   KCVVV+++GRPVV+
Sbjct  496   FLKSNKFDYAIVVVGEPPYAEMFGDSTNLTITEPGPSAITNVCGAVKCVVVVVSGRPVVM  555

Query  1866  QPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             QPY+  +D+LVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  556   QPYVSGVDSLVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  602



>ref|XP_010423523.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Camelina 
sativa]
Length=663

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/598 (65%), Positives = 486/598 (81%), Gaps = 4/598 (1%)
 Frame = +3

Query  222   SRFLIGVAL-LCCWVVV-ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQV  395
             SR  + + L +C WV    + DY+LYKD +Q V  R++DL  RMTL+EKIGQMVQI+R+V
Sbjct  2     SRVFVAILLWMCVWVSCNGDGDYVLYKDPKQTVSDRVEDLFGRMTLEEKIGQMVQIDRKV  61

Query  396   ASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHG  575
             A+  +M+ Y++GSVLS G S P P A+A+ WVDM+N +QKG+L +RLGIPMIYGIDAVHG
Sbjct  62    ATVNIMRDYFIGSVLSGGESAPLPEATAQNWVDMINEYQKGALVSRLGIPMIYGIDAVHG  121

Query  576   NNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRC  755
             +NN YNATIFPHNVGLGATRDP+LV+ IGAATA+EVRATGI Y FAPCIAVCRDPRWGRC
Sbjct  122   HNNVYNATIFPHNVGLGATRDPDLVKRIGAATAVEVRATGIPYTFAPCIAVCRDPRWGRC  181

Query  756   YESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGID  935
             YESYSED ++V  MT++I GLQGE P NY    PFV GR+KVAACAKHYVGDGGT +G++
Sbjct  182   YESYSEDHKVVEDMTDVILGLQGEPPANYKHGIPFVGGRDKVAACAKHYVGDGGTTRGVN  241

Query  936   ENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFR  1115
             ENNT+ D H L S+HM  Y ++I +GV+TVM SYSS NG +MHAN ++ITG+LK TL+F+
Sbjct  242   ENNTVTDLHGLLSVHMPAYADAIYKGVSTVMVSYSSWNGEKMHANTELITGYLKGTLKFK  301

Query  1116  GFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPV  1295
             GFVISD++ +D ++   H NYT S+  +I AGIDMVMVP+N+TEF++ LT LVKNK +PV
Sbjct  302   GFVISDWQGVDKISSPPHTNYTASVRAAIQAGIDMVMVPFNFTEFVNDLTSLVKNKVIPV  361

Query  1296  SRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD  1475
             +RIDDAV+RIL VKF MGLFE+PL DYS ++ LGS+ HR LAR+AVRKSLVLLKNG N  
Sbjct  362   TRIDDAVRRILLVKFTMGLFENPLADYSFSNELGSQAHRDLAREAVRKSLVLLKNG-NKT  420

Query  1476  EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTVDTKT  1652
              P+LPL +K S+ILVAGTHA+N+GYQCGGWT+ WQG SGN  T GTT+L A+K+ VD  T
Sbjct  421   NPMLPLPRKTSKILVAGTHANNLGYQCGGWTMTWQGFSGNKNTRGTTLLGAVKSAVDQST  480

Query  1653  QVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCV  1832
             +V+F E+PD EF+KS+ F++AIV VGE TYAE +GDS  LT+ EPGP+II++ C   KCV
Sbjct  481   EVVFREDPDAEFIKSNNFAYAIVAVGEPTYAETAGDSDKLTMLEPGPAIISSTCQAVKCV  540

Query  1833  VVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VV+I+GRP+V++PY+  I+ALVAAWLPGTEGQG+ D LFGD+GFSGKLP TWF+  +Q
Sbjct  541   VVVISGRPLVMEPYIASIEALVAAWLPGTEGQGITDALFGDHGFSGKLPVTWFRNTEQ  598



>ref|XP_010491016.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=665

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/598 (65%), Positives = 486/598 (81%), Gaps = 4/598 (1%)
 Frame = +3

Query  222   SRFLIGVAL-LCCWV-VVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQV  395
             SR  + + L +C WV    + DY+LYKD +Q V  R++DL  RMTL+EKIGQMVQI++ V
Sbjct  2     SRVFVAILLWMCVWVSCYGDGDYLLYKDPKQTVSDRVEDLFGRMTLEEKIGQMVQIDKSV  61

Query  396   ASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHG  575
             A+  +M+ Y++GSVLS GGS P P A+A+ WVDM+N +QKG+L +RLGIPMIYGIDAVHG
Sbjct  62    ATVNIMRDYFIGSVLSGGGSSPLPEATAQDWVDMINEYQKGALVSRLGIPMIYGIDAVHG  121

Query  576   NNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRC  755
             +NN YNATIFPHNVGLGATRDP+LV+ IGAATA+EVRATGI Y FAPCIAVCRDPRWGRC
Sbjct  122   HNNVYNATIFPHNVGLGATRDPDLVKRIGAATAVEVRATGIPYTFAPCIAVCRDPRWGRC  181

Query  756   YESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGID  935
             YESYSED ++V  MT+II GLQGE P NY    PFV GR+KVAACAKHYVGDGGT +G++
Sbjct  182   YESYSEDHKVVEDMTDIILGLQGEPPANYKHGIPFVGGRDKVAACAKHYVGDGGTTRGVN  241

Query  936   ENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFR  1115
             ENNT+ D H L S+HM  Y ++I +GV+TVM SYSS NG +MHAN ++ITG+LK TL+F+
Sbjct  242   ENNTVTDLHGLLSVHMPAYADAIYKGVSTVMVSYSSWNGEKMHANTELITGYLKGTLKFK  301

Query  1116  GFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPV  1295
             GFVISD++ +D ++   H NYT S+  +I AGIDMVMVP+N+TEF++ LT LVKNK +PV
Sbjct  302   GFVISDWQGVDKISSPPHTNYTASVRAAIQAGIDMVMVPFNFTEFVNDLTSLVKNKVIPV  361

Query  1296  SRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANAD  1475
             +RIDDAV+RIL VKF MGLFE+PL DYS ++ LGS+ HR LAR+AVRKSLVLLKNG N  
Sbjct  362   TRIDDAVRRILLVKFTMGLFENPLADYSFSNELGSQAHRDLAREAVRKSLVLLKNG-NKT  420

Query  1476  EPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTVDTKT  1652
              P+LPL +K S+ILVAGTHADN+GYQCGGWTI WQG SGN  T GTT+L A+K+ VD  T
Sbjct  421   NPMLPLPRKTSKILVAGTHADNLGYQCGGWTITWQGFSGNKNTRGTTLLGAVKSAVDQST  480

Query  1653  QVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCV  1832
             +V+F ENPD EF+KS+ F++AIV VGE TYAE +GD+  LT+ +PGP+II++ C   KCV
Sbjct  481   EVVFRENPDAEFIKSNDFAYAIVAVGEPTYAETAGDNDKLTMLDPGPAIISSTCQAVKCV  540

Query  1833  VVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             VV+I+GRP+V++PY+  I+ALVAAWLPGTEGQG+ D LFGD+GFSGKLP TWF+  +Q
Sbjct  541   VVVISGRPLVMEPYVASIEALVAAWLPGTEGQGITDALFGDHGFSGKLPVTWFRNTEQ  598



>ref|XP_010423522.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Camelina 
sativa]
Length=680

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/602 (65%), Positives = 488/602 (81%), Gaps = 4/602 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVAL-LCCWVVV-ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             + K SR  + + L +C WV    + DY+LYKD +Q V  R++DL  RMTL+EKIGQMVQI
Sbjct  15    LTKMSRVFVAILLWMCVWVSCNGDGDYVLYKDPKQTVSDRVEDLFGRMTLEEKIGQMVQI  74

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             +R+VA+  +M+ Y++GSVLS G S P P A+A+ WVDM+N +QKG+L +RLGIPMIYGID
Sbjct  75    DRKVATVNIMRDYFIGSVLSGGESAPLPEATAQNWVDMINEYQKGALVSRLGIPMIYGID  134

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN YNATIFPHNVGLGATRDP+LV+ IGAATA+EVRATGI Y FAPCIAVCRDPR
Sbjct  135   AVHGHNNVYNATIFPHNVGLGATRDPDLVKRIGAATAVEVRATGIPYTFAPCIAVCRDPR  194

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSED ++V  MT++I GLQGE P NY    PFV GR+KVAACAKHYVGDGGT 
Sbjct  195   WGRCYESYSEDHKVVEDMTDVILGLQGEPPANYKHGIPFVGGRDKVAACAKHYVGDGGTT  254

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
             +G++ENNT+ D H L S+HM  Y ++I +GV+TVM SYSS NG +MHAN ++ITG+LK T
Sbjct  255   RGVNENNTVTDLHGLLSVHMPAYADAIYKGVSTVMVSYSSWNGEKMHANTELITGYLKGT  314

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L+F+GFVISD++ +D ++   H NYT S+  +I AGIDMVMVP+N+TEF++ LT LVKNK
Sbjct  315   LKFKGFVISDWQGVDKISSPPHTNYTASVRAAIQAGIDMVMVPFNFTEFVNDLTSLVKNK  374

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +PV+RIDDAV+RIL VKF MGLFE+PL DYS ++ LGS+ HR LAR+AVRKSLVLLKNG
Sbjct  375   VIPVTRIDDAVRRILLVKFTMGLFENPLADYSFSNELGSQAHRDLAREAVRKSLVLLKNG  434

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTV  1640
              N   P+LPL +K S+ILVAGTHA+N+GYQCGGWT+ WQG SGN  T GTT+L A+K+ V
Sbjct  435   -NKTNPMLPLPRKTSKILVAGTHANNLGYQCGGWTMTWQGFSGNKNTRGTTLLGAVKSAV  493

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  T+V+F E+PD EF+KS+ F++AIV VGE TYAE +GDS  LT+ EPGP+II++ C  
Sbjct  494   DQSTEVVFREDPDAEFIKSNNFAYAIVAVGEPTYAETAGDSDKLTMLEPGPAIISSTCQA  553

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVVV+I+GRP+V++PY+  I+ALVAAWLPGTEGQG+ D LFGD+GFSGKLP TWF+  
Sbjct  554   VKCVVVVISGRPLVMEPYIASIEALVAAWLPGTEGQGITDALFGDHGFSGKLPVTWFRNT  613

Query  2001  DQ  2006
             +Q
Sbjct  614   EQ  615



>ref|XP_010493212.1| PREDICTED: lysosomal beta glucosidase-like [Camelina sativa]
Length=624

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/600 (68%), Positives = 487/600 (81%), Gaps = 4/600 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG  S+ L  + LLCC V  A    + YKD +QP+G RI+DL++RMTL+EKIGQMVQIER
Sbjct  1     MGTLSKVLC-LVLLCCAVAAAEGT-LKYKDPKQPLGARIRDLMNRMTLQEKIGQMVQIER  58

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
              VA+ + M+KY++GSVLS GGSVP  +A+ E WV+MVNG QK +LSTRLGIPMIYGIDAV
Sbjct  59    SVATPEAMQKYFIGSVLSGGGSVPSEKATPETWVNMVNGIQKAALSTRLGIPMIYGIDAV  118

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLG TRDP L++ IG ATALEVRATGI Y FAPCIAVCRDPRWG
Sbjct  119   HGHNNVYGATIFPHNVGLGVTRDPSLLKRIGEATALEVRATGIPYAFAPCIAVCRDPRWG  178

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSED +IV+ MTEIIPGLQG+ P       PFV G+ KVAACAKH+VGDGGTV+G
Sbjct  179   RCYESYSEDYKIVQQMTEIIPGLQGDLPTKR-RGVPFVGGKSKVAACAKHFVGDGGTVRG  237

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             IDENNT++D   LF IHM  YYN++ +GVAT+M SYS+ NG+RMHAN++++TGFLK  L+
Sbjct  238   IDENNTVIDAKGLFGIHMPAYYNAVNKGVATIMVSYSAWNGLRMHANKELVTGFLKNKLK  297

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YS+   I+AGIDM+MVPYNYTEFID +   ++ K +
Sbjct  298   FRGFVISDWQGIDRITTPPHLNYSYSVYAGISAGIDMIMVPYNYTEFIDEINSQIQKKLI  357

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAVKRILRVKF MGLFE+PL D S A+ LGS++HR+LAR+AVRKSLVLLKNG  
Sbjct  358   PISRIDDAVKRILRVKFTMGLFEEPLADLSFANQLGSKEHRELAREAVRKSLVLLKNGKK  417

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
               +P+LPL KK  +ILVAGTHADN+GYQCGGWTI WQGL G + T+GTTIL A+K+TV  
Sbjct  418   GAKPLLPLPKKTGKILVAGTHADNLGYQCGGWTITWQGLKGSDHTVGTTILAAVKSTVAP  477

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              TQV++ ENPD  FVKS KF +AIVVVGE  YAE  GDS+NLTI +PGPS I NVC   K
Sbjct  478   TTQVVYSENPDANFVKSGKFDYAIVVVGEPPYAEMFGDSTNLTISDPGPSTIGNVCGSMK  537

Query  1827  CVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             CVVV+++GRPVVIQPY+  IDALVAAWLPGTEGQGVAD LFGDYGF+GKL  TWFK+V Q
Sbjct  538   CVVVVVSGRPVVIQPYVSTIDALVAAWLPGTEGQGVADALFGDYGFTGKLARTWFKSVKQ  597



>ref|XP_011089216.1| PREDICTED: uncharacterized protein LOC105170243 [Sesamum indicum]
Length=1344

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/591 (68%), Positives = 493/591 (83%), Gaps = 2/591 (0%)
 Frame = +3

Query  234   IGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVM  413
             + V ++ C+ +   A+YM YKD +QP+  RI+DL+ RMTL+EKIGQM  I+R+VASA ++
Sbjct  10    MAVVVVLCFRI--EAEYMRYKDPKQPLDVRIEDLIRRMTLEEKIGQMTMIDRKVASADII  67

Query  414   KkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYN  593
             K Y++G++LS GGSVP P+ASAE W++MVN FQ G+LSTRLGIP+ YGIDAVHG+N  YN
Sbjct  68    KAYFIGALLSGGGSVPAPKASAETWINMVNEFQNGALSTRLGIPVFYGIDAVHGHNTVYN  127

Query  594   ATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSE  773
             ATIFPHNVGLG TRDPELV++IGAATALEVRATGI Y FAPC+AVCRDPRWGRC+ESYSE
Sbjct  128   ATIFPHNVGLGVTRDPELVKKIGAATALEVRATGIPYTFAPCVAVCRDPRWGRCFESYSE  187

Query  774   DPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLV  953
             D EIV+AMTEIIPGLQG+ PP+YP  FP++ GR KVAACAKH+VGDGGT  GI+E+NT++
Sbjct  188   DHEIVQAMTEIIPGLQGDLPPDYPSDFPYIGGRTKVAACAKHFVGDGGTTDGINESNTII  247

Query  954   DTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISD  1133
             D   L SIHM  Y +SI +GVAT+M S+SSLNG +MHAN D+ITG+LKKTL+F+G VISD
Sbjct  248   DWDGLLSIHMPAYLDSIRKGVATIMISFSSLNGTKMHANYDLITGYLKKTLKFQGIVISD  307

Query  1134  FKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDA  1313
              + ID +T   H NYTYS+  SINAGIDM++VP N+TE ID LT LVK   + +SRI+DA
Sbjct  308   SQGIDKITTPSHANYTYSVEASINAGIDMILVPENFTELIDTLTLLVKKNVISMSRINDA  367

Query  1314  VKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPL  1493
             V+RILRVKF+MGLFE+ + D+SL + LGS++HR LAR+AVR+SLVLLKNG N D P++PL
Sbjct  368   VERILRVKFIMGLFENSMADFSLVNQLGSQEHRGLAREAVRRSLVLLKNGENGDAPLIPL  427

Query  1494  RKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEEN  1673
              KKA +ILVAG+HA++IG QCGGWTIEW GLSGNITIGTTIL A+KNT+D +T+V++ EN
Sbjct  428   PKKAKKILVAGSHANDIGNQCGGWTIEWHGLSGNITIGTTILAAVKNTIDPQTEVVYHEN  487

Query  1674  PDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGR  1853
             P+ EF+ S+ FS+AIV VGE  Y+E  GDS NLTI +PG   I+NVC   KCVVV+I+GR
Sbjct  488   PNKEFMNSNSFSYAIVAVGELPYSETVGDSMNLTIAKPGYDTISNVCQAIKCVVVIISGR  547

Query  1854  PVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             PVVIQPYLP IDALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFKTVDQ
Sbjct  548   PVVIQPYLPLIDALVAAWLPGTEGQGVADVLFGDYGFTGKLARTWFKTVDQ  598


 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/608 (67%), Positives = 497/608 (82%), Gaps = 11/608 (2%)
 Frame = +3

Query  216   KGSRFLI--------GVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQ  371
             +G +FL+         +  L  W  V  A YM Y D +QP+  RIKDL+SRM+L+EKIGQ
Sbjct  706   QGPKFLLISMGRVTAALVALWLWTAVVEAGYMKYMDPKQPLNVRIKDLMSRMSLEEKIGQ  765

Query  372   MVQIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMI  551
             M QIER+VAS  V+KKY++GS++S GGSVP+PRASAE W++MVN FQKG+LSTRLGIPMI
Sbjct  766   MTQIERKVASTDVIKKYFIGSIVSGGGSVPRPRASAENWINMVNEFQKGALSTRLGIPMI  825

Query  552   YGIDAVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVC  731
             YGIDAVHG+NNAYNATIFPHNVGLG TRDP+LV++IGAATALEVRATGI Y FAPCIAVC
Sbjct  826   YGIDAVHGHNNAYNATIFPHNVGLGVTRDPDLVKKIGAATALEVRATGIHYTFAPCIAVC  885

Query  732   RDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFV---AGREKVAACAKHY  902
             RDPRWGRCYESYSED EIV++MTEIIPGLQG+ P +YP +FPFV   + R KVAACAKH+
Sbjct  886   RDPRWGRCYESYSEDHEIVQSMTEIIPGLQGDVPSDYPKNFPFVNPSSQRTKVAACAKHF  945

Query  903   VGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMI  1082
             VGDGGT  GI+ENNT++D + L +IHM  Y +SI +GVATVM SYSS NG +MHAN D+I
Sbjct  946   VGDGGTTDGINENNTVIDWNGLLNIHMPAYLDSIRKGVATVMVSYSSWNGKKMHANYDLI  1005

Query  1083  TGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGL  1262
             TG+LK+TL+F+GFVISD   ID +T     NYTYS+   I+AGIDMVMVP  Y EFID L
Sbjct  1006  TGYLKQTLKFKGFVISDMWGIDRITTPSRANYTYSVQAGIHAGIDMVMVPDEYVEFIDDL  1065

Query  1263  TYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKS  1442
             T LVK   +P+SRI+DAV+RILRVKF+MGLFE+ + D SLA  LGS+ HR+LAR+AVRKS
Sbjct  1066  TLLVKKNVIPMSRINDAVRRILRVKFIMGLFENSMADLSLADQLGSQDHRELAREAVRKS  1125

Query  1443  LVLLKNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILT  1622
             LVLLKNG ++++PVLPL   + +ILVAG+HA++IG QCGGWTIEW G +GNIT+GTTILT
Sbjct  1126  LVLLKNGKSSNQPVLPLPTSSEKILVAGSHANDIGNQCGGWTIEWNGQTGNITVGTTILT  1185

Query  1623  AIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSII  1802
             A+KN+VD  T+V++ ENP+ EF+K++ FS+AIVVVGE  Y E +GDS NLTI EPG S I
Sbjct  1186  AVKNSVDESTEVVYNENPEAEFLKANNFSYAIVVVGELPYVETNGDSKNLTIAEPGYSTI  1245

Query  1803  ANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPF  1982
              NVC   KCVV++I+GRP+ I+PYL +IDALVAAWLPGTEGQG+ DVLFG+YGF+GKL  
Sbjct  1246  TNVCEAVKCVVIIISGRPIYIEPYLEKIDALVAAWLPGTEGQGITDVLFGEYGFTGKLAR  1305

Query  1983  TWFKTVDQ  2006
             TWF+TVDQ
Sbjct  1306  TWFRTVDQ  1313



>ref|XP_010558244.1| PREDICTED: lysosomal beta glucosidase [Tarenaya hassleriana]
 ref|XP_010558245.1| PREDICTED: lysosomal beta glucosidase [Tarenaya hassleriana]
Length=664

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/593 (65%), Positives = 481/593 (81%), Gaps = 2/593 (0%)
 Frame = +3

Query  231   LIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQV  410
             ++ +  +C WV     DY+L+KD ++ V  R+ DLLSRMTL+EKIGQMVQI+R +AS  +
Sbjct  8     ILWILWICGWVCAVEGDYVLFKDPKREVEDRVADLLSRMTLEEKIGQMVQIDRSIASVNI  67

Query  411   MKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAY  590
             M+ YY+GSVLS GGS P P A+A++WVDM+N +QKG+LS+RLGIPMIYGIDAVHG+NN Y
Sbjct  68    MRDYYIGSVLSGGGSAPLPEATAQSWVDMINDYQKGALSSRLGIPMIYGIDAVHGHNNVY  127

Query  591   NATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYS  770
             NATIFPHNVGLGATRDP+LV+ IG+ATALEVRATGI Y FAPCIAVCRDPRWGRCYESYS
Sbjct  128   NATIFPHNVGLGATRDPDLVKRIGSATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYS  187

Query  771   EDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTL  950
             ED ++V  MT+II GLQG+ PP Y    P+V G++KVAACAKH+VGDGGT +GI+ENNT+
Sbjct  188   EDHKVVEEMTDIILGLQGDPPPGYTHGVPYVGGKDKVAACAKHFVGDGGTTRGINENNTM  247

Query  951   VDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVIS  1130
             +D H L SIHM  Y +SI +GV+TVM SYSS NG +MHAN  +ITG+LK  L+F+GFVIS
Sbjct  248   IDMHGLLSIHMPAYADSIYKGVSTVMVSYSSWNGEKMHANTQLITGYLKGILKFKGFVIS  307

Query  1131  DFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDD  1310
             D++ ID +T   H NYTYS+  +I AGIDMVMVP+N+TEFI+ LT LVKN  +P+SRIDD
Sbjct  308   DWQGIDRITSPPHLNYTYSVQAAIQAGIDMVMVPFNFTEFINDLTSLVKNNVIPMSRIDD  367

Query  1311  AVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLP  1490
             AV RIL VKF MGLFE+PL DYS  + LGS+ HR LAR+AVRKSLVLLKNG N   P+LP
Sbjct  368   AVTRILFVKFTMGLFENPLADYSFVNELGSQAHRDLAREAVRKSLVLLKNG-NKTNPLLP  426

Query  1491  LRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQVMFE  1667
             L +KAS+ILV+GTHADN+GYQCGGWTI WQG  G+  T GTTIL A+K+ VD  T+V++ 
Sbjct  427   LPRKASKILVSGTHADNLGYQCGGWTITWQGFDGDKSTRGTTILGAVKSAVDPSTEVIYR  486

Query  1668  ENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLIT  1847
             ENPD EF+KS+ F++AIV VGE  YAE +GDS+ L + +PGP+I+   C   KCVVVLI+
Sbjct  487   ENPDAEFIKSNNFAYAIVAVGETPYAETAGDSTELAMKDPGPAIVTTTCQAVKCVVVLIS  546

Query  1848  GRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             GRP++++PY+  I+ALVAAWLPGTEGQGV D +FGD+GFSGKLP TWF+ ++Q
Sbjct  547   GRPILMEPYMSSIEALVAAWLPGTEGQGVTDAIFGDHGFSGKLPITWFRNIEQ  599



>ref|XP_009801845.1| PREDICTED: lysosomal beta glucosidase-like [Nicotiana sylvestris]
Length=629

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/596 (68%), Positives = 484/596 (81%), Gaps = 1/596 (0%)
 Frame = +3

Query  222   SRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVAS  401
             +  ++G  LL     V  A YM YKD +QP+  RI+DL+ RM+L+EKIGQM QIER +AS
Sbjct  7     TTIMMGFLLLFLCAGVTEAVYMKYKDPKQPLNVRIRDLMHRMSLEEKIGQMTQIERHLAS  66

Query  402   AQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNN  581
              ++MK Y++GSVLS GGS P P+A+A  WV MVN  QKGSLSTRLGIPMIYGIDAVHG+N
Sbjct  67    PEIMKNYFIGSVLSLGGSEPAPKATAADWVKMVNEIQKGSLSTRLGIPMIYGIDAVHGHN  126

Query  582   NAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYE  761
             N Y AT+FPHNVGLG TRDP+LV+ IGAATALEVRATGI Y FAPCIAVCRDPRWGRC+E
Sbjct  127   NVYKATVFPHNVGLGVTRDPQLVKRIGAATALEVRATGIPYTFAPCIAVCRDPRWGRCFE  186

Query  762   SYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDEN  941
             SYSED  IVRAMTEIIPGLQG+ P N     PFV G+ KVAACAKH+VGDGGTVKGIDEN
Sbjct  187   SYSEDHRIVRAMTEIIPGLQGDIPANSRKGVPFVEGKIKVAACAKHFVGDGGTVKGIDEN  246

Query  942   NTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGF  1121
             NT++  ++L SIHM  Y +SII+GV+T+M SYSS NG++MHANRD+ITGFLK  L+F+GF
Sbjct  247   NTIISANELLSIHMPAYVDSIIKGVSTIMISYSSWNGMKMHANRDLITGFLKGKLKFKGF  306

Query  1122  VISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSR  1301
             VISD+  ID +T   H NY+YSI   + AGIDM+M P N TEF+D L + V+N  +P+SR
Sbjct  307   VISDWNGIDKITDPPHANYSYSIQAGVLAGIDMIMGPENVTEFLDDLAFQVRNNIIPMSR  366

Query  1302  IDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEP  1481
             IDDAVKRILRVKFVMGLFE+PL D SLA+ LGS++HR+LAR+AVRKSLVLLKNG    +P
Sbjct  367   IDDAVKRILRVKFVMGLFENPLADLSLANQLGSQEHRELAREAVRKSLVLLKNGKAISQP  426

Query  1482  VLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGN-ITIGTTILTAIKNTVDTKTQV  1658
             ++PL KK ++ILVAG+HADN+GYQCGGWT  WQG+ GN +T GTT+LTA++NTV   TQV
Sbjct  427   LVPLSKKVAKILVAGSHADNLGYQCGGWTRSWQGIEGNDLTTGTTVLTAVRNTVHPSTQV  486

Query  1659  MFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVV  1838
             ++ +NPD  F+KS+ FS+AIVVVGE  YAE  GD +NLTIPEPGPS I NVC   KCVVV
Sbjct  487   VYRDNPDINFLKSNHFSYAIVVVGETPYAETFGDGANLTIPEPGPSTITNVCGVVKCVVV  546

Query  1839  LITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +I+GRPVV  PYL  IDALVAAWLPG+EGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  547   VISGRPVVTGPYLANIDALVAAWLPGSEGQGVADVLFGDYGFTGKLARTWFKSVDQ  602



>gb|KHM99112.1| Lysosomal beta glucosidase [Glycine soja]
Length=586

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/559 (72%), Positives = 465/559 (83%), Gaps = 5/559 (1%)
 Frame = +3

Query  345   MTLKEKIGQMVQIERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSL  524
             MTL+EKIGQMVQIER VA+ QVMKKY++GSVLS GGSVP+  ASAE W+ MVNG Q GSL
Sbjct  1     MTLEEKIGQMVQIERSVATPQVMKKYFIGSVLSGGGSVPETNASAETWIQMVNGIQNGSL  60

Query  525   STRLGIPMIYGIDAVHGNNNAYNATIFPHNVGLGATR----DPELVREIGAATALEVRAT  692
             STRLGIPMIYGIDAVHG+NN Y ATIFPHNVGLG TR    DP L+++IG ATALEVRAT
Sbjct  61    STRLGIPMIYGIDAVHGHNNVYKATIFPHNVGLGVTRQVYMDPVLIKKIGDATALEVRAT  120

Query  693   GIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGR  872
             GIQYVFAPCIAVCRDPRWGRCYESYSEDP+IV+AMTEIIPGLQG+   N     PFVAG+
Sbjct  121   GIQYVFAPCIAVCRDPRWGRCYESYSEDPKIVQAMTEIIPGLQGDISDNSRKGVPFVAGK  180

Query  873   EKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNG  1052
              KVAACAKHYVGDGGT KGI+ENNT+V  + L  IHM  Y++SI++GV+TVM SYSS NG
Sbjct  181   NKVAACAKHYVGDGGTTKGINENNTVVSYNGLLRIHMPAYHDSIVKGVSTVMVSYSSWNG  240

Query  1053  VRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVP  1232
              +MHAN  ++T +LK  L+F GFVISD+  ID +T   H NY+YSI   + AGIDM+MVP
Sbjct  241   QKMHANHFLVTDYLKNKLKFMGFVISDWLGIDRITSPSHSNYSYSIQVGVGAGIDMIMVP  300

Query  1233  YNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHR  1412
             +N+TEFID LTY VKN  +PVSRIDDAV+RILRVKFVMGLFE+P  D SL + LGS +HR
Sbjct  301   FNFTEFIDVLTYQVKNNIIPVSRIDDAVRRILRVKFVMGLFENPHADISLVNQLGSEEHR  360

Query  1413  KLARKAVRKSLVLLKNGANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG  1592
             +LAR+AVRKSLVLLKNG +A++P+LPL KKA++ILVAG+HADN+GYQCGGWTI WQG  G
Sbjct  361   QLAREAVRKSLVLLKNGKSAEKPLLPLPKKAAKILVAGSHADNLGYQCGGWTITWQGGGG  420

Query  1593  -NITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSN  1769
              N+T+GTTIL A+K  +D  T+V++ ENPD  FVKS+ FS+AIV+VGE  YAE  GDS N
Sbjct  421   NNLTVGTTILDAVKQAIDPATKVVYNENPDSNFVKSNNFSYAIVIVGEHPYAETFGDSLN  480

Query  1770  LTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLF  1949
             LTIPEPGPS I NVC   +CVVVLITGRPVVIQPYL +IDALVAAWLPGTEGQGV D+LF
Sbjct  481   LTIPEPGPSTITNVCGSIQCVVVLITGRPVVIQPYLSKIDALVAAWLPGTEGQGVTDLLF  540

Query  1950  GDYGFSGKLPFTWFKTVDQ  2006
             GDYGF+GKL  TWFKTVDQ
Sbjct  541   GDYGFTGKLARTWFKTVDQ  559



>ref|XP_004981774.1| PREDICTED: lysosomal beta glucosidase-like isoform X1 [Setaria 
italica]
 ref|XP_004981775.1| PREDICTED: lysosomal beta glucosidase-like isoform X2 [Setaria 
italica]
 ref|XP_004981776.1| PREDICTED: lysosomal beta glucosidase-like isoform X3 [Setaria 
italica]
Length=622

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/592 (69%), Positives = 480/592 (81%), Gaps = 3/592 (1%)
 Frame = +3

Query  234   IGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVM  413
             I   L+ C V +  A+Y+ YKD +QPV  R+KDLLSRMTL EKIGQM QIER+ A+A  +
Sbjct  7     ITFVLMFCLVALGRAEYLRYKDPKQPVSVRVKDLLSRMTLAEKIGQMTQIERENATADAL  66

Query  414   KkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYN  593
              KY++GSVLS GGSVP P+ASA+AW  MV+  QKG+LSTRLGIP+IYGIDAVHG+NN Y 
Sbjct  67    AKYFIGSVLSGGGSVPAPQASAQAWASMVSEMQKGALSTRLGIPIIYGIDAVHGHNNVYK  126

Query  594   ATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSE  773
             ATIFPHNVGLGATRDP+LV+ IG ATALEVRATGI YVFAPCIAVCRDPRWGRCYESYSE
Sbjct  127   ATIFPHNVGLGATRDPDLVKRIGQATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSE  186

Query  774   DPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLV  953
             DP++V++MT +I GLQGE P N  +  P+VAG + VAACAKHYVGDGGT +GI+ENNT++
Sbjct  187   DPKVVQSMTSLISGLQGEVPAN-DVGRPYVAGSKNVAACAKHYVGDGGTHQGINENNTII  245

Query  954   DTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISD  1133
             DTH L SIHM  YYNSIIRGV+TVM SYSS NGV+MHAN  ++T FLK  L+FRGFVISD
Sbjct  246   DTHGLLSIHMPPYYNSIIRGVSTVMVSYSSWNGVKMHANHFLVTDFLKNKLKFRGFVISD  305

Query  1134  FKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDA  1313
             ++ ID +T   H NY+YSI   + AGIDM+MVP+ YTEFID LT  V+NK +P+SRIDDA
Sbjct  306   WEGIDRITSPPHANYSYSIEAGVGAGIDMIMVPFRYTEFIDDLTAQVQNKVIPMSRIDDA  365

Query  1314  VKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPL  1493
             V RILRVKF MGLFE+P  D SLA  LG ++HR LAR+AVRKSLVLLKNG ++  P+LPL
Sbjct  366   VYRILRVKFSMGLFENPYPDTSLAGELGKQEHRDLAREAVRKSLVLLKNGKSSYSPLLPL  425

Query  1494  RKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDTKTQVMFEE  1670
              KKA +ILVAG+HADN+G QCGGWTI WQG  G NIT GTTIL  IK T+D  TQV++ E
Sbjct  426   PKKAGKILVAGSHADNLGNQCGGWTITWQGQPGNNITAGTTILEGIKATIDPSTQVVYSE  485

Query  1671  NPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITG  1850
             NPD   V + K+ +A+VVVGE  YAE  GD+ NLTIP PGPS+I +VC  TKCVVVLI+G
Sbjct  486   NPD-STVLADKYDYAVVVVGEPPYAETFGDNLNLTIPAPGPSVIQSVCKATKCVVVLISG  544

Query  1851  RPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             RP+V++PYL  +DA VAAWLPG+EGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  545   RPLVVEPYLGDMDAFVAAWLPGSEGQGVADVLFGDYGFTGKLSRTWFKSVDQ  596



>ref|NP_680141.2| Glycosyl hydrolase family protein [Arabidopsis thaliana]
 dbj|BAF01189.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90799.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=665

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/602 (65%), Positives = 486/602 (81%), Gaps = 4/602 (1%)
 Frame = +3

Query  210   MGKGSRFLIGVAL-LCCWVVV-ANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQI  383
             M + S  ++GV L +C WV    + +Y+LYKD +Q V  R+ DL  RMTL+EKIGQMVQI
Sbjct  1     MSRDSVRIVGVLLWMCMWVCCYGDGEYLLYKDPKQTVSDRVADLFGRMTLEEKIGQMVQI  60

Query  384   ERQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGID  563
             +R VA+  +M+ Y++GSVLS GGS P P ASA+ WVDM+N +QKG+L +RLGIPMIYGID
Sbjct  61    DRSVATVNIMRDYFIGSVLSGGGSAPLPEASAQNWVDMINEYQKGALVSRLGIPMIYGID  120

Query  564   AVHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPR  743
             AVHG+NN YNATIFPHNVGLGATRDP+LV+ IGAATA+EVRATGI Y FAPCIAVCRDPR
Sbjct  121   AVHGHNNVYNATIFPHNVGLGATRDPDLVKRIGAATAVEVRATGIPYTFAPCIAVCRDPR  180

Query  744   WGRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTV  923
             WGRCYESYSED ++V  MT++I GLQGE P NY    PFV GR+KVAACAKHYVGDGGT 
Sbjct  181   WGRCYESYSEDHKVVEDMTDVILGLQGEPPSNYKHGVPFVGGRDKVAACAKHYVGDGGTT  240

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
             +G++ENNT+ D H L S+HM  Y +++ +GV+TVM SYSS NG +MHAN ++ITG+LK T
Sbjct  241   RGVNENNTVTDLHGLLSVHMPAYADAVYKGVSTVMVSYSSWNGEKMHANTELITGYLKGT  300

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L+F+GFVISD++ +D ++   H +YT S+  +I AGIDMVMVP+N+TEF++ LT LVKN 
Sbjct  301   LKFKGFVISDWQGVDKISTPPHTHYTASVRAAIQAGIDMVMVPFNFTEFVNDLTTLVKNN  360

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +PV+RIDDAV+RIL VKF MGLFE+PL DYS +  LGS+ HR LAR+AVRKSLVLLKNG
Sbjct  361   SIPVTRIDDAVRRILLVKFTMGLFENPLADYSFSSELGSQAHRDLAREAVRKSLVLLKNG  420

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSGNI-TIGTTILTAIKNTV  1640
              N   P+LPL +K S+ILVAGTHADN+GYQCGGWTI WQG SGN  T GTT+L+A+K+ V
Sbjct  421   -NKTNPMLPLPRKTSKILVAGTHADNLGYQCGGWTITWQGFSGNKNTRGTTLLSAVKSAV  479

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  T+V+F ENPD EF+KS+ F++AI+ VGE  YAE +GDS  LT+ +PGP+II++ C  
Sbjct  480   DQSTEVVFRENPDAEFIKSNNFAYAIIAVGEPPYAETAGDSDKLTMLDPGPAIISSTCQA  539

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KCVVV+I+GRP+V++PY+  IDALVAAWLPGTEGQG+ D LFGD+GFSGKLP TWF+  
Sbjct  540   VKCVVVVISGRPLVMEPYVASIDALVAAWLPGTEGQGITDALFGDHGFSGKLPVTWFRNT  599

Query  2001  DQ  2006
             +Q
Sbjct  600   EQ  601



>emb|CDM84404.1| unnamed protein product [Triticum aestivum]
Length=656

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/587 (68%), Positives = 473/587 (81%), Gaps = 1/587 (0%)
 Frame = +3

Query  246   LLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyy  425
             LL C+    +A+YM YKD +QPV  RIKDL+ RMTL EKIGQM QIER VASA VMK Y+
Sbjct  13    LLLCFAWTGDAEYMKYKDPKQPVNTRIKDLIGRMTLAEKIGQMTQIERSVASADVMKNYF  72

Query  426   lgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIF  605
             +GS+LS GGSVP P+A+   WV+MVN FQKG+L+TRLGIPMIYGIDAVHGNNN YNATIF
Sbjct  73    IGSILSGGGSVPAPQATPAMWVNMVNEFQKGALATRLGIPMIYGIDAVHGNNNVYNATIF  132

Query  606   PHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEI  785
             PHNVGLGATRDP+LV+ IG ATALEVRATGI Y FAPCIAVCRDPRWGRCYESYSED +I
Sbjct  133   PHNVGLGATRDPDLVKRIGEATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDHKI  192

Query  786   VRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHD  965
             V+ MT+II GLQGE P N+    P+VA + KVAACAKH+VGDGGT  GI+ENNT++D H 
Sbjct  193   VQQMTDIILGLQGEIPVNHTKGVPYVA-KNKVAACAKHFVGDGGTHNGINENNTIIDEHG  251

Query  966   LFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAI  1145
             L  IHM  YY+SII+GVATVM SYSS+NG +MHAN D++TG+LK  L FRGFVISD+  I
Sbjct  252   LLGIHMPPYYDSIIKGVATVMVSYSSVNGEKMHANHDLVTGYLKSKLHFRGFVISDWLGI  311

Query  1146  DNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRI  1325
             D +T     NYTYS+   INAGIDMVMVP+NYTEFI+  T LV  + + +SRIDDAV RI
Sbjct  312   DRITSPAGANYTYSVQAGINAGIDMVMVPFNYTEFIEDATSLVNKRIISMSRIDDAVSRI  371

Query  1326  LRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKA  1505
             LRVKF MGLFE+PL D S A  LG ++HR+LAR+AVRKSLVLLKNG   ++  LPL KKA
Sbjct  372   LRVKFTMGLFENPLADLSFADQLGKKEHRELAREAVRKSLVLLKNGNTPNQQFLPLPKKA  431

Query  1506  SRILVAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPE  1685
             S+ILVAG+HA N+GYQCGGW+I+W G SG+IT GTTIL AIK+TV   T V++ ENPD  
Sbjct  432   SKILVAGSHASNLGYQCGGWSIQWMGGSGDITAGTTILDAIKSTVGDATPVVYSENPDDS  491

Query  1686  FVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVI  1865
             F+K + FS AIVVVGE  YAE  GD+++LTI +PGP  I  VC   KC VV+++GRPV+I
Sbjct  492   FMKKNDFSFAIVVVGESPYAETVGDNTDLTILDPGPDTIRTVCSAVKCAVVVVSGRPVII  551

Query  1866  QPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
             +PYLP ++ALVAAWLPGTEGQGVADVLFGDYGF+GKL  TWFK+VDQ
Sbjct  552   EPYLPLMEALVAAWLPGTEGQGVADVLFGDYGFTGKLSRTWFKSVDQ  598



>ref|NP_001051277.1| Os03g0749500 [Oryza sativa Japonica Group]
 gb|ABF98887.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|ABF98888.1| Glycosyl hydrolase family 3 N terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13191.1| Os03g0749500 [Oryza sativa Japonica Group]
 dbj|BAG93291.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/583 (67%), Positives = 465/583 (80%), Gaps = 0/583 (0%)
 Frame = +3

Query  258   WVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIERQVASAQVMKkyylgsv  437
             W     A Y+LYKD  +PV  R+ DLL+RMTL EKIGQM QIERQVAS QV+K Y++GS+
Sbjct  17    WAAYGEAQYVLYKDATKPVEARVTDLLARMTLAEKIGQMTQIERQVASPQVLKDYFIGSL  76

Query  438   lssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAVHGNNNAYNATIFPHNV  617
             LS GGSVP+ +A+A  WV MV+ FQKGSLSTRLGIPMIYGIDAVHG+NN Y ATIFPHNV
Sbjct  77    LSGGGSVPRKQATAAEWVSMVSDFQKGSLSTRLGIPMIYGIDAVHGHNNVYGATIFPHNV  136

Query  618   GLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWGRCYESYSEDPEIVRAM  797
              LGATRDP LV+ IGAATALEVRATGIQY FAPCIAVCRDPRWGRCYESYSED  IV+AM
Sbjct  137   ALGATRDPNLVKRIGAATALEVRATGIQYAFAPCIAVCRDPRWGRCYESYSEDHRIVQAM  196

Query  798   TEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKGIDENNTLVDTHDLFSI  977
             TE+IPGLQG+ P N+    P+VAG+  VAACAKH+VGDGGT  G++E+NT++D   L +I
Sbjct  197   TELIPGLQGDVPANFTSGMPYVAGKNNVAACAKHFVGDGGTQNGVNEDNTIIDRRGLMTI  256

Query  978   HMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLRFRGFVISDFKAIDNLT  1157
             HM  Y N++ +GV+TVM SYSS NG++MHAN D++T +LK  L F+GF ISD++ ID +T
Sbjct  257   HMPAYLNALQKGVSTVMISYSSWNGIKMHANHDLVTRYLKDRLNFKGFTISDWEGIDRIT  316

Query  1158  PTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFVPVSRIDDAVKRILRVK  1337
                  NY+YS+   + AGIDM+MVP NY  FI  LT  V N  +P+SRIDDAV RILRVK
Sbjct  317   TPAGSNYSYSVQAGVLAGIDMIMVPNNYQSFISILTSHVNNGIIPMSRIDDAVTRILRVK  376

Query  1338  FVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGANADEPVLPLRKKASRIL  1517
             F MGLFE+P+ D S+A  LG ++HR LAR+AVRKSLVLLKNG  +D+P+LPL KKA +IL
Sbjct  377   FTMGLFENPMPDSSMADQLGKKEHRDLAREAVRKSLVLLKNGKTSDKPMLPLSKKAPKIL  436

Query  1518  VAGTHADNIGYQCGGWTIEWQGLSGNITIGTTILTAIKNTVDTKTQVMFEENPDPEFVKS  1697
             VAG+HADN+GYQCGGWTIEWQG +G IT+G TIL A+K  VD  T V+F ENPD +FVK+
Sbjct  437   VAGSHADNLGYQCGGWTIEWQGDTGRITVGMTILDAVKAAVDPSTTVVFAENPDADFVKN  496

Query  1698  SKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTKCVVVLITGRPVVIQPYL  1877
               FS+AIVVVGE  Y E  GDS NLTIP+PGPS +A VC   +C  VLI+GRPVV+QP+L
Sbjct  497   GGFSYAIVVVGEHPYTETKGDSLNLTIPDPGPSTVATVCGAAQCATVLISGRPVVVQPFL  556

Query  1878  PQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVDQ  2006
               +DALVAAWLPGTEGQGV DVLFGDYGF+GKLP TWFK+VDQ
Sbjct  557   GAMDALVAAWLPGTEGQGVTDVLFGDYGFTGKLPRTWFKSVDQ  599



>ref|XP_008791319.1| PREDICTED: uncharacterized protein LOC103708257 [Phoenix dactylifera]
Length=1262

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/602 (68%), Positives = 490/602 (81%), Gaps = 2/602 (0%)
 Frame = +3

Query  207   KMGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             KM    R +     LC W+ +  A+Y+ YKD +QP+  RI DLLSRMTL EK+GQM QI 
Sbjct  633   KMEHSLRLIFIPLFLCSWMAMGGAEYLKYKDPKQPLNVRIDDLLSRMTLAEKVGQMSQIA  692

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
              + A+++V+ KY++GSVLS GGSVP P+ASAEAWV+MVN  QKG+LSTRLGIPMIYGIDA
Sbjct  693   MENATSEVINKYFIGSVLSGGGSVPAPKASAEAWVNMVNEMQKGALSTRLGIPMIYGIDA  752

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NNAY ATIFPHN+GLGATR+P LV+ IGAATALEVRATGI YVFAPC+ VCRDPRW
Sbjct  753   VHGHNNAYKATIFPHNIGLGATREPTLVKRIGAATALEVRATGIPYVFAPCVVVCRDPRW  812

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAG-REKVAACAKHYVGDGGTV  923
             GRCYESYSED +IV+AMTE+IPGLQGE P N     PFVAG +  VAACAKHYVGDGGT 
Sbjct  813   GRCYESYSEDTKIVQAMTELIPGLQGEIPANSHKGVPFVAGPKRNVAACAKHYVGDGGTY  872

Query  924   KGIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKT  1103
             KGI+ENNT++  H L SIHM  YY +I +GV+TVM S+SS NGV+MHAN  ++T FLK  
Sbjct  873   KGINENNTIISLHGLLSIHMPPYYEAITKGVSTVMVSFSSWNGVKMHANHYLVTDFLKNK  932

Query  1104  LRFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNK  1283
             L FRGFVISD++ ID +T + H NY+YSI   ++AGIDMVM+PY+Y EFID LTY VKN 
Sbjct  933   LHFRGFVISDWQGIDRITSSPHANYSYSIQAGVHAGIDMVMIPYDYPEFIDDLTYQVKNN  992

Query  1284  FVPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNG  1463
              +P+SRIDDA++RILRVKF MGLFE P  D SLA  LG ++HR+LAR+AVRKSLVLLKNG
Sbjct  993   VIPMSRIDDAIRRILRVKFTMGLFEKPYADLSLADQLGKKEHRELAREAVRKSLVLLKNG  1052

Query  1464  ANADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTV  1640
              + D P+LPL KKA +ILVAG+HADN+G QCGGWTI WQG SG N+TIGTTIL AIK TV
Sbjct  1053  KSTDNPLLPLPKKAKKILVAGSHADNLGCQCGGWTITWQGRSGNNLTIGTTILDAIKATV  1112

Query  1641  DTKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPH  1820
             D  T+V++ ENP+ +FV   +FS+AIV VGE+ YAE +GD+ NLTIPEPGPS+I NVC +
Sbjct  1113  DPTTKVVYSENPEADFVDHDQFSYAIVAVGEQPYAETNGDNLNLTIPEPGPSVIQNVCRN  1172

Query  1821  TKCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTV  2000
              KC+VV+I+GRP+VI+PY+  IDALVAAWLPGTEGQGVADVLFGDYGFSGKL  TWFK+V
Sbjct  1173  IKCLVVIISGRPLVIEPYMHMIDALVAAWLPGTEGQGVADVLFGDYGFSGKLSRTWFKSV  1232

Query  2001  DQ  2006
             DQ
Sbjct  1233  DQ  1234


 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/601 (67%), Positives = 485/601 (81%), Gaps = 2/601 (0%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCW-VVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIE  386
             M   SR  + + L  C+ V +  +DY+ YKD +QP+  RI DLLSRMTL EKIGQM QI 
Sbjct  1     MMASSRCHLFILLFICFSVAMGGSDYLKYKDPKQPLNVRINDLLSRMTLAEKIGQMSQIA  60

Query  387   RQVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDA  566
             R+ AS  V+K Y++GSVLS GGSVP P+ASAE W++M+   QK +LSTRLGIPMIYGIDA
Sbjct  61    RENASYDVIKNYFIGSVLSGGGSVPAPKASAETWMNMITVMQKAALSTRLGIPMIYGIDA  120

Query  567   VHGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRW  746
             VHG+NNAYNATIFPHN+GLGA RDP LV++IGAATALEVRATGI Y FAPC+AVCRDPRW
Sbjct  121   VHGHNNAYNATIFPHNIGLGAGRDPALVKKIGAATALEVRATGIPYAFAPCVAVCRDPRW  180

Query  747   GRCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVK  926
             GRCYESYSEDP++V  MTEIIPGLQG+ P N     PFVAG+  VAACAKHYVGDGGT  
Sbjct  181   GRCYESYSEDPKVVEEMTEIIPGLQGDIPANSRKGVPFVAGQRNVAACAKHYVGDGGTYM  240

Query  927   GIDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTL  1106
             GI+ENNT++  H L SIHM  YY++II+GV+TVM SYSS NG +MHAN  ++T FLK  L
Sbjct  241   GINENNTIISPHGLLSIHMPPYYDAIIKGVSTVMVSYSSWNGEKMHANHYLVTKFLKGLL  300

Query  1107  RFRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKF  1286
              FRGFVI+D++ +D +T   H NY+YSI   I+AGIDMVM+PY + EF D LTY V+N  
Sbjct  301   HFRGFVITDWEGLDRITSPPHANYSYSIQAGISAGIDMVMIPYAFKEFRDDLTYQVQNNI  360

Query  1287  VPVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGA  1466
             +P+SRIDDAV+RILRVKF MGLFE+P  D SLA  LG ++HR+LAR+AVRKSLVLLKNG 
Sbjct  361   IPMSRIDDAVRRILRVKFTMGLFENPFPDPSLADQLGKKEHRELAREAVRKSLVLLKNGK  420

Query  1467  NADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVD  1643
             + D P+LPL KK  +IL+AG+HADN+GYQCGGWTI WQGLSG N+T GTTIL AI++TVD
Sbjct  421   SGDSPMLPLPKKTQKILIAGSHADNLGYQCGGWTISWQGLSGNNLTTGTTILNAIQSTVD  480

Query  1644  TKTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHT  1823
              +T+V++ ENPD E + S+KFS+AIVVVGE  YAE  GD+ NLTIP+PGP +I NVC   
Sbjct  481   AETEVIYSENPDSELISSNKFSYAIVVVGEHPYAETDGDNLNLTIPDPGPKVIQNVCSSI  540

Query  1824  KCVVVLITGRPVVIQPYLPQIDALVAAWLPGTEGQGVADVLFGDYGFSGKLPFTWFKTVD  2003
             KCVVVLI+GRP+V++PY+  IDA VAAWLPGTEGQGVADVLFGDYGFSGKLP TWF++VD
Sbjct  541   KCVVVLISGRPLVVEPYIDGIDAFVAAWLPGTEGQGVADVLFGDYGFSGKLPRTWFRSVD  600

Query  2004  Q  2006
             Q
Sbjct  601   Q  601



>ref|XP_006651822.1| PREDICTED: lysosomal beta glucosidase-like [Oryza brachyantha]
Length=647

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/622 (66%), Positives = 483/622 (78%), Gaps = 25/622 (4%)
 Frame = +3

Query  210   MGKGSRFLIGVALLCCWVVVANADYMLYKDHRQPVGRRIKDLLSRMTLKEKIGQMVQIER  389
             MG   +F   V L+ C+  +A+A Y+ YKD +QPV  R+KDLLSRMTL EKIGQM QIER
Sbjct  1     MGSLHKFSF-VILMLCYTTLASAQYVKYKDPKQPVSVRVKDLLSRMTLAEKIGQMTQIER  59

Query  390   QVASAQVMKkyylgsvlssggsvpkpRASAEAWVDMVNGFQKGSLSTRLGIPMIYGIDAV  569
             + A+A+ + KY++GSVLS GGSVP P+AS +AW  MV+  QKG+LSTRLGIP+IYGIDAV
Sbjct  60    ENATAEQISKYFIGSVLSGGGSVPAPQASPQAWASMVDEMQKGALSTRLGIPIIYGIDAV  119

Query  570   HGNNNAYNATIFPHNVGLGATRDPELVREIGAATALEVRATGIQYVFAPCIAVCRDPRWG  749
             HG+NN Y ATIFPHNVGLGATRDPELV++IG ATALEVRATGI YVFAPC+AVCRDPRWG
Sbjct  120   HGHNNVYKATIFPHNVGLGATRDPELVKKIGEATALEVRATGIPYVFAPCVAVCRDPRWG  179

Query  750   RCYESYSEDPEIVRAMTEIIPGLQGEAPPNYPLSFPFVAGREKVAACAKHYVGDGGTVKG  929
             RCYESYSEDP++V++ T +I GLQG+ P N  +  P+V G +KVAACAKHYVGDGGTVKG
Sbjct  180   RCYESYSEDPKVVQSFTTLISGLQGDVPSN-DVGRPYVGGSKKVAACAKHYVGDGGTVKG  238

Query  930   IDENNTLVDTHDLFSIHMAGYYNSIIRGVATVMASYSSLNGVRMHANRDMITGFLKKTLR  1109
             I+ENNT++DTH L +IHM  YYNS+IRGV+TVM SYSS NGV+MHAN  +IT FLK  LR
Sbjct  239   INENNTIIDTHGLMTIHMPPYYNSVIRGVSTVMVSYSSWNGVKMHANHHLITDFLKNKLR  298

Query  1110  FRGFVISDFKAIDNLTPTVHGNYTYSILTSINAGIDMVMVPYNYTEFIDGLTYLVKNKFV  1289
             FRGFVISD++ ID +T   H NY+YSI   I AGIDM+MVPY YTEFID LT  V NK +
Sbjct  299   FRGFVISDWQGIDRITSPPHKNYSYSIEAGIGAGIDMIMVPYTYTEFIDDLTEQVNNKII  358

Query  1290  PVSRIDDAVKRILRVKFVMGLFEDPLGDYSLAHHLGSRKHRKLARKAVRKSLVLLKNGAN  1469
             P+SRIDDAV RILRVKF MGLFE P  D SLA+ LG ++HR+LAR+AVRKSLVLLKNG +
Sbjct  359   PMSRIDDAVYRILRVKFTMGLFESPFSDSSLANELGKQEHRELAREAVRKSLVLLKNGKS  418

Query  1470  ADEPVLPLRKKASRILVAGTHADNIGYQCGGWTIEWQGLSG-NITIGTTILTAIKNTVDT  1646
             +  PVLPL KKA +ILVAG+HAD++G QCGGWTI WQG  G NIT GTTIL+ IK TVD 
Sbjct  419   SYSPVLPLPKKAGKILVAGSHADDLGRQCGGWTITWQGQPGNNITAGTTILSGIKATVDP  478

Query  1647  KTQVMFEENPDPEFVKSSKFSHAIVVVGEKTYAEGSGDSSNLTIPEPGPSIIANVCPHTK  1826
              T V++ ENPD   V   K+ +AIVVVGE  YAEG GD+ NLTIPEPGPS+I  VC   K
Sbjct  479   STTVVYSENPDSSVVAGDKYDYAIVVVGEPPYAEGFGDNLNLTIPEPGPSVIQTVCGSVK  538

Query  1827  CVVVLIT----------------------GRPVVIQPYLPQIDALVAAWLPGTEGQGVAD  1940
             CVVVL++                      GRPVV+QP+L   DA VAAWLPGTEGQGVAD
Sbjct  539   CVVVLVSGRPLVVEPYIGGMDAFVAAWLGGRPVVVQPFLDSTDAFVAAWLPGTEGQGVAD  598

Query  1941  VLFGDYGFSGKLPFTWFKTVDQ  2006
             VLFGDYGF+GKL  TWF++ DQ
Sbjct  599   VLFGDYGFTGKLSRTWFRSADQ  620



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5998204766208