BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25098_g1_i2 len=1409 path=[1374:0-298 2908:299-304 1679:305-347
3076:348-353 1728:354-421 3438:422-439 1814:440-472 3970:473-473
3971:474-477 3520:478-503 1878:504-666 2883:667-668 2043:669-862
2814:863-883 2258:884-965 3203:966-1011 2386:1012-1101
3661:1102-1121 2496:1122-1171 3829:1172-1175 2550:1176-1199
3856:1200-1226 2599:1227-1265 3021:1266-1297 2659:1298-1408]

Length=1409
                                                                      Score     E

ref|XP_011090120.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          575   0.0      
ref|XP_009592182.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          564   0.0      
ref|XP_011080358.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          561   0.0      
ref|XP_006365621.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          556   0.0      
emb|CDP09262.1|  unnamed protein product                                556   0.0      
gb|EYU31375.1|  hypothetical protein MIMGU_mgv1a010032mg                552   0.0      
ref|NP_001234823.1|  phenylacetaldehyde reductase                       551   0.0      
emb|CDP09263.1|  unnamed protein product                                547   0.0      
gb|AHC29025.1|  phenylacetaldehyde reductase                            544   0.0      
ref|XP_011080432.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          544   0.0      
gb|AAX15956.1|  cinnamyl alcohol dehydrogenase 1                        543   0.0      Nicotiana tabacum [American tobacco]
dbj|BAG13450.2|  phenylacetaldehyde reductase                           543   0.0      Rosa x damascena [damask rose]
ref|NP_001280189.1|  cinnamoyl-CoA reductase 1                          542   0.0      
gb|AAX83110.1|  alcohol dehydrogenase-like protein                      541   0.0      Ocimum basilicum [basil]
gb|AFU90744.1|  cinnamyl alcohol dehydrogenase                          541   0.0      
ref|XP_004291772.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          540   0.0      
gb|EYU46248.1|  hypothetical protein MIMGU_mgv1a010028mg                540   0.0      
gb|AAC06319.1|  putative cinnamyl alcohol dehydrogenase                 540   0.0      Malus domestica [apple tree]
ref|XP_002285368.1|  PREDICTED: cinnamoyl-CoA reductase 1               539   0.0      Vitis vinifera
ref|XP_009795334.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          539   0.0      
dbj|BAQ20438.1|  2-phenylethanol                                        539   0.0      
ref|XP_008349860.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          539   0.0      
ref|XP_007211587.1|  hypothetical protein PRUPE_ppa008618mg             539   0.0      
ref|XP_009618541.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          538   0.0      
ref|NP_001234830.1|  phenylacetaldehyde reductase                       536   0.0      
ref|XP_009374930.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          535   0.0      
ref|XP_006365623.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          533   0.0      
ref|XP_011090033.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          533   0.0      
ref|XP_008363357.1|  PREDICTED: cinnamoyl-CoA reductase 1               533   0.0      
gb|AAX15955.1|  cinnamyl alcohol dehydrogenase 1                        532   0.0      Nicotiana tabacum [American tobacco]
ref|NP_001289243.1|  CAD protein                                        532   0.0      
ref|XP_002314079.1|  cinnamyl-alcohol dehydrogenase family protein      531   0.0      Populus trichocarpa [western balsam poplar]
gb|EPS73808.1|  alcohol dehydrogenase-like protein                      531   0.0      
ref|XP_011032045.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          531   0.0      
ref|XP_008363567.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          531   0.0      
gb|AFY97683.1|  cinnamyl alcohol dehydrogenase 1                        530   0.0      
ref|XP_011025551.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          530   0.0      
gb|AIB06353.1|  cinnamyl alcohol dehydrogenase                          530   0.0      
emb|CDX92530.1|  BnaA10g15690D                                          529   0.0      
ref|XP_009120886.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X1    529   0.0      
ref|XP_004143234.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          528   0.0      
gb|ADO51749.1|  cinnamyl alcohol dehydrogenase                          528   0.0      
ref|XP_002298395.1|  cinnamyl-alcohol dehydrogenase family protein      528   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003598002.1|  Dihydroflavonol-4-reductase                        527   0.0      
ref|XP_010045028.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          527   0.0      
ref|XP_004491683.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          526   0.0      
gb|KCW87172.1|  hypothetical protein EUGRSUZ_B03695                     529   0.0      
pdb|4QTZ|A  Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydr...    526   0.0      
ref|XP_006446146.1|  hypothetical protein CICLE_v10015912mg             526   0.0      
ref|XP_010905794.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          525   0.0      
ref|XP_002513513.1|  cinnamoyl-CoA reductase, putative                  528   0.0      Ricinus communis
gb|KCW87173.1|  hypothetical protein EUGRSUZ_B03696                     527   0.0      
ref|XP_010102363.1|  hypothetical protein L484_015312                   525   0.0      
gb|KHN12530.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    525   0.0      
ref|XP_008449698.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          525   0.0      
pdb|4QUK|A  Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydr...    525   0.0      
ref|XP_010045029.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          525   0.0      
ref|XP_007149029.1|  hypothetical protein PHAVU_005G034500g             525   0.0      
gb|AFK47262.1|  unknown                                                 524   0.0      
ref|XP_007015091.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    524   0.0      
ref|XP_010316141.1|  PREDICTED: phenylacetaldehyde reductase isof...    536   0.0      
emb|CAA61275.1|  cinnamyl alcohol dehydrogenase                         523   0.0      Eucalyptus gunnii
ref|XP_010519769.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          523   0.0      
gb|ACJ85556.1|  unknown                                                 523   0.0      Medicago truncatula
emb|CDY14000.1|  BnaC09g38260D                                          522   0.0      
ref|XP_008790952.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    522   0.0      
gb|KHG03033.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    522   0.0      
ref|NP_001242544.1|  uncharacterized protein LOC100781477               521   0.0      
ref|XP_006602185.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          521   1e-180   
ref|XP_006400504.1|  hypothetical protein EUTSA_v10014099mg             520   1e-180   
gb|KDP22108.1|  hypothetical protein JCGZ_25939                         523   2e-180   
ref|XP_010905792.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          522   2e-180   
ref|XP_010534743.1|  PREDICTED: cinnamoyl-CoA reductase 1               519   5e-180   
ref|XP_010651224.1|  PREDICTED: cinnamoyl-CoA reductase 1               519   5e-180   
ref|XP_008790953.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    519   6e-180   
ref|XP_010102362.1|  hypothetical protein L484_015311                   519   8e-180   
gb|KHN12533.1|  Dihydroflavonol-4-reductase                             518   8e-180   
ref|XP_011013832.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          516   4e-179   
emb|CBI16354.3|  unnamed protein product                                518   5e-179   
ref|XP_011045419.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          516   7e-179   
ref|XP_007015092.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    515   1e-178   
ref|XP_010420748.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    515   1e-178   
gb|KFK26207.1|  hypothetical protein AALP_AA8G216400                    514   4e-178   
ref|XP_010454217.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    514   4e-178   
ref|XP_006365624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          514   5e-178   
ref|XP_002871885.1|  hypothetical protein ARALYDRAFT_488833             513   8e-178   
ref|XP_010246748.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          513   1e-177   
gb|AFK47029.1|  unknown                                                 513   1e-177   
ref|XP_010908347.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    513   1e-177   
ref|NP_175552.2|  putative alcohol dehydrogenase                        511   5e-177   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197445.1|  alcohol dehydrogenase-like protein                    511   6e-177   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107209.1|  PREDICTED: cinnamoyl-CoA reductase 1               511   6e-177   
ref|XP_010420747.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    511   7e-177   
ref|XP_010493007.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    510   1e-176   
ref|XP_006287932.1|  hypothetical protein CARUB_v10001167mg             512   2e-176   
ref|XP_006393056.1|  hypothetical protein EUTSA_v10011653mg             510   2e-176   
ref|XP_010536092.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          509   2e-176   
gb|AAM65984.1|  cinnamyl-alcohol dehydrogenase-like protein             509   2e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908348.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    509   4e-176   
gb|AAY26021.2|  cinnamyl alcohol dehydrogenase                          509   5e-176   Eucommia ulmoides
emb|CDY43911.1|  BnaA05g15210D                                          509   5e-176   
ref|XP_009144901.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    509   6e-176   
ref|XP_009114927.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          508   1e-175   
gb|KFK35854.1|  hypothetical protein AALP_AA4G045500                    507   2e-175   
ref|XP_010493009.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          507   2e-175   
ref|XP_010045026.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          507   3e-175   
ref|XP_010493006.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    506   5e-175   
ref|XP_010461970.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          506   7e-175   
emb|CAJ43901.1|  cinnamyl alcohol dehydrogenase                         506   7e-175   Quercus ilex [holly oak]
ref|XP_010493008.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          506   9e-175   
ref|XP_006470635.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          505   1e-174   
ref|XP_010500717.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          505   2e-174   
ref|XP_006306213.1|  hypothetical protein CARUB_v10011885mg             505   3e-174   
ref|XP_002891638.1|  hypothetical protein ARALYDRAFT_314503             521   3e-174   
ref|XP_007131546.1|  hypothetical protein PHAVU_011G022300g             504   3e-174   
ref|XP_006365632.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          504   4e-174   
emb|CDY22576.1|  BnaC05g24140D                                          504   4e-174   
ref|XP_010479624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          504   5e-174   
gb|ABV44810.1|  cinnamyl alcohol dehydrogenase 1                        503   5e-174   Eriobotrya japonica [loquat]
ref|XP_003598007.1|  CCP                                                503   5e-174   
gb|ADD23217.1|  cinnamyl alcohol dehydrogenase                          503   1e-173   Cistanche deserticola
ref|XP_010102364.1|  hypothetical protein L484_015313                   503   1e-173   
ref|XP_007015093.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    501   3e-173   
gb|AAG52618.1|AC024261_5  cinnamyl alcohol dehydrogenase, putativ...    519   4e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493011.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    501   5e-173   
ref|XP_008449700.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          501   5e-173   
ref|XP_010673676.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    499   3e-172   
gb|KHN20640.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    499   5e-172   
ref|NP_001242322.1|  uncharacterized protein LOC100809326               499   5e-172   
ref|XP_010493010.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    497   2e-171   
ref|XP_009413954.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          498   5e-171   
ref|XP_004156308.1|  PREDICTED: tetraketide alpha-pyrone reductas...    495   1e-170   
ref|XP_002453729.1|  hypothetical protein SORBIDRAFT_04g011550          495   2e-170   Sorghum bicolor [broomcorn]
gb|KFK26208.1|  hypothetical protein AALP_AA8G216500                    494   4e-170   
ref|XP_008231479.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          493   6e-170   
ref|XP_007218683.1|  hypothetical protein PRUPE_ppa008707mg             493   7e-170   
ref|XP_010454218.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    493   8e-170   
ref|XP_010454220.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    493   1e-169   
gb|AAQ88099.1|  NADPH-dependent cinnamyl alcohol dehydrogenase          493   1e-169   Quercus suber [cork oak]
ref|XP_010102365.1|  hypothetical protein L484_015314                   490   2e-168   
ref|XP_002263014.1|  PREDICTED: cinnamoyl-CoA reductase 1               488   8e-168   Vitis vinifera
ref|XP_008790948.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    488   1e-167   
ref|XP_010673675.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    488   1e-167   
gb|KHG07124.1|  Dihydroflavonol-4-reductase                             486   3e-167   
ref|XP_004987233.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          487   3e-167   
ref|XP_010230911.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          486   5e-167   
ref|XP_008363305.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          485   8e-167   
ref|XP_010905793.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          488   8e-167   
ref|XP_008349589.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          485   9e-167   
ref|XP_009354346.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    485   1e-166   
emb|CAJ43716.1|  cinnamoyl alcohol dehydrogenase                        482   1e-165   Plantago major [cart-track plant]
ref|XP_009354347.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    482   2e-165   
gb|EAY74373.1|  hypothetical protein OsI_02260                          482   3e-165   Oryza sativa Indica Group [Indian rice]
ref|NP_001043234.1|  Os01g0528800                                       481   5e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007029628.1|  NAD(P)-binding Rossmann-fold superfamily pro...    481   5e-165   
gb|EMS49381.1|  Dihydroflavonol-4-reductase                             480   1e-164   
ref|XP_008790954.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    480   1e-164   
ref|XP_006851072.1|  hypothetical protein AMTR_s00025p00240760          479   2e-164   
ref|XP_010673674.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          479   3e-164   
dbj|BAA12161.1|  CPRD14 protein                                         479   3e-164   Vigna unguiculata
gb|EMT10896.1|  Dihydroflavonol-4-reductase                             479   4e-164   
ref|NP_001150399.1|  LOC100284029                                       479   5e-164   Zea mays [maize]
ref|XP_007029632.1|  NAD(P)-binding Rossmann-fold superfamily pro...    478   6e-164   
ref|XP_010905795.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          477   1e-163   
dbj|BAJ90096.1|  predicted protein                                      478   2e-163   
ref|XP_010905790.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    479   3e-163   
gb|KHN20639.1|  Dihydroflavonol-4-reductase                             476   6e-163   
gb|ACF88378.1|  unknown                                                 476   6e-163   Zea mays [maize]
ref|XP_002314052.1|  putative cinnamoyl-CoA reductase family protein    474   3e-162   Populus trichocarpa [western balsam poplar]
ref|XP_010673664.1|  PREDICTED: tetraketide alpha-pyrone reductas...    474   4e-162   
ref|XP_010659458.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          473   6e-162   
ref|XP_011025488.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    473   6e-162   
ref|XP_007149032.1|  hypothetical protein PHAVU_005G034800g             473   8e-162   
gb|KDP43569.1|  hypothetical protein JCGZ_16856                         472   1e-161   
ref|XP_006851070.1|  hypothetical protein AMTR_s00025p00240180          472   1e-161   
ref|NP_001242261.1|  uncharacterized protein LOC100804704               472   2e-161   
ref|XP_007149031.1|  hypothetical protein PHAVU_005G034700g             471   3e-161   
ref|XP_010905788.1|  PREDICTED: cinnamoyl-CoA reductase 2-like is...    474   4e-161   
gb|KHM99527.1|  Dihydroflavonol-4-reductase                             469   4e-161   
ref|XP_008349583.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          471   5e-161   
ref|XP_004307230.1|  PREDICTED: tetraketide alpha-pyrone reductas...    471   5e-161   
ref|XP_004307229.1|  PREDICTED: tetraketide alpha-pyrone reductas...    470   7e-161   
gb|KGN48125.1|  Cinnamoyl-CoA reductase                                 481   1e-160   
ref|XP_011080359.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          469   2e-160   
gb|ACZ74591.1|  cinnamoyl CoA reductase-like 2c                         468   5e-160   Panicum virgatum
gb|ACZ74589.1|  cinnamoyl CoA reductase-like 2a                         469   5e-160   Panicum virgatum
ref|XP_011025487.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    468   6e-160   
ref|XP_009395948.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          468   2e-159   
ref|NP_001241540.1|  uncharacterized protein LOC100799213               466   3e-159   
gb|AAD53967.1|  aldehyde reductase                                      466   3e-159   Vigna radiata [mung bean]
ref|XP_007149030.1|  hypothetical protein PHAVU_005G034600g             465   1e-158   
emb|CBI40606.3|  unnamed protein product                                464   2e-158   
ref|XP_009413953.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    463   6e-158   
gb|EMS47957.1|  Dihydroflavonol-4-reductase                             463   1e-157   
ref|XP_003607372.1|  Dihydroflavonol-4-reductase                        462   2e-157   
ref|XP_004505624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          461   2e-157   
gb|EYU46247.1|  hypothetical protein MIMGU_mgv1a010028mg                460   3e-157   
ref|XP_009120887.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X2    459   4e-157   
ref|XP_003634871.2|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    461   5e-157   
ref|XP_009413950.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    459   2e-156   
ref|XP_003633516.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X1    459   2e-156   
emb|CBI24952.3|  unnamed protein product                                459   3e-156   
ref|XP_007163919.1|  hypothetical protein PHAVU_L005800g                458   4e-156   
emb|CBI29100.3|  unnamed protein product                                457   7e-156   
ref|XP_010673673.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          457   8e-156   
gb|AES68255.2|  cinnamyl-alcohol dehydrogenase-like protein             456   1e-155   
ref|XP_007163918.1|  hypothetical protein PHAVU_L005700g                457   1e-155   
ref|XP_003598003.1|  Dihydroflavonol-4-reductase                        455   1e-155   
ref|XP_009354348.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    467   3e-155   
ref|XP_004171433.1|  PREDICTED: tetraketide alpha-pyrone reductas...    454   4e-155   
ref|XP_004509912.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    456   4e-155   
ref|XP_007015094.1|  Cinnamyl alcohol dehydrogenase, 82967-79323,...    453   1e-154   
ref|XP_003567728.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          454   1e-154   
gb|KCW87178.1|  hypothetical protein EUGRSUZ_B03705                     454   2e-154   
emb|CBI40605.3|  unnamed protein product                                454   3e-154   
emb|CBI29130.3|  unnamed protein product                                453   3e-154   
gb|ABK21028.1|  unknown                                                 453   3e-154   Picea sitchensis
ref|XP_004956189.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          453   4e-154   
gb|ACZ74590.1|  cinnamoyl CoA reductase-like 2b                         453   4e-154   Panicum virgatum
gb|ABK21248.1|  unknown                                                 452   1e-153   Picea sitchensis
ref|XP_007131547.1|  hypothetical protein PHAVU_011G022400g             452   1e-153   
emb|CAN65489.1|  hypothetical protein VITISV_003761                     452   2e-153   Vitis vinifera
gb|AFK46906.1|  unknown                                                 451   3e-153   
emb|CBI38203.3|  unnamed protein product                                451   4e-153   
ref|XP_010067836.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          450   7e-153   
ref|XP_003628601.1|  Dihydroflavonol-4-reductase                        449   1e-152   
ref|XP_006446144.1|  hypothetical protein CICLE_v100159012mg            447   1e-152   
emb|CAN71341.1|  hypothetical protein VITISV_002438                     449   2e-152   Vitis vinifera
ref|XP_003633515.2|  PREDICTED: LOW QUALITY PROTEIN: cinnamoyl-Co...    457   5e-152   
ref|XP_002268122.1|  PREDICTED: cinnamoyl-CoA reductase 1               448   5e-152   Vitis vinifera
gb|AFK38743.1|  unknown                                                 447   5e-152   
ref|XP_002268322.1|  PREDICTED: cinnamoyl-CoA reductase 1               447   6e-152   Vitis vinifera
ref|XP_010067832.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          447   6e-152   
ref|XP_007131544.1|  hypothetical protein PHAVU_011G022100g             447   7e-152   
gb|KEH19920.1|  cinnamyl alcohol dehydrogenase                          447   8e-152   
ref|XP_003628576.1|  Dihydroflavonol-4-reductase                        447   1e-151   
ref|XP_008790956.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    446   1e-151   
ref|XP_003607374.1|  Dihydroflavonol-4-reductase                        447   1e-151   
ref|XP_010673662.1|  PREDICTED: tetraketide alpha-pyrone reductas...    446   3e-151   
ref|XP_008790949.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    445   3e-151   
ref|XP_007149033.1|  hypothetical protein PHAVU_005G034900g             445   7e-151   
ref|XP_007131545.1|  hypothetical protein PHAVU_011G022200g             444   9e-151   
gb|KEH19926.1|  cinnamyl alcohol dehydrogenase                          444   1e-150   
ref|XP_011025485.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    444   2e-150   
ref|XP_010067837.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    444   2e-150   
ref|XP_004307228.1|  PREDICTED: uncharacterized protein LOC101295856    454   4e-150   
ref|XP_007052475.1|  NAD(P)-binding Rossmann-fold superfamily pro...    443   5e-150   
ref|XP_002267167.2|  PREDICTED: uncharacterized protein LOC100257...    453   1e-149   Vitis vinifera
gb|ABK22554.1|  unknown                                                 441   2e-149   Picea sitchensis
ref|XP_002314053.2|  putative cinnamoyl-CoA reductase family protein    440   4e-149   Populus trichocarpa [western balsam poplar]
ref|XP_010042035.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          439   1e-148   
ref|XP_010067842.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    439   2e-148   
ref|XP_011025486.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    437   6e-148   
ref|XP_002517788.1|  cinnamoyl-CoA reductase, putative                  437   1e-147   Ricinus communis
ref|XP_011025483.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    437   1e-147   
ref|XP_010067835.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          434   7e-147   
ref|XP_010067830.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          434   7e-147   
ref|XP_008231472.1|  PREDICTED: tetraketide alpha-pyrone reductas...    433   3e-146   
ref|XP_010042036.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          433   4e-146   
gb|KCW66066.1|  hypothetical protein EUGRSUZ_G03353                     434   4e-146   
gb|AFK47425.1|  unknown                                                 431   1e-145   
ref|XP_002517775.1|  cinnamoyl-CoA reductase, putative                  444   1e-145   Ricinus communis
ref|XP_010067827.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          431   2e-145   
emb|CDP14617.1|  unnamed protein product                                428   7e-145   
dbj|BAJ98589.1|  predicted protein                                      430   1e-144   
ref|XP_008231476.1|  PREDICTED: tetraketide alpha-pyrone reductas...    429   1e-144   
ref|XP_008790957.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    427   2e-144   
ref|XP_006645958.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          427   5e-144   
ref|XP_007218281.1|  hypothetical protein PRUPE_ppa008382mg             427   5e-144   
ref|XP_008349627.1|  PREDICTED: tetraketide alpha-pyrone reductas...    427   7e-144   
gb|EMT16440.1|  Dihydroflavonol-4-reductase                             426   7e-144   
ref|XP_008366589.1|  PREDICTED: tetraketide alpha-pyrone reductas...    427   8e-144   
ref|XP_009354351.1|  PREDICTED: tetraketide alpha-pyrone reductas...    427   1e-143   
ref|XP_008231478.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          426   1e-143   
ref|XP_002517778.1|  cinnamoyl-CoA reductase, putative                  426   2e-143   Ricinus communis
ref|XP_008354954.1|  PREDICTED: tetraketide alpha-pyrone reductas...    426   2e-143   
ref|XP_009354356.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    425   4e-143   
ref|XP_010067828.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          424   8e-143   
ref|XP_010673669.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    422   5e-142   
ref|XP_009354355.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    422   6e-142   
gb|EMS66665.1|  Dihydroflavonol-4-reductase                             427   6e-142   
ref|XP_007218346.1|  hypothetical protein PRUPE_ppa008671mg             422   6e-142   
ref|XP_002314050.2|  putative cinnamoyl-CoA reductase family protein    421   2e-141   
ref|XP_008349605.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          420   4e-141   
ref|XP_007218282.1|  hypothetical protein PRUPE_ppa008382mg             419   8e-141   
gb|KCW66071.1|  hypothetical protein EUGRSUZ_G03355                     423   1e-140   
ref|XP_011025482.1|  PREDICTED: tetraketide alpha-pyrone reductas...    419   2e-140   
ref|XP_008790951.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    415   5e-140   
gb|AIC85610.1|  cinnamyl alcohol dehydrogenase                          414   5e-140   
ref|XP_010065291.1|  PREDICTED: tetraketide alpha-pyrone reductas...    416   2e-139   
ref|XP_009354350.1|  PREDICTED: uncharacterized protein LOC103945503    426   2e-139   
ref|XP_007032857.1|  NAD(P)-binding Rossmann-fold superfamily pro...    416   3e-139   
ref|XP_008349652.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          415   3e-139   
gb|KCW87170.1|  hypothetical protein EUGRSUZ_B03694                     412   9e-139   
gb|KDP43566.1|  hypothetical protein JCGZ_16853                         414   1e-138   
ref|XP_002517776.1|  cinnamoyl-CoA reductase, putative                  413   2e-138   
ref|XP_007219354.1|  hypothetical protein PRUPE_ppa019466mg             412   4e-138   
ref|XP_011088010.1|  PREDICTED: tetraketide alpha-pyrone reductas...    412   5e-138   
gb|KCW49548.1|  hypothetical protein EUGRSUZ_K03067                     411   1e-137   
ref|XP_009368048.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          411   1e-137   
gb|KDP43565.1|  hypothetical protein JCGZ_16852                         410   2e-137   
ref|XP_010673667.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          410   2e-137   
ref|XP_008375206.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          410   2e-137   
ref|XP_010039187.1|  PREDICTED: tetraketide alpha-pyrone reductas...    411   2e-137   
ref|XP_008231475.1|  PREDICTED: tetraketide alpha-pyrone reductas...    410   2e-137   
ref|XP_008375204.1|  PREDICTED: tetraketide alpha-pyrone reductas...    409   1e-136   
gb|EYU27028.1|  hypothetical protein MIMGU_mgv1a010102mg                408   1e-136   
gb|KHG04265.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    408   2e-136   
ref|XP_009354349.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          408   2e-136   
ref|XP_008375210.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          407   3e-136   
ref|XP_004308687.1|  PREDICTED: uncharacterized protein LOC101310561    418   4e-136   
ref|XP_010673672.1|  PREDICTED: dihydroflavonol-4-reductase-like        407   6e-136   
ref|XP_006851071.1|  hypothetical protein AMTR_s00025p00240500          407   9e-136   
gb|KHG04264.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    406   2e-135   
ref|XP_010673666.1|  PREDICTED: tetraketide alpha-pyrone reductas...    404   2e-135   
ref|XP_009368049.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          405   3e-135   
emb|CDP18888.1|  unnamed protein product                                405   3e-135   
gb|KCW66064.1|  hypothetical protein EUGRSUZ_G03352                     404   6e-135   
gb|EYU27029.1|  hypothetical protein MIMGU_mgv1a010102mg                404   8e-135   
ref|XP_008375207.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          401   6e-134   
emb|CDP18892.1|  unnamed protein product                                401   9e-134   
ref|XP_008344623.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          401   1e-133   
ref|XP_008363307.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          401   1e-133   
ref|XP_010673671.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          401   1e-133   
gb|KEH30630.1|  cinnamoyl-CoA reductase-like protein                    399   2e-133   
ref|XP_008375211.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          400   3e-133   
ref|XP_006482921.1|  PREDICTED: tetraketide alpha-pyrone reductas...    400   3e-133   
ref|XP_008231473.1|  PREDICTED: tetraketide alpha-pyrone reductas...    410   4e-133   
ref|XP_007052474.1|  NAD(P)-binding Rossmann-fold superfamily pro...    402   6e-133   
ref|XP_006438961.1|  hypothetical protein CICLE_v10031947mg             400   7e-133   
gb|KHG28629.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    399   7e-133   
ref|XP_006482922.1|  PREDICTED: tetraketide alpha-pyrone reductas...    399   7e-133   
emb|CDP17812.1|  unnamed protein product                                399   1e-132   
ref|XP_008354915.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          398   1e-132   
emb|CAN63402.1|  hypothetical protein VITISV_030427                     427   2e-132   
emb|CAN62117.1|  hypothetical protein VITISV_011013                     397   4e-132   
emb|CDP19301.1|  unnamed protein product                                397   4e-132   
ref|XP_008363309.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          396   9e-132   
ref|XP_011078732.1|  PREDICTED: tetraketide alpha-pyrone reductas...    396   9e-132   
emb|CDP18890.1|  unnamed protein product                                396   9e-132   
gb|AHF20168.1|  cinnamyl alcohol dehydrogenase                          394   2e-131   
ref|XP_010661299.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          392   9e-131   
gb|ACK76693.1|  cinnamyl alcohol dehydrogenase                          389   1e-130   
emb|CDP19307.1|  unnamed protein product                                393   1e-130   
ref|XP_008790950.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    390   3e-130   
gb|ACK76694.1|  cinnamyl alcohol dehydrogenase                          388   4e-130   
emb|CAN76108.1|  hypothetical protein VITISV_033807                     404   7e-130   
ref|XP_008231477.1|  PREDICTED: tetraketide alpha-pyrone reductas...    390   2e-129   
ref|XP_002977011.1|  hypothetical protein SELMODRAFT_175949             390   2e-129   
ref|XP_008349610.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          389   4e-129   
ref|XP_009354354.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          389   4e-129   
gb|KEH19918.1|  cinnamyl alcohol dehydrogenase                          385   4e-128   
emb|CDP19303.1|  unnamed protein product                                386   5e-128   
ref|XP_002980750.1|  hypothetical protein SELMODRAFT_154000             386   7e-128   
gb|KEH19922.1|  cinnamyl alcohol dehydrogenase                          385   7e-128   
ref|XP_006345416.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          386   1e-127   
gb|ABV44811.1|  cinnamyl alcohol dehydrogenase 2                        385   1e-127   
ref|XP_009611351.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          385   2e-127   
emb|CDP18895.1|  unnamed protein product                                385   2e-127   
emb|CDP18894.1|  unnamed protein product                                385   2e-127   
ref|NP_001234838.1|  alcohol dehydrogenase-like                         384   4e-127   
ref|XP_011078734.1|  PREDICTED: tetraketide alpha-pyrone reductas...    384   4e-127   
gb|ACU17019.1|  unknown                                                 381   4e-127   
ref|XP_008790959.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    382   4e-127   
gb|KEH19927.1|  cinnamyl alcohol dehydrogenase                          383   1e-126   
gb|KCW66052.1|  hypothetical protein EUGRSUZ_G03342                     381   1e-126   
emb|CDP18893.1|  unnamed protein product                                383   2e-126   
gb|KCW66074.1|  hypothetical protein EUGRSUZ_G033561                    381   2e-126   
gb|KCW66063.1|  hypothetical protein EUGRSUZ_G03351                     380   3e-126   
ref|XP_006379089.1|  hypothetical protein POPTR_0009s06260g             380   4e-126   
ref|XP_010067838.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    380   5e-126   
emb|CBI40610.3|  unnamed protein product                                381   5e-126   
emb|CBI29129.3|  unnamed protein product                                382   5e-126   
gb|KDO61223.1|  hypothetical protein CISIN_1g0202661mg                  376   2e-125   
ref|XP_009354352.1|  PREDICTED: tetraketide alpha-pyrone reductas...    378   3e-125   
emb|CDP17817.1|  unnamed protein product                                379   4e-125   
ref|XP_006438962.1|  hypothetical protein CICLE_v10031994mg             378   2e-124   
ref|XP_006482918.1|  PREDICTED: tetraketide alpha-pyrone reductas...    378   2e-124   
gb|KCW66056.1|  hypothetical protein EUGRSUZ_G03345                     374   5e-124   
gb|KCW66067.1|  hypothetical protein EUGRSUZ_G03353                     375   9e-124   
gb|AGS57528.1|  cinnamyl alcohol dehydrogenase 1                        375   2e-123   
emb|CDP19302.1|  unnamed protein product                                373   2e-122   
ref|XP_010673670.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    369   8e-122   
ref|XP_011078733.1|  PREDICTED: tetraketide alpha-pyrone reductas...    370   6e-121   
gb|EMT24500.1|  Dihydroflavonol-4-reductase                             372   3e-120   
ref|XP_006438965.1|  hypothetical protein CICLE_v10032128mg             366   3e-120   
ref|XP_006305369.1|  hypothetical protein CARUB_v10009753mg             366   6e-120   
gb|KDO83328.1|  hypothetical protein CISIN_1g020747mg                   365   2e-119   
ref|XP_001765354.1|  predicted protein                                  364   2e-119   
ref|XP_010475785.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          364   3e-119   
ref|XP_008353752.1|  PREDICTED: tetraketide alpha-pyrone reductas...    363   3e-119   
ref|XP_007219627.1|  hypothetical protein PRUPE_ppa024869mg             362   3e-119   
gb|KCW87174.1|  hypothetical protein EUGRSUZ_B03696                     362   4e-119   
ref|XP_011091760.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          363   7e-119   
ref|XP_008340596.1|  PREDICTED: tetraketide alpha-pyrone reductas...    363   9e-119   
ref|XP_011091759.1|  PREDICTED: tetraketide alpha-pyrone reductas...    362   1e-118   
ref|XP_010557804.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          362   2e-118   
ref|XP_007221091.1|  hypothetical protein PRUPE_ppa017116mg             361   2e-118   
ref|XP_006304701.1|  hypothetical protein CARUB_v10011960mg             361   3e-118   
ref|XP_010490060.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          361   4e-118   
ref|XP_010458233.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          360   9e-118   
ref|XP_008354172.1|  PREDICTED: tetraketide alpha-pyrone reductas...    358   1e-117   
ref|NP_172422.2|  alcohol dehydrogenase-like protein                    358   4e-117   
gb|AHF20167.1|  cinnamyl alcohol dehydrogenase                          355   6e-117   
ref|XP_003598004.1|  Dihydroflavonol-4-reductase                        355   7e-117   
ref|XP_006345417.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          358   7e-117   
ref|XP_002889755.1|  cinnamyl-alcohol dehydrogenase family              355   9e-116   
ref|XP_006482920.1|  PREDICTED: tetraketide alpha-pyrone reductas...    366   9e-116   
gb|KFK43252.1|  hypothetical protein AALP_AA1G099600                    355   1e-115   
gb|KDP43567.1|  hypothetical protein JCGZ_16854                         363   2e-115   
ref|XP_002889753.1|  cinnamyl-alcohol dehydrogenase family              354   2e-115   
gb|AAC33211.1|  Highly similar to cinnamyl alcohol dehydrogenase,...    354   3e-115   
ref|XP_006417567.1|  hypothetical protein EUTSA_v10008208mg             354   3e-115   
ref|XP_006417568.1|  hypothetical protein EUTSA_v10008138mg             354   3e-115   
ref|NP_172420.1|  alcohol dehydrogenase                                 353   4e-115   
gb|AAC33208.1|  Highly similar to cinnamyl alcohol dehydrogenase,...    353   7e-115   
ref|NP_172419.1|  alcohol dehydrogenase-like protein                    353   1e-114   
ref|XP_006391084.1|  hypothetical protein EUTSA_v10019826mg             351   3e-114   
ref|XP_008356774.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          350   4e-114   
emb|CBI29099.3|  unnamed protein product                                348   5e-114   
emb|CAJ43717.1|  cinnamoyl alcohol dehydrogenase                        346   5e-114   
ref|XP_007136730.1|  hypothetical protein PHAVU_009G069400g             348   5e-114   
ref|XP_009368136.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          352   1e-113   
ref|XP_009148244.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          350   1e-113   
ref|XP_010470551.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    349   1e-113   
emb|CDX94966.1|  BnaC05g07050D                                          349   1e-113   
gb|ACP20258.1|  cinnamyl-alcohol dehydrogenase                          349   2e-113   
ref|XP_010470552.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    349   2e-113   
emb|CDY72415.1|  BnaCnng77500D                                          349   3e-113   
emb|CDY64748.1|  BnaA06g37880D                                          350   3e-113   
ref|XP_009148246.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    348   4e-113   
emb|CAN71364.1|  hypothetical protein VITISV_003513                     347   4e-113   
ref|XP_010475788.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          348   5e-113   
emb|CDX94965.1|  BnaC05g07060D                                          348   7e-113   
ref|XP_010415215.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          347   7e-113   
emb|CAN73813.1|  hypothetical protein VITISV_028795                     345   8e-113   
emb|CAN78794.1|  hypothetical protein VITISV_003424                     353   3e-112   
gb|ACP20257.1|  cinnamyl-alcohol dehydrogenase                          346   4e-112   
emb|CDX94967.1|  BnaC05g07040D                                          346   4e-112   
gb|KCW87171.1|  hypothetical protein EUGRSUZ_B03694                     342   4e-112   
ref|XP_009118318.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          345   5e-112   
emb|CDY64747.1|  BnaA06g37870D                                          345   8e-112   
ref|XP_009127680.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    343   3e-111   
ref|XP_009148245.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          342   8e-111   
ref|NP_176852.2|  alcohol dehydrogenase-like protein                    342   2e-110   
ref|XP_010557803.1|  PREDICTED: tetraketide alpha-pyrone reductas...    342   2e-110   
ref|XP_010490093.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          341   2e-110   
ref|XP_010511583.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          341   3e-110   
ref|XP_010458237.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          340   4e-110   
ref|XP_010323594.1|  PREDICTED: alcohol dehydrogenase-like isofor...    337   2e-109   
emb|CBI32204.3|  unnamed protein product                                336   5e-109   
emb|CDX94968.1|  BnaC05g07030D                                          337   1e-108   
ref|XP_008354952.1|  PREDICTED: tetraketide alpha-pyrone reductas...    343   1e-108   
ref|XP_006302493.1|  hypothetical protein CARUB_v10020587mg             335   1e-107   
ref|XP_002889754.1|  cinnamyl-alcohol dehydrogenase family              334   2e-107   
ref|NP_172421.1|  alcohol dehydrogenase-like protein                    333   3e-107   
ref|XP_010905791.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    333   3e-107   
ref|XP_008344624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          328   2e-106   
ref|XP_010490072.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    328   2e-105   
emb|CBI32205.3|  unnamed protein product                                327   2e-105   
gb|EYU42999.1|  hypothetical protein MIMGU_mgv1a009774mg                328   4e-105   
ref|XP_006851069.1|  hypothetical protein AMTR_s00025p00239770          323   2e-104   
ref|XP_010475786.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          326   2e-104   
ref|XP_006305357.1|  hypothetical protein CARUB_v10009736mg             326   2e-104   
ref|XP_010458235.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    325   8e-104   
gb|ACQ59094.1|  cinnamoyl-CoA reductase 4                               323   6e-103   
gb|KHG14771.1|  Dihydroflavonol-4-reductase                             323   6e-103   
ref|XP_009148247.1|  PREDICTED: tetraketide alpha-pyrone reductas...    320   8e-103   
ref|XP_007023416.1|  Cinnamoyl coa reductase 1 isoform 1                322   1e-102   
gb|KFK43249.1|  hypothetical protein AALP_AA1G099200                    322   2e-102   
emb|CBI40609.3|  unnamed protein product                                317   5e-102   
gb|ACI14382.1|  cinnamoyl-CoA reductase                                 320   6e-102   
gb|KFK43250.1|  hypothetical protein AALP_AA1G099400                    317   2e-101   
ref|XP_009594427.1|  PREDICTED: cinnamoyl-CoA reductase 2-like          318   4e-101   
gb|ADU64758.1|  cinnamoyl-CoA reductase                                 318   5e-101   
emb|CAA56103.1|  cinnamoyl-CoA reductase                                318   5e-101   
gb|AHX56186.1|  cinnamoyl-CoA reductase 1                               317   6e-101   
pdb|4R1S|A  Chain A, Crystal Structure Of Petunia Hydrida Cinnamo...    318   6e-101   
ref|XP_010092193.1|  Bifunctional dihydroflavonol 4-reductase/fla...    317   1e-100   
ref|XP_003574536.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          318   1e-100   
ref|XP_006379087.1|  hypothetical protein POPTR_0009s06260g             312   2e-100   
gb|AFK48895.1|  unknown                                                 312   2e-100   
ref|NP_001234612.1|  cinnamoyl-CoA reductase                            316   2e-100   
ref|XP_009758397.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          315   3e-100   
ref|XP_006379086.1|  hypothetical protein POPTR_0009s06260g             312   4e-100   
ref|XP_008361199.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          315   4e-100   
ref|XP_006379088.1|  hypothetical protein POPTR_0009s06260g             311   5e-100   
ref|XP_010539540.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    315   6e-100   
emb|CDO98223.1|  unnamed protein product                                315   6e-100   
ref|XP_006356249.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          315   8e-100   
ref|XP_006341347.1|  PREDICTED: cinnamoyl-CoA reductase 1 isoform X2    314   1e-99    
emb|CAK18610.1|  cinnamoyl CoA reductase                                313   1e-99    
ref|NP_001061909.1|  Os08g0441500                                       314   2e-99    
ref|XP_010458234.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...    313   2e-99    
gb|KCW66061.1|  hypothetical protein EUGRSUZ_G03350                     310   2e-99    
gb|KEH19919.1|  cinnamyl alcohol dehydrogenase                          309   4e-99    
ref|XP_009631380.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          312   5e-99    
ref|XP_011091898.1|  PREDICTED: tetraketide alpha-pyrone reductas...    310   6e-99    
gb|ACF17647.1|  putative cinnamoyl-CoA reductase                        312   8e-99    
ref|XP_011082327.1|  PREDICTED: cinnamoyl-CoA reductase 1-like          312   8e-99    



>ref|XP_011090120.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=328

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 303/328 (92%), Gaps = 0/328 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S+AMKTVCVTGASGYIASWIVKFLLQRGY VKA+VR P+DPKKT+HLLSL+GAKERLHL
Sbjct  1     MSVAMKTVCVTGASGYIASWIVKFLLQRGYTVKASVRDPNDPKKTQHLLSLDGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
              KA+LLEEGSFDSVV GC GVFHTASPFYH VT+PQAELIDPA+KGTLNVL SCAKTPS+
Sbjct  61    LKANLLEEGSFDSVVEGCVGVFHTASPFYHAVTNPQAELIDPALKGTLNVLASCAKTPSI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSS+AAVAYNGKPRTPEVVVDE+WWS  + CKEM+ WYVLSKTLAEDAAWKFVKE
Sbjct  121   KRVVLTSSVAAVAYNGKPRTPEVVVDESWWSNPELCKEMQQWYVLSKTLAEDAAWKFVKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI+MVTINPAMVIGPLLQPTLNTS AAILNLING ETY N+++GWINVKDVANAHILA 
Sbjct  181   KGIDMVTINPAMVIGPLLQPTLNTSCAAILNLINGGETYPNSTFGWINVKDVANAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             ENPSANGRYC++E+VAH+SEVVK L +LYP+L+LPEKC DDKPFVPTYQVSKEKAK LGV
Sbjct  241   ENPSANGRYCLVEKVAHFSEVVKILRELYPSLKLPEKCGDDKPFVPTYQVSKEKAKALGV  300

Query  1114  VFTPLEESLKETVESLKEKGFFVPSAAL  1197
             VFT LEE +KETVESLKEK FF   +A+
Sbjct  301   VFTSLEEGIKETVESLKEKNFFKQPSAI  328



>ref|XP_009592182.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana tomentosiformis]
Length=322

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/322 (81%), Positives = 300/322 (93%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S+A KTVCVTGASGYIASW+VKFLLQRGY VKA+VR P+DPKKT+HLLSL GAKERLHL
Sbjct  1     MSLAAKTVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDPKKTQHLLSLGGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFD+VV GCEGVFHTASPFY++VTDPQAEL+DPAVKGTLN+LGSCAK PSV
Sbjct  61    FKANLLEEGSFDAVVDGCEGVFHTASPFYYSVTDPQAELLDPAVKGTLNLLGSCAKAPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSIAAVAY+G+PRTPEVVVDE+WW++ D+C+E ++WYVLSKTLAEDAAWKFVKE
Sbjct  121   KRVVLTSSIAAVAYSGQPRTPEVVVDESWWTSPDYCREKQLWYVLSKTLAEDAAWKFVKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI+MV INPAMVIGPLLQPTLNTSS A+LNL+NGAETY N+++GW+NVKDVANAHILA 
Sbjct  181   KGIDMVAINPAMVIGPLLQPTLNTSSGAVLNLVNGAETYPNSTFGWVNVKDVANAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             ENPSANGRY M+ERVAHYS+++K L  LYPT+RLPEKCADD P +  YQVSKE+AKNLGV
Sbjct  241   ENPSANGRYLMVERVAHYSDILKILRDLYPTMRLPEKCADDNPLMQNYQVSKERAKNLGV  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              FTPLEES+KETVESLKEK FF
Sbjct  301   KFTPLEESIKETVESLKEKRFF  322



>ref|XP_011080358.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=324

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/318 (83%), Positives = 295/318 (93%), Gaps = 0/318 (0%)
 Frame = +1

Query  226   MKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKAD  405
             MKTVCVTGASGYIASW+VKFLLQRGY VKA+VR P+DPKKT+HLLSLEGAKERLHL KA+
Sbjct  1     MKTVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDPKKTEHLLSLEGAKERLHLIKAN  60

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LLEEGSFD+VV GC+GVFHTASPFY   TDPQA+LIDPA+KGTLNVLGSCAKTPS+Q+VV
Sbjct  61    LLEEGSFDAVVDGCDGVFHTASPFYFATTDPQADLIDPALKGTLNVLGSCAKTPSIQRVV  120

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +TSSI AV +NGKPRTPEVVVDETWWS  + CK+M+ WY+LSKTLAEDAAWKF KEKGI+
Sbjct  121   LTSSIVAVFFNGKPRTPEVVVDETWWSDPELCKQMQQWYMLSKTLAEDAAWKFAKEKGID  180

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             MV+INP+MVIGPLLQPTLNTSSA+ILNLINGA+TY NA+ GW+NVKDVANAHILA ENPS
Sbjct  181   MVSINPSMVIGPLLQPTLNTSSASILNLINGAKTYPNATAGWVNVKDVANAHILAFENPS  240

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYC++E VAHYS+VVK LH+LYP L+LPEKCADDKPF+PTYQVSKE+AK LGV FTP
Sbjct  241   ANGRYCVVESVAHYSQVVKILHELYPNLQLPEKCADDKPFMPTYQVSKERAKGLGVEFTP  300

Query  1126  LEESLKETVESLKEKGFF  1179
             L+ESLKETVESLKEK FF
Sbjct  301   LKESLKETVESLKEKNFF  318



>ref|XP_006365621.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=328

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/328 (79%), Positives = 302/328 (92%), Gaps = 0/328 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S+  KTVCVTGASGYIASW+VKFLL RGY VKA+VR P+DPKKT+HLLSL GAKERLHL
Sbjct  1     MSLTAKTVCVTGASGYIASWLVKFLLHRGYTVKASVRDPNDPKKTQHLLSLGGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFD+VV GCEGVFHTASPFY++VTDPQAEL+DPAVKGTLN+LGSCAK PSV
Sbjct  61    FKANLLEEGSFDAVVDGCEGVFHTASPFYYSVTDPQAELLDPAVKGTLNLLGSCAKAPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSIAAVAY+G+PRTPEVVVDE+WW++ D+CKE ++WYVLSKTLAEDAAWKFVKE
Sbjct  121   KRVVLTSSIAAVAYSGQPRTPEVVVDESWWTSPDYCKEKQLWYVLSKTLAEDAAWKFVKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI+MV +NPAMVIGPLLQPTLNTSSAA+L+L+NGAETY N+S+GW+NVKDVANAHILA 
Sbjct  181   KGIDMVVVNPAMVIGPLLQPTLNTSSAAVLSLVNGAETYPNSSFGWVNVKDVANAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             ENPSANGRY M+ERVAHYS+++K L  LYPT++LPEKCADD P +  YQVS+EKAK+LGV
Sbjct  241   ENPSANGRYLMVERVAHYSDILKILRDLYPTMQLPEKCADDNPLMQNYQVSREKAKSLGV  300

Query  1114  VFTPLEESLKETVESLKEKGFFVPSAAL  1197
              FT LEES+KETVESLKEK FF  S+A+
Sbjct  301   EFTTLEESIKETVESLKEKKFFGGSSAM  328



>emb|CDP09262.1| unnamed protein product [Coffea canephora]
Length=324

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/324 (80%), Positives = 299/324 (92%), Gaps = 0/324 (0%)
 Frame = +1

Query  226   MKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKAD  405
             MKTVCVTGASGYIASW+VKFLLQRGY VKA+VR  +DPKK +HLL+L+GAKERL LFKA+
Sbjct  1     MKTVCVTGASGYIASWLVKFLLQRGYTVKASVRDLNDPKKVEHLLALDGAKERLQLFKAN  60

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LLEEGSFD+ + GC+GVFH ASPFYH VTDPQAELIDPA+KGTLNVLGSCAK+PSV++VV
Sbjct  61    LLEEGSFDAAIDGCDGVFHMASPFYHTVTDPQAELIDPALKGTLNVLGSCAKSPSVKRVV  120

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +TSSIAAVA+NGKPRTP+VVVDETWWS  +FCK+ K+WYVLSKTLAEDAAWKFVKEKG++
Sbjct  121   LTSSIAAVAFNGKPRTPDVVVDETWWSLPEFCKQTKLWYVLSKTLAEDAAWKFVKEKGLD  180

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             MVTINPAMVIGPLLQPTLNTS+AAILNLINGAET+ N+S GW++VKDVANAHILA ENPS
Sbjct  181   MVTINPAMVIGPLLQPTLNTSAAAILNLINGAETFPNSSMGWVDVKDVANAHILAFENPS  240

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             A+GRYC++ERV HYSEVVK L ++YP+ +LPEKCADDKPFVPTYQVSKEKAK+LG+ F P
Sbjct  241   ASGRYCLVERVVHYSEVVKILREIYPSSKLPEKCADDKPFVPTYQVSKEKAKSLGLEFIP  300

Query  1126  LEESLKETVESLKEKGFFVPSAAL  1197
             +E+S+KETVESLKEK F   SAAL
Sbjct  301   VEQSIKETVESLKEKNFLNSSAAL  324



>gb|EYU31375.1| hypothetical protein MIMGU_mgv1a010032mg [Erythranthe guttata]
Length=324

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/324 (81%), Positives = 293/324 (90%), Gaps = 0/324 (0%)
 Frame = +1

Query  226   MKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKAD  405
             MKTVCVTGASGYIASW+VKFLLQRGY VKA+VR P DPKKT+HLL+L+GAKERL L KA+
Sbjct  1     MKTVCVTGASGYIASWLVKFLLQRGYAVKASVRDPHDPKKTQHLLALDGAKERLQLIKAN  60

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LLEEGSFDSVV GC+GVFHTASPFYH VTDPQ ELIDPA+KGTLNVLGSCAKTPS+++VV
Sbjct  61    LLEEGSFDSVVDGCDGVFHTASPFYHGVTDPQTELIDPALKGTLNVLGSCAKTPSIKRVV  120

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +TSS+AAVAYN KPRTPEVVVDETWWS  + C+EM+ WYVLSKTLAE+AAWKFVKEKGI+
Sbjct  121   LTSSVAAVAYNSKPRTPEVVVDETWWSDPEICREMQQWYVLSKTLAEEAAWKFVKEKGID  180

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             MVTINPAMVIGPLLQPTLNTSSAAIL LIN AETY N+++GWINVKDVANAHILA EN S
Sbjct  181   MVTINPAMVIGPLLQPTLNTSSAAILGLINDAETYPNSTFGWINVKDVANAHILAFENTS  240

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             A+GRYC++E VAHYSE+V  L +LYPT +LPEKCADDKPFVP YQVSKEKAK+LGV FT 
Sbjct  241   ASGRYCLVESVAHYSEIVNVLRELYPTYQLPEKCADDKPFVPKYQVSKEKAKSLGVEFTT  300

Query  1126  LEESLKETVESLKEKGFFVPSAAL  1197
             L+E +KETVESLKEK  F P +A+
Sbjct  301   LKEGIKETVESLKEKNLFKPKSAI  324



>ref|NP_001234823.1| phenylacetaldehyde reductase [Solanum lycopersicum]
 gb|ABR15768.1| phenylacetaldehyde reductase [Solanum lycopersicum]
Length=328

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/328 (78%), Positives = 301/328 (92%), Gaps = 0/328 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S+  KTVCVTGASGYIASW+VKFLL  GY VKA+VR P+DPKKT+HLLSL GAKERLHL
Sbjct  1     MSVTAKTVCVTGASGYIASWLVKFLLHSGYNVKASVRDPNDPKKTQHLLSLGGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFD+VV GCEGVFHTASPFY++VTDPQAEL+DPAVKGTLN+LGSCAK PSV
Sbjct  61    FKANLLEEGSFDAVVDGCEGVFHTASPFYYSVTDPQAELLDPAVKGTLNLLGSCAKAPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSIAAVAY+G+PRTPEVVVDE+WW++ D+CKE ++WYVLSKTLAEDAAWKFVKE
Sbjct  121   KRVVLTSSIAAVAYSGQPRTPEVVVDESWWTSPDYCKEKQLWYVLSKTLAEDAAWKFVKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI+MV +NPAMVIGPLLQPTLNTSSAA+L+L+NGAETY N+S+GW+NVKDVANAHILA 
Sbjct  181   KGIDMVVVNPAMVIGPLLQPTLNTSSAAVLSLVNGAETYPNSSFGWVNVKDVANAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             ENPSANGRY M+ERVAHYS+++K L  LYPT++LPEKCADD P +  YQVSKEKAK+LG+
Sbjct  241   ENPSANGRYLMVERVAHYSDILKILRDLYPTMQLPEKCADDNPLMQNYQVSKEKAKSLGI  300

Query  1114  VFTPLEESLKETVESLKEKGFFVPSAAL  1197
              FT LEES+KETVESLKEK FF  S+++
Sbjct  301   EFTTLEESIKETVESLKEKKFFGGSSSM  328



>emb|CDP09263.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/324 (80%), Positives = 298/324 (92%), Gaps = 1/324 (0%)
 Frame = +1

Query  226   MKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKAD  405
             MKTVCVTGASGYIASWIVKFLLQRGY VKA+VR  +DPKK  HLL+L+GA ERL LFKA+
Sbjct  1     MKTVCVTGASGYIASWIVKFLLQRGYTVKASVRDLNDPKKVGHLLALDGA-ERLQLFKAN  59

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LLEEGSFD+ + GC+GVFHTASPFYH+VTDPQAELIDPA+KGTLNVLGSCAK+PSV++VV
Sbjct  60    LLEEGSFDAAIHGCDGVFHTASPFYHSVTDPQAELIDPALKGTLNVLGSCAKSPSVKRVV  119

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +TSS+AAV YNG+ R+P+VVVDETWWS  D CKE K+WYVLSKTLAEDAA KFVKEKG++
Sbjct  120   LTSSVAAVYYNGRSRSPDVVVDETWWSLPDLCKENKLWYVLSKTLAEDAACKFVKEKGLD  179

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             MVTINPAMVIGPLLQPTLNTS+AAILNLINGAET+ N++ GW++V+DVANAH+LA ENPS
Sbjct  180   MVTINPAMVIGPLLQPTLNTSAAAILNLINGAETFPNSTLGWVDVRDVANAHVLAFENPS  239

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             A+GRYC++ERVAHYSEVVK LH LYP+++LPEKCADDKPFVPTYQVSKEKAK+LG+ FTP
Sbjct  240   ASGRYCLVERVAHYSEVVKILHTLYPSVKLPEKCADDKPFVPTYQVSKEKAKSLGLEFTP  299

Query  1126  LEESLKETVESLKEKGFFVPSAAL  1197
             LE+S+KETVESLK+K F   SAAL
Sbjct  300   LEQSIKETVESLKDKNFLGSSAAL  323



>gb|AHC29025.1| phenylacetaldehyde reductase [Rosa rugosa]
Length=322

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/319 (79%), Positives = 293/319 (92%), Gaps = 0/319 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M+ K VCVTGASGYIASW+VK LLQRGY VKA+VR P+DP KT+HLL+L+GAKERL LFK
Sbjct  1     MSNKVVCVTGASGYIASWLVKLLLQRGYTVKASVRNPNDPTKTEHLLALDGAKERLQLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             ADLLEEGSFDSVV GCEGVFHTASPFYH+VTDP+AEL+DPAVKGTLNVL SC+K+PS+++
Sbjct  61    ADLLEEGSFDSVVEGCEGVFHTASPFYHDVTDPKAELLDPAVKGTLNVLNSCSKSPSIKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSSIAAVAYNGKPRTP+VVVDETW++  D CKE K+WYVLSKTLAEDAAWK VKEKG
Sbjct  121   VVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESKLWYVLSKTLAEDAAWKLVKEKG  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I+MVTINPAMVIGPLLQPTLNTS+AAILN+I GA TY NAS+GWINVKDVANAH+ A E 
Sbjct  181   IDMVTINPAMVIGPLLQPTLNTSAAAILNIIKGARTYPNASFGWINVKDVANAHVQAFEI  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSA+GRYC++ERVAH++EV++ +H+LYP L+LPEKC+DDKPFVPTYQVSKEKAK+LG+ F
Sbjct  241   PSASGRYCLVERVAHFTEVLQIIHELYPDLQLPEKCSDDKPFVPTYQVSKEKAKSLGIEF  300

Query  1120  TPLEESLKETVESLKEKGF  1176
              PL+ SLKET+ESLKEK F
Sbjct  301   IPLDISLKETIESLKEKSF  319



>ref|XP_011080432.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=332

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/318 (79%), Positives = 289/318 (91%), Gaps = 0/318 (0%)
 Frame = +1

Query  226   MKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKAD  405
             MKTVCVTGASGYIASW+VKFLLQRGYIVKA+VR P+DPKKT+HLL+L+GAKERLHL KAD
Sbjct  1     MKTVCVTGASGYIASWLVKFLLQRGYIVKASVRDPNDPKKTQHLLALDGAKERLHLIKAD  60

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LLE+GSFD+VV GC+GVFHTASP     TDPQ ELIDPA+KGTLNVLGSCAKTPSV++VV
Sbjct  61    LLEQGSFDAVVDGCDGVFHTASPVKFASTDPQGELIDPALKGTLNVLGSCAKTPSVKRVV  120

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +TSSIAA+  NGKPRTPE+V+DETWWS  +FCK+ + WY+LSKTLAEDAAWKFVKEKG++
Sbjct  121   LTSSIAAILANGKPRTPELVLDETWWSDPEFCKQTQQWYLLSKTLAEDAAWKFVKEKGMD  180

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             MV INP+MVIGPLLQPTLNTSSAAILNL+NGA+TY NA+YGW+NVKDVANAHILA ENP+
Sbjct  181   MVAINPSMVIGPLLQPTLNTSSAAILNLMNGAKTYPNAAYGWVNVKDVANAHILAFENPT  240

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYCM  RVAH+S+VVK L +LYPT +LPEKCADD P  PT+QVSKE+AK+LGV FTP
Sbjct  241   ANGRYCMTNRVAHFSQVVKILRELYPTFQLPEKCADDNPLAPTFQVSKERAKSLGVEFTP  300

Query  1126  LEESLKETVESLKEKGFF  1179
             LEE++KETVESL EK FF
Sbjct  301   LEETIKETVESLMEKNFF  318



>gb|AAX15956.1| cinnamyl alcohol dehydrogenase 1 [Nicotiana tabacum]
Length=327

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/328 (78%), Positives = 298/328 (91%), Gaps = 1/328 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S+A KTVCVTGASGYIASW+VKFLLQRGY VKA+VR P+DPKKT+HLLSL G  ERLHL
Sbjct  1     MSLAAKTVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDPKKTQHLLSLGGGAERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFD+VV G EGVFHTASPF ++VTDPQAEL+ PAVKGTLN+LGSCAK PSV
Sbjct  61    FKANLLEEGSFDAVVDGYEGVFHTASPFPYSVTDPQAELLAPAVKGTLNLLGSCAKAPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSIA VAY+G+PRTPEVVVDE+WW++ D+C+E ++WYVLSKTLAEDAAWKFVKE
Sbjct  121   KRVVLTSSIA-VAYSGQPRTPEVVVDESWWTSPDYCREKQLWYVLSKTLAEDAAWKFVKE  179

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI+MV INPAMVIGPLLQPTLNTSS A+LNL+NGAETY N+++GW+NVKDVANAHILA 
Sbjct  180   KGIDMVAINPAMVIGPLLQPTLNTSSGAVLNLVNGAETYPNSTFGWVNVKDVANAHILAF  239

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             ENPSANGRY M+ERVAHYS+++K L  LYPT+RLPEKCADD P +  YQVSKE+AK+LGV
Sbjct  240   ENPSANGRYLMVERVAHYSDILKILRDLYPTMRLPEKCADDNPLMQNYQVSKERAKSLGV  299

Query  1114  VFTPLEESLKETVESLKEKGFFVPSAAL  1197
              FTPLEES+KETVESLKEK FF  S+A+
Sbjct  300   EFTPLEESIKETVESLKEKRFFGGSSAM  327



>dbj|BAG13450.2| phenylacetaldehyde reductase [Rosa x damascena]
 dbj|BAQ20439.1| 2-phenylethanol [Rosa hybrid cultivar]
Length=322

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/319 (79%), Positives = 292/319 (92%), Gaps = 0/319 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M+ K VCVTGASGYIASW+VK LLQRGY VKA+VR P+DP KT+HLL+L+GAKERL LFK
Sbjct  1     MSNKVVCVTGASGYIASWLVKLLLQRGYTVKASVRNPNDPTKTEHLLALDGAKERLQLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             ADLLEEGSFDS V GCEGVFHTASPFYH+VTDP+AEL+DPAVKGTLNVL SC+K+PS+++
Sbjct  61    ADLLEEGSFDSAVEGCEGVFHTASPFYHDVTDPKAELLDPAVKGTLNVLNSCSKSPSIKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSSIAAVAYNGKPRTP+VVVDETW++  D CKE K+WYVLSKTLAEDAAWKFVKEKG
Sbjct  121   VVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEKG  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I+MVTINPAMVIGPLLQPTLNTS+AAILN+I GA TY NAS+GWINVKDVANAH+ A E 
Sbjct  181   IDMVTINPAMVIGPLLQPTLNTSAAAILNIIKGARTYPNASFGWINVKDVANAHVQAFEI  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSA+GRYC++ERVAH++EV++ +H+LYP L+LPEKC+DDKPFVPTYQVSKEKAK+LG+ F
Sbjct  241   PSASGRYCLVERVAHFTEVLQIIHELYPDLQLPEKCSDDKPFVPTYQVSKEKAKSLGIEF  300

Query  1120  TPLEESLKETVESLKEKGF  1176
              PL+ SLKET+ESLKEK  
Sbjct  301   IPLDISLKETIESLKEKSI  319



>ref|NP_001280189.1| cinnamoyl-CoA reductase 1 [Prunus mume]
 dbj|BAE48658.1| Cinnamyl alcohol dehydrogenase [Prunus mume]
Length=325

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/320 (81%), Positives = 290/320 (91%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LLQ GY VKA+VR P+DP KT+HLL L+GA+ERL LF
Sbjct  3     SGAGKVVCVTGASGYIASWLVKLLLQGGYTVKASVRDPNDPTKTEHLLGLDGAQERLQLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS V GCEGVFHTASPFYH+VTDP+AEL+DPAVKGTLNVL SCAK+ S++
Sbjct  63    KANLLEEGSFDSAVDGCEGVFHTASPFYHDVTDPKAELLDPAVKGTLNVLNSCAKSQSIR  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSSIAAVAYNGKPRTP+VVVDETW++ ADFCKE K+WYVLSKTLAEDAAWKFVKEK
Sbjct  123   RVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADFCKESKLWYVLSKTLAEDAAWKFVKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI+MVTINPAMVIGPLLQPTLNTS+AA+LN+I GA T+ NAS+GWINVKDVANAHI A E
Sbjct  183   GIDMVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFPNASFGWINVKDVANAHIQAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
              PSA+GRYC++ERVAH+SEVV+ L +LYP L+LPEKCADDKPFVPTYQVSKEKAK LGV 
Sbjct  243   IPSASGRYCLVERVAHFSEVVRILQELYPGLQLPEKCADDKPFVPTYQVSKEKAKKLGVE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE SLKETVESLKEK F
Sbjct  303   FIPLEVSLKETVESLKEKNF  322



>gb|AAX83110.1| alcohol dehydrogenase-like protein [Ocimum basilicum]
Length=325

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/317 (81%), Positives = 289/317 (91%), Gaps = 0/317 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             VCVTGASG+IASW+VKFLLQ+GY VKA+VR P+DPKKT+HLL+L+GAKERL L KA+LL+
Sbjct  9     VCVTGASGFIASWLVKFLLQKGYTVKASVRDPNDPKKTEHLLALDGAKERLCLMKANLLD  68

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EGSFDS+V GCEGVFHTASPFYH V DPQAELIDPA+KGTLNVLGSC KT SV+K+V+TS
Sbjct  69    EGSFDSIVDGCEGVFHTASPFYHAVKDPQAELIDPALKGTLNVLGSCVKTSSVKKIVLTS  128

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             SIAAVAY GKPRTPEV+VDETWWS  + CK+M++WYVLSKTLAEDAAWKFVKEK I+MV 
Sbjct  129   SIAAVAYCGKPRTPEVIVDETWWSDPEICKQMQLWYVLSKTLAEDAAWKFVKEKDIDMVA  188

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INPAMVIGPLLQPTLNTS+AAILNLINGAETY N+S+GWINVKDVA+AHILA EN SA+G
Sbjct  189   INPAMVIGPLLQPTLNTSAAAILNLINGAETYPNSSFGWINVKDVAHAHILAFENASASG  248

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             RYC++ERVAH+SEVVK L  LYPT +LPEKCADDKPFVP YQVSKEKAK+LG+ FTPLEE
Sbjct  249   RYCLVERVAHFSEVVKILRGLYPTYKLPEKCADDKPFVPIYQVSKEKAKSLGLEFTPLEE  308

Query  1135  SLKETVESLKEKGFFVP  1185
              +KETVE LKEK FF P
Sbjct  309   GIKETVERLKEKNFFKP  325



>gb|AFU90744.1| cinnamyl alcohol dehydrogenase [Punica granatum]
Length=326

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/321 (78%), Positives = 293/321 (91%), Gaps = 0/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             ++ A K VCVTGASGYIASW+VK LLQRGY VKA+VR P+DP+KT+HL SL+GAKERL L
Sbjct  3     VTGAGKIVCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDPRKTEHLFSLDGAKERLQL  62

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             +KA+LLEEGSFD +V GC GVFHTASPFYH+V DP+AELIDPA+KGTLNVL SCAK  S+
Sbjct  63    YKANLLEEGSFDPIVDGCAGVFHTASPFYHDVKDPEAELIDPALKGTLNVLKSCAKVSSI  122

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             Q+VV+TSS+AAVAYNGKPRTP+VVVDETW+S+ +FC+E KMWYVLSKTLAEDAAWKFVKE
Sbjct  123   QRVVLTSSVAAVAYNGKPRTPDVVVDETWFSSPEFCRENKMWYVLSKTLAEDAAWKFVKE  182

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI+MV INPAMVIGPLLQPTLNTS+AAILN+INGAET+ NAS+GW+NVKDVANAH+ A 
Sbjct  183   KGIDMVAINPAMVIGPLLQPTLNTSAAAILNIINGAETFPNASFGWVNVKDVANAHVQAF  242

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GR+C++ERVAHYSEVVK L +LYP ++LPEKCADDKPFVPTYQVSKEKAK+LG+
Sbjct  243   EIPSASGRHCLVERVAHYSEVVKILRELYPQIKLPEKCADDKPFVPTYQVSKEKAKSLGI  302

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              + PLE+ +KETVESLKEKGF
Sbjct  303   DYIPLEQGIKETVESLKEKGF  323



>ref|XP_004291772.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/317 (79%), Positives = 288/317 (91%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY VKA+VR P+DP KT+HLL+ +GAKERLH FKADL
Sbjct  3     KVVCVTGASGYIASWLVKLLLQRGYTVKASVRNPNDPTKTEHLLAFDGAKERLHFFKADL  62

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS V GCE VFHTASPFYH+VTDP+AEL+DPAVKGTLNVL SC+K+PS+++VV+
Sbjct  63    LEEGSFDSGVEGCECVFHTASPFYHDVTDPKAELLDPAVKGTLNVLNSCSKSPSIKRVVL  122

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVAYNGKPRTP+VVVDETW++    CKE K+WYVLSKTLAEDAAWKFVKEKGI+M
Sbjct  123   TSSIAAVAYNGKPRTPDVVVDETWFTDPGVCKEQKLWYVLSKTLAEDAAWKFVKEKGIDM  182

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AA+LN+I GA TY NAS+GWINVKDVANAH+ A ENPSA
Sbjct  183   VTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTYPNASFGWINVKDVANAHVQAFENPSA  242

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAH+SEVV+ LH+LYP L+LPEKC+DDKP VPTYQVSKEKAK+LG+ F PL
Sbjct  243   SGRYCLVERVAHFSEVVQILHELYPDLQLPEKCSDDKPLVPTYQVSKEKAKSLGIEFVPL  302

Query  1129  EESLKETVESLKEKGFF  1179
             + SLKETVESLKEK F 
Sbjct  303   DISLKETVESLKEKSFI  319



>gb|EYU46248.1| hypothetical protein MIMGU_mgv1a010028mg [Erythranthe guttata]
Length=324

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/324 (79%), Positives = 289/324 (89%), Gaps = 0/324 (0%)
 Frame = +1

Query  226   MKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKAD  405
             MKTVCVTGASGYIASWIVKFLL+RGY VKA+VR   DP KT+HLL+L+GAKERLHL KA+
Sbjct  1     MKTVCVTGASGYIASWIVKFLLRRGYTVKASVRDTSDPNKTQHLLALDGAKERLHLIKAN  60

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LLEEGSFD+VV GC+GVFHTASPF+ + TDP+AELI+PA+KGTLNVL SCAKTP+V++VV
Sbjct  61    LLEEGSFDAVVDGCDGVFHTASPFFLSTTDPEAELINPALKGTLNVLRSCAKTPTVKRVV  120

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +TSSI AV  NGKPRTPEVVVDETWWS   FC++M+ WY+LSKTLAE+AAWKFVKEKGI+
Sbjct  121   LTSSIVAVFANGKPRTPEVVVDETWWSDPLFCRQMQQWYMLSKTLAEEAAWKFVKEKGID  180

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             MV INPAMVIGPLLQPTLNTSSAAILNLINGAE Y N + GW+NVKDVANAHILA ENPS
Sbjct  181   MVAINPAMVIGPLLQPTLNTSSAAILNLINGAEAYPNVTSGWVNVKDVANAHILAFENPS  240

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYCM+E VAH+SE+   L  LYPT RLPEKCADDKPFVPTYQVSKE+AK+LGV FTP
Sbjct  241   ANGRYCMVESVAHFSEIANILRGLYPTFRLPEKCADDKPFVPTYQVSKERAKSLGVEFTP  300

Query  1126  LEESLKETVESLKEKGFFVPSAAL  1197
             LEES+KETVESL+EK F  P+ A+
Sbjct  301   LEESIKETVESLEEKNFVKPTPAI  324



>gb|AAC06319.1| putative cinnamyl alcohol dehydrogenase [Malus domestica]
Length=325

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/320 (79%), Positives = 293/320 (92%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LLQRGY VKA++R P+DP KT+HL +L+GA++RL LF
Sbjct  3     SGAGKVVCVTGASGYIASWLVKLLLQRGYTVKASIRDPNDPTKTEHLHALDGAQDRLQLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS V GCEGVFHTASPFYH+VTDP+AEL++PAVKGTLNVL SCAK+PS++
Sbjct  63    KANLLEEGSFDSAVEGCEGVFHTASPFYHDVTDPKAELLEPAVKGTLNVLNSCAKSPSIK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSSIAAVAYNGKPRTP+VVVDETW++  D CKE K+WYVLSKTLAEDAAWKFVKEK
Sbjct  123   RVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI++VTINPAMVIGPLLQPTLNTS+AA+LN+I GA T+ NAS+GWINVKDVANAHI A E
Sbjct  183   GIDLVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFPNASFGWINVKDVANAHIQAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
              P+A+GRYC++ERVAH+SEVV+ L +LYPTL+LPEKCADDKPFVPTYQVSKEKAK+LGV 
Sbjct  243   RPTASGRYCLVERVAHFSEVVRILRELYPTLQLPEKCADDKPFVPTYQVSKEKAKSLGVE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PL+ SLKETVESLKEKGF
Sbjct  303   FIPLDVSLKETVESLKEKGF  322



>ref|XP_002285368.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 emb|CBI16353.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/322 (79%), Positives = 289/322 (90%), Gaps = 0/322 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M+   VCVTGASGYIASW+VK LLQRGY VKA+VR P+DPKKT+HLLSL+GAKERLHLFK
Sbjct  1     MSSGVVCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDPKKTEHLLSLDGAKERLHLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLEEGSFDS+V GC GVFHTASPF+H VTDPQAELIDPAVKGTLNVLGSCAK  SV++
Sbjct  61    ANLLEEGSFDSIVEGCVGVFHTASPFFHAVTDPQAELIDPAVKGTLNVLGSCAKASSVKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VVVTSSIAAVAYN  PRTP+VVVDETW++  DFCK +++WYV+SKTLAEDAAWKF KEKG
Sbjct  121   VVVTSSIAAVAYNRNPRTPDVVVDETWFTDPDFCKGLQLWYVVSKTLAEDAAWKFAKEKG  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I+MVTINPAMVIGPLLQPTLNTS+AAILNLING +T+ NAS+GW+NVKDVA AHI A E 
Sbjct  181   IDMVTINPAMVIGPLLQPTLNTSAAAILNLINGGQTFPNASFGWVNVKDVAEAHIQAFEV  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSA+GRYC++ERV HYSE+VK L +L+P  +LPEKCADDKPFVPT+QVSKEKAK+LG+ F
Sbjct  241   PSASGRYCLVERVVHYSELVKILKELFPDFQLPEKCADDKPFVPTFQVSKEKAKSLGIEF  300

Query  1120  TPLEESLKETVESLKEKGFFVP  1185
              PLE SLKETVESLKEK FF P
Sbjct  301   IPLEVSLKETVESLKEKEFFSP  322



>ref|XP_009795334.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana sylvestris]
Length=323

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/320 (80%), Positives = 286/320 (89%), Gaps = 0/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             MA KTVCVTGASGYIASW+VKFLLQRGY VKATVR P+DPKKT HL SL+GAKERLHLFK
Sbjct  1     MATKTVCVTGASGYIASWLVKFLLQRGYTVKATVRDPNDPKKTDHLTSLDGAKERLHLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLEEG+FD+VV GCEGVFHTASPFYH V DPQAELIDPA+KGTLNVLGS AKTPS+++
Sbjct  61    ANLLEEGAFDAVVDGCEGVFHTASPFYHAVKDPQAELIDPALKGTLNVLGSVAKTPSIRR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAVA+NGKPR PEVVVDETWWS  DFC+E ++WYVLSKTLAEDAAWKFVKEK 
Sbjct  121   VVLTSSVAAVAFNGKPRAPEVVVDETWWSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKA  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I+MVTINPAMVIG LLQPTLNTS AA+L LINGAETY NA+ GW+NVKDVA AHILA EN
Sbjct  181   IDMVTINPAMVIGSLLQPTLNTSCAAVLQLINGAETYPNATLGWVNVKDVALAHILAFEN  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRY M+E VAHYSE+VK L + YPT++LPEKC DDKPF P YQV+ E+AK LGV F
Sbjct  241   PSANGRYLMVEAVAHYSELVKILREHYPTMKLPEKCVDDKPFPPKYQVNIERAKQLGVEF  300

Query  1120  TPLEESLKETVESLKEKGFF  1179
             TPL E++KETVESLKEK F+
Sbjct  301   TPLAENIKETVESLKEKKFY  320



>dbj|BAQ20438.1| 2-phenylethanol [Rosa hybrid cultivar]
Length=322

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/319 (78%), Positives = 291/319 (91%), Gaps = 0/319 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M+ K VCVTGASGYIASW+VK LLQRGY VKA+VR P+DP KT+HLL+L+GAKERL LFK
Sbjct  1     MSNKVVCVTGASGYIASWLVKLLLQRGYTVKASVRNPNDPTKTEHLLALDGAKERLQLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             ADLLEEGSFDS V GCEGVFHTASPFYH+VTDP+AEL+DPAVKGTLNVL SC+K+ S+++
Sbjct  61    ADLLEEGSFDSAVEGCEGVFHTASPFYHDVTDPKAELLDPAVKGTLNVLNSCSKSTSIKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSSIAAVAYNGKPRTP+VVVDETW++  D CKE K+WYVLSKTLAEDAAWKFVKEKG
Sbjct  121   VVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEKG  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I+MVTINPAMVIGPLLQPTLNTS+AAILN+I GA TY NAS+GW+NVKDVANAH+ A E 
Sbjct  181   IDMVTINPAMVIGPLLQPTLNTSAAAILNIIKGARTYPNASFGWVNVKDVANAHVQAFEI  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSA+GRYC++ERVAH++EV++ +H+LYP L+LPEKC+DDKPFVPTYQVSKEKAK+LG+ F
Sbjct  241   PSASGRYCLVERVAHFTEVLQIIHELYPDLQLPEKCSDDKPFVPTYQVSKEKAKSLGIEF  300

Query  1120  TPLEESLKETVESLKEKGF  1176
              PL+ SLKET+ESLKEK  
Sbjct  301   IPLDISLKETIESLKEKSI  319



>ref|XP_008349860.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=326

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/320 (79%), Positives = 293/320 (92%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LLQRGY VKA++R P+DP KT+HL +L+GA++RL LF
Sbjct  4     SGAGKVVCVTGASGYIASWLVKLLLQRGYTVKASIRDPNDPTKTEHLHALDGAQDRLQLF  63

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS V GCEGVFHTASPFYH+VTDP+AEL++PAVKGTLNVL SCAK+PS++
Sbjct  64    KANLLEEGSFDSAVEGCEGVFHTASPFYHDVTDPKAELLEPAVKGTLNVLNSCAKSPSIK  123

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSSIAAVAYNGKPRTP+VVVDETW++  D CKE K+WYVLSKTLAEDAAWKFVKEK
Sbjct  124   RVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEK  183

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI++VTINPAMVIGPLLQPTLNTS+AA+LN+I GA T+ NAS+GWINVKDVANAHI A E
Sbjct  184   GIDLVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFPNASFGWINVKDVANAHIQAFE  243

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
              P+A+GRYC++ERVAH+SEVV+ L +LYPTL+LPEKCADDKPFVPTYQVSKEKAK+LGV 
Sbjct  244   RPTASGRYCLVERVAHFSEVVRILRELYPTLQLPEKCADDKPFVPTYQVSKEKAKSLGVE  303

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PL+ SLKETVESLKEKGF
Sbjct  304   FIPLDVSLKETVESLKEKGF  323



>ref|XP_007211587.1| hypothetical protein PRUPE_ppa008618mg [Prunus persica]
 gb|EMJ12786.1| hypothetical protein PRUPE_ppa008618mg [Prunus persica]
Length=325

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/320 (80%), Positives = 289/320 (90%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LL  GY VKA+VR P+DP KT+HLL L+GA+ERL LF
Sbjct  3     SGAGKVVCVTGASGYIASWLVKLLLHGGYTVKASVRDPNDPTKTEHLLGLDGAQERLQLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS V GCEGVFHTASPFYH+VTDP+AEL+DPAVKGTLNVL SCAK+ S++
Sbjct  63    KANLLEEGSFDSAVEGCEGVFHTASPFYHDVTDPKAELLDPAVKGTLNVLNSCAKSQSIR  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSSIAAVAYNGKPRTP+VVVDETW++ ADFCKE K+WYVLSKTLAEDAAWKFVKEK
Sbjct  123   RVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADFCKESKLWYVLSKTLAEDAAWKFVKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI+MVTINPAMVIGPLLQPTLNTS+AA+LN+I GA T+ NAS+GWINVKDVANAHI A E
Sbjct  183   GIDMVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFPNASFGWINVKDVANAHIRAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
              PSA+GRYC++ERVAH+SEVV+ L +LYP L+LPEKCADDKPFVPTYQVSKEKAK LGV 
Sbjct  243   IPSASGRYCLVERVAHFSEVVRILQELYPGLQLPEKCADDKPFVPTYQVSKEKAKKLGVE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE SLKETVESLKEK F
Sbjct  303   FIPLEVSLKETVESLKEKNF  322



>ref|XP_009618541.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana tomentosiformis]
Length=323

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/320 (80%), Positives = 285/320 (89%), Gaps = 0/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             MA KTVCVTG+SGYIASW+VKFLLQRGY VKATVR P DPKKT HL SL+GAKERLHLFK
Sbjct  1     MATKTVCVTGSSGYIASWLVKFLLQRGYTVKATVRDPSDPKKTDHLTSLDGAKERLHLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLEEG+FD+VV GCEGVFHTASPFYH V DPQAELIDPA+KGTLNVLGS AKTPS+++
Sbjct  61    ANLLEEGAFDAVVDGCEGVFHTASPFYHGVKDPQAELIDPALKGTLNVLGSVAKTPSIRR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAVA+NGKPRTPEVVVDETWWS  DFC+E ++WYVLSKTLAEDAAWKFVKEK 
Sbjct  121   VVLTSSVAAVAFNGKPRTPEVVVDETWWSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKA  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I+MVTINPAMVIG LLQP LNTS AA+L LINGAETY NA+ GW+NVKDVA AHILA EN
Sbjct  181   IDMVTINPAMVIGGLLQPILNTSCAAVLQLINGAETYPNATLGWVNVKDVALAHILAFEN  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRY M+E VAHYSE+VK L + YPT++LPEKC DDKPF P YQV+ E+AK LGV F
Sbjct  241   PSANGRYLMVEAVAHYSELVKILREHYPTMKLPEKCVDDKPFPPKYQVNIERAKQLGVEF  300

Query  1120  TPLEESLKETVESLKEKGFF  1179
             TPL ES+KETVESLKEK F+
Sbjct  301   TPLAESIKETVESLKEKKFY  320



>ref|NP_001234830.1| phenylacetaldehyde reductase [Solanum lycopersicum]
 gb|ABR15769.1| phenylacetaldehyde reductase [Solanum lycopersicum]
Length=320

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/320 (79%), Positives = 285/320 (89%), Gaps = 0/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             MAM+TVCVTGASGYIASW+VKFLLQRGY VKATVR  +D KK  HL SL+GAKERLHLFK
Sbjct  1     MAMRTVCVTGASGYIASWLVKFLLQRGYTVKATVRDLNDQKKVDHLTSLDGAKERLHLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             ADLLEEGSFD+VV GCEGVFHTASPFY  V DPQ E+IDPA+KGTLNVLGS AKTPSV++
Sbjct  61    ADLLEEGSFDAVVEGCEGVFHTASPFYLGVKDPQVEMIDPALKGTLNVLGSVAKTPSVRR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAVA+NGKPRTPEVVVDETWWS  DFC+E ++WYVLSKTLAEDAAWKFVKEK 
Sbjct  121   VVLTSSVAAVAFNGKPRTPEVVVDETWWSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKA  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
              +MVTINPAMVIG LLQPTLNTS+AAIL L+NG+ETY N+++GW+NVKDVA AHILA EN
Sbjct  181   FDMVTINPAMVIGGLLQPTLNTSAAAILQLLNGSETYPNSTFGWVNVKDVALAHILAFEN  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRY M+E VAHYSE+VK L +LYPTL+LPEKCADDKPF PTYQV+ E+AK LG+ F
Sbjct  241   PSANGRYLMVESVAHYSEIVKILRELYPTLKLPEKCADDKPFTPTYQVNVERAKKLGIEF  300

Query  1120  TPLEESLKETVESLKEKGFF  1179
              PL ES+KET ESLKEK F+
Sbjct  301   IPLAESVKETAESLKEKKFY  320



>ref|XP_009374930.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Pyrus x bretschneideri]
Length=325

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/316 (79%), Positives = 290/316 (92%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY VKA++R P+DP KT+HL +L+GA++RL LFKA+L
Sbjct  7     KVVCVTGASGYIASWLVKLLLQRGYTVKASIRDPNDPTKTEHLHALDGAQDRLQLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS V GCEGVFHTASPFYH+VTDP+AEL++PAVKGTLNVL SCAK+PS+++VV+
Sbjct  67    LEEGSFDSAVEGCEGVFHTASPFYHDVTDPKAELLEPAVKGTLNVLNSCAKSPSIKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVAYNGKPRTP+VV+DETW++  D CKE K+WYVLSKTLAEDAAWKFVKEKGI++
Sbjct  127   TSSIAAVAYNGKPRTPDVVIDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEKGIDL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AA+LN+I GA T+ NAS+GWINVKDVANAHI A E+P+A
Sbjct  187   VTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFPNASFGWINVKDVANAHIQAFESPTA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
              GRYC++E VAH+SEVV+ L +LYPTL+LPEKCADDKPFVPTYQVSKEKAK+LGV F PL
Sbjct  247   GGRYCLVETVAHFSEVVRILRELYPTLQLPEKCADDKPFVPTYQVSKEKAKSLGVEFIPL  306

Query  1129  EESLKETVESLKEKGF  1176
             + SLKETVESLKEKGF
Sbjct  307   DVSLKETVESLKEKGF  322



>ref|XP_006365623.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=320

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/320 (79%), Positives = 284/320 (89%), Gaps = 0/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             MA KTVCVTGASGYIASW+VKFLLQRGY VKATVR P+D KKT HL SL+GA+ERLHLFK
Sbjct  1     MATKTVCVTGASGYIASWLVKFLLQRGYTVKATVRDPNDKKKTDHLTSLDGAEERLHLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLEEGSFD+VV GCEGVFHTASPFY  V DPQAELIDPA+KGTLNVL S AKTPSV++
Sbjct  61    ANLLEEGSFDAVVEGCEGVFHTASPFYLGVKDPQAELIDPALKGTLNVLESVAKTPSVRR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAVA+NGKPRTPEVVVDETWWS  DFC+E ++WYVLSKTLAEDAAWKFVKEK 
Sbjct  121   VVLTSSVAAVAFNGKPRTPEVVVDETWWSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKA  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
              +MVTINPAMVIG LLQPTLNTS+AAIL L+NG+ETY N++ GW+NVKDVA AHILA EN
Sbjct  181   FDMVTINPAMVIGSLLQPTLNTSAAAILQLLNGSETYPNSTLGWVNVKDVALAHILAFEN  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRY M+E VAHYSE+VK L +LYPT++LPEKCADDKPF P YQV+ E+AK LG+ F
Sbjct  241   PSANGRYLMVESVAHYSEIVKILRELYPTMKLPEKCADDKPFTPMYQVNIERAKKLGIEF  300

Query  1120  TPLEESLKETVESLKEKGFF  1179
              PL ESLKET ESLKEK F+
Sbjct  301   IPLAESLKETAESLKEKKFY  320



>ref|XP_011090033.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=322

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/322 (79%), Positives = 290/322 (90%), Gaps = 1/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S+AMKTVCVTGASGYI SWIVKFLLQRGY VKA+   P+DPKKT+HLLSL+GAKERLHL
Sbjct  1     MSVAMKTVCVTGASGYIGSWIVKFLLQRGYTVKASDWDPNDPKKTQHLLSLDGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
              KA+LLEEGSFDSVV GC GVFHTASPFYH VT+PQAELI   +KGT+NVL SCAKTPS+
Sbjct  61    LKANLLEEGSFDSVVEGCVGVFHTASPFYHAVTNPQAELIS-QLKGTINVLASCAKTPSI  119

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSS+AAV +NGK RTPEVVVDE+WWS  + CKEM+ W++LSKTLAEDAAW+FVKE
Sbjct  120   KRVVLTSSLAAVVHNGKRRTPEVVVDESWWSNPELCKEMQQWHLLSKTLAEDAAWEFVKE  179

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI+MVTINP MVIGPLLQPTLNTS AAILNLING ET+ N+++GWINVKDVANAHILA 
Sbjct  180   KGIDMVTINPGMVIGPLLQPTLNTSCAAILNLINGGETHPNSTFGWINVKDVANAHILAF  239

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             ENPSANGRYC++E+VAH+SEVVK L +LYP+L LPEKCADDKPFVPTYQVSKEKAK LGV
Sbjct  240   ENPSANGRYCLVEKVAHFSEVVKILRELYPSLELPEKCADDKPFVPTYQVSKEKAKALGV  299

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
             VFT LEE +KE+VESLK+  FF
Sbjct  300   VFTSLEEGIKESVESLKDMNFF  321



>ref|XP_008363357.1| PREDICTED: cinnamoyl-CoA reductase 1 [Malus domestica]
Length=325

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/316 (78%), Positives = 290/316 (92%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY VKA++R P+DP KT+HL +L+GA++RL LFKA+L
Sbjct  7     KVVCVTGASGYIASWLVKLLLQRGYTVKASIRDPNDPTKTEHLHALDGAQDRLQLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS V GCEGVFHTASPFYH+VTDP+AEL++PAVKGTLNVL SCAK+PS+++VV+
Sbjct  67    LEEGSFDSAVEGCEGVFHTASPFYHDVTDPKAELLEPAVKGTLNVLNSCAKSPSIKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVAYNGKPRTP+VV+DETW++  D CKE K+WYVLSKTLAEDAAWKFVKEKGI++
Sbjct  127   TSSIAAVAYNGKPRTPDVVIDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEKGIDL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AA+LN+I GA T+ NAS+GWINVKDVANAHI A E+P+A
Sbjct  187   VTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFPNASFGWINVKDVANAHIQAFESPTA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++E VAH+SEVV+ L +L+PTL+LPEKCADDKPFVPTYQVSKEKAK LGV F PL
Sbjct  247   SGRYCLVETVAHFSEVVRILRELHPTLQLPEKCADDKPFVPTYQVSKEKAKXLGVEFIPL  306

Query  1129  EESLKETVESLKEKGF  1176
             + SLKETVESLKEKGF
Sbjct  307   DVSLKETVESLKEKGF  322



>gb|AAX15955.1| cinnamyl alcohol dehydrogenase 1 [Nicotiana tabacum]
Length=323

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/320 (80%), Positives = 283/320 (88%), Gaps = 0/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             MA KTVCVTG+SGYIASW+VKFLLQRGY VKATVR P DPKKT HL SL GAKERLHLFK
Sbjct  1     MATKTVCVTGSSGYIASWLVKFLLQRGYTVKATVRDPSDPKKTDHLHSLSGAKERLHLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLEEG+FD+VV GCEGVFHTASPFYH V DPQAELIDPA+KGTLNVLGS AKTPS+++
Sbjct  61    ANLLEEGAFDAVVDGCEGVFHTASPFYHGVKDPQAELIDPALKGTLNVLGSVAKTPSIRR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAVA+NGKPRTPEVVVDETW S  DFC+E ++WYVLSKTLAEDAAWKFVKEK 
Sbjct  121   VVLTSSVAAVAFNGKPRTPEVVVDETWGSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKA  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I+MVTINPAMVIG LLQP LNTS AA+L LINGAETY NA+ GW+NVKDVA AHILA EN
Sbjct  181   IDMVTINPAMVIGGLLQPILNTSCAAVLQLINGAETYPNATLGWVNVKDVALAHILAFEN  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRY M+E VAHYSE+VK L + YPT++LPEKC DDKPF P YQV+ E+AK LGV F
Sbjct  241   PSANGRYLMVEAVAHYSELVKILREHYPTMKLPEKCVDDKPFPPKYQVNIERAKQLGVEF  300

Query  1120  TPLEESLKETVESLKEKGFF  1179
             TPL ES+KETVESLKEK F+
Sbjct  301   TPLAESIKETVESLKEKKFY  320



>ref|NP_001289243.1| CAD protein [Pyrus x bretschneideri]
 gb|AGW45367.1| cinnamyl alcohol dehydrogenase [Pyrus x bretschneideri]
Length=325

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/320 (78%), Positives = 291/320 (91%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LLQRGY VKA++R P+DP KT+HL +L+GA++RL LF
Sbjct  3     SGAGKVVCVTGASGYIASWLVKLLLQRGYTVKASIRDPNDPTKTEHLHALDGAQDRLQLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS V GCEGVFHTASPFY++VTDP+AEL++PAVKGTLNVL SC K+PS++
Sbjct  63    KANLLEEGSFDSAVEGCEGVFHTASPFYNDVTDPKAELLEPAVKGTLNVLNSCVKSPSIK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVAYNGKPRTP+VVVDETW++  D CKE K+WYVLSKTLAEDAAWKFVKEK
Sbjct  123   RVVLTSSMAAVAYNGKPRTPDVVVDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI++VTINPAMVIGPLLQPTLNTS+AAILN+I GA T+ NAS+GWINVKDVANAHI A E
Sbjct  183   GIDLVTINPAMVIGPLLQPTLNTSAAAILNVIKGARTFPNASFGWINVKDVANAHIQAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
              P+A+GRYC++ERVAH+SEVV+ L +LYPTL+LPEKCADDKPFVPTY VSKEKAK+LGV 
Sbjct  243   RPTASGRYCLVERVAHFSEVVRVLRELYPTLQLPEKCADDKPFVPTYHVSKEKAKSLGVE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PL+ SLKETVESLKEKGF
Sbjct  303   FIPLDVSLKETVESLKEKGF  322



>ref|XP_002314079.1| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
 gb|EEE88034.1| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
Length=325

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/320 (79%), Positives = 287/320 (90%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LL RGY VKA+VR P+DPKKT+HL +L GA+ERL LF
Sbjct  3     SGAGKIVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTEHLRALNGAQERLQLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS+V GCEGVFHTASPFYH+V DPQ EL+DPAVKGTLNVLGSCAK PS++
Sbjct  63    KANLLEEGSFDSIVEGCEGVFHTASPFYHDVKDPQVELLDPAVKGTLNVLGSCAKHPSIR  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVAYNGKPRTP+VVVDETW+S  + C+E K+WYVLSKTLAEDAAWKF KEK
Sbjct  123   RVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPNLCRESKVWYVLSKTLAEDAAWKFAKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              ++MV INPAMVIGPLLQPTLNTS+AAIL+LI GA+T+ NAS+GWINVKDVANAHI A E
Sbjct  183   DMDMVAINPAMVIGPLLQPTLNTSAAAILSLIKGAQTFPNASFGWINVKDVANAHIQAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
               SA+GRYC++ERVAHYSEVVK LH+LYP L+LPEKCADDKP+VP YQVSKEKAK+LGV 
Sbjct  243   LSSASGRYCLVERVAHYSEVVKILHELYPDLQLPEKCADDKPYVPIYQVSKEKAKSLGVE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE S+KETVESLKEKGF
Sbjct  303   FIPLEASVKETVESLKEKGF  322



>gb|EPS73808.1| alcohol dehydrogenase-like protein, partial [Genlisea aurea]
Length=322

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/317 (78%), Positives = 285/317 (90%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASG++ASW+VK LLQRGY+V+A+VR P+DPKKT+HL SL+GAKERL L KA+L
Sbjct  1     KTVCVTGASGFVASWLVKLLLQRGYVVRASVRDPNDPKKTEHLTSLDGAKERLTLLKANL  60

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LE GSFDSVV GCEGVFHTASPF+H  TDPQ ELIDPAVKGTLNVLGSC K PSV++VV+
Sbjct  61    LENGSFDSVVEGCEGVFHTASPFFHTTTDPQVELIDPAVKGTLNVLGSCVKFPSVKRVVL  120

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVAYN KPRTP+VVVDETWWS  + C++ + WYVLSKTLAEDAAWKF KEKGI++
Sbjct  121   TSSIAAVAYNAKPRTPDVVVDETWWSDPEICRKFEQWYVLSKTLAEDAAWKFAKEKGIDL  180

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGP+LQP+LNTSSAAILNLINGAET+ N ++GWINVKDVA AHILA E+PSA
Sbjct  181   VTINPAMVIGPMLQPSLNTSSAAILNLINGAETFPNTTFGWINVKDVALAHILAYEDPSA  240

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++E+VAH SE+VK L  LYP+L+LPEKCAD+KPFVPTYQVSK KA +LGV FTPL
Sbjct  241   NGRYCLVEKVAHASEIVKILRDLYPSLKLPEKCADEKPFVPTYQVSKGKANSLGVEFTPL  300

Query  1129  EESLKETVESLKEKGFF  1179
             E+ +KETVESLKEK FF
Sbjct  301   EQGVKETVESLKEKNFF  317



>ref|XP_011032045.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=325

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/320 (78%), Positives = 287/320 (90%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LL RGY VKA+VR P+DPKKT+HL +L GA+ERL LF
Sbjct  3     SGAGKIVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTEHLRALNGAQERLQLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDSVV GCEGVFHTASPFYH+V DPQ EL+DPAVKGTLNVLGSCAK PS++
Sbjct  63    KANLLEEGSFDSVVEGCEGVFHTASPFYHDVKDPQVELLDPAVKGTLNVLGSCAKHPSIK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVAYNGKPRTP+VVVDETW+S  + C+E K+WYVLSKTLAEDAAWKF KEK
Sbjct  123   RVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPNLCRESKVWYVLSKTLAEDAAWKFAKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              ++MV INPAMVIGPLLQPTLNTS+AAIL+LI GA+T+ NAS+GWINVKDVANAHI A E
Sbjct  183   DMDMVAINPAMVIGPLLQPTLNTSAAAILSLIKGAQTFPNASFGWINVKDVANAHIQAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
               SA+GRYC++ERVAHYSE+VK LH+LYP L+LPEKCADDKP+VP YQVSKEKAK+LG+ 
Sbjct  243   LSSASGRYCLVERVAHYSELVKILHELYPDLQLPEKCADDKPYVPIYQVSKEKAKSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE S+KETVESLKEKGF
Sbjct  303   FIPLEASVKETVESLKEKGF  322



>ref|XP_008363567.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=325

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/316 (78%), Positives = 289/316 (91%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY VKA++R P+DP KT+HL +L+GA++RL LFKA+L
Sbjct  7     KVVCVTGASGYIASWLVKLLLQRGYTVKASIRDPNDPTKTEHLHALDGAQDRLQLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LE GSFDS V GCEGVFHTASPFYH+VTDP+AEL++PAVKGTLNVL SCAK+PS+++VV+
Sbjct  67    LEXGSFDSAVEGCEGVFHTASPFYHDVTDPKAELLEPAVKGTLNVLNSCAKSPSIKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVAYNGKPRTP+VV+DETW++  D CKE K+WYVLSKTLAEDAAWKFVKEKGI++
Sbjct  127   TSSIAAVAYNGKPRTPDVVIDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEKGIDL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AA+LN+I GA T+ NAS+GWINVKDVANAHI A E+P+A
Sbjct  187   VTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFPNASFGWINVKDVANAHIQAFESPTA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++E VAH+SEVV+ L +L+PTL+LPEKCADDKPFVPTYQVSKEKAK LGV F PL
Sbjct  247   SGRYCLVETVAHFSEVVRILRELHPTLQLPEKCADDKPFVPTYQVSKEKAKTLGVEFIPL  306

Query  1129  EESLKETVESLKEKGF  1176
             + SLKETVESLKEKGF
Sbjct  307   DVSLKETVESLKEKGF  322



>gb|AFY97683.1| cinnamyl alcohol dehydrogenase 1 [Pyrus pyrifolia]
Length=325

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/320 (78%), Positives = 289/320 (90%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LLQRGY VKA++R P+DP KT+HL +L+GA++RL LF
Sbjct  3     SGAGKVVCVTGASGYIASWLVKLLLQRGYTVKASIRDPNDPTKTEHLHALDGAQDRLQLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS V GCEGVFHTASPFYH+VTDP+AEL++PAVKGTLNVL SCAK+PS++
Sbjct  63    KANLLEEGSFDSAVEGCEGVFHTASPFYHDVTDPKAELLEPAVKGTLNVLNSCAKSPSIK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
              VV+TSSIAAVAYNGKPRTP+VV+DETW++  D CKE K+WYVLSKTLAEDAAWKFVKEK
Sbjct  123   GVVLTSSIAAVAYNGKPRTPDVVIDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI++VTINPAMVIGPLLQPTLNTS+AA+LN+I GA T+ NAS GWINVKDV NAHI A E
Sbjct  183   GIDLVTINPAMVIGPLLQPTLNTSAAAVLNVIKGARTFPNASSGWINVKDVTNAHIQAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             +P+A GRYC++E VAH+SEVV+ L +LYPTL+LP+KCADDKPFVPTYQVSKEKAK+LGV 
Sbjct  243   SPTAGGRYCLVETVAHFSEVVRILRELYPTLQLPDKCADDKPFVPTYQVSKEKAKSLGVE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PL+ SLKETVESLKEKGF
Sbjct  303   FIPLDVSLKETVESLKEKGF  322



>ref|XP_011025551.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=325

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/320 (78%), Positives = 287/320 (90%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LL RGY VKA+VR P+DPKKT+HL +L GA+ERL LF
Sbjct  3     SGAGKIVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTEHLRALNGAQERLQLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDSVV GCEGVFHTASPFYH+V DPQ EL+DPAVKGTLNVLGSCAK PS++
Sbjct  63    KANLLEEGSFDSVVEGCEGVFHTASPFYHDVKDPQVELLDPAVKGTLNVLGSCAKHPSIK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVAYNGKPRTP+VVVDETW+S  + C+E K+WYVLSKTLAEDAAWKF KEK
Sbjct  123   RVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPNLCRESKVWYVLSKTLAEDAAWKFAKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              ++MV INPAMVIGPLLQPTLNTS+AAIL+LI GA+T+ NAS+GW+NVKDVANAHI A E
Sbjct  183   DMDMVAINPAMVIGPLLQPTLNTSAAAILSLIKGAQTFPNASFGWVNVKDVANAHIQAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
               SA+GRYC++ERVAHYSE+VK LH+LYP L+LPEKCADDKP+VP YQVSKEKAK+LG+ 
Sbjct  243   LSSASGRYCLVERVAHYSELVKILHELYPDLQLPEKCADDKPYVPIYQVSKEKAKSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE S+KETVESLKEKGF
Sbjct  303   FIPLEASVKETVESLKEKGF  322



>gb|AIB06353.1| cinnamyl alcohol dehydrogenase, partial [Pyrus pyrifolia]
Length=315

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/312 (79%), Positives = 288/312 (92%), Gaps = 0/312 (0%)
 Frame = +1

Query  241   VTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLEEG  420
             VTGASGYIASW+VK LLQRGY VKA++R P+DP KT+HL +L+GA++RL LFKA+LLEEG
Sbjct  1     VTGASGYIASWLVKLLLQRGYTVKASIRDPNDPTKTEHLHALDGAQDRLQLFKANLLEEG  60

Query  421   SFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTSSI  600
             SFDS V GCEGVFHTASPFY++VTDP+AEL++PAVKGTLNVL SC K+PS+++VV+TSS+
Sbjct  61    SFDSAVEGCEGVFHTASPFYNDVTDPKAELLEPAVKGTLNVLNSCVKSPSIKRVVLTSSM  120

Query  601   AAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVTIN  780
             AAVAYNGKPRTP+VVVDETW++  D CKE K+WYVLSKTLAEDAAWKFVKEKGI++VTIN
Sbjct  121   AAVAYNGKPRTPDVVVDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEKGIDLVTIN  180

Query  781   PAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANGRY  960
             PAMVIGPLLQPTLNTS+AAILN+I GA T+ NAS+GWINVKDVANAHILA E P+A+GRY
Sbjct  181   PAMVIGPLLQPTLNTSAAAILNVIKGARTFPNASFGWINVKDVANAHILAFERPTASGRY  240

Query  961   CMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEESL  1140
             C++ERVAH+SEVV+ L +LYPTL+LPEKCADDKPFVPTYQVSKEKAK+LGV F PL+ SL
Sbjct  241   CLVERVAHFSEVVRVLRELYPTLQLPEKCADDKPFVPTYQVSKEKAKSLGVEFIPLDVSL  300

Query  1141  KETVESLKEKGF  1176
             KETVESLKEKGF
Sbjct  301   KETVESLKEKGF  312



>emb|CDX92530.1| BnaA10g15690D [Brassica napus]
Length=330

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/323 (77%), Positives = 285/323 (88%), Gaps = 0/323 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SL+GAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLDGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAELIDPAVKGTLNVL SC K  SV++VVV
Sbjct  68    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELIDPAVKGTLNVLNSCTKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+V VDETW+S  + CK  KMWYVLSKTLAEDAAWKF KEKG+++
Sbjct  128   TSSMAAVAYNGKPRTPDVTVDETWFSDPEVCKTSKMWYVLSKTLAEDAAWKFAKEKGLDI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILN INGA+T+SN+++GW+NVKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNFINGAKTFSNSTFGWVNVKDVANAHIQAYEIPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+ERV H+SE+V  L +LYP L+LPE CAD+ PFVPTY+VSKEK K++G+ + PL
Sbjct  248   NGRYCMVERVLHHSEIVNILRQLYPNLQLPESCADENPFVPTYEVSKEKIKSIGIDYIPL  307

Query  1129  EESLKETVESLKEKGFFVPSAAL  1197
             E S+KETVESLKEKGF    A++
Sbjct  308   EVSIKETVESLKEKGFINVRASI  330



>ref|XP_009120886.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X1 [Brassica rapa]
Length=330

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/323 (77%), Positives = 284/323 (88%), Gaps = 0/323 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SL+GAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLDGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAELIDPAVKGTLNVL SC K  SV++VVV
Sbjct  68    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELIDPAVKGTLNVLNSCTKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+V VDETW+S  + CK  KMWYVLSKTLAEDAAWKF KEK +++
Sbjct  128   TSSMAAVAYNGKPRTPDVTVDETWFSDPEVCKTSKMWYVLSKTLAEDAAWKFAKEKDLDI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILN INGA+T+SN+++GW+NVKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNFINGAKTFSNSTFGWVNVKDVANAHIQAYEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+ERV H+SE+V  L +LYP L+LPE CAD+ PFVPTYQVSKEK K++G+ + PL
Sbjct  248   NGRYCMVERVLHHSEIVNILRQLYPNLQLPESCADENPFVPTYQVSKEKIKSIGIDYIPL  307

Query  1129  EESLKETVESLKEKGFFVPSAAL  1197
             E S+KETVESLKEKGF    A++
Sbjct  308   EVSIKETVESLKEKGFINVRASI  330



>ref|XP_004143234.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis sativus]
Length=325

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/319 (77%), Positives = 283/319 (89%), Gaps = 0/319 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A KTVCVTG SGYIASWIVKFLLQRGY VKA+VR P DP KT HLLSL+GA ERLHLFKA
Sbjct  5     AAKTVCVTGGSGYIASWIVKFLLQRGYTVKASVRNPADPIKTAHLLSLDGAAERLHLFKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS + GC+GVFHTASPF+HNVTDPQAELIDPA+KGTLNVL S AK+ SV++V
Sbjct  65    NLLEEGSFDSAIEGCQGVFHTASPFFHNVTDPQAELIDPALKGTLNVLKSVAKSSSVKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAVAY+G+PR P+ V+DETW+S  + CKEMK+WYVLSKTLAE+AAW FVKEKGI
Sbjct  125   VLTSSMAAVAYSGQPRNPDTVIDETWFSNPEICKEMKLWYVLSKTLAEEAAWNFVKEKGI  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +MVTINPAMVIGPLLQPTLNTS+ AILNLI+GA+T+ N+++GW+NVKDVANAHILA E P
Sbjct  185   DMVTINPAMVIGPLLQPTLNTSAEAILNLISGAQTFPNSTFGWVNVKDVANAHILAYEVP  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SANGRYC++E V HYS +VK LH LYP+L+LP+KCADDKPF P YQVS EKAKNLG+ F 
Sbjct  245   SANGRYCLVESVIHYSGIVKLLHDLYPSLQLPDKCADDKPFTPVYQVSVEKAKNLGIQFI  304

Query  1123  PLEESLKETVESLKEKGFF  1179
             PL ESLKETVESLKEK F 
Sbjct  305   PLAESLKETVESLKEKNFI  323



>gb|ADO51749.1| cinnamyl alcohol dehydrogenase [Camellia sinensis]
Length=324

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/322 (76%), Positives = 287/322 (89%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S   KTVCVTGASGYIASW+VK LLQRGY VKA+VR P DPKKT+HLL+LEGAKERLHL
Sbjct  1     MSGVGKTVCVTGASGYIASWLVKLLLQRGYTVKASVRDPSDPKKTQHLLALEGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
              KA+LLEEG FDS+V GCEGVFHTASPFYH+V DPQ ELIDPA+KGTLNVLGSCAK PSV
Sbjct  61    TKANLLEEGCFDSLVDGCEGVFHTASPFYHDVKDPQVELIDPALKGTLNVLGSCAKNPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSS+AAVA+NG+PR P+VVVDE+W+S  +FCK+ K+WYVLSKTLAEDAAWKF K 
Sbjct  121   KRVVLTSSVAAVAFNGRPRAPDVVVDESWFSDPEFCKQNKLWYVLSKTLAEDAAWKFTKG  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI+MVTINPAMV+GPLLQPTLNTS+AAILN+ING++T+ N+++GW+NVKDVANAHI A 
Sbjct  181   KGIDMVTINPAMVVGPLLQPTLNTSAAAILNVINGSQTFPNSTFGWVNVKDVANAHIQAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSANGRYC++E VAHYSEVVK L +L+P  +LPEKCADDKPF PTYQVSKE+ K+LG+
Sbjct  241   EIPSANGRYCLVESVAHYSEVVKILQELFPAFQLPEKCADDKPFTPTYQVSKERTKSLGI  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              F PL++S+KETVESL EK  F
Sbjct  301   EFIPLKQSIKETVESLMEKKLF  322



>ref|XP_002298395.1| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
 gb|EEE83200.1| cinnamyl-alcohol dehydrogenase family protein [Populus trichocarpa]
Length=325

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/318 (78%), Positives = 286/318 (90%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASGYIASWIVK LL RGY VKA+VR P+DPKKT+HL +L GA+ERL L KA
Sbjct  5     AGKIVCVTGASGYIASWIVKLLLSRGYTVKASVRDPNDPKKTQHLRALRGAQERLELVKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS+V GCEGVFHTASPFYH+V DPQAEL+DPAVKGTLNVLGSCA+ PS+++V
Sbjct  65    NLLEEGSFDSIVEGCEGVFHTASPFYHDVKDPQAELLDPAVKGTLNVLGSCARHPSIKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAVAYN KPRTP+VVVDETW+S  + C+E K+WYVLSKTLAEDAAWKF KEKG+
Sbjct  125   VLTSSMAAVAYNRKPRTPDVVVDETWFSDPELCRESKLWYVLSKTLAEDAAWKFAKEKGM  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +MV INP+MVIGPLLQPTLNTS+AAIL+LI GA+T+SNAS+GWINVKDVANAHI A E  
Sbjct  185   DMVAINPSMVIGPLLQPTLNTSAAAILSLIKGAQTFSNASFGWINVKDVANAHIQAFELS  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SA+GRYC++ERVAH+SEVVK L +LYP L+LPEKCADDKP+VP YQVSKEKAK+LG+ F 
Sbjct  245   SASGRYCLVERVAHHSEVVKILRELYPDLQLPEKCADDKPYVPIYQVSKEKAKSLGIEFI  304

Query  1123  PLEESLKETVESLKEKGF  1176
             PLE S+KETVESLKEKGF
Sbjct  305   PLEASIKETVESLKEKGF  322



>ref|XP_003598002.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AES68253.1| cinnamyl-alcohol dehydrogenase-like protein [Medicago truncatula]
Length=326

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/314 (78%), Positives = 286/314 (91%), Gaps = 0/314 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             VCVTGASGYIASW+V+ LL RGY VKATVR P+DPKK  HL+ L+GAKERL LFKA+LLE
Sbjct  10    VCVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLE  69

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EG+FDSVV GC GVFHTASPFYH+V DPQAELIDPA+KGTLNVL SCAK+PS+++VV+TS
Sbjct  70    EGAFDSVVQGCHGVFHTASPFYHDVKDPQAELIDPALKGTLNVLNSCAKSPSLKRVVLTS  129

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             SIAAVAYNGKPRTP+VVVDETW++ ADFC +  +WYV+SKTLAE+AAWKFVKE  I+MVT
Sbjct  130   SIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENNIDMVT  189

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INPAMVIGPLLQP LNTS+AAILNLINGA+T+ NAS+GW+NVKDVANAHILA EN SA+G
Sbjct  190   INPAMVIGPLLQPVLNTSAAAILNLINGAQTFPNASFGWVNVKDVANAHILAYENASASG  249

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             R+C++ERVAHYSEVV+ L +LYP+L+LPEKCADDKP+VP YQVSKEKAK+LG+ +TPLE 
Sbjct  250   RHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGLEYTPLEV  309

Query  1135  SLKETVESLKEKGF  1176
             S+KETVESLKEK F
Sbjct  310   SIKETVESLKEKKF  323



>ref|XP_010045028.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
Length=327

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/318 (77%), Positives = 285/318 (90%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASGYIASW+VK LLQRGY VKA+VR P+DPKKT+HLL L+GAK+RL LFKA
Sbjct  7     AGKVVCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDPKKTEHLLGLDGAKDRLQLFKA  66

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFD +V GC GVFHTASPFYH+V DPQAEL+DPAVKGTLNVL SC+K PS+Q+V
Sbjct  67    NLLEEGSFDPIVEGCAGVFHTASPFYHDVKDPQAELLDPAVKGTLNVLKSCSKAPSLQRV  126

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAVAYN +PRTPEVVVDE+W+S  D C++   WYVLSKTLAEDAAWKFVKEKGI
Sbjct  127   VLTSSMAAVAYNRQPRTPEVVVDESWFSDPDLCRQTNAWYVLSKTLAEDAAWKFVKEKGI  186

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +MVTINPAMVIGPLLQPTLNTS+AAI NLINGA T+ NAS+GW+NVKDVANAHILA E P
Sbjct  187   DMVTINPAMVIGPLLQPTLNTSAAAIGNLINGAPTFPNASFGWVNVKDVANAHILAFEVP  246

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SA+GRYC++ER+AHYSE+V+ L +LYP+ +LPEK ADDKPFVP YQVSKEK K+LG+ + 
Sbjct  247   SASGRYCLVERIAHYSEIVRILRELYPSAQLPEKSADDKPFVPIYQVSKEKVKSLGINYI  306

Query  1123  PLEESLKETVESLKEKGF  1176
             PLE++LKETVESLKEKGF
Sbjct  307   PLEQNLKETVESLKEKGF  324



>ref|XP_004491683.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cicer arietinum]
Length=325

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/320 (77%), Positives = 287/320 (90%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             ++A K VCVTGASGYIASW+VK LL RGY VKATVR P+DPKK  HLL L+GAKERL +F
Sbjct  3     NIAGKVVCVTGASGYIASWLVKLLLHRGYTVKATVRDPNDPKKIDHLLKLDGAKERLKVF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDSVV GC GVFHTASPF+H+V DPQAELIDPAVKGTLNVL SC K+PS++
Sbjct  63    KANLLEEGSFDSVVEGCYGVFHTASPFFHDVKDPQAELIDPAVKGTLNVLKSCVKSPSLK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSSIAAVAYNGKPRTP+VVVDETW++  DFC +  +WYV+SKTLAEDAAWKFV+E 
Sbjct  123   RVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPDFCAQSNLWYVVSKTLAEDAAWKFVREN  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I+MVTINPAMVIGPLLQP LNTS+AAILNL+NGA+T++NAS+GW+NVKDVANAHI A E
Sbjct  183   NIDMVTINPAMVIGPLLQPVLNTSAAAILNLVNGAQTFANASFGWVNVKDVANAHIQAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             N SA+GRYC++ERV H+SE+VK L + YP+L+LPEKCADDKP+VPTYQVSKEKAK+LG+ 
Sbjct  243   NASASGRYCLVERVVHHSEIVKILRQHYPSLQLPEKCADDKPYVPTYQVSKEKAKSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             FTPLE SLKETVESLKEK F
Sbjct  303   FTPLEVSLKETVESLKEKKF  322



>gb|KCW87172.1| hypothetical protein EUGRSUZ_B03695 [Eucalyptus grandis]
Length=384

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/318 (78%), Positives = 283/318 (89%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASGYIASW+VK LLQRGY VKATVR P+DPKKT+HLL L+GAK+RL LFKA
Sbjct  64    AGKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLGLDGAKDRLQLFKA  123

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFD +V GC GVFHTASPFYH+V DPQAEL+DPAVKGTLNVL SC+K PSVQ+V
Sbjct  124   NLLEEGSFDPIVEGCAGVFHTASPFYHDVKDPQAELLDPAVKGTLNVLKSCSKAPSVQRV  183

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSSIAAV YNG+PRTPEVVVDE+W+S  D C++   WY+LSKTLAEDAAWKFVKEKGI
Sbjct  184   VLTSSIAAVVYNGQPRTPEVVVDESWFSDPDLCRQTNAWYLLSKTLAEDAAWKFVKEKGI  243

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +MVTINPAMVIGPLLQPTLNTS+AAI NLINGA T+ NAS+GW+NVKDVANAHILA E P
Sbjct  244   DMVTINPAMVIGPLLQPTLNTSAAAIGNLINGAPTFPNASFGWVNVKDVANAHILAFEVP  303

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SA+GRYC++ER+AH SE+V+ L +LYP+++LPEK ADDKPFVP YQVSKEK K+LG+   
Sbjct  304   SASGRYCLVERIAHCSEIVRILRELYPSVQLPEKSADDKPFVPIYQVSKEKVKSLGIDCI  363

Query  1123  PLEESLKETVESLKEKGF  1176
             PL +SLKETVESLKEKGF
Sbjct  364   PLNQSLKETVESLKEKGF  381



>pdb|4QTZ|A Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydrogenase 
2
Length=321

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/314 (78%), Positives = 286/314 (91%), Gaps = 0/314 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             VCVTGASGYIASW+V+ LL RGY VKATVR P+DPKK  HL+ L+GAKERL LFKA+LLE
Sbjct  5     VCVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLE  64

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EG+FDSVV GC GVFHTASPFYH+V DPQAELIDPA+KGTLNVL SCAK+PS+++VV+TS
Sbjct  65    EGAFDSVVQGCHGVFHTASPFYHDVKDPQAELIDPALKGTLNVLNSCAKSPSLKRVVLTS  124

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             SIAAVAYNGKPRTP+VVVDETW++ ADFC +  +WYV+SKTLAE+AAWKFVKE  I+MVT
Sbjct  125   SIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENNIDMVT  184

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INPAMVIGPLLQP LNTS+AAILNLINGA+T+ NAS+GW+NVKDVANAHILA EN SA+G
Sbjct  185   INPAMVIGPLLQPVLNTSAAAILNLINGAQTFPNASFGWVNVKDVANAHILAYENASASG  244

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             R+C++ERVAHYSEVV+ L +LYP+L+LPEKCADDKP+VP YQVSKEKAK+LG+ +TPLE 
Sbjct  245   RHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGLEYTPLEV  304

Query  1135  SLKETVESLKEKGF  1176
             S+KETVESLKEK F
Sbjct  305   SIKETVESLKEKKF  318



>ref|XP_006446146.1| hypothetical protein CICLE_v10015912mg [Citrus clementina]
 ref|XP_006470636.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Citrus sinensis]
 gb|ESR59386.1| hypothetical protein CICLE_v10015912mg [Citrus clementina]
 gb|KDO61219.1| hypothetical protein CISIN_1g020326mg [Citrus sinensis]
Length=327

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/318 (77%), Positives = 284/318 (89%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASGYIASW+VK LL RGY VKA+VR P+DPKKT HLL+L+GA ERL LFKA
Sbjct  7     AGKVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTGHLLALDGASERLQLFKA  66

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGS+DSVV GC+GVFHTASPFYH+V DPQ EL+DPAVKGT+NVL SCAK PS+++V
Sbjct  67    NLLEEGSYDSVVDGCDGVFHTASPFYHDVKDPQVELLDPAVKGTVNVLNSCAKFPSIKRV  126

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAVAYNGKPRTP+VVVDETW+S  + CK+ K+WYVLSKTLAEDAAWKF KEK I
Sbjct  127   VLTSSMAAVAYNGKPRTPDVVVDETWFSDPEVCKQSKLWYVLSKTLAEDAAWKFAKEKSI  186

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +MVTINPAMVIGPLLQPTLNTS+AA+L+LI GA+TY NA+ GW+NVKDVANAHI A E P
Sbjct  187   DMVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTYPNATLGWVNVKDVANAHIQAFEVP  246

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SA+GRYC++ERV HYS++V  +H+LYPT  LPEKCADDKP+VPTYQVSKEKAKNLG+ F 
Sbjct  247   SASGRYCLVERVLHYSKLVNTVHELYPTFELPEKCADDKPYVPTYQVSKEKAKNLGIEFI  306

Query  1123  PLEESLKETVESLKEKGF  1176
             PLE SLKET+ESLKEKGF
Sbjct  307   PLEVSLKETIESLKEKGF  324



>ref|XP_010905794.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Elaeis guineensis]
Length=324

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/321 (77%), Positives = 284/321 (88%), Gaps = 0/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S + K VCVTGASGYIASW+VK LLQRGY V+A+VR   DPKK +HL +LEGA ERLHL
Sbjct  1     MSGSGKVVCVTGASGYIASWLVKLLLQRGYTVRASVRDLADPKKIEHLRALEGANERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEE SFDSVV GCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNV  SC KTP +
Sbjct  61    FKANLLEEHSFDSVVEGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVFSSCVKTPCI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSS+AAVAYNG+PRTP+VVVDETW+S+A+FCK+ KMWYVLSKTLAE+AAWKF K+
Sbjct  121   KRVVVTSSMAAVAYNGRPRTPDVVVDETWFSSAEFCKQAKMWYVLSKTLAEEAAWKFSKD  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               I+MVTINPAMVIGPLLQPTLNTS+AAILNLING+ TY NAS+GW+NVKDVA AHILA 
Sbjct  181   NSIDMVTINPAMVIGPLLQPTLNTSAAAILNLINGSSTYPNASFGWVNVKDVAKAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRYC++ERVAHY+E+VK LH  YP L+LPE CADD+PFVP YQVSKEK K+LG+
Sbjct  241   EVPSASGRYCLVERVAHYAELVKILHDQYPALKLPEMCADDEPFVPIYQVSKEKTKSLGI  300

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              + P+E S+ ETVESL+EKGF
Sbjct  301   DYIPVETSIMETVESLREKGF  321



>ref|XP_002513513.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF48916.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=402

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/318 (78%), Positives = 285/318 (90%), Gaps = 1/318 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVKFLLQRGY VKA+VR P+DP+KT+HL SL+GA+ERL LFKADL
Sbjct  85    KTVCVTGASGYIASWIVKFLLQRGYTVKASVRDPNDPRKTEHLRSLDGAEERLQLFKADL  144

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD+ V GC GVFHTASPFYH++TDPQ ELIDPAVKGTLNVL SCAKTPSV++VV+
Sbjct  145   LEEGSFDAAVEGCRGVFHTASPFYHDITDPQ-ELIDPAVKGTLNVLNSCAKTPSVKRVVL  203

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVAYNGKPRTPEVVVDETW+S  DFC+E K+WYV+SKTLAEDAAWKF KEKG+++
Sbjct  204   TSSIAAVAYNGKPRTPEVVVDETWFSDPDFCRESKLWYVVSKTLAEDAAWKFAKEKGLDL  263

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V INPAMV+GPLLQPTLNTS+AA+L+L+ GA T+ NAS+GW+NVKDVANAHI A E PSA
Sbjct  264   VAINPAMVVGPLLQPTLNTSAAAVLSLLKGANTFPNASFGWVNVKDVANAHIQAFEIPSA  323

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GR+C++ERVAHYSEVV    +LYP  + PEKCAD+KP+VPTYQVSKEKAK LG+ F PL
Sbjct  324   SGRHCLVERVAHYSEVVNITRELYPDFQFPEKCADEKPYVPTYQVSKEKAKGLGIDFIPL  383

Query  1129  EESLKETVESLKEKGFFV  1182
               SLKETVESLKEKGF +
Sbjct  384   NVSLKETVESLKEKGFII  401



>gb|KCW87173.1| hypothetical protein EUGRSUZ_B03696 [Eucalyptus grandis]
Length=375

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/318 (77%), Positives = 285/318 (90%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASGYIASW+VK LLQRGY VKA+VR P+DPKKT+HLL L+GAK+RL LFKA
Sbjct  55    AGKVVCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDPKKTEHLLGLDGAKDRLQLFKA  114

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFD +V GC GVFHTASPFYH+V DPQAEL+DPAVKGTLNVL SC+K PS+Q+V
Sbjct  115   NLLEEGSFDPIVEGCAGVFHTASPFYHDVKDPQAELLDPAVKGTLNVLKSCSKAPSLQRV  174

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAVAYN +PRTPEVVVDE+W+S  D C++   WYVLSKTLAEDAAWKFVKEKGI
Sbjct  175   VLTSSMAAVAYNRQPRTPEVVVDESWFSDPDLCRQTNAWYVLSKTLAEDAAWKFVKEKGI  234

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +MVTINPAMVIGPLLQPTLNTS+AAI NLINGA T+ NAS+GW+NVKDVANAHILA E P
Sbjct  235   DMVTINPAMVIGPLLQPTLNTSAAAIGNLINGAPTFPNASFGWVNVKDVANAHILAFEVP  294

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SA+GRYC++ER+AHYSE+V+ L +LYP+ +LPEK ADDKPFVP YQVSKEK K+LG+ + 
Sbjct  295   SASGRYCLVERIAHYSEIVRILRELYPSAQLPEKSADDKPFVPIYQVSKEKVKSLGINYI  354

Query  1123  PLEESLKETVESLKEKGF  1176
             PLE++LKETVESLKEKGF
Sbjct  355   PLEQNLKETVESLKEKGF  372



>ref|XP_010102363.1| hypothetical protein L484_015312 [Morus notabilis]
 gb|EXB93324.1| hypothetical protein L484_015312 [Morus notabilis]
Length=328

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/321 (78%), Positives = 287/321 (89%), Gaps = 0/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             ++ A K VCVTGASGYIASW+VKFLLQRGY VKA+VR P+D KKT HL SL+GAKERL L
Sbjct  5     VTGAGKVVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDQKKTAHLTSLDGAKERLQL  64

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSFDSV+ G EGVFHTASPFYH+V DP+AEL+DPAVKGTLNVL SCAK+ SV
Sbjct  65    FKADLLEEGSFDSVIEGSEGVFHTASPFYHDVKDPEAELLDPAVKGTLNVLNSCAKSSSV  124

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSIAAV+YNGKPRTP+V+VDETW+S  D CKE+K WYVLSKTLAEDAAWKFVKE
Sbjct  125   KRVVLTSSIAAVSYNGKPRTPDVIVDETWFSDPDICKELKQWYVLSKTLAEDAAWKFVKE  184

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI++VT+NPAMVIGPLLQPTLNTS+AAILNLINGA+T+ N + GW+NVKDVANAHILA 
Sbjct  185   KGIDLVTMNPAMVIGPLLQPTLNTSAAAILNLINGAQTFLNFTLGWVNVKDVANAHILAY  244

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRYC++E VAHYSE+V+ L +LYP+L LPEKCADDK F+PTYQVSKEKA +LG+
Sbjct  245   EVPSASGRYCLVESVAHYSEIVRLLRELYPSLPLPEKCADDKLFMPTYQVSKEKATSLGI  304

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              F PL+  LKETVESLKEK F
Sbjct  305   DFIPLKTGLKETVESLKEKQF  325



>gb|KHN12530.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=325

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/320 (77%), Positives = 282/320 (88%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASWIVKFLL RGY VKATVR   DPKK  HL+ L+GAKERLHL+
Sbjct  3     SGAGKVVCVTGASGYIASWIVKFLLNRGYTVKATVRDTSDPKKINHLVGLDGAKERLHLY  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSF+SVV GC  VFHTASPFYHNV DPQAEL+DPA+KGTLNVL SC   P+++
Sbjct  63    KANLLEEGSFNSVVQGCHAVFHTASPFYHNVKDPQAELLDPALKGTLNVLKSCVNLPTLE  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVAYNGKPRTP+VVVDETW+S   FC+E +MWY LSKTLAEDAAWKFVKE 
Sbjct  123   RVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPGFCRESQMWYTLSKTLAEDAAWKFVKEN  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I+MVTINPAMVIGPLLQP LNTS+A+ILN+INGA+T+ NAS+GW+NVKDVANAHILA E
Sbjct  183   NIDMVTINPAMVIGPLLQPVLNTSAASILNVINGAQTFPNASFGWVNVKDVANAHILAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             N SANGRYC++ERVAHYSE+VK L  LYPTL+LPEKCADD P+VP YQVSKE+AK+LG+ 
Sbjct  243   NASANGRYCLVERVAHYSEIVKILRDLYPTLQLPEKCADDNPYVPIYQVSKERAKSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             +TPLE SLKETV+SLKEK F
Sbjct  303   YTPLEVSLKETVDSLKEKKF  322



>ref|XP_008449698.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis melo]
 ref|XP_008449699.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis melo]
Length=325

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/319 (76%), Positives = 283/319 (89%), Gaps = 0/319 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A KTVCVTG SGYIASWIVKFLLQRGY VKA+VR P DP KT HLLSL+GA ERLHLFKA
Sbjct  5     AAKTVCVTGGSGYIASWIVKFLLQRGYTVKASVRNPADPIKTAHLLSLDGAAERLHLFKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS + GC+GVFHTASPF+HNV+DPQAELIDPA+KGTLNVL S AK+ SV++V
Sbjct  65    NLLEEGSFDSAIEGCQGVFHTASPFFHNVSDPQAELIDPALKGTLNVLKSVAKSSSVKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAVAYNG+PR P+ V+DETW+S  + CKE+K+WYVLSKTLAE+AAW FV+EKGI
Sbjct  125   VLTSSMAAVAYNGQPRNPDTVIDETWFSNPEICKELKLWYVLSKTLAEEAAWNFVREKGI  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +M+TINPAMVIGPLLQPTLNTS+ AILNLI+GA+T+ N+++GW+NVKDVANAHILA E P
Sbjct  185   DMITINPAMVIGPLLQPTLNTSAEAILNLISGAQTFPNSTFGWVNVKDVANAHILAYEVP  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SANGRYC++E V HYS +VK LH LYP+L+LP+KCADDKPF P YQVS EKAKNLG+ F 
Sbjct  245   SANGRYCLVESVIHYSGIVKILHDLYPSLQLPDKCADDKPFTPVYQVSVEKAKNLGIQFI  304

Query  1123  PLEESLKETVESLKEKGFF  1179
             PL ESLKETVESLKEK F 
Sbjct  305   PLVESLKETVESLKEKNFI  323



>pdb|4QUK|A Chain A, Crystal Structure Of Cinnamyl-alcohol Dehydrogenase 
2 Mutant K169a
Length=319

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/314 (78%), Positives = 285/314 (91%), Gaps = 0/314 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             VCVTGASGYIASW+V+ LL RGY VKATVR P+DPKK  HL+ L+GAKERL LFKA+LLE
Sbjct  3     VCVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLE  62

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EG+FDSVV GC GVFHTASPFYH+V DPQAELIDPA+KGTLNVL SCAK+PS+++VV+TS
Sbjct  63    EGAFDSVVQGCHGVFHTASPFYHDVKDPQAELIDPALKGTLNVLNSCAKSPSLKRVVLTS  122

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             SIAAVAYNGKPRTP+VVVDETW++ ADFC +  +WYV+S TLAE+AAWKFVKE  I+MVT
Sbjct  123   SIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSATLAEEAAWKFVKENNIDMVT  182

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INPAMVIGPLLQP LNTS+AAILNLINGA+T+ NAS+GW+NVKDVANAHILA EN SA+G
Sbjct  183   INPAMVIGPLLQPVLNTSAAAILNLINGAQTFPNASFGWVNVKDVANAHILAYENASASG  242

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             R+C++ERVAHYSEVV+ L +LYP+L+LPEKCADDKP+VP YQVSKEKAK+LG+ +TPLE 
Sbjct  243   RHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGLEYTPLEV  302

Query  1135  SLKETVESLKEKGF  1176
             S+KETVESLKEK F
Sbjct  303   SIKETVESLKEKKF  316



>ref|XP_010045029.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
Length=327

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/318 (78%), Positives = 283/318 (89%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASGYIASW+VK LLQRGY VKATVR P+DPKKT+HLL L+GAK+RL LFKA
Sbjct  7     AGKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLGLDGAKDRLQLFKA  66

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFD +V GC GVFHTASPFYH+V DPQAEL+DPAVKGTLNVL SC+K PSVQ+V
Sbjct  67    NLLEEGSFDPIVEGCAGVFHTASPFYHDVKDPQAELLDPAVKGTLNVLKSCSKAPSVQRV  126

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSSIAAV YNG+PRTPEVVVDE+W+S  D C++   WY+LSKTLAEDAAWKFVKEKGI
Sbjct  127   VLTSSIAAVVYNGQPRTPEVVVDESWFSDPDLCRQTNAWYLLSKTLAEDAAWKFVKEKGI  186

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +MVTINPAMVIGPLLQPTLNTS+AAI NLINGA T+ NAS+GW+NVKDVANAHILA E P
Sbjct  187   DMVTINPAMVIGPLLQPTLNTSAAAIGNLINGAPTFPNASFGWVNVKDVANAHILAFEVP  246

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SA+GRYC++ER+AH SE+V+ L +LYP+++LPEK ADDKPFVP YQVSKEK K+LG+   
Sbjct  247   SASGRYCLVERIAHCSEIVRILRELYPSVQLPEKSADDKPFVPIYQVSKEKVKSLGIDCI  306

Query  1123  PLEESLKETVESLKEKGF  1176
             PL +SLKETVESLKEKGF
Sbjct  307   PLNQSLKETVESLKEKGF  324



>ref|XP_007149029.1| hypothetical protein PHAVU_005G034500g [Phaseolus vulgaris]
 gb|ESW21023.1| hypothetical protein PHAVU_005G034500g [Phaseolus vulgaris]
Length=329

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/321 (76%), Positives = 281/321 (88%), Gaps = 0/321 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A + VCVTGASGYIASWIVK LL RGY VKATVR P+DPKK  HLL+L+GAKERLHL 
Sbjct  3     SGAGQVVCVTGASGYIASWIVKLLLHRGYTVKATVRDPNDPKKVNHLLNLDGAKERLHLV  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDSVV GC  VFHTASPFYH+V DPQ EL+DPAVKGTLNVL SC  +P ++
Sbjct  63    KANLLEEGSFDSVVQGCHAVFHTASPFYHDVKDPQVELLDPAVKGTLNVLKSCVNSPVLK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSSIAAVAYNGKPRTP+VVVDETW+S  DFC+E +MWY LSKTLAEDAAWKFVKE 
Sbjct  123   RVVLTSSIAAVAYNGKPRTPDVVVDETWFSDPDFCRESQMWYTLSKTLAEDAAWKFVKEN  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I++VTINPAMV+GPLLQP LNTS+A+ILN++NG +T+ NAS+GW+NVKDVANAHILA E
Sbjct  183   NIDLVTINPAMVVGPLLQPVLNTSAASILNVVNGMQTFQNASFGWVNVKDVANAHILAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             N SANGRYC++ERVAHYS+V+K L  LYPTL+LP+KC DDKP+VP YQVSKEKAK+LG+ 
Sbjct  243   NSSANGRYCLVERVAHYSDVLKILRDLYPTLQLPQKCGDDKPYVPIYQVSKEKAKSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGFF  1179
             F PLE SLKETVESLKEK F 
Sbjct  303   FIPLEVSLKETVESLKEKKFI  323



>gb|AFK47262.1| unknown [Medicago truncatula]
Length=326

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/314 (78%), Positives = 285/314 (91%), Gaps = 0/314 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             VCVTGASGYIASW+V+ LL RGY VKATVR P+DPKK  HL+ L+GAKERL LFKA+LLE
Sbjct  10    VCVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLE  69

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EG+FDSVV GC GVFHTASPFYH+V DPQAELIDPA+KGTLNVL SCAK+PS+++VV+TS
Sbjct  70    EGAFDSVVQGCHGVFHTASPFYHDVKDPQAELIDPALKGTLNVLNSCAKSPSLKRVVLTS  129

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             SIAAVAYNGKPRTP+VVV ETW++ ADFC +  +WYV+SKTLAE+AAWKFVKE  I+MVT
Sbjct  130   SIAAVAYNGKPRTPDVVVGETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENNIDMVT  189

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INPAMVIGPLLQP LNTS+AAILNLINGA+T+ NAS+GW+NVKDVANAHILA EN SA+G
Sbjct  190   INPAMVIGPLLQPVLNTSAAAILNLINGAQTFPNASFGWVNVKDVANAHILAYENASASG  249

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             R+C++ERVAHYSEVV+ L +LYP+L+LPEKCADDKP+VP YQVSKEKAK+LG+ +TPLE 
Sbjct  250   RHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGLEYTPLEV  309

Query  1135  SLKETVESLKEKGF  1176
             S+KETVESLKEK F
Sbjct  310   SIKETVESLKEKKF  323



>ref|XP_007015091.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
1 [Theobroma cacao]
 gb|EOY32710.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
1 [Theobroma cacao]
Length=325

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/316 (78%), Positives = 287/316 (91%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIAS +VK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ RL LFKA L
Sbjct  7     KTVCVTGASGYIASCLVKLLLLRGYTVKASVRDPNDPRKTQHLLALEGAEGRLKLFKATL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEE S+D+VV GCEGVFHTASPFYH+VTDPQAEL+DPAVKGTLNVL SCAKT SV++VV+
Sbjct  67    LEEDSYDAVVEGCEGVFHTASPFYHDVTDPQAELLDPAVKGTLNVLNSCAKTSSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+VVVDETW++  D+CK +K+WYV+SKT+AEDAAWKF KEKGI+M
Sbjct  127   TSSMAAVAYNGKPRTPDVVVDETWFTDPDYCKGLKLWYVVSKTMAEDAAWKFAKEKGIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V INPAMVIGPLLQPTLNTS+AA+L+LI GAET+ NA++GW+NVKDVANAHI A E PSA
Sbjct  187   VAINPAMVIGPLLQPTLNTSAAAVLSLIKGAETFPNATFGWVNVKDVANAHIQAFEIPSA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAHYSE+VK L +LYP+ +LPEKCADDKP+VPTYQVSKEKAK LG+ F PL
Sbjct  247   SGRYCLVERVAHYSEIVKVLQELYPSFQLPEKCADDKPYVPTYQVSKEKAKCLGIDFIPL  306

Query  1129  EESLKETVESLKEKGF  1176
             + SLKETVESLKEKGF
Sbjct  307   DVSLKETVESLKEKGF  322



>ref|XP_010316141.1| PREDICTED: phenylacetaldehyde reductase isoform X1 [Solanum lycopersicum]
Length=650

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/320 (79%), Positives = 285/320 (89%), Gaps = 0/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             MAM+TVCVTGASGYIASW+VKFLLQRGY VKATVR  +D KK  HL SL+GAKERLHLFK
Sbjct  1     MAMRTVCVTGASGYIASWLVKFLLQRGYTVKATVRDLNDQKKVDHLTSLDGAKERLHLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             ADLLEEGSFD+VV GCEGVFHTASPFY  V DPQ E+IDPA+KGTLNVLGS AKTPSV++
Sbjct  61    ADLLEEGSFDAVVEGCEGVFHTASPFYLGVKDPQVEMIDPALKGTLNVLGSVAKTPSVRR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAVA+NGKPRTPEVVVDETWWS  DFC+E ++WYVLSKTLAEDAAWKFVKEK 
Sbjct  121   VVLTSSVAAVAFNGKPRTPEVVVDETWWSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKA  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
              +MVTINPAMVIG LLQPTLNTS+AAIL L+NG+ETY N+++GW+NVKDVA AHILA EN
Sbjct  181   FDMVTINPAMVIGGLLQPTLNTSAAAILQLLNGSETYPNSTFGWVNVKDVALAHILAFEN  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRY M+E VAHYSE+VK L +LYPTL+LPEKCADDKPF PTYQV+ E+AK LG+ F
Sbjct  241   PSANGRYLMVESVAHYSEIVKILRELYPTLKLPEKCADDKPFTPTYQVNVERAKKLGIEF  300

Query  1120  TPLEESLKETVESLKEKGFF  1179
              PL ES+KET ESLKEK F+
Sbjct  301   IPLAESVKETAESLKEKKFY  320


 Score =   478 bits (1231),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 228/323 (71%), Positives = 268/323 (83%), Gaps = 1/323 (0%)
 Frame = +1

Query  214   ISMAMKTV-CVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLH  390
             +S+  KTV CVTGASG+IASW+VK LL RGY VKA+VR P+D +K  HL  L+GAKERLH
Sbjct  328   MSLETKTVVCVTGASGFIASWLVKLLLNRGYTVKASVRDPNDQEKIDHLTCLDGAKERLH  387

Query  391   LFKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPS  570
             LFKA LLE+GSFD+VV GCEGVFHTASP Y    DPQAELIDPAVKGTLNVLGS AKT +
Sbjct  388   LFKASLLEQGSFDAVVDGCEGVFHTASPCYFEAKDPQAELIDPAVKGTLNVLGSVAKTTT  447

Query  571   VQKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVK  750
             V++VV+TSSIAAV++NGKPRT E V+DETWWS  D+C++ ++WY+LSKTLAEDAAWKF K
Sbjct  448   VRRVVLTSSIAAVSFNGKPRTREAVIDETWWSDPDYCRKKQLWYILSKTLAEDAAWKFAK  507

Query  751   EKGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILA  930
             EKG +MVTINPA VIG LLQPTLNT+  AIL L+ G+ETY N + GW+NVKDVA AHILA
Sbjct  508   EKGFDMVTINPATVIGSLLQPTLNTTCDAILQLLKGSETYPNTTSGWVNVKDVALAHILA  567

Query  931   LENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLG  1110
              ENPSANGRY M+E VAHYSE+V+ L +LYPT++LPE+C  DKPF P YQV+ EK + LG
Sbjct  568   FENPSANGRYIMVESVAHYSELVQILRELYPTMKLPERCVVDKPFPPKYQVNIEKTRTLG  627

Query  1111  VVFTPLEESLKETVESLKEKGFF  1179
             V FTPL  S+KET ESLKEK F+
Sbjct  628   VEFTPLALSIKETAESLKEKKFY  650



>emb|CAA61275.1| cinnamyl alcohol dehydrogenase [Eucalyptus gunnii]
Length=327

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/318 (77%), Positives = 284/318 (89%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGAS YIASW+VK LLQRGY VKA+VR P+DPKKT+HLL L+GAK+RL LFKA
Sbjct  7     AGKVVCVTGASRYIASWLVKLLLQRGYTVKASVRDPNDPKKTEHLLGLDGAKDRLQLFKA  66

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFD +V GC GVFHTASPFYH+V DPQAEL+DPAVKGTLNVL SC+K PS+Q+V
Sbjct  67    NLLEEGSFDPIVEGCAGVFHTASPFYHDVKDPQAELLDPAVKGTLNVLKSCSKAPSLQRV  126

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAVAYN +PRTPEVVVDE+W+S  D C++   WYVLSKTLAEDAAWKFVKEKGI
Sbjct  127   VLTSSMAAVAYNRQPRTPEVVVDESWFSDPDLCRQTNAWYVLSKTLAEDAAWKFVKEKGI  186

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +MVTINPAMVIGPLLQPTLNTS+AAI NLINGA T+ NAS+GW+NVKDVANAHILA E P
Sbjct  187   DMVTINPAMVIGPLLQPTLNTSAAAIGNLINGAPTFPNASFGWVNVKDVANAHILAFEVP  246

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SA+GRYC++ER+AHYSE+V+ L +LYP+ +LPEK ADDKPFVP YQVSKEK K+LG+ + 
Sbjct  247   SASGRYCLVERIAHYSEIVRILRELYPSAQLPEKSADDKPFVPIYQVSKEKVKSLGINYI  306

Query  1123  PLEESLKETVESLKEKGF  1176
             PLE++LKETVESLKEKGF
Sbjct  307   PLEQNLKETVESLKEKGF  324



>ref|XP_010519769.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Tarenaya hassleriana]
Length=320

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/317 (77%), Positives = 287/317 (91%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P+DPKKT+HLLSLEGA ERLHLFKA+L
Sbjct  3     KVVCVTGASGYIASWVVKFLLLRGYTVKASVRDPNDPKKTEHLLSLEGASERLHLFKANL  62

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LE+GSFDS V GCEGVFHTASPFYH+V DPQAELIDPAVKGTLNVL SC+KT +V++VVV
Sbjct  63    LEDGSFDSAVDGCEGVFHTASPFYHDVKDPQAELIDPAVKGTLNVLNSCSKTSTVKRVVV  122

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+V+VDETW+S  + CK  KMWY+LSKTLAE+AAWK+ KEKGI++
Sbjct  123   TSSMAAVAYNGKPRTPDVMVDETWFSDPEVCKASKMWYILSKTLAEEAAWKYAKEKGIDI  182

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAI +LING +T+ N+S+GW+NVKDVANAHILA ENPSA
Sbjct  183   VTINPAMVIGPLLQPTLNTSAAAISSLINGTKTFPNSSFGWVNVKDVANAHILAFENPSA  242

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++E VAH+SEVV  L +L+P L+LPEKCAD+KP+VPTYQVSKE+AK+LG+ + PL
Sbjct  243   NGRYCLVESVAHHSEVVNILRELFPNLQLPEKCADEKPYVPTYQVSKERAKSLGIDYIPL  302

Query  1129  EESLKETVESLKEKGFF  1179
             + S++ETVESLK KGF 
Sbjct  303   KVSIQETVESLKGKGFL  319



>gb|ACJ85556.1| unknown [Medicago truncatula]
Length=326

 Score =   523 bits (1346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/314 (78%), Positives = 285/314 (91%), Gaps = 0/314 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             VCVTGASGYIASW+V+ LL RGY VKATVR P+DPKK  HL+ L+GAKERL LFKA+LLE
Sbjct  10    VCVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLE  69

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EG+FDSVV GC GVFHTASPFYH+V DP+AELIDPA+KGTLNVL SCAK+ S+++VV+TS
Sbjct  70    EGAFDSVVQGCHGVFHTASPFYHDVKDPRAELIDPALKGTLNVLNSCAKSSSLKRVVLTS  129

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             SIAAVAYNGKPRTP+VVVDETW++ ADFC +  +WYV+SKTLAE+AAWKFVKE  I+MVT
Sbjct  130   SIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENNIDMVT  189

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INPAMVIGPLLQP LNTS+AAILNLINGA+T+ NAS+GW+NVKDVANAHILA EN SA+G
Sbjct  190   INPAMVIGPLLQPVLNTSAAAILNLINGAQTFPNASFGWVNVKDVANAHILAYENASASG  249

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             R+C++ERVAHYSEVV+ L +LYP+L+LPEKCADDKP+VP YQVSKEKAK+LG+ +TPLE 
Sbjct  250   RHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGLEYTPLEV  309

Query  1135  SLKETVESLKEKGF  1176
             S+KETVESLKEK F
Sbjct  310   SIKETVESLKEKKF  323



>emb|CDY14000.1| BnaC09g38260D [Brassica napus]
Length=326

 Score =   522 bits (1345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/317 (78%), Positives = 280/317 (88%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LL RGY VKA+VR P DPKKT+HLLSL+GAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKSLLSRGYTVKASVRDPSDPKKTQHLLSLDGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAELIDPAVKGTLNVL SC K  SV++VVV
Sbjct  68    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELIDPAVKGTLNVLNSCTKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKP TP+V VDETW+S  + CK  KMWYVLSKTLAEDAAWKF KEKG+++
Sbjct  128   TSSMAAVAYNGKPLTPDVTVDETWFSDPEVCKTSKMWYVLSKTLAEDAAWKFAKEKGLDI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILN INGA+T+SN+++GW++VKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNFINGAKTFSNSTFGWVSVKDVANAHIQAYEIPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+ERV H+SE+V  L +LYP L+LPE CAD+ P+VPTYQVSKEK K+LG+ + PL
Sbjct  248   NGRYCMVERVLHHSEIVNILRQLYPNLQLPESCADENPYVPTYQVSKEKIKSLGIDYIPL  307

Query  1129  EESLKETVESLKEKGFF  1179
             E S+KETVESLKEKGF 
Sbjct  308   EVSIKETVESLKEKGFI  324



>ref|XP_008790952.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Phoenix 
dactylifera]
Length=323

 Score =   522 bits (1344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/321 (77%), Positives = 287/321 (89%), Gaps = 1/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S + K VCVTGASGYIASW+VK LLQRGY V+ATVR   DPKKT+HL +LEGA ERLHL
Sbjct  1     MSGSGKVVCVTGASGYIASWLVKLLLQRGYTVRATVRDLADPKKTEHLHALEGANERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFDSVV GCEGVFHTASPFYH+VTDPQAELIDPAVKGTLNV  SC KTP V
Sbjct  61    FKANLLEEGSFDSVVEGCEGVFHTASPFYHDVTDPQAELIDPAVKGTLNVFSSCIKTP-V  119

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSS+AAVA+NG+PRTP+VVVDETW+S+A+ CK+ K+WYVLSKTLAE+AAWKF K+
Sbjct  120   KRVVVTSSMAAVAFNGRPRTPDVVVDETWFSSAEVCKQAKLWYVLSKTLAEEAAWKFSKD  179

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               I+MVTINPAMVIGPLLQPTLNTS+AAILNLING+ TY N ++GW+NVKDVA AHILA 
Sbjct  180   NSIDMVTINPAMVIGPLLQPTLNTSAAAILNLINGSCTYPNTTFGWVNVKDVAMAHILAF  239

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRYC++ERVAHY+++VK LH+ YP L+LPEKCADDKPFVP YQVSKEK K+LG+
Sbjct  240   EVPSASGRYCLVERVAHYAQLVKILHEQYPALKLPEKCADDKPFVPIYQVSKEKVKSLGI  299

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              + PLE S+KETVESL+EKGF
Sbjct  300   DYIPLETSIKETVESLREKGF  320



>gb|KHG03033.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Gossypium arboreum]
Length=327

 Score =   522 bits (1344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/316 (77%), Positives = 287/316 (91%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIAS +VK LL RGY VKA+VR P DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  7     KTVCVTGASGYIASCLVKHLLLRGYTVKASVRDPSDPRKTQHLLALEGAEERLKLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS V GC+GVFHTASPFYH+VTDPQAEL+DPAVKGTLNVL SCA TPSV++VV+
Sbjct  67    LEEGSFDSGVEGCDGVFHTASPFYHDVTDPQAELLDPAVKGTLNVLNSCANTPSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAV YNGKPRTP+VVVDE+W++  ++CK +K+WYV+SKT+AED+AWKF KEKG++M
Sbjct  127   TSSIAAVTYNGKPRTPDVVVDESWFTDPEYCKNLKLWYVVSKTIAEDSAWKFAKEKGLDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V +NPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A E PSA
Sbjct  187   VVVNPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFEIPSA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAH SEVVK L +LYP+ +LPEKCADDKP+VPTYQVSKEKAK LG+ FTPL
Sbjct  247   SGRYCLVERVAHCSEVVKMLSELYPSFQLPEKCADDKPYVPTYQVSKEKAKTLGIEFTPL  306

Query  1129  EESLKETVESLKEKGF  1176
             + SLKETVESLKEKGF
Sbjct  307   DVSLKETVESLKEKGF  322



>ref|NP_001242544.1| uncharacterized protein LOC100781477 [Glycine max]
 gb|ACU21419.1| unknown [Glycine max]
Length=325

 Score =   521 bits (1343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/320 (77%), Positives = 280/320 (88%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASWIVKFLL RGY VKATVR   DPKK  HL+ L+GAKERLHL+
Sbjct  3     SGAGKVVCVTGASGYIASWIVKFLLNRGYTVKATVRDTSDPKKINHLVGLDGAKERLHLY  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSF+SVV GC  VFHTASPFYHNV DPQAEL+DPA+KGTLNVL SC   P+++
Sbjct  63    KANLLEEGSFNSVVQGCHAVFHTASPFYHNVKDPQAELLDPALKGTLNVLKSCVNLPTLE  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVAYNGKPRTP+VVVDETW+S   FC+E +MWY LSKTLAEDAAWKFVKE 
Sbjct  123   RVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPGFCRESQMWYTLSKTLAEDAAWKFVKEN  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I+MVTINPAMVIGPLLQP LNTS+A+ILN+INGA+T+ NAS+GW+NVKDVANAHILA E
Sbjct  183   NIDMVTINPAMVIGPLLQPVLNTSAASILNVINGAQTFPNASFGWVNVKDVANAHILAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             N SANGRYC++ERVAHYSE+VK L  LYPTL LP KCADD P+VP YQVSKEKAK+LG+ 
Sbjct  243   NASANGRYCLVERVAHYSEIVKILRDLYPTLLLPGKCADDNPYVPIYQVSKEKAKSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             +TPLE SLKETV+SLKEK F
Sbjct  303   YTPLEVSLKETVDSLKEKKF  322



>ref|XP_006602185.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Glycine max]
Length=325

 Score =   521 bits (1341),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 249/320 (78%), Positives = 280/320 (88%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASWIVKFLL RGY VKATVR   DPKKT HL+ L+GAKERLHL+
Sbjct  3     SGAGKVVCVTGASGYIASWIVKFLLLRGYTVKATVRDTSDPKKTNHLIGLDGAKERLHLY  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             +A+LLEEGSF+SVV GC  VFHTASPFYHNV DPQAEL+DPA+KGTLNVL SC   P+++
Sbjct  63    EANLLEEGSFNSVVQGCHAVFHTASPFYHNVKDPQAELLDPALKGTLNVLKSCVNLPTLE  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVA NGKP TP VVVDETW+S  D C+E K WY LSKTLAEDAAWKFVKE 
Sbjct  123   RVVLTSSVAAVANNGKPLTPYVVVDETWFSDPDLCREAKRWYTLSKTLAEDAAWKFVKEN  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I+MVTINPAMVIGPLLQP LNTS+A+ILN+INGAET+ NASYGW+NVKDVANAHILA E
Sbjct  183   NIDMVTINPAMVIGPLLQPVLNTSAASILNIINGAETFPNASYGWVNVKDVANAHILAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             N SANGRYC++ERVAHYSE+VK L  LYPTL+LPEKCADDKP+VP YQVSKEKAK+LG+ 
Sbjct  243   NASANGRYCLVERVAHYSEIVKVLPDLYPTLQLPEKCADDKPYVPIYQVSKEKAKSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             +TPLE SLKETV+SLKEK F
Sbjct  303   YTPLEVSLKETVDSLKEKKF  322



>ref|XP_006400504.1| hypothetical protein EUTSA_v10014099mg [Eutrema salsugineum]
 gb|ESQ41957.1| hypothetical protein EUTSA_v10014099mg [Eutrema salsugineum]
Length=326

 Score =   520 bits (1340),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 244/317 (77%), Positives = 278/317 (88%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LL RGY VKA+VR P DPKKT+HL+SLEGAKERL LFKADL
Sbjct  8     KVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLQLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAELIDPAVKGTLNVL SC K  SV++VVV
Sbjct  68    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELIDPAVKGTLNVLNSCTKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV YNGKPRTPEV VDETW+S  + CK  KMWYVLSKTLAEDAAWKF KEKG+ +
Sbjct  128   TSSMAAVGYNGKPRTPEVTVDETWFSDPELCKASKMWYVLSKTLAEDAAWKFAKEKGLAI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILN INGA+T++NAS+GW+NVKDVANAHI A E  SA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNFINGAKTFANASFGWVNVKDVANAHIQAFEVSSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAH+SEVV  L +LYP L+LPE+C D+ P+VPTY+VSKEK ++LG+ + PL
Sbjct  248   NGRYCLVERVAHHSEVVNILRELYPNLQLPERCVDENPYVPTYEVSKEKTRSLGIDYIPL  307

Query  1129  EESLKETVESLKEKGFF  1179
             + S+KETVESLKEKGF 
Sbjct  308   KVSIKETVESLKEKGFI  324



>gb|KDP22108.1| hypothetical protein JCGZ_25939 [Jatropha curcas]
Length=409

 Score =   523 bits (1348),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 244/322 (76%), Positives = 284/322 (88%), Gaps = 0/322 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VKFLL RGY VKA+VR PDDPKK +HL +LEGA+ERL LF
Sbjct  87    SGAGKIVCVTGASGYIASWLVKFLLLRGYTVKASVRNPDDPKKVEHLTALEGAQERLQLF  146

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFD+ + GCEGVFHTASPF+H+VTDPQ ELIDPAVKGTLNVL SCA+TPSV+
Sbjct  147   KANLLEEGSFDAAIEGCEGVFHTASPFFHDVTDPQTELIDPAVKGTLNVLNSCARTPSVK  206

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSSIAAV YNGKPRTPEVVVDETW+S  +FCKE K+WYV+SKTLAEDAAWKF KEK
Sbjct  207   RVVLTSSIAAVNYNGKPRTPEVVVDETWFSDPEFCKENKLWYVVSKTLAEDAAWKFAKEK  266

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I++V INPAMVIGPLLQPTLNTS+AA+L+L+ G +T+ NA++GW+NVKDVANAHI A E
Sbjct  267   DIDLVAINPAMVIGPLLQPTLNTSAAAVLSLMKGVQTFPNATFGWVNVKDVANAHIQAFE  326

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
              PSA+GRYC++E VAHYS+VV  L +LYP  + PEKCADDKP+VPTY+VSKEKAK LG+ 
Sbjct  327   IPSASGRYCLVETVAHYSKVVDTLRELYPDFQFPEKCADDKPYVPTYEVSKEKAKRLGID  386

Query  1117  FTPLEESLKETVESLKEKGFFV  1182
             F PL+ S+KETVESLKEKGF V
Sbjct  387   FIPLKVSIKETVESLKEKGFIV  408



>ref|XP_010905792.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Elaeis guineensis]
Length=385

 Score =   522 bits (1345),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 255/345 (74%), Positives = 295/345 (86%), Gaps = 12/345 (3%)
 Frame = +1

Query  142   YGRRRTLLNLRASEWrrkrarrrrISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATV  321
             YGR    +  RASE       RRR+S + K VCVTGASGYIASW+VK LLQRGY V+A+V
Sbjct  50    YGR----VGARASE-------RRRMSGSGKVVCVTGASGYIASWLVKLLLQRGYTVRASV  98

Query  322   RYPDDPKKTKHLLSLEGAKERLHLFKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQ  501
             R   DPKK +HL +LEGA ERLHLFKA+LLEEGSFDSVV GCEGVFHTASPFYHNVTDPQ
Sbjct  99    RDLADPKKIEHLRALEGANERLHLFKANLLEEGSFDSVVEGCEGVFHTASPFYHNVTDPQ  158

Query  502   AELIDPAVKGTLNVLGSCAKTPSVQKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFC  681
             AELIDPAVKGTLNV  SC KTP +++VVVTSS+AAVA+NG+PRTP+VVVDETW+S+A+FC
Sbjct  159   AELIDPAVKGTLNVFSSCIKTP-IKRVVVTSSMAAVAFNGRPRTPDVVVDETWFSSAEFC  217

Query  682   KEMKMWYVLSKTLAEDAAWKFVKEKGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGA  861
             K+ KMWYVLSKTLAE+ AWKF K+  I+MVTINPAMVIGPLLQPTLNTS+AAI+NLING+
Sbjct  218   KQAKMWYVLSKTLAEEVAWKFSKDNSIDMVTINPAMVIGPLLQPTLNTSAAAIMNLINGS  277

Query  862   ETYSNASYGWINVKDVANAHILALENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPE  1041
              TY NAS+GW+NVKDVA AHILA E PSA+GRYC++ERVAHY+E+VK LH  YP L+LPE
Sbjct  278   STYPNASFGWVNVKDVAMAHILAFEVPSASGRYCLVERVAHYAELVKILHDQYPALKLPE  337

Query  1042  KCADDKPFVPTYQVSKEKAKNLGVVFTPLEESLKETVESLKEKGF  1176
              CADDKPFVP YQVSKEK K+LG+ + PLE S+ ETV+SL+EKGF
Sbjct  338   MCADDKPFVPIYQVSKEKTKSLGIDYIPLETSIMETVKSLREKGF  382



>ref|XP_010534743.1| PREDICTED: cinnamoyl-CoA reductase 1 [Tarenaya hassleriana]
Length=325

 Score =   519 bits (1336),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 240/317 (76%), Positives = 282/317 (89%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA ERL LFKA+L
Sbjct  7     KTVCVTGASGYIASWIVKLLLIRGYTVKASVRDPNDPRKTEHLLALEGASERLKLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQ EL+DPAVKGT+NVL SC KT SV++VV+
Sbjct  67    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQVELLDPAVKGTINVLNSCLKTSSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NGKPRTPE VVDETW++  D+C+  K+WYVLSKTLAEDAAWKF KE  + +
Sbjct  127   TSSIAAVAFNGKPRTPETVVDETWFADPDYCRAAKLWYVLSKTLAEDAAWKFAKENDMQL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+INPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENPSA
Sbjct  187   VSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPSA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  LHKLYP  +LPEKCAD+K ++PTY+VSKEKA++LG+ F PL
Sbjct  247   NGRYCLVERVAHYSEVVDILHKLYPDFQLPEKCADEKQYIPTYKVSKEKAESLGIEFVPL  306

Query  1129  EESLKETVESLKEKGFF  1179
             E S+KETVESLK+KGF 
Sbjct  307   EVSIKETVESLKDKGFI  323



>ref|XP_010651224.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
Length=322

 Score =   519 bits (1336),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 245/322 (76%), Positives = 279/322 (87%), Gaps = 0/322 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M+   VCVTGASGYIASW+VK LLQR Y VKA+VR P+DPKKT+HLLSL+GAKERLHLFK
Sbjct  1     MSSGVVCVTGASGYIASWLVKLLLQRDYTVKASVRDPNDPKKTEHLLSLDGAKERLHLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLEEGSFDS+V GC GVFHTASPFY+ VTDPQAELIDPA+KGTLNVL SCAKTP+V++
Sbjct  61    ANLLEEGSFDSIVEGCVGVFHTASPFYYGVTDPQAELIDPALKGTLNVLSSCAKTPTVKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VVVTSSIAAV Y+GKPRTPE+VVDETW+S  D CKEMK WY LSKTLAE+AAWKF KEKG
Sbjct  121   VVVTSSIAAVVYSGKPRTPEIVVDETWFSNQDICKEMKHWYALSKTLAEEAAWKFAKEKG  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             +++VTINPAMVIGPLLQPTLN S+A ILNLINGA+ + N + GW++VKDVA AHI A E 
Sbjct  181   MDIVTINPAMVIGPLLQPTLNASAATILNLINGAQIFPNFTMGWVHVKDVAEAHIQAFEI  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRYC+ ER  HYSE+VK L  L+P  +LP KCADD PF+PTYQ+SKEKAK+LG+ F
Sbjct  241   PSANGRYCLAERTVHYSEIVKILKDLFPDFQLPVKCADDHPFMPTYQISKEKAKSLGIEF  300

Query  1120  TPLEESLKETVESLKEKGFFVP  1185
              PLEESLKETVESLKEK F  P
Sbjct  301   IPLEESLKETVESLKEKKFLSP  322



>ref|XP_008790953.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Phoenix 
dactylifera]
Length=323

 Score =   519 bits (1336),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 246/321 (77%), Positives = 286/321 (89%), Gaps = 1/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S + K V VTGASGYIASW+VK LLQRGY V+ATVR   DPKKT+HL +LEGA ERLHL
Sbjct  1     MSGSGKMVSVTGASGYIASWLVKLLLQRGYTVRATVRDLADPKKTEHLHALEGANERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFDSVV GCEGVFHTASPFYH+VTDPQAELIDPAVKGTLNV  SC KTP V
Sbjct  61    FKANLLEEGSFDSVVEGCEGVFHTASPFYHDVTDPQAELIDPAVKGTLNVFSSCIKTP-V  119

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSS+AAVA+NG+PRTP+VVVDETW+S+A+ CK+ K+WYVLSKTLAE+AAWKF K+
Sbjct  120   KRVVVTSSMAAVAFNGRPRTPDVVVDETWFSSAEVCKQAKLWYVLSKTLAEEAAWKFSKD  179

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               I+MVTINPAMVIGPLLQPTLNTS+AAILNLING+ TY N ++GW+NVKDVA AHILA 
Sbjct  180   NSIDMVTINPAMVIGPLLQPTLNTSAAAILNLINGSCTYPNTTFGWVNVKDVAMAHILAF  239

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRYC++ERVAHY+++VK LH+ YP L+LPEKCADDKPFVP YQVSKEK K+LG+
Sbjct  240   EVPSASGRYCLVERVAHYAQLVKILHEQYPALKLPEKCADDKPFVPIYQVSKEKVKSLGI  299

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              + PLE S+KETVESL+EKGF
Sbjct  300   DYIPLETSIKETVESLREKGF  320



>ref|XP_010102362.1| hypothetical protein L484_015311 [Morus notabilis]
 gb|EXB93323.1| hypothetical protein L484_015311 [Morus notabilis]
Length=328

 Score =   519 bits (1336),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 246/321 (77%), Positives = 284/321 (88%), Gaps = 0/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             ++ A K VCVTGASGYIASW+VKFLLQRGY VKA+VR P+D KKT HL SL+GAKERL L
Sbjct  5     VTGAGKVVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDQKKTAHLTSLDGAKERLQL  64

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSFD+ + G EGVFHTASPFYH+V DPQ EL+DPAVKGTLNVL SCAK+ SV
Sbjct  65    FKADLLEEGSFDNAIEGSEGVFHTASPFYHDVKDPQEELLDPAVKGTLNVLNSCAKSSSV  124

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSIAAV+YNGKPRTP+V+VDETW+S  D CKE+K WY LSKTLAEDAAWKFVKE
Sbjct  125   KRVVLTSSIAAVSYNGKPRTPDVIVDETWFSDPDICKELKQWYWLSKTLAEDAAWKFVKE  184

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI++VTINPA+VIGPLLQPTLNTS+AAILNLINGA+T+ N + GW+NVKDVANAHILA 
Sbjct  185   KGIDLVTINPALVIGPLLQPTLNTSAAAILNLINGAQTFLNLTVGWVNVKDVANAHILAY  244

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRYC++E VAHYSE+V+ L +LYP+L LPEKCADDK F+PTYQVSKEKA +LG+
Sbjct  245   EVPSASGRYCLVESVAHYSEIVRLLRELYPSLPLPEKCADDKLFMPTYQVSKEKATSLGI  304

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              F PL+  LKETVESLKEK F
Sbjct  305   DFIPLKTGLKETVESLKEKQF  325



>gb|KHN12533.1| Dihydroflavonol-4-reductase [Glycine soja]
Length=325

 Score =   518 bits (1335),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 248/320 (78%), Positives = 279/320 (87%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASWIVKFLL RGY VKATVR   DPKKT HL+ L+GAKERLHL+
Sbjct  3     SGAGKVVCVTGASGYIASWIVKFLLLRGYTVKATVRDTSDPKKTNHLIGLDGAKERLHLY  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             +A+LLEEGSF+SVV GC  VFHTASPFYHNV DPQAEL+DPA+KGTLNVL SC   P+++
Sbjct  63    EANLLEEGSFNSVVQGCHAVFHTASPFYHNVKDPQAELLDPALKGTLNVLKSCVNLPTLE  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVA NGKP TP VVVDETW+S  D C+E K WY LSKTLAEDAAWKFVKE 
Sbjct  123   RVVLTSSVAAVANNGKPLTPYVVVDETWFSDPDLCREAKRWYTLSKTLAEDAAWKFVKEN  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I+MVTINPAMVIGPLLQP LNTS+A+ILN+INGAET+ NASYGW+NVKDVANAHILA E
Sbjct  183   NIDMVTINPAMVIGPLLQPVLNTSAASILNIINGAETFPNASYGWVNVKDVANAHILAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             N SANGRYC++ERVAHYSE+VK L  LYPTL+LPEKCADD P+VP YQVSKEKAK+LG+ 
Sbjct  243   NASANGRYCLVERVAHYSEIVKVLPDLYPTLQLPEKCADDNPYVPIYQVSKEKAKSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             +TPLE SLKETV+SLKEK F
Sbjct  303   YTPLEVSLKETVDSLKEKKF  322



>ref|XP_011013832.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=325

 Score =   516 bits (1330),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 246/320 (77%), Positives = 285/320 (89%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASWIVK LL RGY VKA+VR P+DPKKT+HL +L GA++RL L 
Sbjct  3     SGAGKIVCVTGASGYIASWIVKLLLSRGYTVKASVRDPNDPKKTQHLRALCGAQKRLELV  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS+V GCEGVFHTASP Y++V DPQAEL+DPAVKGTLNVLGSCAK PS++
Sbjct  63    KANLLEEGSFDSIVEGCEGVFHTASPCYYDVKDPQAELLDPAVKGTLNVLGSCAKHPSIK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVAYNGKPRTP+VVVDETW+S  + C+E K+WYVLSKTLAEDAAW+F KEK
Sbjct  123   RVVLTSSMAAVAYNGKPRTPDVVVDETWFSDPELCRESKLWYVLSKTLAEDAAWQFAKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             G++MV INP+MVIGPLLQPTLNTS+AAIL+LI GA+T+ NAS+GWINVKDVANAHI A E
Sbjct  183   GMDMVAINPSMVIGPLLQPTLNTSTAAILSLIKGAQTFPNASFGWINVKDVANAHIQAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
               SA+GRYC++ERVAH+SEVVK L +LYP L+LPEKCADDKP VP YQVSKEKAK+LG+ 
Sbjct  243   LSSASGRYCLVERVAHHSEVVKILRELYPDLQLPEKCADDKPCVPIYQVSKEKAKSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE S+KETVESLKEKGF
Sbjct  303   FIPLEASIKETVESLKEKGF  322



>emb|CBI16354.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   518 bits (1335),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 245/322 (76%), Positives = 279/322 (87%), Gaps = 0/322 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M+   VCVTGASGYIASW+VK LLQR Y VKA+VR P+DPKKT+HLLSL+GAKERLHLFK
Sbjct  58    MSSGVVCVTGASGYIASWLVKLLLQRDYTVKASVRDPNDPKKTEHLLSLDGAKERLHLFK  117

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLEEGSFDS+V GC GVFHTASPFY+ VTDPQAELIDPA+KGTLNVL SCAKTP+V++
Sbjct  118   ANLLEEGSFDSIVEGCVGVFHTASPFYYGVTDPQAELIDPALKGTLNVLSSCAKTPTVKR  177

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VVVTSSIAAV Y+GKPRTPE+VVDETW+S  D CKEMK WY LSKTLAE+AAWKF KEKG
Sbjct  178   VVVTSSIAAVVYSGKPRTPEIVVDETWFSNQDICKEMKHWYALSKTLAEEAAWKFAKEKG  237

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             +++VTINPAMVIGPLLQPTLN S+A ILNLINGA+ + N + GW++VKDVA AHI A E 
Sbjct  238   MDIVTINPAMVIGPLLQPTLNASAATILNLINGAQIFPNFTMGWVHVKDVAEAHIQAFEI  297

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRYC+ ER  HYSE+VK L  L+P  +LP KCADD PF+PTYQ+SKEKAK+LG+ F
Sbjct  298   PSANGRYCLAERTVHYSEIVKILKDLFPDFQLPVKCADDHPFMPTYQISKEKAKSLGIEF  357

Query  1120  TPLEESLKETVESLKEKGFFVP  1185
              PLEESLKETVESLKEK F  P
Sbjct  358   IPLEESLKETVESLKEKKFLSP  379



>ref|XP_011045419.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Populus euphratica]
Length=325

 Score =   516 bits (1329),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 246/320 (77%), Positives = 284/320 (89%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASWIVK LL RGY VKA+VR P+DPKKT+HL +L GA++RL L 
Sbjct  3     SGAGKIVCVTGASGYIASWIVKLLLSRGYTVKASVRDPNDPKKTQHLRALCGAQKRLELV  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS+V GCEGVFHTASP Y++V DPQAEL+DPAVKGTLNVLGSCAK PS++
Sbjct  63    KANLLEEGSFDSIVEGCEGVFHTASPCYYDVKDPQAELLDPAVKGTLNVLGSCAKHPSIK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVAYNGKPRTP+VVVDETW+S    C+E K+WYVLSKTLAEDAAW+F KEK
Sbjct  123   RVVLTSSMAAVAYNGKPRTPDVVVDETWFSDPQLCRESKLWYVLSKTLAEDAAWQFAKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             G++MV INP+MVIGPLLQPTLNTS+AAIL+LI GA+T+ NAS+GWINVKDVANAHI A E
Sbjct  183   GMDMVAINPSMVIGPLLQPTLNTSTAAILSLIKGAQTFPNASFGWINVKDVANAHIQAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
               SA+GRYC++ERVAH+SEVVK L +LYP L+LPEKCADDKP VP YQVSKEKAK+LG+ 
Sbjct  243   LSSASGRYCLVERVAHHSEVVKILRELYPDLQLPEKCADDKPCVPIYQVSKEKAKSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE S+KETVESLKEKGF
Sbjct  303   FIPLEASIKETVESLKEKGF  322



>ref|XP_007015092.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
2 [Theobroma cacao]
 gb|EOY32711.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
2 [Theobroma cacao]
Length=323

 Score =   515 bits (1327),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 244/316 (77%), Positives = 285/316 (90%), Gaps = 2/316 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIAS +VK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ RL LFKA L
Sbjct  7     KTVCVTGASGYIASCLVKLLLLRGYTVKASVRDPNDPRKTQHLLALEGAEGRLKLFKATL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEE S+D+VV GCEGVFHTASPFYH+VTDPQAEL+DPAVKGTLNVL SCAKT SV++VV+
Sbjct  67    LEEDSYDAVVEGCEGVFHTASPFYHDVTDPQAELLDPAVKGTLNVLNSCAKTSSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+VVVDETW++  D+CK +K+WYV+SKT+AEDAAWKF KEKGI+M
Sbjct  127   TSSMAAVAYNGKPRTPDVVVDETWFTDPDYCKGLKLWYVVSKTMAEDAAWKFAKEKGIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V INPAMVIGPLLQPTLNTS+AA+L+LI   ET+ NA++GW+NVKDVANAHI A E PSA
Sbjct  187   VAINPAMVIGPLLQPTLNTSAAAVLSLIK--ETFPNATFGWVNVKDVANAHIQAFEIPSA  244

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAHYSE+VK L +LYP+ +LPEKCADDKP+VPTYQVSKEKAK LG+ F PL
Sbjct  245   SGRYCLVERVAHYSEIVKVLQELYPSFQLPEKCADDKPYVPTYQVSKEKAKCLGIDFIPL  304

Query  1129  EESLKETVESLKEKGF  1176
             + SLKETVESLKEKGF
Sbjct  305   DVSLKETVESLKEKGF  320



>ref|XP_010420748.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Camelina 
sativa]
Length=326

 Score =   515 bits (1327),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 243/316 (77%), Positives = 275/316 (87%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GC+GVFHTASPFYH+V DPQ ELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  68    LVEGSFDSAIDGCQGVFHTASPFYHDVKDPQVELIDPAVKGTLNVLNSCAKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV  NGKPRTP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+ +
Sbjct  128   TSSMAAVTLNGKPRTPDVTVDETWFSTPELCEASKMWYVLSKTLAEDAAWKLAKEKGLEI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILNLINGA+T+ NAS+GW+NVKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFPNASFGWVNVKDVANAHIQAFEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+ERVAHYSE+V  LH+LYP + LPE+C D+ P   TYQVSKEK K+LG+ + PL
Sbjct  248   NGRYCMVERVAHYSELVSILHELYPNVPLPERCVDENPHASTYQVSKEKIKSLGIDYVPL  307

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLKEKGF
Sbjct  308   KVSIKETVESLKEKGF  323



>gb|KFK26207.1| hypothetical protein AALP_AA8G216400 [Arabis alpina]
Length=329

 Score =   514 bits (1325),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 243/321 (76%), Positives = 281/321 (88%), Gaps = 1/321 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTG SGYIASW+VK LL RGYIVKA+VR P DPKKT+HL+SLEGAKERLHLFKA+L
Sbjct  8     KVVCVTGGSGYIASWLVKLLLNRGYIVKASVRDPSDPKKTQHLVSLEGAKERLHLFKANL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAK-TPSVQKVV  585
             L+EGSFDS + GC  VFHTASPFYH+V DPQ ELIDPAVKGTLNVL SCAK + SV++VV
Sbjct  68    LDEGSFDSAIDGCVAVFHTASPFYHDVKDPQVELIDPAVKGTLNVLNSCAKASSSVKRVV  127

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             VTSS+AAVAYNGKPRTP+VVVDETW+S  D CK  +MWYVLSKTLAEDAAWKF KEKG++
Sbjct  128   VTSSMAAVAYNGKPRTPDVVVDETWFSDPDICKASQMWYVLSKTLAEDAAWKFAKEKGLD  187

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             +VTINPAMVIGPLLQPTLNTS+AAILNLINGA+T+ N+S+GW+NVKDVANAHI A E PS
Sbjct  188   IVTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFPNSSFGWVNVKDVANAHIQAFEVPS  247

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYC++ERVAH+SEVV  L +LYP L+LPE C D+ P+VP YQVSKEK ++LG+ +  
Sbjct  248   ANGRYCLVERVAHHSEVVNILRELYPNLQLPESCVDENPYVPIYQVSKEKTQSLGIDYIT  307

Query  1126  LEESLKETVESLKEKGFFVPS  1188
             L++S+KETVESLKEKGF   S
Sbjct  308   LKDSIKETVESLKEKGFIQSS  328



>ref|XP_010454217.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Camelina 
sativa]
Length=326

 Score =   514 bits (1324),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 242/316 (77%), Positives = 275/316 (87%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             + VCVTGASG+IASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     RVVCVTGASGFIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GCEGVFHTASPFYH+V DPQ ELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  68    LVEGSFDSAIDGCEGVFHTASPFYHDVKDPQVELIDPAVKGTLNVLNSCAKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV  NGKPRTP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+ +
Sbjct  128   TSSMAAVTSNGKPRTPDVTVDETWFSTPELCEASKMWYVLSKTLAEDAAWKLAKEKGLEI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILNLINGA+TY N+S+GW+NVKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNLINGAKTYPNSSFGWVNVKDVANAHIQAFEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+ERVAHYSE+V  LH+LYP + LPE+C D+ P   TYQVSKEK K+LG+ + PL
Sbjct  248   NGRYCMVERVAHYSEMVSILHELYPNVPLPERCVDENPHASTYQVSKEKIKSLGIDYVPL  307

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLKEKGF
Sbjct  308   KVSIKETVESLKEKGF  323



>ref|XP_006365624.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=322

 Score =   514 bits (1323),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 245/322 (76%), Positives = 279/322 (87%), Gaps = 2/322 (1%)
 Frame = +1

Query  220   MAMKTVCV--TGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             MA KTVCV  TGASGYIASW+VKFLLQRGY VKATVR P+D KKT HL SL+GAKERLHL
Sbjct  1     MATKTVCVSVTGASGYIASWLVKFLLQRGYTVKATVRDPNDKKKTDHLTSLDGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFD+VV GCEGVFHTASP Y  V DPQAE+IDPA+KGTLNVL S AKTPSV
Sbjct  61    FKANLLEEGSFDAVVEGCEGVFHTASPCYLEVKDPQAEMIDPALKGTLNVLESVAKTPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSS+AAV +NGKPRTPEVVVDETWWS  DFC+E ++WYVLSKTLAEDAAWKFVKE
Sbjct  121   RRVVLTSSVAAVVFNGKPRTPEVVVDETWWSDPDFCRESQLWYVLSKTLAEDAAWKFVKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             K  +MVTINP MVIG LLQPTLNTS+AAI+ L+NG+ETY N ++GW+NVKDVA AHILA 
Sbjct  181   KTFDMVTINPGMVIGSLLQPTLNTSAAAIVQLLNGSETYPNYTFGWVNVKDVALAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             ENPSANGRY M+E VAH+SE+VK L +LYPT++LPEKCADDKPF P YQV+ E+ K LG+
Sbjct  241   ENPSANGRYLMVESVAHFSEIVKILRELYPTMKLPEKCADDKPFTPMYQVNVERTKKLGI  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              F PL ES+KET E LKEK F+
Sbjct  301   EFIPLAESVKETAECLKEKKFY  322



>ref|XP_002871885.1| hypothetical protein ARALYDRAFT_488833 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48144.1| hypothetical protein ARALYDRAFT_488833 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   513 bits (1322),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 237/317 (75%), Positives = 277/317 (87%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LE+GSFDS + GC GVFHTASPF+H+V DPQ ELIDPAVKGTLNVL SC K  SV++VVV
Sbjct  68    LEQGSFDSAIDGCHGVFHTASPFFHDVKDPQVELIDPAVKGTLNVLNSCTKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+V VDETW+S  + C+  KMWYVLSKTLAED AWK  KEKG+++
Sbjct  128   TSSMAAVAYNGKPRTPDVTVDETWFSDPELCETSKMWYVLSKTLAEDTAWKLAKEKGLDI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AA+LNLINGA+T+ N+S+GW+NVKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAVLNLINGAKTFPNSSFGWVNVKDVANAHIQAFEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERV H+SE+V  L +LYP L LPE+C D+ P+VPTYQVSKEK ++LG+ + PL
Sbjct  248   NGRYCLVERVVHHSEIVNILRELYPNLPLPERCVDENPYVPTYQVSKEKTRSLGIDYIPL  307

Query  1129  EESLKETVESLKEKGFF  1179
             + S+KETVESLKE+GF 
Sbjct  308   KVSIKETVESLKERGFI  324



>ref|XP_010246748.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nelumbo nucifera]
Length=324

 Score =   513 bits (1321),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 248/322 (77%), Positives = 275/322 (85%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S A K VCVTGASGYIASW+VK LLQRGY VKA+VR  +DPKKT HL +L GAKERLHL
Sbjct  1     MSGAGKLVCVTGASGYIASWLVKLLLQRGYTVKASVRDRNDPKKTAHLRALVGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFDSVV  CE VFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSC K  SV
Sbjct  61    FKANLLEEGSFDSVVEECEAVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCKKASSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSS+AAVAYN KPR P+VVVDETW+S  +FCKE   WY+LSKTLAE AAWKF KE
Sbjct  121   KRVVVTSSMAAVAYNRKPRNPDVVVDETWFSDPEFCKETNAWYLLSKTLAEAAAWKFAKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
              GI+MVTINPAMVIGPLLQPTLNTS+ AIL L+NG  TY NA+ GW+NVKDVANAHI A 
Sbjct  181   NGIDMVTINPAMVIGPLLQPTLNTSAEAILKLVNGTNTYPNATLGWVNVKDVANAHIQAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRYC++E V HYS VVK LH+L+P+  LP KCADDKP VPTYQVSKEKAK+LG+
Sbjct  241   EIPSASGRYCLVESVVHYSGVVKILHELFPSFHLPNKCADDKPHVPTYQVSKEKAKSLGI  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              F P +ESLKETVESLKEK FF
Sbjct  301   DFIPFKESLKETVESLKEKNFF  322



>gb|AFK47029.1| unknown [Lotus japonicus]
Length=325

 Score =   513 bits (1321),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 240/316 (76%), Positives = 281/316 (89%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             + VCVTGASGYIASWIVKFLL RGY VKATVR P+D KK  HLL+L+GAKERLHLFKA+L
Sbjct  7     QVVCVTGASGYIASWIVKFLLHRGYTVKATVRDPNDSKKVDHLLNLDGAKERLHLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC GVFHTASPFYH+V DPQ EL+DPAVKGTLNVL SC  +P++++VV+
Sbjct  67    LEEGSFDSVVQGCHGVFHTASPFYHDVKDPQVELLDPAVKGTLNVLKSCVNSPTLKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVAYNGKPRTP+VVVDETW++     +E KMWYVLSKTLAE+AAWKFV+E  I+M
Sbjct  127   TSSIAAVAYNGKPRTPDVVVDETWFTDPVLNREAKMWYVLSKTLAEEAAWKFVRENNIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQP LNTS+A++LN +NGA+T++NAS+GW+NVKDVANAHI A E  SA
Sbjct  187   VTINPAMVIGPLLQPVLNTSAASVLNFVNGAQTFANASFGWVNVKDVANAHIQAYEIASA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GR+C++ERV H+SE+VK L +LYPTL+LPEKCADDKP+VPTYQVSKEKAK+LG+ + PL
Sbjct  247   SGRHCLVERVVHHSEIVKILRELYPTLQLPEKCADDKPYVPTYQVSKEKAKSLGIEYIPL  306

Query  1129  EESLKETVESLKEKGF  1176
             E SLKETVESLKEK F
Sbjct  307   EVSLKETVESLKEKKF  322



>ref|XP_010908347.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Elaeis 
guineensis]
Length=324

 Score =   513 bits (1321),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 244/316 (77%), Positives = 278/316 (88%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY V+ATVR   DPKKT+HL +LEGA  RLHLFKA+L
Sbjct  6     KVVCVTGASGYIASWLVKLLLQRGYTVRATVRDLADPKKTEHLHALEGANGRLHLFKANL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GCEGVFHTASPFY NV DPQAELIDPAVKGTLNV  SC KTPSV+++VV
Sbjct  66    LEEGSFDSVVEGCEGVFHTASPFYENVIDPQAELIDPAVKGTLNVFSSCIKTPSVKRLVV  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV  NG+P TP+VVVDETW+S A++CK+ K WYVLSKTLAE+AAWKF K+  I+M
Sbjct  126   TSSMAAVIRNGRPLTPDVVVDETWFSNAEYCKQAKKWYVLSKTLAEEAAWKFSKDNSIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILNLING+ TY NAS+ W+NVKDVA AHILA E PSA
Sbjct  186   VTINPAMVIGPLLQPTLNTSAAAILNLINGSSTYPNASFVWVNVKDVAIAHILAFEVPSA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAHY+E+VK LH+ YP L+LPEKCADDKPFVP YQVSKEK K+LG+ + PL
Sbjct  246   SGRYCLVERVAHYAELVKILHEQYPALKLPEKCADDKPFVPIYQVSKEKVKSLGIDYIPL  305

Query  1129  EESLKETVESLKEKGF  1176
             E S+KETVESL+EKGF
Sbjct  306   ETSIKETVESLREKGF  321



>ref|NP_175552.2| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAY78648.1| putative cinnamyl-alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AEE32665.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=325

 Score =   511 bits (1317),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 235/316 (74%), Positives = 281/316 (89%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  7     KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAEL+DPAVKGT+NVL SC KT SV++VV+
Sbjct  67    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTPE +VDETW++  D+C+  K+WYVLSKTLAE+AAWKF KE  + +
Sbjct  127   TSSIAAVAFNGMPRTPETIVDETWFADPDYCRASKLWYVLSKTLAENAAWKFAKENNLQL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+INPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP A
Sbjct  187   VSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPDA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAHYSEVV  LH LYP  +LPEKCAD+K ++PTY+VSKEKA++LGV F PL
Sbjct  247   DGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIYIPTYKVSKEKAESLGVEFVPL  306

Query  1129  EESLKETVESLKEKGF  1176
             E S+KETVESL++KGF
Sbjct  307   EVSIKETVESLRDKGF  322



>ref|NP_197445.1| alcohol dehydrogenase-like protein [Arabidopsis thaliana]
 gb|ABD59060.1| At5g19440 [Arabidopsis thaliana]
 gb|AED92707.1| alcohol dehydrogenase-like protein [Arabidopsis thaliana]
Length=326

 Score =   511 bits (1316),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 238/316 (75%), Positives = 277/316 (88%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LE+GSFDS + GC GVFHTASPF+++  DPQAELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  68    LEQGSFDSAIDGCHGVFHTASPFFNDAKDPQAELIDPAVKGTLNVLNSCAKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV YNGKPRTP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+++
Sbjct  128   TSSMAAVGYNGKPRTPDVTVDETWFSDPELCEASKMWYVLSKTLAEDAAWKLAKEKGLDI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILNLINGA+T+ N S+GW+NVKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFPNLSFGWVNVKDVANAHIQAFEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERV H+SE+V  L +LYP L LPE+C D+ P+VPTYQVSK+K ++LG+ + PL
Sbjct  248   NGRYCLVERVVHHSEIVNILRELYPNLPLPERCVDENPYVPTYQVSKDKTRSLGIDYIPL  307

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLKEKGF
Sbjct  308   KVSIKETVESLKEKGF  323



>ref|XP_009107209.1| PREDICTED: cinnamoyl-CoA reductase 1 [Brassica rapa]
 emb|CDY65726.1| BnaAnng20950D [Brassica napus]
 emb|CDY03618.1| BnaC03g68770D [Brassica napus]
Length=325

 Score =   511 bits (1316),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 234/316 (74%), Positives = 281/316 (89%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  7     KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLQLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GC+GVFHTASPFYH+V DPQAEL+DPAVKGT+NVL +C KTPSV++VV+
Sbjct  67    LEEGSFDSAIDGCQGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSTCLKTPSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTP+ +VDETW++  D+C+  K+WYVLSKTLAE+AAWKF KE  + +
Sbjct  127   TSSIAAVAFNGMPRTPDTIVDETWFADPDYCRAAKLWYVLSKTLAENAAWKFAKENDMQL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+IN AMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP A
Sbjct  187   VSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPEA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  LH LYP  +LPEKCAD+K F+PTY+VSKEKA++LGV F PL
Sbjct  247   NGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIFIPTYKVSKEKAESLGVEFVPL  306

Query  1129  EESLKETVESLKEKGF  1176
             E S+KETVESL++KGF
Sbjct  307   EVSIKETVESLQDKGF  322



>ref|XP_010420747.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Camelina 
sativa]
Length=327

 Score =   511 bits (1316),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 243/317 (77%), Positives = 275/317 (87%), Gaps = 1/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GC+GVFHTASPFYH+V DPQ ELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  68    LVEGSFDSAIDGCQGVFHTASPFYHDVKDPQVELIDPAVKGTLNVLNSCAKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV  NGKPRTP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+ +
Sbjct  128   TSSMAAVTLNGKPRTPDVTVDETWFSTPELCEASKMWYVLSKTLAEDAAWKLAKEKGLEI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLIN-GAETYSNASYGWINVKDVANAHILALENPS  945
             VTINPAMVIGPLLQPTLNTS+AAILNLIN GA+T+ NAS+GW+NVKDVANAHI A E PS
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNLINAGAKTFPNASFGWVNVKDVANAHIQAFEVPS  247

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYCM+ERVAHYSE+V  LH+LYP + LPE+C D+ P   TYQVSKEK K+LG+ + P
Sbjct  248   ANGRYCMVERVAHYSELVSILHELYPNVPLPERCVDENPHASTYQVSKEKIKSLGIDYVP  307

Query  1126  LEESLKETVESLKEKGF  1176
             L+ S+KETVESLKEKGF
Sbjct  308   LKVSIKETVESLKEKGF  324



>ref|XP_010493007.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Camelina 
sativa]
Length=326

 Score =   510 bits (1314),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 242/316 (77%), Positives = 274/316 (87%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GC+GVFHTASPFY +V DPQ ELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  68    LVEGSFDSAIDGCQGVFHTASPFYIDVKDPQVELIDPAVKGTLNVLNSCAKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV YNGKP TP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+ +
Sbjct  128   TSSMAAVCYNGKPCTPDVTVDETWFSNPELCEASKMWYVLSKTLAEDAAWKLAKEKGLEI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILNLINGA+T+ NAS+GW+NVKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFPNASFGWVNVKDVANAHIQAFEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERV HYSEVV  LH+LYP + LPE+C D+ P  PTYQVSKEK K+LG+ + PL
Sbjct  248   NGRYCLVERVVHYSEVVSILHELYPNVPLPERCVDENPHAPTYQVSKEKIKSLGIDYVPL  307

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLKEKGF
Sbjct  308   QVSIKETVESLKEKGF  323



>ref|XP_006287932.1| hypothetical protein CARUB_v10001167mg [Capsella rubella]
 gb|EOA20830.1| hypothetical protein CARUB_v10001167mg [Capsella rubella]
Length=382

 Score =   512 bits (1319),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 242/316 (77%), Positives = 275/316 (87%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SL+GAKERLHLFKADL
Sbjct  64    KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLDGAKERLHLFKADL  123

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GCEGVFHTASPFYH+V DPQ ELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  124   LVEGSFDSAIDGCEGVFHTASPFYHDVKDPQVELIDPAVKGTLNVLNSCAKASSVKRVVV  183

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV  NGKPRTP+V VDETW+S    C+  KMWYVLSKTLAEDAAWK  KEKG+ +
Sbjct  184   TSSMAAVTLNGKPRTPDVTVDETWFSDPQLCEASKMWYVLSKTLAEDAAWKLAKEKGLEI  243

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILNLINGA+T+ N+S+GW+NVKDVANAHI A E PSA
Sbjct  244   VTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFPNSSFGWVNVKDVANAHIQAFEVPSA  303

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+E VAHYSE+V  LH+LYP + LPE+C D+ P+VPTYQVSKEK K+LG+ +  L
Sbjct  304   NGRYCMVESVAHYSELVNILHELYPNVPLPERCVDENPYVPTYQVSKEKIKSLGIDYISL  363

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLKEKGF
Sbjct  364   KVSIKETVESLKEKGF  379



>ref|XP_006393056.1| hypothetical protein EUTSA_v10011653mg [Eutrema salsugineum]
 gb|ESQ30342.1| hypothetical protein EUTSA_v10011653mg [Eutrema salsugineum]
Length=325

 Score =   510 bits (1313),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 234/317 (74%), Positives = 282/317 (89%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  7     KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GC+GVFHTASPFYH+V DPQAEL+DPAVKGT+NVL SC KT SV++VV+
Sbjct  67    LEEGSFDSAIDGCQGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSSCMKTSSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTPE +VDE+W++  ++C+  K+WYVLSKTLAE+AAWKF KE  I +
Sbjct  127   TSSIAAVAFNGVPRTPETIVDESWFADPEYCRASKLWYVLSKTLAENAAWKFAKENDIQL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+INPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP+A
Sbjct  187   VSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPTA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  LH LYP  +LPEKCAD+K ++PTY+VSKEKA++LGV F PL
Sbjct  247   NGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIYIPTYKVSKEKAESLGVDFVPL  306

Query  1129  EESLKETVESLKEKGFF  1179
             E S+KETVESL++KGF 
Sbjct  307   EVSIKETVESLRDKGFI  323



>ref|XP_010536092.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Tarenaya hassleriana]
Length=321

 Score =   509 bits (1312),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 237/316 (75%), Positives = 281/316 (89%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LL RGY VKA+VR P+DPKKT+HLLSLEGA ERLHLFKA+L
Sbjct  3     KVVCVTGASGYIASWVVKLLLLRGYTVKASVRDPNDPKKTEHLLSLEGASERLHLFKANL  62

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GC+GVFHTASPFY++V DPQAELIDPAVKGTLNVL SCAKT SV++VVV
Sbjct  63    LEEGSFDSAIDGCDGVFHTASPFYNDVKDPQAELIDPAVKGTLNVLNSCAKTSSVKRVVV  122

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV  NGKPRTP+V VDETW+S ++FC+  K+WYVLSKTLAE+AAWKF KEKGI+M
Sbjct  123   TSSMAAVVCNGKPRTPDVTVDETWFSDSEFCEASKLWYVLSKTLAEEAAWKFCKEKGIDM  182

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+A I NL+NG++T+ N++ GW+NVKDVAN+HILA ENPSA
Sbjct  183   VTINPAMVIGPLLQPTLNTSAAVIANLMNGSKTFPNSTLGWVNVKDVANSHILAFENPSA  242

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++E VAHYSE+V  L +LYP L+LPEKCAD+ P++PTYQVSKE+ K+LG+ +  L
Sbjct  243   DGRYCLVESVAHYSEIVNILRELYPNLQLPEKCADENPYMPTYQVSKERVKSLGIEYITL  302

Query  1129  EESLKETVESLKEKGF  1176
             + S+ ETVESLKEKGF
Sbjct  303   KVSINETVESLKEKGF  318



>gb|AAM65984.1| cinnamyl-alcohol dehydrogenase-like protein [Arabidopsis thaliana]
Length=326

 Score =   509 bits (1312),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 237/316 (75%), Positives = 276/316 (87%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LE+GSFDS + GC GVFHTASPF+++  DPQAELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  68    LEQGSFDSAIDGCHGVFHTASPFFNDAKDPQAELIDPAVKGTLNVLNSCAKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV YNGKPRTP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+++
Sbjct  128   TSSMAAVGYNGKPRTPDVTVDETWFSDPELCEASKMWYVLSKTLAEDAAWKLAKEKGLDI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILNLINGA+T+ N S+GW+NVKDVANAHI   E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFPNLSFGWVNVKDVANAHIQTFEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERV H+SE+V  L +LYP L LPE+C D+ P+VPTYQVSK+K ++LG+ + PL
Sbjct  248   NGRYCLVERVVHHSEIVNILRELYPNLPLPERCVDENPYVPTYQVSKDKTRSLGIDYIPL  307

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLKEKGF
Sbjct  308   KVSIKETVESLKEKGF  323



>ref|XP_010908348.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Elaeis 
guineensis]
Length=323

 Score =   509 bits (1311),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 244/316 (77%), Positives = 278/316 (88%), Gaps = 1/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY V+ATVR   DPKKT+HL +LEGA  RLHLFKA+L
Sbjct  6     KVVCVTGASGYIASWLVKLLLQRGYTVRATVRDLADPKKTEHLHALEGANGRLHLFKANL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GCEGVFHTASPFY NV DPQAELIDPAVKGTLNV  SC KTPSV+++VV
Sbjct  66    LEEGSFDSVVEGCEGVFHTASPFYENVIDPQAELIDPAVKGTLNVFSSCIKTPSVKRLVV  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV  NG+P TP+VVVDETW+S A++CK+ K WYVLSKTLAE+AAWKF K+  I+M
Sbjct  126   TSSMAAVIRNGRPLTPDVVVDETWFSNAEYCKQAK-WYVLSKTLAEEAAWKFSKDNSIDM  184

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILNLING+ TY NAS+ W+NVKDVA AHILA E PSA
Sbjct  185   VTINPAMVIGPLLQPTLNTSAAAILNLINGSSTYPNASFVWVNVKDVAIAHILAFEVPSA  244

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAHY+E+VK LH+ YP L+LPEKCADDKPFVP YQVSKEK K+LG+ + PL
Sbjct  245   SGRYCLVERVAHYAELVKILHEQYPALKLPEKCADDKPFVPIYQVSKEKVKSLGIDYIPL  304

Query  1129  EESLKETVESLKEKGF  1176
             E S+KETVESL+EKGF
Sbjct  305   ETSIKETVESLREKGF  320



>gb|AAY26021.2| cinnamyl alcohol dehydrogenase [Eucommia ulmoides]
Length=322

 Score =   509 bits (1310),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 236/322 (73%), Positives = 286/322 (89%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S A KTVCVTGASG+IASWIVKFLLQRGY V+ATVR P+DPKKT+HL +LEGA ERLHL
Sbjct  1     MSGAGKTVCVTGASGFIASWIVKFLLQRGYTVRATVRDPNDPKKTEHLRTLEGASERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLE+G+FD+VV G +GVFHTASPF++N  +PQ +LIDPAVKG++NVLGSCAK+PSV
Sbjct  61    FKAELLEDGAFDAVVDGTDGVFHTASPFFYNTDNPQKDLIDPAVKGSVNVLGSCAKSPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSS+AAVA N +P+ P+VVVDETW S  +FC + K+WYVLSKTLAE+AAWKF KE
Sbjct  121   KRVVLTSSVAAVAINSRPKNPDVVVDETWHSDVEFCTQRKLWYVLSKTLAEEAAWKFAKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KG+++VTINPAMVIGPLLQP+LNTS++AILN +NGA+TYSN+S GWI+V++VANAHI A 
Sbjct  181   KGLDLVTINPAMVIGPLLQPSLNTSASAILNFLNGAKTYSNSSMGWIDVRNVANAHIQAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSANGRYC++ERVAHYSE+V+ L   YPTL LPEKCADD PF PT+QVSKEKAK+LG+
Sbjct  241   EIPSANGRYCLVERVAHYSEIVQILRNHYPTLPLPEKCADDNPFQPTFQVSKEKAKSLGI  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              F PLE S+K+TVESLKEK FF
Sbjct  301   EFIPLEVSIKDTVESLKEKKFF  322



>emb|CDY43911.1| BnaA05g15210D [Brassica napus]
Length=325

 Score =   509 bits (1310),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 233/316 (74%), Positives = 281/316 (89%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGAKERL LFKA+L
Sbjct  7     KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAKERLQLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GC+GVFHTASPFYH+V DPQAEL+DPAVKGT+NVL +C KTPSV++VV+
Sbjct  67    LEEGSFDSAIDGCQGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSTCLKTPSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIA+VA+NG PRTPE +VDETW++   +C+  K+WYVLSKTLAE+AAWKF KE  + +
Sbjct  127   TSSIASVAFNGMPRTPETIVDETWFADPGYCRAAKLWYVLSKTLAENAAWKFAKENDLQL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+IN AMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP+A
Sbjct  187   VSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPTA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  LH LYP  +LPEKCAD+K ++PTY+VSKEKA++LGV F PL
Sbjct  247   NGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIYIPTYKVSKEKAESLGVEFVPL  306

Query  1129  EESLKETVESLKEKGF  1176
             E S+KETVESL++KGF
Sbjct  307   EVSIKETVESLQDKGF  322



>ref|XP_009144901.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Brassica 
rapa]
Length=325

 Score =   509 bits (1310),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 232/316 (73%), Positives = 282/316 (89%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGAKERL LFKA+L
Sbjct  7     KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAKERLQLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GC+GVFHTASPFYH+V DPQAEL+DPAVKGT+NVL +C KTPSV++VV+
Sbjct  67    LEEGSFDSAIDGCQGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSTCLKTPSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIA+VA+NG PRTPE +VDE+W++  ++C+  K+WYVLSKTLAE+AAWKF KE  + +
Sbjct  127   TSSIASVAFNGMPRTPETIVDESWFADPEYCRAAKLWYVLSKTLAENAAWKFAKENDLQL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+IN AMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP+A
Sbjct  187   VSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPTA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  LH LYP  +LPEKCAD+K ++PTY+VSKEKA++LGV F PL
Sbjct  247   NGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIYIPTYKVSKEKAESLGVEFVPL  306

Query  1129  EESLKETVESLKEKGF  1176
             E S+KETVESL++KGF
Sbjct  307   EVSIKETVESLQDKGF  322



>ref|XP_009114927.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Brassica rapa]
Length=325

 Score =   508 bits (1308),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 232/316 (73%), Positives = 281/316 (89%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  7     KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLQLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GC+GVFHTASPFYH+V DPQAEL+DPAVKGT+NVL +C KTPSV++VV+
Sbjct  67    LEEGSFDSAIDGCQGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSTCLKTPSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTP+ +VDE+W++  ++C+  K+WYVLSKTLAE+AAWKF KE  + +
Sbjct  127   TSSIAAVAFNGMPRTPDTIVDESWFADPEYCRAAKLWYVLSKTLAENAAWKFAKENDMQL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+IN AMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP A
Sbjct  187   VSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPDA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  LH LYP  +LPEKCAD+K F+PTY+VSKEKA++LGV F PL
Sbjct  247   NGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIFIPTYKVSKEKAESLGVEFVPL  306

Query  1129  EESLKETVESLKEKGF  1176
             E S+KETVESL++KGF
Sbjct  307   EVSIKETVESLQDKGF  322



>gb|KFK35854.1| hypothetical protein AALP_AA4G045500 [Arabis alpina]
Length=325

 Score =   507 bits (1306),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 232/316 (73%), Positives = 280/316 (89%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  7     KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GC+GVFHTASPFYH+V DPQAEL+DPAVKGT+NVL SC KT SV++VV+
Sbjct  67    LEEGSFDSAIDGCQGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTP+ +VDE+W++  D+C+  K+WYVLSKTLAE++AW F KE  + +
Sbjct  127   TSSIAAVAFNGMPRTPDTIVDESWFADPDYCRASKLWYVLSKTLAENSAWTFAKENDMQL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+INPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP A
Sbjct  187   VSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPDA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  LH LYP  +LPEKCAD+K F+PTY+VSKEKA++LGV F PL
Sbjct  247   NGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIFIPTYKVSKEKAESLGVEFVPL  306

Query  1129  EESLKETVESLKEKGF  1176
             E S+KETVESL++KGF
Sbjct  307   EVSIKETVESLRDKGF  322



>ref|XP_010493009.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=326

 Score =   507 bits (1306),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 239/316 (76%), Positives = 275/316 (87%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GCEGVFHTASPFYH+V DPQ ELIDPAVKGTLNVL SCAK+ S+++VVV
Sbjct  68    LVEGSFDSAIDGCEGVFHTASPFYHDVKDPQVELIDPAVKGTLNVLNSCAKSSSLKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV  NGKPRTP+V VDETW+S  + C+  KMWYVLSKTLAE+AAWK  KEKG+ +
Sbjct  128   TSSMAAVTLNGKPRTPDVTVDETWFSTPELCEASKMWYVLSKTLAEEAAWKLAKEKGLEI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAIL+LINGA+T+ N+S+GW+NVKDVANAHI A E  SA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILDLINGAKTFPNSSFGWVNVKDVANAHIQAFEVGSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+ERVAHYSE+V  LH+LYP + LPE+C D+ P   TYQVSKEK K+LG+ + PL
Sbjct  248   NGRYCMVERVAHYSELVSILHELYPNVPLPERCVDENPHASTYQVSKEKIKSLGIDYVPL  307

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLKEKGF
Sbjct  308   KVSIKETVESLKEKGF  323



>ref|XP_010045026.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
 gb|KCW87169.1| hypothetical protein EUGRSUZ_B03694 [Eucalyptus grandis]
Length=327

 Score =   507 bits (1305),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 233/314 (74%), Positives = 280/314 (89%), Gaps = 0/314 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             VCVTGASGYIASW+VK LLQRGY VKA+VR P+DPKK +HLL+L+GAK+RL LFKADLLE
Sbjct  11    VCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDPKKVEHLLALDGAKDRLRLFKADLLE  70

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EGSFD +V GC GVFHTASPFY++V DPQAEL+DPA+KGTLNVL SC+K PSV++VV+TS
Sbjct  71    EGSFDPIVEGCVGVFHTASPFYNDVRDPQAELLDPALKGTLNVLKSCSKAPSVKRVVLTS  130

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             S+ AVA+ G+P T +VVVDE W+S  +FC++ KMWY LSKTLAEDAAWKFVKEKGINMVT
Sbjct  131   SMGAVAFTGQPLTVDVVVDENWFSDPEFCRKRKMWYALSKTLAEDAAWKFVKEKGINMVT  190

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INP +VIGPLLQPTLNTS+AAI NL+NGA+T+ NAS   +NVKDVA+AH+LA ENPSA+G
Sbjct  191   INPGLVIGPLLQPTLNTSAAAIANLVNGAQTFPNASTRLVNVKDVADAHVLAFENPSASG  250

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             RYC++ERVAHYSE+V+ L +LYP+L+LPEKC DDKPF P+YQVSK+KA++LG+ + PLE+
Sbjct  251   RYCLVERVAHYSEIVRILRELYPSLQLPEKCTDDKPFAPSYQVSKDKARSLGLDYIPLEQ  310

Query  1135  SLKETVESLKEKGF  1176
             SLKETVESLKEKG 
Sbjct  311   SLKETVESLKEKGL  324



>ref|XP_010493006.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Camelina 
sativa]
Length=327

 Score =   506 bits (1304),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 242/317 (76%), Positives = 274/317 (86%), Gaps = 1/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GC+GVFHTASPFY +V DPQ ELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  68    LVEGSFDSAIDGCQGVFHTASPFYIDVKDPQVELIDPAVKGTLNVLNSCAKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV YNGKP TP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+ +
Sbjct  128   TSSMAAVCYNGKPCTPDVTVDETWFSNPELCEASKMWYVLSKTLAEDAAWKLAKEKGLEI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLIN-GAETYSNASYGWINVKDVANAHILALENPS  945
             VTINPAMVIGPLLQPTLNTS+AAILNLIN GA+T+ NAS+GW+NVKDVANAHI A E PS
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNLINAGAKTFPNASFGWVNVKDVANAHIQAFEVPS  247

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYC++ERV HYSEVV  LH+LYP + LPE+C D+ P  PTYQVSKEK K+LG+ + P
Sbjct  248   ANGRYCLVERVVHYSEVVSILHELYPNVPLPERCVDENPHAPTYQVSKEKIKSLGIDYVP  307

Query  1126  LEESLKETVESLKEKGF  1176
             L+ S+KETVESLKEKGF
Sbjct  308   LQVSIKETVESLKEKGF  324



>ref|XP_010461970.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=325

 Score =   506 bits (1303),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 232/317 (73%), Positives = 282/317 (89%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  7     KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAEL+DPAVKGT+NVL SC KT SV++VV+
Sbjct  67    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTPE +VDE+W++  ++C+  K+WYVLSKTLAE+AAWKF +E  + +
Sbjct  127   TSSIAAVAFNGMPRTPETIVDESWFADPEYCRASKLWYVLSKTLAENAAWKFAEENELQL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+INPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP+A
Sbjct  187   VSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPTA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  L+ LYP  +LPEKCAD+K ++PTY+VSKEKA++LGV F PL
Sbjct  247   NGRYCLVERVAHYSEVVNILNDLYPEFQLPEKCADEKIYIPTYKVSKEKAESLGVEFVPL  306

Query  1129  EESLKETVESLKEKGFF  1179
             E S+KETVESL++KGF 
Sbjct  307   EVSIKETVESLRDKGFI  323



>emb|CAJ43901.1| cinnamyl alcohol dehydrogenase [Quercus ilex]
Length=325

 Score =   506 bits (1303),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 240/320 (75%), Positives = 276/320 (86%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LL RGY VKA+VR P+DPKKT HL  L+GAKERLHLF
Sbjct  3     SGAGKIVCVTGASGYIASWLVKLLLNRGYTVKASVRDPNDPKKTNHLQVLDGAKERLHLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS V GC+GVFHTASP YHNVTDP+AEL++PAVKGTLNVL SCAK PSV+
Sbjct  63    KANLLEEGSFDSAVEGCDGVFHTASPLYHNVTDPEAELLEPAVKGTLNVLNSCAKFPSVK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             + VVTSS+AAV YN K +TP+VVVDETW+S  D CKE K WY+LSKTLAE+ AWKF KEK
Sbjct  123   RXVVTSSMAAVHYNKKAKTPDVVVDETWFSDPDLCKETKQWYMLSKTLAEENAWKFAKEK  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI++VTINPAMVIGP LQPTLNTS+AAILNLINGA+T+ N S+GW+NVKDVANAHI A E
Sbjct  183   GIDIVTINPAMVIGPXLQPTLNTSAAAILNLINGAQTFPNVSFGWVNVKDVANAHIQAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
              P+A+GRYC++E V H SEVV+ L KLYP+L+LPEKCADDKPF PTYQVSKE+ ++LG+ 
Sbjct  243   IPTASGRYCLVESVIHQSEVVRVLRKLYPSLQLPEKCADDKPFAPTYQVSKERTRSLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             + P E SLKETVESLKEK F
Sbjct  303   YIPFEVSLKETVESLKEKKF  322



>ref|XP_010493008.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=326

 Score =   506 bits (1302),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 241/316 (76%), Positives = 271/316 (86%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+V FLL RGY VKA+VR P DPKKT+HLLSLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVHFLLSRGYTVKASVRDPSDPKKTQHLLSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GC GVFHTASP Y +V DPQ ELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  68    LVEGSFDSAIDGCHGVFHTASPCYFDVKDPQVELIDPAVKGTLNVLNSCAKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV  NGKPRTP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+ +
Sbjct  128   TSSMAAVNCNGKPRTPDVTVDETWFSDPELCEASKMWYVLSKTLAEDAAWKLAKEKGLEI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+A ILNLINGA+T+ N S+GW+NVKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAATILNLINGAKTFPNVSFGWVNVKDVANAHIQAFEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+ERVAHYSE+V  LH+LYP + LPEKC D+ P+ PTYQVSKEK K+LG+ + PL
Sbjct  248   NGRYCMVERVAHYSEMVSILHELYPNVPLPEKCEDENPYAPTYQVSKEKIKSLGIDYVPL  307

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLKEKGF
Sbjct  308   KVSIKETVESLKEKGF  323



>ref|XP_006470635.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Citrus sinensis]
Length=328

 Score =   505 bits (1301),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 235/318 (74%), Positives = 276/318 (87%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASGYIASW+VK LL RGY VKA+VR P+DPKKT+HLL+L+GA ERL LFKA
Sbjct  8     AGKVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTRHLLALDGASERLQLFKA  67

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS+V GC+GV HTASPFYH+  DPQ EL+DPAVKGTLNVL SCAK PS+++V
Sbjct  68    NLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELLDPAVKGTLNVLNSCAKFPSIKRV  127

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAV   GKPRTP+VVVDETW+S  + CK+ ++WY LSKTLAEDAAWKF KEK I
Sbjct  128   VLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSELWYPLSKTLAEDAAWKFAKEKSI  187

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             ++VTINPAMVIGPLLQPTLNTS+AA+L+LI GA+TY N ++GW+NVKDVANAHI A E P
Sbjct  188   DLVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTYPNVTFGWVNVKDVANAHIQAFEVP  247

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SANGRYC++ERV+HYSE+V  + +LYP  +LPEKCADDKP VPTYQV KEK KNLG+ F 
Sbjct  248   SANGRYCLVERVSHYSEIVNIIRELYPAFQLPEKCADDKPHVPTYQVLKEKVKNLGIEFI  307

Query  1123  PLEESLKETVESLKEKGF  1176
             P+E SLKET+ESLKEKGF
Sbjct  308   PVEVSLKETIESLKEKGF  325



>ref|XP_010500717.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=333

 Score =   505 bits (1301),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 232/317 (73%), Positives = 281/317 (89%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  15    KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPSDPRKTEHLLALEGAEERLKLFKANL  74

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAEL+DPAVKGT+NVL SC KT SV++VV+
Sbjct  75    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVVL  134

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTPE +VDE+W++  ++C+  K+WYVLSKTLAE+AAWKF +E  + +
Sbjct  135   TSSIAAVAFNGMPRTPETIVDESWFADPEYCRASKLWYVLSKTLAENAAWKFAEENELQL  194

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+INPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP+A
Sbjct  195   VSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPTA  254

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  L+ LYP  +LPEKCAD+K ++PTY+VSKEKA++LGV F PL
Sbjct  255   NGRYCLVERVAHYSEVVNILNDLYPEFQLPEKCADEKIYIPTYKVSKEKAESLGVEFVPL  314

Query  1129  EESLKETVESLKEKGFF  1179
             E S+KETVESL++KGF 
Sbjct  315   EVSIKETVESLRDKGFI  331



>ref|XP_006306213.1| hypothetical protein CARUB_v10011885mg [Capsella rubella]
 gb|EOA39111.1| hypothetical protein CARUB_v10011885mg [Capsella rubella]
Length=333

 Score =   505 bits (1300),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 232/317 (73%), Positives = 280/317 (88%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  15    KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANL  74

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAEL+DPAVKGT+NVL SC KT SV++VV+
Sbjct  75    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVVL  134

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTPE +VDE+W++  ++C+  K+WYVLSKTLAE+AAWKF +E  + +
Sbjct  135   TSSIAAVAFNGMPRTPETIVDESWFADPEYCRASKLWYVLSKTLAENAAWKFAEENDLQL  194

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+INPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP+A
Sbjct  195   VSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPTA  254

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  L  LYP   LPEKCAD+K ++PTY+VSKEKA++LGV F PL
Sbjct  255   NGRYCLVERVAHYSEVVNILQDLYPDFLLPEKCADEKIYIPTYKVSKEKAESLGVEFVPL  314

Query  1129  EESLKETVESLKEKGFF  1179
             E S+KETVESL++KGF 
Sbjct  315   EVSIKETVESLRDKGFI  331



>ref|XP_002891638.1| hypothetical protein ARALYDRAFT_314503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67897.1| hypothetical protein ARALYDRAFT_314503 [Arabidopsis lyrata subsp. 
lyrata]
Length=796

 Score =   521 bits (1343),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 236/317 (74%), Positives = 282/317 (89%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  478   KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANL  537

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAELIDPAVKGT+NVL SC KT SV++VV+
Sbjct  538   LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELIDPAVKGTINVLSSCLKTSSVKRVVL  597

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTPE +VDETW++  D+C+  K+WYVLSKTLAE+AAWKF KE  + +
Sbjct  598   TSSIAAVAFNGMPRTPETIVDETWFADPDYCRASKLWYVLSKTLAENAAWKFAKENDLQL  657

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+INPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP+A
Sbjct  658   VSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPTA  717

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAHYSEVV  LH LYP  +LPEKCAD+K ++PTY+VSKEKA++LGV F PL
Sbjct  718   DGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIYIPTYKVSKEKAESLGVEFVPL  777

Query  1129  EESLKETVESLKEKGFF  1179
             E S+KETVESL++KGF 
Sbjct  778   EVSIKETVESLRDKGFI  794



>ref|XP_007131546.1| hypothetical protein PHAVU_011G022300g [Phaseolus vulgaris]
 gb|ESW03540.1| hypothetical protein PHAVU_011G022300g [Phaseolus vulgaris]
Length=324

 Score =   504 bits (1298),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 236/321 (74%), Positives = 279/321 (87%), Gaps = 0/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S   K VCVTGASGYIASWIVKFLLQRGY V+ATVR P+D +K +HLL LEGA+ERLHL
Sbjct  1     MSSEGKLVCVTGASGYIASWIVKFLLQRGYTVRATVRNPNDHRKVEHLLKLEGAEERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
              KADLL E SFDSVV GC+GVFHTASPF++NV DPQAELIDPAV GTLNVL SC K+ SV
Sbjct  61    LKADLLSENSFDSVVEGCDGVFHTASPFFNNVKDPQAELIDPAVNGTLNVLKSCVKSSSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSS+AAVAYN +P++PEVVVDETW+S  D+C+E+KMWY+LSKTLAEDAAWKF KE
Sbjct  121   KRVVLTSSVAAVAYNERPKSPEVVVDETWFSNPDYCRELKMWYLLSKTLAEDAAWKFSKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               +++V++NPAMV+GPLLQ  LNTS++ ILNL+NG+ET+ N +YGWINVKDVANAHI A 
Sbjct  181   NNLDLVSVNPAMVVGPLLQAELNTSASTILNLVNGSETFPNDTYGWINVKDVANAHIQAY  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E  SA+GRYC++ERVAH+SEV K LH LYPT ++PEK ADDKP+VPT+QVSKEKAK+LGV
Sbjct  241   EIASASGRYCLVERVAHFSEVAKILHDLYPTYQIPEKSADDKPYVPTFQVSKEKAKSLGV  300

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              F PLE SLKETVESLKEK F
Sbjct  301   EFIPLEVSLKETVESLKEKNF  321



>ref|XP_006365632.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Solanum tuberosum]
Length=321

 Score =   504 bits (1298),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 236/315 (75%), Positives = 271/315 (86%), Gaps = 0/315 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             +CVTGASG+IASW+VK LL RGY VKA+VR P+DPKKT HL SL+GAKERLHLFKA LLE
Sbjct  7     LCVTGASGFIASWLVKLLLHRGYTVKASVRDPNDPKKTDHLTSLDGAKERLHLFKASLLE  66

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EGSFD+VV GCEGVFHTASP Y  V DPQAELIDPA+KGTLNVLGS AKTP+V++VV+TS
Sbjct  67    EGSFDAVVDGCEGVFHTASPCYFEVKDPQAELIDPALKGTLNVLGSVAKTPTVRRVVLTS  126

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             S AAV++NGKPRTPE V+DETWWS  DFC+E ++WY+LSKTLAEDAAWKFVKEK  +MVT
Sbjct  127   STAAVSFNGKPRTPETVIDETWWSDPDFCRESQLWYILSKTLAEDAAWKFVKEKAFDMVT  186

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INP MVIG LLQPTLNT+ AAIL L+NG+ETY N + GW+NVKDVA AHILA ENPSANG
Sbjct  187   INPTMVIGSLLQPTLNTTCAAILQLLNGSETYPNTTSGWVNVKDVALAHILAFENPSANG  246

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             RY M+E VAHYSE+ + L +LYPT++LPEKC DDKPF P YQ + EKAK LGV FTPL +
Sbjct  247   RYIMVESVAHYSELAQILRELYPTMKLPEKCVDDKPFPPKYQFNVEKAKTLGVEFTPLAK  306

Query  1135  SLKETVESLKEKGFF  1179
             S+KET ESLKEK F+
Sbjct  307   SIKETAESLKEKKFY  321



>emb|CDY22576.1| BnaC05g24140D [Brassica napus]
Length=325

 Score =   504 bits (1297),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 230/316 (73%), Positives = 279/316 (88%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA ERL LFKA+L
Sbjct  7     KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAAERLQLFKANL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GC+GVFHTASPFYH+V DPQAEL+DPAVKGT+NVL +C KTPSV++VV+
Sbjct  67    LEEGSFDSAIDGCQGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSTCLKTPSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTP+ +VDE+W++  ++C+  K+WYVLSKTLAE+AAWKF KE  + +
Sbjct  127   TSSIAAVAFNGMPRTPDTIVDESWFADPEYCRAAKLWYVLSKTLAENAAWKFAKENDMQL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+IN AMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP A
Sbjct  187   VSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPDA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  LH LYP  +LP+KC+D+K F+PTY+VSKEKA+ LGV F PL
Sbjct  247   NGRYCLVERVAHYSEVVNILHDLYPDFQLPQKCSDEKIFIPTYKVSKEKAEFLGVEFVPL  306

Query  1129  EESLKETVESLKEKGF  1176
             E S+KETVESL++KGF
Sbjct  307   EVSIKETVESLQDKGF  322



>ref|XP_010479624.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Camelina sativa]
Length=333

 Score =   504 bits (1298),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 230/317 (73%), Positives = 282/317 (89%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  15    KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANL  74

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAEL+DPAVKGT+NVL SC KT SV++VV+
Sbjct  75    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVVL  134

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTP+ +VDE+W++  ++C+  K+WYVLSKTLAE+AAWKF +E  + +
Sbjct  135   TSSIAAVAFNGMPRTPDTIVDESWFADPEYCRASKLWYVLSKTLAENAAWKFAEENDLQL  194

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+INPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP+A
Sbjct  195   VSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPTA  254

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++ERVAHYSEVV  L+ LYP  +LPE+CAD+K ++PTY+VSKEKA++LGV F PL
Sbjct  255   NGRYCLVERVAHYSEVVNILNDLYPEFQLPERCADEKIYIPTYKVSKEKAESLGVEFVPL  314

Query  1129  EESLKETVESLKEKGFF  1179
             E S+KETVESL++KGF 
Sbjct  315   EVSIKETVESLRDKGFI  331



>gb|ABV44810.1| cinnamyl alcohol dehydrogenase 1 [Eriobotrya japonica]
Length=305

 Score =   503 bits (1295),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 232/302 (77%), Positives = 274/302 (91%), Gaps = 0/302 (0%)
 Frame = +1

Query  271   WIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLEEGSFDSVVAGCE  450
             W+VK LLQRGY  KA++R P+DP KT+HL +L+ A++RL LFKA+LLEEGSFDS V GCE
Sbjct  1     WLVKLLLQRGYTAKASIRDPNDPTKTEHLHALDEAQDRLQLFKANLLEEGSFDSAVEGCE  60

Query  451   GVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTSSIAAVAYNGKPR  630
             GVFHTASPFYH+VTDP+AEL++PAVKGTLNVL SCAK+PS+++VV+TSSIAAVAYNGKPR
Sbjct  61    GVFHTASPFYHDVTDPKAELLEPAVKGTLNVLNSCAKSPSIKRVVLTSSIAAVAYNGKPR  120

Query  631   TPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVTINPAMVIGPLLQ  810
             TP+ V+DETW++  D CKE K+WYVLSKTLAEDAAWKFVKEKGI++VTINPAMVIGPLLQ
Sbjct  121   TPDAVIDETWFTDPDVCKESKLWYVLSKTLAEDAAWKFVKEKGIDLVTINPAMVIGPLLQ  180

Query  811   PTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANGRYCMIERVAHYS  990
             PTLNTS+AA+LN++ GA T+ NAS+GWINVKD ANAHI A E+P+A+GRYC++E VAH+S
Sbjct  181   PTLNTSAAAVLNVVKGARTFPNASFGWINVKDAANAHIQAFESPTASGRYCLVETVAHFS  240

Query  991   EVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEESLKETVESLKEK  1170
             EVV+ L +LYPTL+LPEKCADDKPFVPTYQVSKEKAKNLGV F PL+ SLKETVESLKEK
Sbjct  241   EVVRILRELYPTLQLPEKCADDKPFVPTYQVSKEKAKNLGVEFIPLDVSLKETVESLKEK  300

Query  1171  GF  1176
             GF
Sbjct  301   GF  302



>ref|XP_003598007.1| CCP [Medicago truncatula]
 gb|AES68258.1| cinnamyl-alcohol dehydrogenase-like protein [Medicago truncatula]
Length=322

 Score =   503 bits (1296),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 235/319 (74%), Positives = 277/319 (87%), Gaps = 0/319 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M    VCVTGASGYIASW+V++LL RGY VKATVR P DPKK  HL+ LEGAKERL LFK
Sbjct  1     MNSNVVCVTGASGYIASWLVRYLLHRGYTVKATVRDPSDPKKINHLVKLEGAKERLQLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLE+G+FDS V GC GVFHTASPFYH+V DPQAELIDPA+ GTLNVL SCAK+P +++
Sbjct  61    ANLLEQGAFDSAVQGCHGVFHTASPFYHHVKDPQAELIDPALNGTLNVLKSCAKSPLLKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS AAVAYN KPRTP+VVVDETW++ ADFC ++ +WY +SKTLAE+AAWKFVKE  
Sbjct  121   VVLTSSAAAVAYNEKPRTPDVVVDETWFTDADFCAKLNLWYAVSKTLAEEAAWKFVKENN  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I+MVTINPAMVIGPLLQP LNTS+AAILNLING +T+ N++ GW+ VKDVANAHILA EN
Sbjct  181   IDMVTINPAMVIGPLLQPVLNTSAAAILNLINGTQTFPNSTLGWVYVKDVANAHILAYEN  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
              SA+GR+C++E VAHYSE+VK L +LYP+L+LPEKCADDKP+VPTYQ SKEKA +LG+ +
Sbjct  241   ASASGRHCLVESVAHYSEIVKILRELYPSLQLPEKCADDKPYVPTYQFSKEKATSLGIEY  300

Query  1120  TPLEESLKETVESLKEKGF  1176
             TPLE S+KETVESLKEK F
Sbjct  301   TPLEVSIKETVESLKEKKF  319



>gb|ADD23217.1| cinnamyl alcohol dehydrogenase [Cistanche deserticola]
Length=324

 Score =   503 bits (1295),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 240/323 (74%), Positives = 274/323 (85%), Gaps = 0/323 (0%)
 Frame = +1

Query  226   MKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKAD  405
             MKTVCVTGASG+IASWIVKFLLQ+GY VKA+VR P+DPKKT+HL +L GA ERLHL KAD
Sbjct  1     MKTVCVTGASGFIASWIVKFLLQKGYTVKASVRDPNDPKKTEHLTALAGANERLHLIKAD  60

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LLEEGSFDSVV GCEGVFH ASPFYH V DPQAELIDPA+KGTLNVL S AK PSV++VV
Sbjct  61    LLEEGSFDSVVDGCEGVFHIASPFYHAVKDPQAELIDPALKGTLNVLASVAKAPSVKRVV  120

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +TSSIA+VAYN  PR PE V+DETWWS  D+CK++K WYVLSKT+AE+AAWKFV+EKGI 
Sbjct  121   LTSSIASVAYNETPRGPETVIDETWWSDPDWCKQVKKWYVLSKTVAEEAAWKFVEEKGIE  180

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             MVTI P MVIGPLLQPTLNTS  AILNL+NGA  Y N++YGW+NVKDVA AHILA ENPS
Sbjct  181   MVTICPPMVIGPLLQPTLNTSCEAILNLVNGAAAYPNSTYGWVNVKDVAMAHILAFENPS  240

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRY M+ERVAHYSE+V  + +LYP L +P KCADDKPF   Y VSKE+AK+LG+ F P
Sbjct  241   ANGRYLMVERVAHYSEIVDIMSRLYPDLPIPHKCADDKPFATKYLVSKERAKSLGIDFIP  300

Query  1126  LEESLKETVESLKEKGFFVPSAA  1194
             +++ LKETVESLKEK    P+ A
Sbjct  301   VDKGLKETVESLKEKNLVKPAPA  323



>ref|XP_010102364.1| hypothetical protein L484_015313 [Morus notabilis]
 gb|EXB93325.1| hypothetical protein L484_015313 [Morus notabilis]
Length=328

 Score =   503 bits (1295),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 239/321 (74%), Positives = 279/321 (87%), Gaps = 0/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             ++ A K VCVTGASGYIASW+VKFLLQRGY VKA VR  +D KKT HL SL+GAKERL L
Sbjct  5     VTGAGKVVCVTGASGYIASWLVKFLLQRGYTVKAFVRDLNDRKKTAHLTSLDGAKERLQL  64

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEG+FDS V G EGVFHTASPF ++V DPQAEL+DPA+KGTLNVL +CAK+PSV
Sbjct  65    FKADLLEEGAFDSAVEGSEGVFHTASPFSNDVKDPQAELLDPAIKGTLNVLNACAKSPSV  124

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSIAAV Y GKPRTP+V VDETW+S  D CKE+K+WYVLSKTLAEDAAWKFVK+
Sbjct  125   KRVVLTSSIAAVVYTGKPRTPDVTVDETWFSIPDICKELKLWYVLSKTLAEDAAWKFVKQ  184

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI+MVTINPAMVIGPLLQPTLN SSA I NLINGA+T+ N + GW+NVKDVANAHILA 
Sbjct  185   KGIDMVTINPAMVIGPLLQPTLNASSAVISNLINGAQTFPNFTVGWVNVKDVANAHILAY  244

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRY ++E V+HYSE+V+ L +LYP+  LP++CADDKPF+PTYQVSK KAK+LG+
Sbjct  245   EVPSASGRYVLVESVSHYSEIVRILRELYPSAPLPDRCADDKPFMPTYQVSKGKAKSLGI  304

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              + PL+ SLKETVESLKEK F
Sbjct  305   DYIPLKTSLKETVESLKEKQF  325



>ref|XP_007015093.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
3 [Theobroma cacao]
 gb|EOY32712.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
3 [Theobroma cacao]
Length=316

 Score =   501 bits (1291),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 240/316 (76%), Positives = 279/316 (88%), Gaps = 9/316 (3%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIAS +VK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ RL LFKA L
Sbjct  7     KTVCVTGASGYIASCLVKLLLLRGYTVKASVRDPNDPRKTQHLLALEGAEGRLKLFKATL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEE S+D+VV GCEGVFHTASPFYH+VTDPQAEL+DPAVKGTLNVL SCAKT SV++VV+
Sbjct  67    LEEDSYDAVVEGCEGVFHTASPFYHDVTDPQAELLDPAVKGTLNVLNSCAKTSSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+VVVDETW++  D+CK +K+WYV+SKT+AEDAAWKF KEKGI+M
Sbjct  127   TSSMAAVAYNGKPRTPDVVVDETWFTDPDYCKGLKLWYVVSKTMAEDAAWKFAKEKGIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V INPAMVIGPLLQPTLNTS+AA+L+LI GAET+ NA++GW+NVKDVANAHI A E PSA
Sbjct  187   VAINPAMVIGPLLQPTLNTSAAAVLSLIKGAETFPNATFGWVNVKDVANAHIQAFEIPSA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAHYSE+VK L +L         CADDKP+VPTYQVSKEKAK LG+ F PL
Sbjct  247   SGRYCLVERVAHYSEIVKVLQEL---------CADDKPYVPTYQVSKEKAKCLGIDFIPL  297

Query  1129  EESLKETVESLKEKGF  1176
             + SLKETVESLKEKGF
Sbjct  298   DVSLKETVESLKEKGF  313



>gb|AAG52618.1|AC024261_5 cinnamyl alcohol dehydrogenase, putative; 82967-79323 [Arabidopsis 
thaliana]
Length=809

 Score =   519 bits (1336),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 235/317 (74%), Positives = 281/317 (89%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASWIVK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ERL LFKA+L
Sbjct  491   KTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPRKTEHLLALEGAEERLKLFKANL  550

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAEL+DPAVKGT+NVL SC KT SV++VV+
Sbjct  551   LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELLDPAVKGTINVLSSCLKTSSVKRVVL  610

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVA+NG PRTPE +VDETW++  D+C+  K+WYVLSKTLAE+AAWKF KE  + +
Sbjct  611   TSSIAAVAFNGMPRTPETIVDETWFADPDYCRASKLWYVLSKTLAENAAWKFAKENNLQL  670

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V+INPAMVIGPLLQPTLNTS+AA+L+LI GA+T+ NA++GW+NVKDVANAHI A ENP A
Sbjct  671   VSINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTFPNATFGWVNVKDVANAHIQAFENPDA  730

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAHYSEVV  LH LYP  +LPEKCAD+K ++PTY+VSKEKA++LGV F PL
Sbjct  731   DGRYCLVERVAHYSEVVNILHDLYPDFQLPEKCADEKIYIPTYKVSKEKAESLGVEFVPL  790

Query  1129  EESLKETVESLKEKGFF  1179
             E S+KETVESL++KGF 
Sbjct  791   EVSIKETVESLRDKGFI  807



>ref|XP_010493011.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Camelina 
sativa]
Length=326

 Score =   501 bits (1291),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 238/316 (75%), Positives = 273/316 (86%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GC GVFHTASP Y +V DPQ ELIDPAVKGTLNVL SCAK  S+++VVV
Sbjct  68    LVEGSFDSAIDGCHGVFHTASPCYTDVKDPQVELIDPAVKGTLNVLNSCAKASSIKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV YNGKP TP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+ +
Sbjct  128   TSSMAAVNYNGKPCTPDVTVDETWFSDPEHCEASKMWYVLSKTLAEDAAWKLAKEKGLEI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILNLINGA+T+ N S+GW+ VKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFPNVSFGWVYVKDVANAHIQAFEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+ERVAH+S+VV  LH+LYP + LPE+C D+ P++PTYQVSKEK K+LG+ + PL
Sbjct  248   NGRYCMVERVAHFSDVVSILHELYPNVPLPERCVDENPYMPTYQVSKEKIKSLGIDYIPL  307

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLKEKGF
Sbjct  308   KVSIKETVESLKEKGF  323



>ref|XP_008449700.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cucumis melo]
Length=325

 Score =   501 bits (1290),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 281/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             +A KTVCVTG SGYIASWIVKFLLQRGY V+A+VR PDDP KT HL++L+GA ERLHLFK
Sbjct  4     LAAKTVCVTGGSGYIASWIVKFLLQRGYTVRASVRDPDDPIKTAHLVALDGADERLHLFK  63

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLEEGSFDS + GC+GVFHTASPF+H+V+DPQAELI+PA+KGTLNVL S AK  SV++
Sbjct  64    ANLLEEGSFDSAIEGCQGVFHTASPFFHSVSDPQAELIEPALKGTLNVLNSVAKASSVKR  123

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAV+YN KP+TP+ +VDE+W+S  D C++ ++WY LSKTLAE+AAW FVKEKG
Sbjct  124   VVLTSSMAAVSYNTKPQTPQTIVDESWFSDPDMCRDQEIWYSLSKTLAEEAAWNFVKEKG  183

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I++VTINPAMVIGPLLQPTLNTS+ AILNLI+G ET+ N+++GW+NVKDVANAHI A E 
Sbjct  184   IDLVTINPAMVIGPLLQPTLNTSAQAILNLISGGETFPNSAFGWVNVKDVANAHIEAYEI  243

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             P+ANGRYC++ER  HYSE+VK LH+LYP+++LP+K AD+K FV  YQVS EKAK+LG+ F
Sbjct  244   PTANGRYCLVERALHYSEMVKILHQLYPSIQLPQKAADEKLFVLAYQVSTEKAKSLGIDF  303

Query  1120  TPLEESLKETVESLKEKGF  1176
              PLE+SLKETVESLKEK F
Sbjct  304   IPLEDSLKETVESLKEKNF  322



>ref|XP_010673676.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=324

 Score =   499 bits (1285),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 234/316 (74%), Positives = 274/316 (87%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIASW+VK LLQRGY VKATVR P+DPKK +HL SL+GA++RLHL  A+L
Sbjct  6     KTVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKVEHLRSLDGAEDRLHLVPANL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFD  V GCEGVFHTASPFYH+V DPQAEL+DPAVKGTLNVL +CAK PS+++VV+
Sbjct  66    LAEGSFDDAVEGCEGVFHTASPFYHDVKDPQAELLDPAVKGTLNVLSACAKVPSIKRVVL  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTPEVVVDE+W++  +  +E +MWYVLSKTLAE+AAW FVKEKGI+M
Sbjct  126   TSSMAAVAYNGKPRTPEVVVDESWFTDPNLARESQMWYVLSKTLAEEAAWNFVKEKGIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAI  L+NG+E+Y N + GW++VKDVA AHILA E PSA
Sbjct  186   VTINPAMVIGPLLQPTLNTSAAAIAKLLNGSESYGNVALGWVHVKDVAMAHILAFEVPSA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
              GRYC++E VAHY++V K L +LYP   LPEKCADDKPFVP YQVSKEK ++LG+ + PL
Sbjct  246   KGRYCLVESVAHYADVAKILKELYPNAPLPEKCADDKPFVPVYQVSKEKTQSLGIDYIPL  305

Query  1129  EESLKETVESLKEKGF  1176
             + SLKET ESLKEKGF
Sbjct  306   KTSLKETGESLKEKGF  321



>gb|KHN20640.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=325

 Score =   499 bits (1284),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 232/320 (73%), Positives = 276/320 (86%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGA+GYIASWIVKFLL+RGY V+ATVR P+D  K +HLL LEGAKERLHLF
Sbjct  3     SSAGKLVCVTGAAGYIASWIVKFLLERGYTVRATVRNPNDHTKVEHLLKLEGAKERLHLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KADLL E SFDS+V GC+GVFHTASPF  NV DPQA+L+DPAVKGTLNVL SC K+PSV+
Sbjct  63    KADLLGENSFDSIVEGCDGVFHTASPFIINVKDPQADLLDPAVKGTLNVLKSCVKSPSVK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +V++TSS+AAVAYN +P++PEVVVDETWWS  D+C+E+K+WY+LSKTLAEDAAWKF KE 
Sbjct  123   RVILTSSVAAVAYNKRPKSPEVVVDETWWSDPDYCRELKLWYLLSKTLAEDAAWKFAKEN  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              +++V +NPAMV+GPLLQ  LNTS+A ILNLING+ET+SN +YGWINVKDVANAHI A E
Sbjct  183   DLDLVVVNPAMVVGPLLQAELNTSAAIILNLINGSETFSNDTYGWINVKDVANAHIQAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
               SA+GRYC++ERVAHYSE+ + L   YPT ++PEK ADDKP+VPT+QVSKEKAK LG+ 
Sbjct  243   IASASGRYCLVERVAHYSELARILRDQYPTYQIPEKSADDKPYVPTFQVSKEKAKTLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE SL+ETVE+LKEK F
Sbjct  303   FIPLEVSLRETVETLKEKNF  322



>ref|NP_001242322.1| uncharacterized protein LOC100809326 [Glycine max]
 gb|ACU21505.1| unknown [Glycine max]
Length=325

 Score =   499 bits (1284),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 232/320 (73%), Positives = 276/320 (86%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGA+GYIASWIVKFLL+RGY V+ATVR P+D  K +HLL LEGAKERLHLF
Sbjct  3     SSAGKLVCVTGAAGYIASWIVKFLLERGYTVRATVRNPNDHTKVEHLLKLEGAKERLHLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KADLL E SFDS+V GC+GVFHTASPF  NV DPQA+L+DPAVKGTLNVL SC K+PSV+
Sbjct  63    KADLLGENSFDSIVEGCDGVFHTASPFIINVKDPQADLLDPAVKGTLNVLKSCVKSPSVK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +V++TSS+AAVAYN +P++PEVVVDETWWS  D+C+E+K+WY+LSKTLAEDAAWKF KE 
Sbjct  123   RVILTSSVAAVAYNKRPKSPEVVVDETWWSDPDYCRELKLWYLLSKTLAEDAAWKFAKEN  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              +++V +NPAMV+GPLLQ  LNTS+A ILNLING+ET+SN +YGWINVKDVANAHI A E
Sbjct  183   DLDLVVVNPAMVVGPLLQAELNTSAAIILNLINGSETFSNDTYGWINVKDVANAHIQAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
               SA+GRYC++ERVAHYSE+ + L   YPT ++PEK ADDKP+VPT+QVSKEKAK LG+ 
Sbjct  243   IASASGRYCLVERVAHYSELARILRDRYPTYQIPEKSADDKPYVPTFQVSKEKAKTLGIE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE SL+ETVE+LKEK F
Sbjct  303   FIPLEVSLRETVETLKEKNF  322



>ref|XP_010493010.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Camelina 
sativa]
Length=327

 Score =   497 bits (1280),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 238/317 (75%), Positives = 273/317 (86%), Gaps = 1/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GC GVFHTASP Y +V DPQ ELIDPAVKGTLNVL SCAK  S+++VVV
Sbjct  68    LVEGSFDSAIDGCHGVFHTASPCYTDVKDPQVELIDPAVKGTLNVLNSCAKASSIKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV YNGKP TP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+ +
Sbjct  128   TSSMAAVNYNGKPCTPDVTVDETWFSDPEHCEASKMWYVLSKTLAEDAAWKLAKEKGLEI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLIN-GAETYSNASYGWINVKDVANAHILALENPS  945
             VTINPAMVIGPLLQPTLNTS+AAILNLIN GA+T+ N S+GW+ VKDVANAHI A E PS
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNLINAGAKTFPNVSFGWVYVKDVANAHIQAFEVPS  247

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYCM+ERVAH+S+VV  LH+LYP + LPE+C D+ P++PTYQVSKEK K+LG+ + P
Sbjct  248   ANGRYCMVERVAHFSDVVSILHELYPNVPLPERCVDENPYMPTYQVSKEKIKSLGIDYIP  307

Query  1126  LEESLKETVESLKEKGF  1176
             L+ S+KETVESLKEKGF
Sbjct  308   LKVSIKETVESLKEKGF  324



>ref|XP_009413954.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Musa acuminata subsp. 
malaccensis]
Length=376

 Score =   498 bits (1282),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 236/347 (68%), Positives = 287/347 (83%), Gaps = 1/347 (0%)
 Frame = +1

Query  136   YIYGRRRTLLNLRASEWrrkrarrrrISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKA  315
             ++ G RR+           +      +S   K VCVTGASG+IASW+VK LLQRGY V+A
Sbjct  28    HLNGPRRSFACSSTKTATGRARAVVTMSGGGKVVCVTGASGFIASWLVKLLLQRGYTVRA  87

Query  316   TVRYPDDPKKTKHLLSLEGAKERLHLFKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTD  495
             +VR P DPKKT+HL +LEGA ERL LFKA+LLEEGS+D+VV GC+GVFHTASPFYH VT+
Sbjct  88    SVRDPADPKKTQHLRALEGATERLLLFKANLLEEGSYDAVVEGCDGVFHTASPFYHAVTN  147

Query  496   PQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAAD  675
             PQAELI+PAVKGTLNVL SC K  SV+KVVVTSS+AAVAYN KPRTP+VVVDETW+S+ +
Sbjct  148   PQAELIEPAVKGTLNVLASC-KNSSVKKVVVTSSMAAVAYNSKPRTPDVVVDETWFSSPE  206

Query  676   FCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVTINPAMVIGPLLQPTLNTSSAAILNLIN  855
              C++ K WYVLSKTLAE+AAWKF KE GI++VTINP MV GPLLQ TLNTSSAAILNLIN
Sbjct  207   VCEQQKQWYVLSKTLAEEAAWKFSKENGIDIVTINPGMVTGPLLQSTLNTSSAAILNLIN  266

Query  856   GAETYSNASYGWINVKDVANAHILALENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRL  1035
             G+ T+ NA++GW+NV+DVA AH+LA E PSA+GRYC++ERV HYSE++K +H+LYP+ +L
Sbjct  267   GSSTFPNATFGWVNVQDVAMAHVLAFELPSASGRYCLVERVVHYSEILKIIHELYPSFQL  326

Query  1036  PEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEESLKETVESLKEKGF  1176
             P+KCADDKPFVP Y+VSKEK K+LG+ + PLE S+KET+ESLKEK F
Sbjct  327   PDKCADDKPFVPVYKVSKEKFKSLGLYYIPLETSIKETIESLKEKNF  373



>ref|XP_004156308.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Cucumis 
sativus]
Length=325

 Score =   495 bits (1274),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 228/320 (71%), Positives = 279/320 (87%), Gaps = 0/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             +A KTVCVTG SGYIASWIVKFLLQRGY V+A+VR PDD  KT HL++L+GA ERLHLFK
Sbjct  4     VAAKTVCVTGGSGYIASWIVKFLLQRGYTVRASVRDPDDSIKTAHLVALDGADERLHLFK  63

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLEEGSFDS + GC+GVFHTASPF+H+V+DPQAELI+PA+KGTLNVL S AK  SV++
Sbjct  64    ANLLEEGSFDSAIEGCQGVFHTASPFFHSVSDPQAELIEPALKGTLNVLNSVAKASSVKR  123

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAV+YN KP+TP+ +VDE+W+S  D C++ ++WY LSKTLAE+AAW FVKEKG
Sbjct  124   VVLTSSMAAVSYNTKPQTPQTIVDESWFSDPDMCRDQEIWYCLSKTLAEEAAWNFVKEKG  183

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I++VTINPAMVIGPLLQPTLNTS+ AILNLI+G ET+ N+++GW+NVKDVA AHI A E 
Sbjct  184   IDLVTINPAMVIGPLLQPTLNTSAQAILNLISGGETFPNSAFGWVNVKDVAKAHIEAYEI  243

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             P+ANGRYC++ER  HYSE+VK LH+LYP+++LP+K AD+K FV  YQVS EKAK+LG+ F
Sbjct  244   PTANGRYCLVERALHYSEIVKILHQLYPSIQLPQKAADEKLFVLAYQVSTEKAKSLGIDF  303

Query  1120  TPLEESLKETVESLKEKGFF  1179
              PLE+SLKETVESLKEK F 
Sbjct  304   IPLEDSLKETVESLKEKKFI  323



>ref|XP_002453729.1| hypothetical protein SORBIDRAFT_04g011550 [Sorghum bicolor]
 gb|EES06705.1| hypothetical protein SORBIDRAFT_04g011550 [Sorghum bicolor]
Length=334

 Score =   495 bits (1275),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 232/318 (73%), Positives = 271/318 (85%), Gaps = 1/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASGYIASWIV+ LL RGY V+ATVR   DPKKT HL +L+GAK+RLHLFKA
Sbjct  10    AGKVVCVTGASGYIASWIVRLLLDRGYTVRATVRDTADPKKTLHLTALDGAKDRLHLFKA  69

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
              LLEEGSFD+ V GC+ VFHTASPFYHNV DP+AEL+DPAVKGTLNVLGSC K  S+ KV
Sbjct  70    SLLEEGSFDAAVHGCDTVFHTASPFYHNVKDPKAELLDPAVKGTLNVLGSCKKA-SITKV  128

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAV+YN KPRTPEV VDETW++    C++ + WYVLSKTLAE AAWKF ++ G 
Sbjct  129   VITSSMAAVSYNEKPRTPEVTVDETWFTDPQICEKTQQWYVLSKTLAEQAAWKFSRDNGF  188

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
              +VTINPAMVIGPLLQPTLNTS+ AIL LING+ TY N+S+GW+NVKDVA AHILA E P
Sbjct  189   EIVTINPAMVIGPLLQPTLNTSAEAILKLINGSSTYPNSSFGWVNVKDVALAHILAYEIP  248

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SANGRYCM+ERV HYSE+VK + K+YPT+RLP+KCADDKPFVPTYQVSKEK +++G+   
Sbjct  249   SANGRYCMVERVVHYSELVKIIRKMYPTIRLPDKCADDKPFVPTYQVSKEKIRSIGIELI  308

Query  1123  PLEESLKETVESLKEKGF  1176
             P+E S+KET+ESLKEKGF
Sbjct  309   PVETSVKETIESLKEKGF  326



>gb|KFK26208.1| hypothetical protein AALP_AA8G216500 [Arabis alpina]
Length=327

 Score =   494 bits (1271),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 235/318 (74%), Positives = 275/318 (86%), Gaps = 1/318 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LL RGY VKA+VR P D KKT+HL+SLEGA ERLHLFKA+L
Sbjct  8     KVVCVTGASGYIASWLVKLLLIRGYTVKASVRDPSDQKKTQHLVSLEGASERLHLFKANL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAK-TPSVQKVV  585
             L+EGSFDS + GC  VFHTASPF+++V DPQ ELIDPAVKGTLNVL SCAK + SV++VV
Sbjct  68    LDEGSFDSAIDGCVAVFHTASPFFNDVKDPQVELIDPAVKGTLNVLNSCAKASSSVKRVV  127

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             VTSS+AAVA NGKP TP+V+VDETW+S  D CK  +MWYVLSKTLAEDAAWKF KEKG++
Sbjct  128   VTSSLAAVACNGKPLTPDVIVDETWFSDPDICKASQMWYVLSKTLAEDAAWKFAKEKGLD  187

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             +VTINPAMVIGPLLQPTLNTS+AAILNLINGA+T+ N+S+GW+ VKDVANAHI A E PS
Sbjct  188   IVTINPAMVIGPLLQPTLNTSAAAILNLINGAKTFPNSSFGWVYVKDVANAHIQAFEVPS  247

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYC++ERVAH+SEVV  L +LYP L LPE C D+ P+VP YQVSKEK ++LG+ + P
Sbjct  248   ANGRYCLVERVAHHSEVVNILRELYPNLELPEICVDENPYVPIYQVSKEKTQSLGIDYIP  307

Query  1126  LEESLKETVESLKEKGFF  1179
             L++S+KETVESLKEKGF 
Sbjct  308   LKDSIKETVESLKEKGFI  325



>ref|XP_008231479.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Prunus mume]
Length=322

 Score =   493 bits (1270),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 228/322 (71%), Positives = 277/322 (86%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S A K V VTGASGYIASW+VK LLQRGY VKA+VR P+D KKT+HLL+L+GAKERL L
Sbjct  1     MSGAEKVVSVTGASGYIASWVVKLLLQRGYTVKASVRDPNDKKKTEHLLALDGAKERLQL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSFDS+V G EGVFHTASPFYH+V+DPQAELIDPA+KGTLNVL SCAK PS+
Sbjct  61    FKADLLEEGSFDSIVEGSEGVFHTASPFYHDVSDPQAELIDPALKGTLNVLRSCAKVPSI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             +KVV+TSS+AAVA+NGKP  P+V++DE+W+S    C+++K+WY++SKTLAE+AAWKF KE
Sbjct  121   KKVVITSSMAAVAFNGKPLAPDVIIDESWFSDLAVCEKLKLWYMISKTLAEEAAWKFTKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
              GI+MV INP +VIGPLLQPTLNTS   +L L+NGAET+ N +Y W++V+DVANAHILA 
Sbjct  181   NGIDMVAINPGLVIGPLLQPTLNTSVEPVLKLVNGAETFPNITYRWVDVRDVANAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             EN SA+GRYC++ R+ H SEVVK L  L+P L++PEKCADDKPF PTYQVSKE+A+ LGV
Sbjct  241   ENASASGRYCLVGRITHCSEVVKLLRDLFPALKIPEKCADDKPFTPTYQVSKERAQALGV  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              FTPLE +L++TVESLKEK F 
Sbjct  301   KFTPLEVTLEDTVESLKEKNFL  322



>ref|XP_007218683.1| hypothetical protein PRUPE_ppa008707mg [Prunus persica]
 gb|EMJ19882.1| hypothetical protein PRUPE_ppa008707mg [Prunus persica]
Length=322

 Score =   493 bits (1269),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 277/322 (86%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S A K V VTGASGYIASW+VK LLQRGY VKA+VR P+D KKT+HLL+L+GAKERL L
Sbjct  1     MSGAEKVVSVTGASGYIASWVVKLLLQRGYTVKASVRDPNDKKKTEHLLALDGAKERLQL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSF+SVV G EGVFHTASPFYH+V+DPQAELIDPA+KGTLNVL SCAK PS+
Sbjct  61    FKADLLEEGSFNSVVEGSEGVFHTASPFYHDVSDPQAELIDPALKGTLNVLRSCAKVPSI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSS+AAVA+NGKP  P+V++DE+W+S    C+++K+WY++SKTLAEDAAWKF KE
Sbjct  121   KRVVITSSMAAVAFNGKPLAPDVIIDESWFSDLAVCEKLKLWYMISKTLAEDAAWKFTKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               I+MV INP +VIGPLLQPTLNTS   +L LINGAET+ N +Y W++V+DVANAHILA 
Sbjct  181   NRIDMVAINPGLVIGPLLQPTLNTSVEPVLKLINGAETFPNITYRWVDVRDVANAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             EN SA+GRYC++ R+AH SEVVK L  L+P L++PEKCADDKPF P YQVSKE+A+ LGV
Sbjct  241   ENASASGRYCLVGRIAHCSEVVKLLRGLFPALKIPEKCADDKPFTPIYQVSKERAQALGV  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              FTPLE +LK+TVESLKEK FF
Sbjct  301   KFTPLEVTLKDTVESLKEKNFF  322



>ref|XP_010454218.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Camelina 
sativa]
Length=326

 Score =   493 bits (1269),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 233/316 (74%), Positives = 271/316 (86%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+V FLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHL++ADL
Sbjct  8     KVVCVTGASGYIASWLVHFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLYEADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GC+GVFHTASP Y +V DPQAELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  68    LVEGSFDSAIDGCQGVFHTASPCYTDVKDPQAELIDPAVKGTLNVLNSCAKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV YNGK  TP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+++
Sbjct  128   TSSMAAVNYNGKLCTPDVTVDETWFSDPEHCEASKMWYVLSKTLAEDAAWKLAKEKGLDI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+A +LNLINGA+T+ N S+GW+ VKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAVVLNLINGAKTFPNVSFGWVYVKDVANAHIQAFEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+ERVAHYS++V  LH LYP + LPE C D+ P++PTYQVSKEK K+LG+ + PL
Sbjct  248   NGRYCMVERVAHYSDIVSILHDLYPNVPLPESCVDENPYIPTYQVSKEKIKSLGIDYIPL  307

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLK+KGF
Sbjct  308   KVSIKETVESLKKKGF  323



>ref|XP_010454220.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X3 [Camelina 
sativa]
Length=326

 Score =   493 bits (1269),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 232/316 (73%), Positives = 272/316 (86%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             + VCVTGASG+IASW+VKFLL RGY VKA+VR P DPKKT+HL+SLEGAKERLHL++ADL
Sbjct  8     RVVCVTGASGFIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLYEADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L EGSFDS + GC+GVFHTASP Y +V DPQAELIDPAVKGTLNVL SCAK  SV++VVV
Sbjct  68    LVEGSFDSAIDGCQGVFHTASPCYTDVKDPQAELIDPAVKGTLNVLNSCAKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV YNGK  TP+V VDETW+S  + C+  KMWYVLSKTLAEDAAWK  KEKG+++
Sbjct  128   TSSMAAVNYNGKLCTPDVTVDETWFSDPEHCEASKMWYVLSKTLAEDAAWKLAKEKGLDI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+A +LNLINGA+T+ N S+GW+ VKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAVVLNLINGAKTFPNVSFGWVYVKDVANAHIQAFEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYCM+ERVAHYS++V  LH LYP + LPE C D+ P++PTYQVSKEK K+LG+ + PL
Sbjct  248   NGRYCMVERVAHYSDIVSILHDLYPNVPLPESCVDENPYIPTYQVSKEKIKSLGIDYIPL  307

Query  1129  EESLKETVESLKEKGF  1176
             + S+KETVESLK+KGF
Sbjct  308   KVSIKETVESLKKKGF  323



>gb|AAQ88099.1| NADPH-dependent cinnamyl alcohol dehydrogenase [Quercus suber]
 emb|CAJ43900.1| cinnamyl alcohol dehydrogenase [Quercus suber]
Length=326

 Score =   493 bits (1268),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 235/320 (73%), Positives = 274/320 (86%), Gaps = 1/320 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASGYIASW+VK LL RGY VKA+VR P+D KKT HL  L+GAKERLHLFKA
Sbjct  5     AGKIVCVTGASGYIASWLVKLLLNRGYTVKASVRDPNDSKKTNHLQVLDGAKERLHLFKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS V GC+GVFHTASPFYHNVTDP+AEL++PAVKGTLNVL SCAK PSV++V
Sbjct  65    NLLEEGSFDSAVEGCDGVFHTASPFYHNVTDPEAELLEPAVKGTLNVLNSCAKFPSVKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             VVTSS+AAV  N K + P+VVVDETW+S  D CKE K WY+LSKTLAE+  WKF KEKGI
Sbjct  125   VVTSSMAAVHCNKKAKAPDVVVDETWFSDPDVCKETKQWYMLSKTLAEENVWKFAKEKGI  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGA-ETYSNASYGWINVKDVANAHILALEN  939
             ++VTINPAMVIGPLLQPTLNTS+AAILNLING  +T+ N ++GW+NVKDVANAHI A E 
Sbjct  185   DIVTINPAMVIGPLLQPTLNTSAAAILNLINGTHQTFPNVAFGWVNVKDVANAHIQAYEI  244

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             P+A+GRYC++E V H+SEVV+ L KLYP+++LPEKCADDKPF PTYQVSKE+ ++LG+ +
Sbjct  245   PTASGRYCLVESVIHHSEVVRVLRKLYPSVQLPEKCADDKPFAPTYQVSKERTRSLGIEY  304

Query  1120  TPLEESLKETVESLKEKGFF  1179
              P E SLKETVESLKEK F 
Sbjct  305   IPFEVSLKETVESLKEKKFI  324



>ref|XP_010102365.1| hypothetical protein L484_015314 [Morus notabilis]
 gb|EXB93326.1| hypothetical protein L484_015314 [Morus notabilis]
Length=328

 Score =   490 bits (1261),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 235/321 (73%), Positives = 283/321 (88%), Gaps = 0/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             ++ A K VCVTGASG+IASW+VKFLLQRGY VKA+VR P+D KKT HL SL+GAKERL L
Sbjct  5     VTGAGKVVCVTGASGFIASWLVKFLLQRGYTVKASVRDPNDAKKTAHLTSLDGAKERLKL  64

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSFDS + GC+GVFHTASPF+H+V DP+ EL++PA+KGTLNVL SC+K+ SV
Sbjct  65    FKADLLEEGSFDSAIEGCDGVFHTASPFFHDVKDPEVELLEPAIKGTLNVLSSCSKSKSV  124

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSIAAVAYNGKPRTP+VVVDETW++  +  +E K+WYVLSKTLAE+AAWKFVKE
Sbjct  125   KRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDPNIARESKLWYVLSKTLAEEAAWKFVKE  184

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             KGI++VTINPAMVIGPLLQPTLNTS++AIL+LINGA+T+ N S+GW++VKDVANAH+ A 
Sbjct  185   KGIDLVTINPAMVIGPLLQPTLNTSASAILDLINGAQTFPNLSFGWVHVKDVANAHVQAF  244

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRY ++ERV HYSEVV  L +LYP LRLPEK ADDKPF PT+QVSKEKAK+LG+
Sbjct  245   EVPSASGRYLLVERVCHYSEVVGILRELYPALRLPEKSADDKPFAPTFQVSKEKAKSLGI  304

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              + P++  LKETVESLKEK F
Sbjct  305   NYIPIQTGLKETVESLKEKQF  325



>ref|XP_002263014.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 ref|XP_010648113.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 emb|CBI32944.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   488 bits (1256),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 227/322 (70%), Positives = 273/322 (85%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S A K VCVTGASGYIASW+VK LLQRGY V A+VR PDDP KT+HLL+L+GAKERLHL
Sbjct  1     MSGAEKVVCVTGASGYIASWLVKLLLQRGYTVNASVRDPDDPTKTEHLLALDGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEG+FDS+V GCEGVFHTASPFYH V++PQ ELIDPAVKGTLNVL SCAK PS+
Sbjct  61    FKANLLEEGAFDSMVDGCEGVFHTASPFYHTVSNPQVELIDPAVKGTLNVLRSCAKVPSI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSS+AAVA+ G+  TP+VVVDETW+S    C+++K+WY+LSKTLAE+AAWKF KE
Sbjct  121   RRVVVTSSMAAVAFTGQTLTPDVVVDETWFSDPAVCEKLKLWYMLSKTLAEEAAWKFAKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               I++V INP +VIGPLLQPTLNTS   +L LING +T+ N +Y W++V+DVANAHI A 
Sbjct  181   NKIDLVAINPGLVIGPLLQPTLNTSVEPVLKLINGTQTFPNITYRWVDVRDVANAHIQAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSANGRYC++ RV H SEVVK LH+LYPT  LP+KCADDKPF PTYQVS+E+A++LG+
Sbjct  241   EVPSANGRYCLVSRVTHCSEVVKILHELYPTSNLPDKCADDKPFEPTYQVSQERARSLGI  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              F P+E S  +TVESLKEK FF
Sbjct  301   NFIPVEVSFNDTVESLKEKKFF  322



>ref|XP_008790948.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Phoenix 
dactylifera]
Length=330

 Score =   488 bits (1256),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 233/321 (73%), Positives = 272/321 (85%), Gaps = 1/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S + K VCVTGASGYIASW+VK LLQRGY V+ TVR   DPK+T+HL +LEGA ERL L
Sbjct  1     MSGSGKVVCVTGASGYIASWLVKLLLQRGYTVRGTVRDLADPKRTEHLRALEGANERLQL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFDSVV GCEGVFHTASP Y N TDPQAE IDPAVKGTLNV GSC KTPSV
Sbjct  61    FKANLLEEGSFDSVVEGCEGVFHTASPCYVNATDPQAEFIDPAVKGTLNVFGSCIKTPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSS+A V  NG+P+TP+VVVD TW+S+A+FC++ K+WY LSKTLAE+AAWK+ K+
Sbjct  121   KRVVVTSSMATVVCNGRPQTPDVVVDATWFSSAEFCEQEKLWYPLSKTLAEEAAWKYSKD  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               I+MVTI+P  VIGPLLQPTLN+SSA  LNLING+ TY N S+GW+NVKDVA AHILA 
Sbjct  181   NSIDMVTIHPGAVIGPLLQPTLNSSSALFLNLINGS-TYPNLSFGWVNVKDVAMAHILAF  239

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA GRYC++ERVAHYSE+VK L + YP L+LPEKCADDKPF P YQVSKEK K+LG+
Sbjct  240   EVPSARGRYCLVERVAHYSEIVKILREQYPALKLPEKCADDKPFPPIYQVSKEKEKSLGI  299

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              + P+E S+KETVESLKEKGF
Sbjct  300   DYIPIETSIKETVESLKEKGF  320



>ref|XP_010673675.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score =   488 bits (1257),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 234/331 (71%), Positives = 273/331 (82%), Gaps = 15/331 (5%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPD---------------DPKKTKHLLS  363
             KTVCVTGASGYIASW+VK LLQRGY VKATVR P                DPKK +HL S
Sbjct  6     KTVCVTGASGYIASWLVKLLLQRGYTVKATVRDPRNANRSVCKSLIVRGYDPKKVEHLRS  65

Query  364   LEGAKERLHLFKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNV  543
             L+GA++RLHL  A+LL EGSFD  V GCEGVFHTASPFYH+V DPQAEL+DPAVKGTLNV
Sbjct  66    LDGAEDRLHLVPANLLAEGSFDDAVEGCEGVFHTASPFYHDVKDPQAELLDPAVKGTLNV  125

Query  544   LGSCAKTPSVQKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLA  723
             L +CAK PS+++VV+TSS+AAVAYNGKPRTPEVVVDE+W++  +  +E +MWYVLSKTLA
Sbjct  126   LSACAKVPSIKRVVLTSSMAAVAYNGKPRTPEVVVDESWFTDPNLARESQMWYVLSKTLA  185

Query  724   EDAAWKFVKEKGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVK  903
             E+AAW FVKEKGI+MVTINPAMVIGPLLQPTLNTS+AAI  L+NG+E+Y N + GW++VK
Sbjct  186   EEAAWNFVKEKGIDMVTINPAMVIGPLLQPTLNTSAAAIAKLLNGSESYGNVALGWVHVK  245

Query  904   DVANAHILALENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQV  1083
             DVA AHILA E PSA GRYC++E VAHY++V K L +LYP   LPEKCADDKPFVP YQV
Sbjct  246   DVAMAHILAFEVPSAKGRYCLVESVAHYADVAKILKELYPNAPLPEKCADDKPFVPVYQV  305

Query  1084  SKEKAKNLGVVFTPLEESLKETVESLKEKGF  1176
             SKEK ++LG+ + PL+ SLKET ESLKEKGF
Sbjct  306   SKEKTQSLGIDYIPLKTSLKETGESLKEKGF  336



>gb|KHG07124.1| Dihydroflavonol-4-reductase [Gossypium arboreum]
Length=324

 Score =   486 bits (1252),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 272/322 (84%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S   K VCVTGASGYIASW+VKFLLQRGY VKATVR P DPKK++HLL L+GAKERL L
Sbjct  1     MSGTGKVVCVTGASGYIASWLVKFLLQRGYTVKATVRDPSDPKKSEHLLVLDGAKERLRL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA LL+EG+FDSVV GC GVFHTASPFYHN+ DPQAE++DPAVKGTLNVL SCAK PS+
Sbjct  61    FKAQLLDEGAFDSVVDGCVGVFHTASPFYHNIKDPQAEMLDPAVKGTLNVLRSCAKVPSI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSIAA+ YNG+P  P+VVVDETW+S   FC++ K+WY+LSKTLAE+AAWKF KE
Sbjct  121   KRVVITSSIAAIVYNGRPLGPDVVVDETWFSDPAFCEKSKLWYMLSKTLAEEAAWKFAKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
              GI+MVTINP +VIGPLLQPT+NTS   IL LINGA+T+ NA++  I+V+DVANAH+LA 
Sbjct  181   NGIDMVTINPGLVIGPLLQPTVNTSVEPILKLINGAKTFPNATFRLIDVRDVANAHVLAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             EN SA GRY ++ER  H SEVV+ L KLYP L LPEKCAD+K  VP +QVSKE+AK+LGV
Sbjct  241   ENSSACGRYLLVERAVHCSEVVQALRKLYPALSLPEKCADEKLSVPIFQVSKERAKSLGV  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              FTPLE SLK+TVESLKEK  F
Sbjct  301   KFTPLEVSLKDTVESLKEKNIF  322



>ref|XP_004987233.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Setaria italica]
Length=337

 Score =   487 bits (1253),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 238/326 (73%), Positives = 272/326 (83%), Gaps = 4/326 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASWIVK LL RGY V+ATVR   DPKKT HL  L+GAK+RLH FKA L
Sbjct  13    KVVCVTGASGYIASWIVKLLLARGYTVRATVRDTADPKKTLHLSVLDGAKDRLHFFKASL  72

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD+ V GCE VFHTASPFYHNV DP+AEL+DPAVKGTLNVLGSC K  S++KVVV
Sbjct  73    LEEGSFDAAVDGCETVFHTASPFYHNVKDPKAELLDPAVKGTLNVLGSCKKA-SIKKVVV  131

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIAAVAYNGKPRTPEV+VDETW+S    C++ + WYV+SKTLAE+AAWKF ++ G  +
Sbjct  132   TSSIAAVAYNGKPRTPEVIVDETWFSDPHICEKNQQWYVVSKTLAEEAAWKFSRDSGFEI  191

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILALENPS  945
             +TINPAMVIGPLLQPTLNTS+ AIL LING + TY N S+GW+NVKDVA AHILA E PS
Sbjct  192   ITINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFSFGWVNVKDVALAHILAYEVPS  251

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV--VF  1119
             ANGRYCM+ERV HYSEVV  + K+YPT+ LPEKCADDKPFVPTYQVSKEK ++LG+    
Sbjct  252   ANGRYCMVERVVHYSEVVNIIRKMYPTIPLPEKCADDKPFVPTYQVSKEKIRSLGIELKL  311

Query  1120  TPLEESLKETVESLKEKGFFVPSAAL  1197
              PLE S+KET+ESLKEK  FV ++ L
Sbjct  312   IPLETSIKETIESLKEKDLFVLTSNL  337



>ref|XP_010230911.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Brachypodium distachyon]
Length=329

 Score =   486 bits (1251),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 272/320 (85%), Gaps = 2/320 (1%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASGYIASW+VK LL RGY V+ATVR  DDPKKT HL +L+GAK+RLHLFKA
Sbjct  9     AGKAVCVTGASGYIASWLVKLLLARGYTVRATVRDTDDPKKTLHLHALDGAKDRLHLFKA  68

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
              LLEEGSFD+ +AG E VFHTASPFYHNV DP+AEL+DPAV+GTLNVL SC K  S+++V
Sbjct  69    SLLEEGSFDAAIAGSECVFHTASPFYHNVKDPKAELLDPAVEGTLNVLRSCKKA-SIKRV  127

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             VVTSS+AAVAYN KPRTP+VVVDETW+S  + C++ + WYVLSKTLAEDAAWKF K+ G 
Sbjct  128   VVTSSMAAVAYNEKPRTPDVVVDETWFSHPELCEKNQQWYVLSKTLAEDAAWKFSKDNGF  187

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILALEN  939
              MVTINPAMVIGPLLQPTLNTS+  IL LING + TY N S+GWINVKDVA AHILA E 
Sbjct  188   EMVTINPAMVIGPLLQPTLNTSAEVILKLINGSSSTYPNFSFGWINVKDVALAHILAYEV  247

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRYCM+ERVAH+SE++K +H+LYP L +P+KCADD PFVPTYQVSK+K ++LG+  
Sbjct  248   PSANGRYCMVERVAHHSEILKIIHELYPNLPVPDKCADDGPFVPTYQVSKDKIRSLGLQL  307

Query  1120  TPLEESLKETVESLKEKGFF  1179
              PLE S+KET+ESLKEKGF 
Sbjct  308   IPLETSIKETIESLKEKGFL  327



>ref|XP_008363305.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=324

 Score =   485 bits (1249),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 273/319 (86%), Gaps = 0/319 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K + VTGASGYIASW+VK LLQRGY VKA++R P+D KKT+HLL+L+GAKERL LFKA
Sbjct  6     ATKVMSVTGASGYIASWLVKLLLQRGYTVKASIRDPNDXKKTEHLLALDGAKERLQLFKA  65

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             DLLE+GSFDS+V G EGVFHTASPFYHNV+DPQAELIDPA+KGTLNVL SCAK PS+++V
Sbjct  66    DLLEDGSFDSLVEGSEGVFHTASPFYHNVSDPQAELIDPALKGTLNVLRSCAKVPSIKRV  125

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAVA+NGKP  P+VVVDE+W+S    C++ K+WY++SKTLAE+AAWKF KE GI
Sbjct  126   VITSSMAAVAFNGKPLAPDVVVDESWFSDVAVCEKSKLWYMISKTLAEEAAWKFAKENGI  185

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             ++VTINP +VIGPLLQPTLNTS   +L L+NGAE + N +Y W++V+DVA AHILA EN 
Sbjct  186   DIVTINPGLVIGPLLQPTLNTSVEPVLKLVNGAERFPNTTYRWVDVRDVATAHILAFENA  245

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SA+GRYC++ RV H S+ V  L  L+P L+LPE+CADDKPF PTYQVSKE+A++LGV FT
Sbjct  246   SASGRYCLVGRVIHCSDTVNILRDLFPALKLPEECADDKPFTPTYQVSKERAQSLGVKFT  305

Query  1123  PLEESLKETVESLKEKGFF  1179
             PLE +LK+TVESLKEK FF
Sbjct  306   PLEVTLKDTVESLKEKNFF  324



>ref|XP_010905793.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Elaeis guineensis]
Length=389

 Score =   488 bits (1256),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 230/321 (72%), Positives = 268/321 (83%), Gaps = 0/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S + K VCVTGASGYIASW+VK LLQRGY V+ATVR   DPKKTKHL +LEGA ERLHL
Sbjct  66    MSGSGKVVCVTGASGYIASWLVKLLLQRGYTVRATVRDLTDPKKTKHLRALEGANERLHL  125

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSF SV+ GCEGVFHTASPFY +  DPQ ELIDPAVKGTLNVL SC KTPSV
Sbjct  126   FKANLLEEGSFASVIEGCEGVFHTASPFYMHAADPQTELIDPAVKGTLNVLSSCVKTPSV  185

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSS+A V YNG+PRTP V+VDETW+S+ +FCK+ K+WY LSK LAE+AAWKF K+
Sbjct  186   RRVVVTSSMATVYYNGRPRTPNVIVDETWFSSVEFCKQEKLWYQLSKILAEEAAWKFSKD  245

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               I+MVTI+PA VIGPLLQPTLN S+A  L LING+ TY NASYG +NVKDVA AHILA 
Sbjct  246   NSIDMVTIHPAFVIGPLLQPTLNASAAVFLKLINGSSTYPNASYGLVNVKDVAMAHILAF  305

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRYC++E VAHYS++VK LH+ YP L+LPE CADDKP VP Y VS+EKAK+LG+
Sbjct  306   EVPSASGRYCLVESVAHYSDIVKILHEQYPALKLPEMCADDKPLVPIYHVSREKAKSLGI  365

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              +  LE S+ E V+SLKEKGF
Sbjct  366   DYILLETSIMEIVKSLKEKGF  386



>ref|XP_008349589.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=324

 Score =   485 bits (1249),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 273/319 (86%), Gaps = 0/319 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K + VTGASGYIASW+VK LLQRGY VKA++R P+D KKT+HLL+L+GAKERL LFKA
Sbjct  6     ATKVMSVTGASGYIASWLVKLLLQRGYTVKASIRDPNDKKKTEHLLALDGAKERLQLFKA  65

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             DLLE+GSFDS+V G EGVFHTASPFYHNV+DPQAELIDPA+KGTLNVL SCAK PS+++V
Sbjct  66    DLLEDGSFDSLVEGSEGVFHTASPFYHNVSDPQAELIDPALKGTLNVLRSCAKVPSIKRV  125

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAVA+NGKP  P+VVVDE+W+S    C++ K+WY++SKTLAE+AAWKF KE GI
Sbjct  126   VITSSMAAVAFNGKPLAPDVVVDESWFSDVAVCEKSKLWYMISKTLAEEAAWKFAKENGI  185

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             ++VTINP +VIGPLLQPTLNTS   +L L+NGAE + N +Y W++V+DVA AHILA EN 
Sbjct  186   DIVTINPGLVIGPLLQPTLNTSVEPVLKLVNGAERFPNTTYRWVDVRDVATAHILAFENA  245

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SA+GRYC++ RV H S+ V  L  L+P L+LPE+CADDKPF PTYQVSKE+A++LGV FT
Sbjct  246   SASGRYCLVGRVIHCSDTVNILRDLFPALKLPEECADDKPFTPTYQVSKERAQSLGVKFT  305

Query  1123  PLEESLKETVESLKEKGFF  1179
             PLE +LK+TVESLKEK FF
Sbjct  306   PLEVTLKDTVESLKEKNFF  324



>ref|XP_009354346.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Pyrus x 
bretschneideri]
Length=324

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 225/321 (70%), Positives = 271/321 (84%), Gaps = 0/321 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             + A K V VTGASGYIASW+VK LLQRGY VKA+VR P+D KKT HLL+L+GAKERL LF
Sbjct  4     TRATKVVSVTGASGYIASWLVKLLLQRGYTVKASVRDPNDKKKTAHLLALDGAKERLQLF  63

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KADLLEEGSFDS+V G EGVFHTASPFYHNV+DPQAELIDPA+KGTLNVL SCAK PS++
Sbjct  64    KADLLEEGSFDSLVEGSEGVFHTASPFYHNVSDPQAELIDPALKGTLNVLRSCAKVPSIK  123

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVA+NGKP  P+VVVDE+W+S    C++ K+WY++SKTLAE+AAWKF KE 
Sbjct  124   RVVITSSMAAVAFNGKPLAPDVVVDESWFSDVAVCEKSKLWYMISKTLAEEAAWKFAKEN  183

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI++ TINP +V GPLLQPTLNTS   +L L+NGAE + N +Y W++V+DVA AHILALE
Sbjct  184   GIDIATINPGLVTGPLLQPTLNTSVEPVLKLVNGAERFPNTTYRWVDVRDVATAHILALE  243

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             N SA+GRYC++ RV H S+ V  L  L+P L+LPE+CADDKPF PTYQVS E+A++LGV 
Sbjct  244   NASASGRYCLVGRVIHSSDTVNILRDLFPALKLPEECADDKPFTPTYQVSNERAQSLGVK  303

Query  1117  FTPLEESLKETVESLKEKGFF  1179
             FTPLE +LK+TVESLKEK FF
Sbjct  304   FTPLEVTLKDTVESLKEKNFF  324



>emb|CAJ43716.1| cinnamoyl alcohol dehydrogenase [Plantago major]
Length=317

 Score =   482 bits (1241),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 224/318 (70%), Positives = 271/318 (85%), Gaps = 1/318 (0%)
 Frame = +1

Query  226   MKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKAD  405
             MKTV VTG SGYIASWI+KFLLQRGY VKA+VRYPDDPKKT HLL+L+GAKERL L KAD
Sbjct  1     MKTVAVTGGSGYIASWIIKFLLQRGYTVKASVRYPDDPKKTSHLLALDGAKERLKLIKAD  60

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LL+EGSFD+V  GC+GVFHTASPF+    +P+ +L+ PA+KGTLNVL S AKTPSV++VV
Sbjct  61    LLDEGSFDAVFEGCDGVFHTASPFFLETENPEDDLLTPALKGTLNVLNSVAKTPSVKRVV  120

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +TSS AAV++NGKPRTPEVVVDETW+S   FC+E K+WYVLSKTLAE AAWKF KEKGI+
Sbjct  121   LTSSEAAVSFNGKPRTPEVVVDETWFSDEVFCRENKLWYVLSKTLAESAAWKFAKEKGID  180

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             ++++NPA+V+GPLLQPTLNTSSA +L+++ G+ETY+N S GW+NVKDVAN HILA E PS
Sbjct  181   LISMNPALVVGPLLQPTLNTSSAVVLDMLKGSETYANVSVGWVNVKDVANGHILAYETPS  240

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             A+GRY M+ERVAHYSE VK L  LYP ++LP KC  + PF+P YQVSK++ K+LG+  TP
Sbjct  241   ASGRYVMVERVAHYSEAVKILRDLYPDMKLPTKCQSE-PFLPIYQVSKDRIKSLGIELTP  299

Query  1126  LEESLKETVESLKEKGFF  1179
             LE S+KETV+SLKEK F 
Sbjct  300   LEVSIKETVDSLKEKNFI  317



>ref|XP_009354347.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Pyrus x 
bretschneideri]
Length=324

 Score =   482 bits (1240),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 224/321 (70%), Positives = 270/321 (84%), Gaps = 0/321 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             + A K V VTGASGYIASW+VK LLQRGY VKA+VR P+D KKT HLL+L+GAKERL LF
Sbjct  4     TRATKVVSVTGASGYIASWLVKLLLQRGYTVKASVRDPNDKKKTAHLLALDGAKERLQLF  63

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KADLLEEGSFDS+V G EGVFHTASPFYHNV+DPQAELIDPA+KGTLNVL SCAK PS++
Sbjct  64    KADLLEEGSFDSLVEGSEGVFHTASPFYHNVSDPQAELIDPALKGTLNVLRSCAKVPSIK  123

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVA+NGKP  P+VVVDE+W+S    C++ K+WY++SKTLAE+AAWKF KE 
Sbjct  124   RVVITSSMAAVAFNGKPLAPDVVVDESWFSDVAVCEKSKLWYMISKTLAEEAAWKFAKEN  183

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI++ TINP +V GPLLQPTLNTS   +L L+NGAE + N +Y W++V+DVA AHILALE
Sbjct  184   GIDIATINPGLVTGPLLQPTLNTSVEPVLKLVNGAERFPNTTYRWVDVRDVATAHILALE  243

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             N SA+GRYC++ RV H S+ V  L  L+P L+LPE+CADDKPF PTYQVSKE+A+ LGVV
Sbjct  244   NASASGRYCLVGRVIHSSDTVNILRDLFPALKLPEECADDKPFTPTYQVSKERAETLGVV  303

Query  1117  FTPLEESLKETVESLKEKGFF  1179
              TPLE +LK+ VESLK+K FF
Sbjct  304   CTPLEVTLKDAVESLKQKNFF  324



>gb|EAY74373.1| hypothetical protein OsI_02260 [Oryza sativa Indica Group]
Length=336

 Score =   482 bits (1240),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 229/317 (72%), Positives = 271/317 (85%), Gaps = 2/317 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+V+ LL RGY V+ATVR   DPKKT HL +L+GA ERLHLF+A+L
Sbjct  13    KLVCVTGASGYIASWLVRLLLARGYTVRATVRDTSDPKKTLHLRALDGANERLHLFEANL  72

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD+ V GC+ VFHTASPFYHNV DP+AEL+DPAVKGTLNVLGSC K  S+++V+V
Sbjct  73    LEEGSFDAAVNGCDCVFHTASPFYHNVKDPKAELLDPAVKGTLNVLGSCKKA-SIRRVIV  131

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+VVVDETW+S  + C++ + WYVLSKTLAE+AAWKF K+ G  +
Sbjct  132   TSSMAAVAYNGKPRTPDVVVDETWFSVPEICEKHQQWYVLSKTLAEEAAWKFSKDNGFEI  191

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILALENPS  945
             VT+NPAMVIGPLLQP+LNTS+ AIL LING + TY N S+GWINVKDVA AHILA E PS
Sbjct  192   VTVNPAMVIGPLLQPSLNTSAEAILKLINGSSSTYPNFSFGWINVKDVALAHILAYEVPS  251

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYCM+ERVAHYSE+V+ + ++YP + LP+KCADDKP VP YQVSKEK K+LG+  TP
Sbjct  252   ANGRYCMVERVAHYSELVQIIREMYPNIPLPDKCADDKPSVPIYQVSKEKIKSLGLELTP  311

Query  1126  LEESLKETVESLKEKGF  1176
             L  S+KET+ESLKEKGF
Sbjct  312   LHTSIKETIESLKEKGF  328



>ref|NP_001043234.1| Os01g0528800 [Oryza sativa Japonica Group]
 dbj|BAD73514.1| putative cinnamyl alcohol dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAF05148.1| Os01g0528800 [Oryza sativa Japonica Group]
 gb|EAZ12181.1| hypothetical protein OsJ_02064 [Oryza sativa Japonica Group]
 dbj|BAG91110.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86957.1| unnamed protein product [Oryza sativa Japonica Group]
Length=336

 Score =   481 bits (1238),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 228/317 (72%), Positives = 271/317 (85%), Gaps = 2/317 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+V+ LL RGY V+AT+R   DPKKT HL +L+GA ERLHLF+A+L
Sbjct  13    KLVCVTGASGYIASWLVRLLLARGYTVRATIRDTSDPKKTLHLRALDGANERLHLFEANL  72

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD+ V GC+ VFHTASPFYHNV DP+AEL+DPAVKGTLNVLGSC K  S+++V+V
Sbjct  73    LEEGSFDAAVNGCDCVFHTASPFYHNVKDPKAELLDPAVKGTLNVLGSCKKA-SIRRVIV  131

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+VVVDETW+S  + C++ + WYVLSKTLAE+AAWKF K+ G  +
Sbjct  132   TSSMAAVAYNGKPRTPDVVVDETWFSVPEICEKHQQWYVLSKTLAEEAAWKFSKDNGFEI  191

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILALENPS  945
             VT+NPAMVIGPLLQP+LNTS+ AIL LING + TY N S+GWINVKDVA AHILA E PS
Sbjct  192   VTVNPAMVIGPLLQPSLNTSAEAILKLINGSSSTYPNFSFGWINVKDVALAHILAYEVPS  251

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYCM+ERVAHYSE+V+ + ++YP + LP+KCADDKP VP YQVSKEK K+LG+  TP
Sbjct  252   ANGRYCMVERVAHYSELVQIIREMYPNIPLPDKCADDKPSVPIYQVSKEKIKSLGLELTP  311

Query  1126  LEESLKETVESLKEKGF  1176
             L  S+KET+ESLKEKGF
Sbjct  312   LHTSIKETIESLKEKGF  328



>ref|XP_007029628.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY10130.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=324

 Score =   481 bits (1237),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 226/322 (70%), Positives = 273/322 (85%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S   K VCVTGASGYIASW+VKFLLQRGY VKATVR P DPKKT+HLL+L+GAKERLHL
Sbjct  1     MSETGKVVCVTGASGYIASWLVKFLLQRGYTVKATVRDPSDPKKTEHLLALDGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LL+EG+FDSVV GC GVFHTASPFYHN+ DPQAE+IDPAVKGTLNVL SCAK PS+
Sbjct  61    FKAELLDEGAFDSVVDGCVGVFHTASPFYHNIKDPQAEMIDPAVKGTLNVLRSCAKVPSI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSS+AAV YNG+P  P+V VDETW+S   FC++ K+WY+LSKTLAE+AAWK+ K+
Sbjct  121   KRVVITSSVAAVVYNGRPLGPDVKVDETWFSDPTFCEKSKLWYMLSKTLAEEAAWKYAKD  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
              GI+MVT+NP +VIGPLLQPT+N S   IL LINGAET+ N +Y  I+V+DVANAHILA 
Sbjct  181   NGIDMVTVNPGLVIGPLLQPTINASVEPILKLINGAETFPNTNYRLIDVRDVANAHILAY  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             EN SA GRY ++ER    SE+V+ L +LYP LRLPEKCAD+K  +P +QVSK++AK+LGV
Sbjct  241   ENSSACGRYLLVERPMPCSEIVQALRELYPALRLPEKCADEKLAIPAFQVSKDRAKSLGV  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              FTP+E S+K+TVESLKEK FF
Sbjct  301   KFTPIEVSIKDTVESLKEKNFF  322



>gb|EMS49381.1| Dihydroflavonol-4-reductase [Triticum urartu]
Length=330

 Score =   480 bits (1236),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 226/317 (71%), Positives = 270/317 (85%), Gaps = 2/317 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTG SGYIASW+VKFLLQRGY V+ATVR   DPKKT HL +L+GAK+RLHLFKA L
Sbjct  7     KVVCVTGGSGYIASWLVKFLLQRGYTVRATVRDTADPKKTLHLQALDGAKDRLHLFKASL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD+ VAGC+ VFHTASPFYHNV DP+AEL+DPAV GTLNVL SC K  S+++V+V
Sbjct  67    LEEGSFDATVAGCDCVFHTASPFYHNVKDPKAELLDPAVDGTLNVLRSCKKA-SIKRVIV  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+VVVDETW+S+A+ C++ K WYVLSKTLAE+AAWK+  + G+ +
Sbjct  126   TSSMAAVAYNGKPRTPDVVVDETWFSSAEVCEKNKQWYVLSKTLAEEAAWKYANDNGLEI  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILALENPS  945
             +TINP MVIGPLLQPTLNTS+ AIL  ING + TY+N  +GWINVKDVA AHILA E PS
Sbjct  186   ITINPTMVIGPLLQPTLNTSTEAILKFINGSSSTYANFCFGWINVKDVALAHILAYEVPS  245

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYCM+ERV H+S++VK +H++YP   +P+KCADD PF P YQVSK+K ++LG+  TP
Sbjct  246   ANGRYCMVERVIHHSDLVKIIHEMYPEFPVPDKCADDAPFAPIYQVSKDKIRSLGMELTP  305

Query  1126  LEESLKETVESLKEKGF  1176
             LE SLKET+ESLKEKGF
Sbjct  306   LETSLKETIESLKEKGF  322



>ref|XP_008790954.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Phoenix 
dactylifera]
Length=331

 Score =   480 bits (1235),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 227/321 (71%), Positives = 270/321 (84%), Gaps = 0/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S + K VCVTGASGYIASW+VK LLQRGY V+ TVR   DPK+T+HL +LEGA ERL L
Sbjct  1     MSGSGKVVCVTGASGYIASWLVKLLLQRGYTVRGTVRDLADPKRTEHLRALEGANERLQL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFDSVV GCEGVFHTASP Y N TDPQAELIDPAVKG LNV GSC KTPSV
Sbjct  61    FKANLLEEGSFDSVVEGCEGVFHTASPCYVNATDPQAELIDPAVKGALNVFGSCIKTPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSS+AAV +NG+P+TP+VV+D TW+S+ +FC++ K WY LSKTLAE+AAWKF K+
Sbjct  121   KRVVVTSSMAAVLHNGRPQTPDVVIDATWFSSVEFCEQEKKWYPLSKTLAEEAAWKFSKD  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               I+MVTI+P +VIGPLLQPTLN SSA +LNL+NG+ TY N  + W+NVKDVA AHILA 
Sbjct  181   NSIDMVTIHPGVVIGPLLQPTLNESSAMLLNLLNGSSTYPNLRFPWVNVKDVAMAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRY ++ERVAHYSE+VK L + YP L+LPEKC DDKPF+P YQVSKEK K+LG+
Sbjct  241   EVPSASGRYFLVERVAHYSEIVKILREQYPALKLPEKCVDDKPFLPIYQVSKEKEKSLGI  300

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              + P+  S+KETVESLKEKGF
Sbjct  301   DYVPIVTSIKETVESLKEKGF  321



>ref|XP_006851072.1| hypothetical protein AMTR_s00025p00240760 [Amborella trichopoda]
 gb|ERN12653.1| hypothetical protein AMTR_s00025p00240760 [Amborella trichopoda]
Length=320

 Score =   479 bits (1233),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 226/320 (71%), Positives = 268/320 (84%), Gaps = 0/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M+ K VCVTGASG+IASW+VK LLQRGY V+ATVR  +DPKKTKHLL LEGA ERL L+ 
Sbjct  1     MSGKVVCVTGASGFIASWLVKLLLQRGYTVQATVRDINDPKKTKHLLELEGANERLKLYN  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             AD L++GSFD+ + GC GVFHTASPF+ +  DPQ ELIDPAVKGTLNVL SC+KT SV++
Sbjct  61    ADNLKDGSFDAAMDGCAGVFHTASPFFFSSKDPQTELIDPAVKGTLNVLASCSKTSSVKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAV YN  PRTP+VVVDETW+S   FCKE++ WYVLSKTLAE+AAW F KEKG
Sbjct  121   VVLTSSVAAVVYNRNPRTPDVVVDETWFSDPAFCKEVQNWYVLSKTLAEEAAWDFAKEKG  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I++VTINPAMVIGPLLQP LNTS AAIL+L+NG+ TY+N ++GW+NVKDVA AHILA E 
Sbjct  181   IDLVTINPAMVIGPLLQPMLNTSCAAILDLVNGSPTYTNGTFGWVNVKDVAEAHILAYEV  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PS +GRYC++ERV H+SE+VK LH LYP   +P+KC D+ PF P +QVSK+K + LGV F
Sbjct  241   PSVSGRYCLVERVVHFSELVKLLHDLYPEYPVPQKCVDENPFPPKFQVSKKKTQTLGVNF  300

Query  1120  TPLEESLKETVESLKEKGFF  1179
             TPLE SLKETVESLKEK FF
Sbjct  301   TPLEVSLKETVESLKEKKFF  320



>ref|XP_010673674.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=326

 Score =   479 bits (1232),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 229/317 (72%), Positives = 264/317 (83%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGYIVKATVR  +DPKK +HL  L+GA ERLHL  A+L
Sbjct  8     KVVCVTGASGYIASWLVKLLLQRGYIVKATVRDLNDPKKVEHLRCLDGATERLHLLHANL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD+ V GC GVFHTASPFYH+V DPQAEL+DPAVKGTLNVL SCAK  S+++VV+
Sbjct  68    LEEGSFDAAVEGCAGVFHTASPFYHDVKDPQAELLDPAVKGTLNVLNSCAKFSSIKRVVL  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSI AV  NGK    EV+VDE+W+S  DFC+  KMWYVLSKTLAE+AAWKF KE GI+M
Sbjct  128   TSSITAVVRNGKSLNLEVLVDESWFSDPDFCRNSKMWYVLSKTLAEEAAWKFAKENGIDM  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+A+I NL+NG+ETY N ++GWI+VKDVA AHILALE PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAASIANLLNGSETYPNLTFGWIHVKDVATAHILALEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++E V  +SE+VK L +LYP   LPEKCADD P  P+Y+VSK KA++LG+ F PL
Sbjct  248   NGRYCLVETVTPFSEIVKILRELYPNAALPEKCADDNPLKPSYKVSKNKARSLGIDFIPL  307

Query  1129  EESLKETVESLKEKGFF  1179
             E SLKETVE LKEK F 
Sbjct  308   ETSLKETVECLKEKRFI  324



>dbj|BAA12161.1| CPRD14 protein [Vigna unguiculata]
Length=325

 Score =   479 bits (1232),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 269/319 (84%), Gaps = 0/319 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A + VCVTGASGYIASW+VKFLL+RGY VKATVR   DPKK  HLLSL+GAKERLHL KA
Sbjct  5     AGQVVCVTGASGYIASWVVKFLLERGYTVKATVRDTSDPKKVDHLLSLDGAKERLHLVKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS V GC  VFHTASPF+ +  DPQ EL+DPA+KGTLNVL SC  +P++++V
Sbjct  65    NLLEEGSFDSAVEGCHAVFHTASPFFDDAKDPQTELLDPALKGTLNVLKSCVNSPTLKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             VVTSSIAAV++N +P+ P+VVVDETW+S  ++CK   +WY LSKTLAEDAAWKF KE  I
Sbjct  125   VVTSSIAAVSFNDRPKNPDVVVDETWYSDPEYCKRNGIWYNLSKTLAEDAAWKFAKENNI  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             ++VT NPA+V+GPLLQP LNTSSAA+LNLING+ T+ N + GW++V+DVA AH+LA EN 
Sbjct  185   DLVTANPALVVGPLLQPVLNTSSAAVLNLINGSPTFKNVTLGWVDVRDVAIAHVLAYENA  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SANGRY ++ERVAH+ +VVK LH LYPTL+LP+KC DD+P+ P +QVSKEKAK+LG+ FT
Sbjct  245   SANGRYLLVERVAHFGDVVKILHDLYPTLQLPQKCVDDRPYDPIFQVSKEKAKSLGLEFT  304

Query  1123  PLEESLKETVESLKEKGFF  1179
             PLE S+K+TVESLKEKGF 
Sbjct  305   PLEVSIKDTVESLKEKGFI  323



>gb|EMT10896.1| Dihydroflavonol-4-reductase [Aegilops tauschii]
Length=330

 Score =   479 bits (1232),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 224/317 (71%), Positives = 270/317 (85%), Gaps = 2/317 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLLQRGY V+ATVR   DPKKT HL +L+GAK+RLHLFKA L
Sbjct  7     KVVCVTGASGYIASWLVKFLLQRGYTVRATVRDTADPKKTLHLQALDGAKDRLHLFKASL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEG+FD  VAGC+ VFHTASPFYHNV DP+AEL+DPAV GTLNVL SC K  S+++V+V
Sbjct  67    LEEGTFDDAVAGCDCVFHTASPFYHNVKDPKAELLDPAVNGTLNVLRSCKKA-SIKRVIV  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+VVVDETW+S+A+ C++ K WYVLSKTLAE+AAWK+  + G+ +
Sbjct  126   TSSMAAVAYNGKPRTPDVVVDETWFSSAEVCEKNKQWYVLSKTLAEEAAWKYANDNGLEI  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILALENPS  945
             +TINP MVIGPLLQPTLNTS+ AIL  ING + TY+N  +GWINVKDVA AHILA E PS
Sbjct  186   ITINPTMVIGPLLQPTLNTSTEAILKFINGSSSTYANFCFGWINVKDVALAHILAYEVPS  245

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYCM+ERV H+S++VK +H++YP   +P+KCADD PF P YQVSK++ ++LG+  TP
Sbjct  246   ANGRYCMVERVIHHSDLVKIIHEMYPEFPVPDKCADDAPFAPIYQVSKDRIRSLGMELTP  305

Query  1126  LEESLKETVESLKEKGF  1176
             LE SLKET+ESL+EKGF
Sbjct  306   LETSLKETIESLREKGF  322



>ref|NP_001150399.1| LOC100284029 [Zea mays]
 gb|ACG38940.1| dihydroflavonol-4-reductase [Zea mays]
Length=332

 Score =   479 bits (1232),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 229/317 (72%), Positives = 266/317 (84%), Gaps = 2/317 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASWIV+ LL RGY V+ATVR   DPKKT HL +L+GAK+RLHLFKA L
Sbjct  14    KVVCVTGASGYIASWIVRLLLDRGYTVRATVRDTADPKKTLHLTALDGAKDRLHLFKASL  73

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD+ V GC+ VFHTASPFYHNV D +AEL+DPAVKGTLNVLGSC K  S++KVVV
Sbjct  74    LEEGSFDAAVHGCDTVFHTASPFYHNVKDAKAELLDPAVKGTLNVLGSCKKA-SIKKVVV  132

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNG+PRTPEV VDETW+S    C+  + WY+LSKTLAE+AAWKF ++ G+ +
Sbjct  133   TSSMAAVAYNGRPRTPEVTVDETWFSDPQICETNQQWYILSKTLAEEAAWKFSRDNGLEI  192

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILALENPS  945
             VTINPAMVIGPLLQPTLNTS+ AIL LING + TY N  +GW+NVKDVA AHILA E PS
Sbjct  193   VTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFCFGWVNVKDVALAHILAYEVPS  252

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             +NGRYCM+ERV HYSE+V  +  +YPTL LP+KCADDKPFVP YQVSKEK K++G+   P
Sbjct  253   SNGRYCMVERVVHYSELVNIIRNMYPTLPLPDKCADDKPFVPPYQVSKEKIKSIGIELIP  312

Query  1126  LEESLKETVESLKEKGF  1176
             LE S+KET+ESLKEKGF
Sbjct  313   LETSVKETIESLKEKGF  329



>ref|XP_007029632.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY10134.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=324

 Score =   478 bits (1230),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 225/322 (70%), Positives = 273/322 (85%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S   K VCVTGASGYIASW+VKFLLQRGY VKATVR P +PKKT+HL++L+GAKERLHL
Sbjct  1     MSGTGKVVCVTGASGYIASWLVKFLLQRGYTVKATVRDPSNPKKTEHLVALDGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LL+EG+FDSVV GC GVFHTASPFY +V DPQAE+IDPAVKGTLNVL SCAK PS+
Sbjct  61    FKAELLDEGAFDSVVDGCVGVFHTASPFYLDVKDPQAEMIDPAVKGTLNVLRSCAKVPSI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSI AV +NG+P  P+V+VDETW+S   FC++ K+WY+LSKTLAE+AAWK+ KE
Sbjct  121   KRVVITSSIVAVIFNGRPLGPDVLVDETWFSNPTFCEKSKLWYMLSKTLAEEAAWKYAKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
              GI MVT+NP +VIGPLLQPT+NTS   IL LINGAET+ N SY  I+V+DVANAHI+A 
Sbjct  181   NGIQMVTVNPGLVIGPLLQPTINTSVEPILKLINGAETFPNTSYRLIDVRDVANAHIIAY  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             EN SA GRY ++ERV H SE+V+ L +LYP LRLPE+CAD+K  +P +QVSK++AK+LGV
Sbjct  241   ENSSACGRYLLVERVMHCSEIVQALRELYPALRLPERCADEKVGMPVFQVSKDRAKSLGV  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              FTP E S+K+TVESLKEK FF
Sbjct  301   NFTPTEVSIKDTVESLKEKNFF  322



>ref|XP_010905795.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Elaeis guineensis]
Length=324

 Score =   477 bits (1228),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 231/316 (73%), Positives = 271/316 (86%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASW+VK LLQRGY V ATVR   D KKT+HL +LEGA ERLHLFKA+L
Sbjct  6     KVVCVTGASGFIASWLVKLLLQRGYTVHATVRDLADSKKTEHLCALEGANERLHLFKANL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GCEGVFHTASP Y N  DPQAELIDPAVKGTLNVL SC KTPS+++VVV
Sbjct  66    LEEGSFDSVVKGCEGVFHTASPCYGNAIDPQAELIDPAVKGTLNVLSSCVKTPSIKRVVV  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS  AV YNG+PRTP+VVVDETW+S+A+FCK+ K+WY LSK+LAE+AAWKF K+  I+M
Sbjct  126   TSSTVAVEYNGRPRTPDVVVDETWFSSAEFCKQAKLWYELSKSLAEEAAWKFSKDNSIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTI+P+MVIGP+LQPTLN SSA  L LI+G+ TYSN S+GW+NVKDV  AHILA E PSA
Sbjct  186   VTIHPSMVIGPILQPTLNGSSARFLKLIDGSSTYSNISHGWVNVKDVGMAHILAFEVPSA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERVAH+SEVVK L + YP L+LPE+CADDKPF+P YQVSKEK K+LG+ + PL
Sbjct  246   SGRYCLVERVAHHSEVVKILREQYPALKLPERCADDKPFMPIYQVSKEKVKSLGIDYIPL  305

Query  1129  EESLKETVESLKEKGF  1176
             E S+KE +ESLK+KGF
Sbjct  306   ETSIKEAIESLKKKGF  321



>dbj|BAJ90096.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score =   478 bits (1229),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/323 (69%), Positives = 271/323 (84%), Gaps = 2/323 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LL RGY V+ATVR   DPKKT HL +LEGAKERLHLFKA L
Sbjct  18    KVVCVTGASGYIASWLVKLLLHRGYTVRATVRDTADPKKTLHLQALEGAKERLHLFKASL  77

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEG+FD+ +AGC+ VFHTASPFYHNV DP+AEL+DPAV GTLNVL SC K  S+++V+V
Sbjct  78    LEEGTFDAAIAGCDCVFHTASPFYHNVKDPKAELLDPAVNGTLNVLRSCKKA-SIKRVIV  136

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+VVVDETW+S+A+ C++ K WYVLSKTLAE+AAWKF K+ G+ +
Sbjct  137   TSSMAAVAYNGKPRTPDVVVDETWFSSAEVCEKNKQWYVLSKTLAEEAAWKFAKDNGLEI  196

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILALENPS  945
             +TINP MVIGPLLQPTLNTS+ AIL  ING + TY+N  +GW+NVKDVA AHILA E+PS
Sbjct  197   ITINPTMVIGPLLQPTLNTSAEAILKFINGSSSTYANFCFGWVNVKDVALAHILAYEDPS  256

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYCM+ERV H+S++VK +H++YP   +P+KCADD PF   YQVSK+K ++LG+   P
Sbjct  257   ANGRYCMVERVIHHSDLVKIIHEMYPEFPVPDKCADDAPFATIYQVSKDKIRSLGMELIP  316

Query  1126  LEESLKETVESLKEKGFFVPSAA  1194
             LE SLKET+ESLKEKGF    ++
Sbjct  317   LETSLKETIESLKEKGFLTSESS  339



>ref|XP_010905790.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Elaeis 
guineensis]
Length=392

 Score =   479 bits (1233),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 232/350 (66%), Positives = 282/350 (81%), Gaps = 3/350 (1%)
 Frame = +1

Query  130   YKYIYGRRR-TLLNLRASEWrrkrarrrrISMAMKTVCVTGASGYIASWIVKFLLQRGYI  306
             + Y+Y R    +LN R+    +++ RR  +S + + VCVTGASGYIASW+VK LLQRGY 
Sbjct  42    FLYVYPRASYQILNSRSE--IKRQGRRETMSGSGRVVCVTGASGYIASWLVKLLLQRGYT  99

Query  307   VKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLEEGSFDSVVAGCEGVFHTASPFYHN  486
             V+ATVR    PKK +HL +LEGA ERLHLFKA+LLEEGSFD V+ GCEGVFHTASP Y +
Sbjct  100   VRATVRDLTGPKKIEHLRALEGANERLHLFKANLLEEGSFDLVIEGCEGVFHTASPCYIH  159

Query  487   VTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTSSIAAVAYNGKPRTPEVVVDETWWS  666
               DPQ ELI+PAVKGTLNV  SC KTPSV++VVVTS++ +V YNG+PRTP+++VDETW+S
Sbjct  160   AMDPQTELIEPAVKGTLNVFSSCVKTPSVRRVVVTSTMGSVYYNGRPRTPDIIVDETWFS  219

Query  667   AADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVTINPAMVIGPLLQPTLNTSSAAILN  846
              A+FCK+ KMWY LSKTLAE+ AWKF K+  I+MVTI+PA VIGPLLQPTLNTS+A  L 
Sbjct  220   NAEFCKQEKMWYQLSKTLAEEVAWKFSKDNSIDMVTIHPAFVIGPLLQPTLNTSAAEFLK  279

Query  847   LINGAETYSNASYGWINVKDVANAHILALENPSANGRYCMIERVAHYSEVVKKLHKLYPT  1026
             LING+ TY N +YGW+NVKDVA AHILA E PSA+GRYC++E VAH SE+VK LH+ Y  
Sbjct  280   LINGSSTYPNVTYGWVNVKDVAMAHILAFEVPSASGRYCLVESVAHCSEIVKILHEQYSA  339

Query  1027  LRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEESLKETVESLKEKGF  1176
             L+LPEKCADDKP +P Y VSKEKAK+LG+ + PLE S+KE V+SLKEKGF
Sbjct  340   LKLPEKCADDKPLMPIYHVSKEKAKSLGIDYIPLETSIKEIVKSLKEKGF  389



>gb|KHN20639.1| Dihydroflavonol-4-reductase [Glycine soja]
Length=325

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 223/320 (70%), Positives = 267/320 (83%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S + K VCVTGASG+IASWI+K LLQRGY V+ATVR P  P+K  HLL L+GAKERLHLF
Sbjct  3     SNSGKVVCVTGASGFIASWIIKLLLQRGYTVRATVRDPSKPEKVDHLLKLDGAKERLHLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KADLLEEGSFDS   GC+GVFHTASP +  VTDPQ +LIDPA+KGTLNV+ SCAK+PSV+
Sbjct  63    KADLLEEGSFDSAFEGCDGVFHTASPVHFIVTDPQNQLIDPAIKGTLNVVKSCAKSPSVK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +V++TSS+AAV YNG+PRTPEVVVDETW+S  DF +E + WY  +KT AEDAA KF+ E 
Sbjct  123   QVILTSSVAAVLYNGRPRTPEVVVDETWFSDPDFLRENERWYAFAKTSAEDAARKFLSEY  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I +V INP+M IGPLLQP LN SS++ILNLING+ T+SN S+GWINVKDVANAHI A E
Sbjct  183   DIKLVVINPSMSIGPLLQPELNASSSSILNLINGSPTFSNNSFGWINVKDVANAHIQAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
               SA+GRYC++ERV H+SE+ K L  +YPTL++P+KC DD+PF+PT+QVSKEKAK+LGV 
Sbjct  243   IDSASGRYCLVERVIHFSELAKILRDMYPTLQIPDKCEDDEPFMPTFQVSKEKAKSLGVE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE SL+ETVESLKEK F
Sbjct  303   FIPLEVSLRETVESLKEKKF  322



>gb|ACF88378.1| unknown [Zea mays]
 gb|AFW70878.1| dihydroflavonol-4-reductase [Zea mays]
Length=332

 Score =   476 bits (1225),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 228/317 (72%), Positives = 265/317 (84%), Gaps = 2/317 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASWIV+ LL RGY V+ATVR   DPKKT HL +L+GAK+RLHLFKA L
Sbjct  14    KVVCVTGASGYIASWIVRLLLDRGYTVRATVRDTADPKKTLHLTALDGAKDRLHLFKASL  73

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD+ V GC+ VFHTASPFYHNV D +AEL+DPAVKGTLNVLGSC K  S++KVVV
Sbjct  74    LEEGSFDAAVHGCDTVFHTASPFYHNVKDAKAELLDPAVKGTLNVLGSCKKA-SIKKVVV  132

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYN +PRTPEV VDETW+S    C+  + WY+LSKTLAE+AAWKF ++ G+ +
Sbjct  133   TSSMAAVAYNRRPRTPEVTVDETWFSDPQICETNQQWYILSKTLAEEAAWKFSRDNGLEI  192

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILALENPS  945
             VTINPAMVIGPLLQPTLNTS+ AIL LING + TY N  +GW+NVKDVA AHILA E PS
Sbjct  193   VTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFCFGWVNVKDVALAHILAYEVPS  252

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             +NGRYCM+ERV HYSE+V  +  +YPTL LP+KCADDKPFVP YQVSKEK K++G+   P
Sbjct  253   SNGRYCMVERVVHYSELVNIIRNMYPTLPLPDKCADDKPFVPPYQVSKEKIKSIGIELIP  312

Query  1126  LEESLKETVESLKEKGF  1176
             LE S+KET+ESLKEKGF
Sbjct  313   LETSVKETIESLKEKGF  329



>ref|XP_002314052.1| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa]
 gb|ABK95157.1| unknown [Populus trichocarpa]
 gb|EEE88007.1| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa]
Length=324

 Score =   474 bits (1220),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 221/316 (70%), Positives = 269/316 (85%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K V VTGASGYIASW+VK LL+RGY VKA+VR P+D KKT+HLL+L+GAKERL LFKADL
Sbjct  6     KVVSVTGASGYIASWLVKLLLERGYTVKASVRDPNDAKKTEHLLALDGAKERLQLFKADL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L+EGSFD VV GCE VFHTASPFY  V DPQAEL+DPA+KGT+NVL SC K PS+++VV+
Sbjct  66    LDEGSFDPVVEGCECVFHTASPFYFTVNDPQAELVDPALKGTVNVLRSCTKIPSIKRVVI  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV +NGK   P+VVVDETW+S +DFC++ K+WY LSKTLAE+AAWKF KE GI+M
Sbjct  126   TSSMAAVVFNGKSLAPDVVVDETWFSDSDFCEKSKLWYHLSKTLAEEAAWKFTKENGIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VT+NP +VIGPLLQPTLN S+ ++L+LINGA++Y N +Y W++V+DVANAHI ALENPSA
Sbjct  186   VTLNPGLVIGPLLQPTLNQSAESVLDLINGAKSYPNTTYRWVDVRDVANAHIYALENPSA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++  V H SE VK L KLYP L +P++CADDKP +P YQVSKE+A +LGV +TPL
Sbjct  246   NGRYCLVGTVIHSSEAVKILSKLYPDLTIPKQCADDKPPMPKYQVSKERAASLGVKYTPL  305

Query  1129  EESLKETVESLKEKGF  1176
             E SLK+T+ESLKEK F
Sbjct  306   EASLKDTIESLKEKNF  321



>ref|XP_010673664.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673665.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=330

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 228/320 (71%), Positives = 265/320 (83%), Gaps = 1/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             + MK VCVTGASGYIASW+VK LL  GY V ATVR P+D  K  HLL+LEGAKERLHLFK
Sbjct  5     IEMKVVCVTGASGYIASWLVKLLLNHGYTVHATVRDPNDEVKIVHLLNLEGAKERLHLFK  64

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             ADLLEEGSFDS ++GC GVFHTASP    V DPQA+++DPAVKGTLNVL SC K PSV++
Sbjct  65    ADLLEEGSFDSAISGCHGVFHTASPVLFTVKDPQADVLDPAVKGTLNVLTSCKKFPSVRR  124

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMK-MWYVLSKTLAEDAAWKFVKEK  756
             VV+TSS+AAV + GKPR PEVVVDE+W S  + CKE   MWY LSKTLAEDAAWKFVKE 
Sbjct  125   VVLTSSMAAVLFTGKPRAPEVVVDESWISDPELCKESSIMWYTLSKTLAEDAAWKFVKEN  184

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI+M++INPAMV+GP+LQP+LN+S A ILNLINGAETY NA++GW++VKDVA AHILA E
Sbjct  185   GIDMISINPAMVVGPMLQPSLNSSVAPILNLINGAETYPNAAFGWVHVKDVATAHILAFE  244

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
               SA+GRY + E VAH SE+VK L +LYP L LP+KCADDKP  PTYQVSKEKAK+LG+ 
Sbjct  245   VRSASGRYILAETVAHCSEIVKILQELYPALTLPDKCADDKPLAPTYQVSKEKAKSLGIN  304

Query  1117  FTPLEESLKETVESLKEKGF  1176
             + PL+ SLKETVE+LKEKG 
Sbjct  305   YIPLKVSLKETVENLKEKGL  324



>ref|XP_010659458.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Vitis vinifera]
Length=325

 Score =   473 bits (1217),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 227/316 (72%), Positives = 267/316 (84%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASW+VK LLQ  Y VKATVR P+DPKKT+HLLSL+GAKERLHLFKADL
Sbjct  7     KVVCVTGASGFIASWLVKLLLQHDYTVKATVRDPNDPKKTQHLLSLDGAKERLHLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP   +V +PQAELIDPA+KGT+NVL SCAK PSV++VVV
Sbjct  67    LEEGSFDSVVDGCDGVFHTASPVAMDVVNPQAELIDPALKGTINVLRSCAKFPSVKRVVV  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV + GKP T EV++DE+W+S    CKE K+WYVLSKTLAE+AAWKF KE GI+M
Sbjct  127   TSSMAAVVFTGKPLTSEVLIDESWFSDPVLCKESKLWYVLSKTLAEEAAWKFSKENGIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPA VIGPL+QPTLN S+  +LNLINGA+T+ N SY  ++V+DVANAHI A E P A
Sbjct  187   VTINPAWVIGPLIQPTLNLSAEVVLNLINGAQTFPNRSYRLVDVRDVANAHIQAYEIPEA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++E+  HYSE VK L KLYP L LPEKCADDKP+ P+ +VS+EK K+LG+ FTPL
Sbjct  247   SGRYCLVEKDLHYSETVKILRKLYPELPLPEKCADDKPYAPSSRVSQEKVKSLGIHFTPL  306

Query  1129  EESLKETVESLKEKGF  1176
             E SLK+TVESLKEK F
Sbjct  307   EVSLKDTVESLKEKNF  322



>ref|XP_011025488.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Populus 
euphratica]
Length=324

 Score =   473 bits (1217),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 221/316 (70%), Positives = 268/316 (85%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K V VTGASGYIASW+VK LL+RGY VKA+VR P+D KKT+HLL+L GAKERL LFKADL
Sbjct  6     KVVSVTGASGYIASWLVKLLLERGYTVKASVRDPNDAKKTEHLLALGGAKERLQLFKADL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD VV GCE VFHTASPFY  V DPQAEL+DPA+KGT+NVL SC K PS+++VV+
Sbjct  66    LEEGSFDPVVEGCECVFHTASPFYFTVNDPQAELVDPALKGTVNVLRSCTKIPSIKRVVI  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV +NGK   P+VVVDETW+S +DFC++ K+WY LSKTLAE+AAWKF KE GI+M
Sbjct  126   TSSMAAVVFNGKSLAPDVVVDETWFSDSDFCEKSKLWYQLSKTLAEEAAWKFTKENGIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VT+NP +VIGPLLQPTLN S+ ++L+LINGA++Y N +Y W++V+DVA+AHI ALENPSA
Sbjct  186   VTLNPGLVIGPLLQPTLNQSAESVLDLINGAKSYPNTTYRWVDVRDVADAHIYALENPSA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC++  V H SE VK L KLYP L +P++CADDKP +P YQVSKE+A +LGV +TPL
Sbjct  246   NGRYCLVGTVIHSSEAVKILSKLYPDLTIPKQCADDKPPMPKYQVSKERAASLGVKYTPL  305

Query  1129  EESLKETVESLKEKGF  1176
             E SLK+T+ESLKEK F
Sbjct  306   EASLKDTIESLKEKNF  321



>ref|XP_007149032.1| hypothetical protein PHAVU_005G034800g [Phaseolus vulgaris]
 gb|ESW21026.1| hypothetical protein PHAVU_005G034800g [Phaseolus vulgaris]
Length=325

 Score =   473 bits (1216),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 271/319 (85%), Gaps = 0/319 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A + VCVTGASG+IASW+VKFLLQRGY VKATVR P++  K  HLL+LEGAKERLHL KA
Sbjct  5     AGQVVCVTGASGFIASWLVKFLLQRGYTVKATVRDPNNSSKVDHLLNLEGAKERLHLVKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFD+ V G   VFHTASPF++N  DPQ EL+DPA+KGTLNVL SC  +P++++V
Sbjct  65    NLLEEGSFDAAVEGSHAVFHTASPFFNNAKDPQTELLDPALKGTLNVLKSCVNSPTLKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSSIAAV++N +P+TP+VVVDETW+S  ++CKE  +WY LSKTLAEDAAWKFVKE  I
Sbjct  125   VLTSSIAAVSFNYRPKTPDVVVDETWYSDPEYCKENGLWYNLSKTLAEDAAWKFVKENNI  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             ++VT+NPA+V GPLLQP LNTS++ +LNL+NGA+T+ N   GW++V+DVA AHILA E+ 
Sbjct  185   DLVTVNPALVSGPLLQPELNTSASVVLNLVNGAQTFKNDIVGWVDVRDVAMAHILAYESA  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SANGRY +++RVAH+SEVVK L  LYPTL++PEKC DDKP+VP +QVSKEKAK+LG+ FT
Sbjct  245   SANGRYLLVDRVAHFSEVVKILRDLYPTLQIPEKCEDDKPYVPIFQVSKEKAKSLGLEFT  304

Query  1123  PLEESLKETVESLKEKGFF  1179
             PLE SLK+TVESLKEK F 
Sbjct  305   PLEVSLKDTVESLKEKNFL  323



>gb|KDP43569.1| hypothetical protein JCGZ_16856 [Jatropha curcas]
Length=324

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 223/316 (71%), Positives = 266/316 (84%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K V VTGASGYIASW+VK LLQRGY VKA+VR P+DPKK +HLL+L+GAKERL LFKADL
Sbjct  6     KLVGVTGASGYIASWLVKLLLQRGYRVKASVRDPNDPKKIEHLLALDGAKERLQLFKADL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             L+EGSFD VV GCE VFHTASPFY  VTDPQA+LIDPA+KGTLNVL SC K  S+++VV+
Sbjct  66    LDEGSFDPVVKGCECVFHTASPFYFTVTDPQAQLIDPALKGTLNVLRSCTKVSSIKRVVI  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVA+NGKP  P+V+VDETW+S  DFC++ K+WY+LSKTLAE+AAWKF KE G++M
Sbjct  126   TSSMAAVAFNGKPLAPDVIVDETWFSDPDFCEKSKLWYMLSKTLAEEAAWKFTKENGMDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINP +VIGPLLQPTLNTS+ ++L LINGAE Y N +Y W++V+DVANAHI A ENPSA
Sbjct  186   VTINPGLVIGPLLQPTLNTSAESVLKLINGAEKYPNTTYRWVDVRDVANAHICAFENPSA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++  V H SE +K LHKLYP   LP++C DDKP    YQVSKE+A++LGV FTPL
Sbjct  246   SGRYCLVGTVIHSSEAMKILHKLYPDNNLPKECTDDKPPATKYQVSKERAESLGVKFTPL  305

Query  1129  EESLKETVESLKEKGF  1176
             + SLKETVESLKEK  
Sbjct  306   DVSLKETVESLKEKNL  321



>ref|XP_006851070.1| hypothetical protein AMTR_s00025p00240180 [Amborella trichopoda]
 gb|ERN12651.1| hypothetical protein AMTR_s00025p00240180 [Amborella trichopoda]
Length=318

 Score =   472 bits (1214),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 230/320 (72%), Positives = 267/320 (83%), Gaps = 2/320 (1%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M  K VCVTGASGYIASW+VKFLLQRGY V+ATVR  +D KKTKHLL LEGA E L L+K
Sbjct  1     MDGKVVCVTGASGYIASWLVKFLLQRGYTVRATVRDINDSKKTKHLLELEGANENLKLYK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             AD LE+GSFD+ V GC+GVFHTASPFY ++ DPQ E+IDPAVKGTLNVLGSC+KT SV++
Sbjct  61    ADNLEDGSFDAAVDGCDGVFHTASPFYSSIKDPQTEMIDPAVKGTLNVLGSCSKTLSVKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             V+VTSS+AAV  N  P+ P+VVVDETW+S    CK++K WYVLSKTLAE AAW F KEKG
Sbjct  121   VIVTSSMAAVLVNRNPQNPDVVVDETWFSDPTVCKDIKSWYVLSKTLAEKAAWDFAKEKG  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I++VTINPAMVIGPLLQPTLNTS AAILNL+NG+ TY +A++GW+NVKDVA AHILA E 
Sbjct  181   IDLVTINPAMVIGPLLQPTLNTSCAAILNLVNGSPTYVSANFGWVNVKDVAEAHILAYEV  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSA+GRYCM ERV H SE+VK LH+LYP   +P+KCAD+    PT++VSKEKA+ LGV F
Sbjct  241   PSASGRYCMTERVVHSSEIVKLLHELYPEYPVPQKCADENR--PTFKVSKEKAQKLGVNF  298

Query  1120  TPLEESLKETVESLKEKGFF  1179
              PLE SLKETVESLKEK FF
Sbjct  299   IPLEVSLKETVESLKEKKFF  318



>ref|NP_001242261.1| uncharacterized protein LOC100804704 [Glycine max]
 gb|ACU20138.1| unknown [Glycine max]
Length=325

 Score =   472 bits (1214),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/320 (69%), Positives = 266/320 (83%), Gaps = 0/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S + K VCVTGASG+IASWI+K LLQRGY V+ATVR P  P+K  HLL L+GAKERLHLF
Sbjct  3     SNSGKVVCVTGASGFIASWIIKLLLQRGYTVRATVRDPSKPEKVDHLLKLDGAKERLHLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KADLLEEGSFDS   GC+GVFHTASP +  V DPQ +LIDPA+KGTLNV+ SCAK+PSV+
Sbjct  63    KADLLEEGSFDSAFEGCDGVFHTASPVHFIVADPQNQLIDPAIKGTLNVVKSCAKSPSVK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +V++TSS+AAV YNG+PRTPEVVVDETW+S  DF +E + WY  +KT AEDAA KF+ E 
Sbjct  123   QVILTSSVAAVLYNGRPRTPEVVVDETWFSDPDFLRENERWYAFAKTSAEDAAGKFLSEY  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I +V I+P+M IGPLLQP LN SS++ILNLING+ T+SN S+GWINVKDVANAHI A E
Sbjct  183   DIKLVVIDPSMSIGPLLQPELNASSSSILNLINGSPTFSNNSFGWINVKDVANAHIQAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
               SA+GRYC++ERV H+SE+ K L  +YPTL++P+KC DD+PF+PT+QVSKEKAK+LGV 
Sbjct  243   IDSASGRYCLVERVIHFSELAKILRDMYPTLQIPDKCEDDEPFMPTFQVSKEKAKSLGVE  302

Query  1117  FTPLEESLKETVESLKEKGF  1176
             F PLE SL+ETVESLKEK F
Sbjct  303   FIPLEVSLRETVESLKEKKF  322



>ref|XP_007149031.1| hypothetical protein PHAVU_005G034700g [Phaseolus vulgaris]
 gb|ESW21025.1| hypothetical protein PHAVU_005G034700g [Phaseolus vulgaris]
Length=325

 Score =   471 bits (1212),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 218/318 (69%), Positives = 269/318 (85%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A + VCVTGASGYIASW+VKFLLQRGY VKATVR   DPKK  HLL+L+GAKERLHL KA
Sbjct  5     AGQVVCVTGASGYIASWLVKFLLQRGYTVKATVRNLSDPKKVDHLLNLDGAKERLHLVKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS V GC  VFHTASPF+H   DPQ EL+DPA+KGTLNVL SC K+P++++V
Sbjct  65    NLLEEGSFDSAVQGCHAVFHTASPFFHESKDPQVELLDPALKGTLNVLKSCVKSPTLKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSSIAAV++N +P+TP+VVVDETW+S  ++CKE  +WY LSKTLAEDAAWKFVKE  I
Sbjct  125   VLTSSIAAVSFNYRPKTPDVVVDETWYSDPEYCKENGIWYNLSKTLAEDAAWKFVKENNI  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             ++VT+NPA+V+GPLLQP LNTSSA +L+L++G+ T+ N + GW++V+DVA AH+LA E+ 
Sbjct  185   DLVTMNPALVVGPLLQPELNTSSAMVLDLVDGSPTFKNITLGWVDVRDVAMAHVLAYESA  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SANGRY ++ERV H+S VVK L  LYPTL+LPEKC DDKP+ P +QVSKEKAK+LG+ + 
Sbjct  245   SANGRYLLVERVTHFSNVVKILRDLYPTLQLPEKCVDDKPYDPAFQVSKEKAKSLGIEYI  304

Query  1123  PLEESLKETVESLKEKGF  1176
             PLE S+K+TVESLKEK F
Sbjct  305   PLEVSIKDTVESLKEKNF  322



>ref|XP_010905788.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Elaeis 
guineensis]
Length=393

 Score =   474 bits (1219),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 231/351 (66%), Positives = 282/351 (80%), Gaps = 4/351 (1%)
 Frame = +1

Query  130   YKYIYGRRR-TLLNLRASEWrrkrarrrrISMAMKTVCVTGASGYIASWIVKFLLQRGYI  306
             + Y+Y R    +LN R+    +++ RR  +S + + VCVTGASGYIASW+VK LLQRGY 
Sbjct  42    FLYVYPRASYQILNSRSE--IKRQGRRETMSGSGRVVCVTGASGYIASWLVKLLLQRGYT  99

Query  307   VKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLEEGSFDSVVAGCEGVFHTASPFYHN  486
             V+ATVR    PKK +HL +LEGA ERLHLFKA+LLEEGSFD V+ GCEGVFHTASP Y +
Sbjct  100   VRATVRDLTGPKKIEHLRALEGANERLHLFKANLLEEGSFDLVIEGCEGVFHTASPCYIH  159

Query  487   VTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTSSIAAVAYNGKPRTPEVVVDETWWS  666
               DPQ ELI+PAVKGTLNV  SC KTPSV++VVVTS++ +V YNG+PRTP+++VDETW+S
Sbjct  160   AMDPQTELIEPAVKGTLNVFSSCVKTPSVRRVVVTSTMGSVYYNGRPRTPDIIVDETWFS  219

Query  667   AADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVTINPAMVIGPLLQPTLNTSSAAILN  846
              A+FCK+ KMWY LSKTLAE+ AWKF K+  I+MVTI+PA VIGPLLQPTLNTS+A  L 
Sbjct  220   NAEFCKQEKMWYQLSKTLAEEVAWKFSKDNSIDMVTIHPAFVIGPLLQPTLNTSAAEFLK  279

Query  847   LINGAETYSNASYGWINVKDVANAHILALENPSANGRYCMIERVAHYSEVVKKLHKLYPT  1026
             LING+ TY N +YGW+NVKDVA AHILA E PSA+GRYC++E VAH SE+VK LH+ Y  
Sbjct  280   LINGSSTYPNVTYGWVNVKDVAMAHILAFEVPSASGRYCLVESVAHCSEIVKILHEQYSA  339

Query  1027  LRLPE-KCADDKPFVPTYQVSKEKAKNLGVVFTPLEESLKETVESLKEKGF  1176
             L+LPE +CADDKP +P Y VSKEKAK+LG+ + PLE S+KE V+SLKEKGF
Sbjct  340   LKLPENRCADDKPLMPIYHVSKEKAKSLGIDYIPLETSIKEIVKSLKEKGF  390



>gb|KHM99527.1| Dihydroflavonol-4-reductase [Glycine soja]
Length=290

 Score =   469 bits (1208),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 253/283 (89%), Gaps = 0/283 (0%)
 Frame = +1

Query  328   PDDPKKTKHLLSLEGAKERLHLFKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAE  507
             PDD KK  HL+SL+GAKERLHL+KA+LLEEGSFDSV  GC  VFHTASPFYH+V DPQAE
Sbjct  5     PDDLKKINHLVSLDGAKERLHLYKANLLEEGSFDSVFQGCHAVFHTASPFYHDVKDPQAE  64

Query  508   LIDPAVKGTLNVLGSCAKTPSVQKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKE  687
             L+DPA+KGTLNVL SC   P++++VV+TSS+AAVAYNGKPRTP+VVVDETW+S  DFC+E
Sbjct  65    LLDPALKGTLNVLKSCVNLPTLERVVLTSSVAAVAYNGKPRTPDVVVDETWFSDPDFCRE  124

Query  688   MKMWYVLSKTLAEDAAWKFVKEKGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAET  867
              +MWY LSKTLAEDAAWKFVKE  I+MVTINPAMVIGPLLQP LNTS+A+ILN+INGA+T
Sbjct  125   SQMWYTLSKTLAEDAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAASILNIINGAQT  184

Query  868   YSNASYGWINVKDVANAHILALENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKC  1047
             + NAS+GW+NVKDVANAHILA EN SANGRYC++ERVAH+SE+VK L  LYPTL+ PEKC
Sbjct  185   FPNASFGWVNVKDVANAHILAYENASANGRYCLVERVAHHSELVKILRDLYPTLQHPEKC  244

Query  1048  ADDKPFVPTYQVSKEKAKNLGVVFTPLEESLKETVESLKEKGF  1176
             ADDKP+VP YQVSKEKAK+LG+ +TPLE SLKETVESLKEK F
Sbjct  245   ADDKPYVPIYQVSKEKAKSLGIEYTPLEVSLKETVESLKEKKF  287



>ref|XP_008349583.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
 ref|XP_008363306.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Malus domestica]
Length=322

 Score =   471 bits (1211),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 217/322 (67%), Positives = 268/322 (83%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S   K VCVTGASG+IASW+VKFLLQ GY VKATVR P+DPKKT+HLLSL+GAKERLHL
Sbjct  1     MSGGSKVVCVTGASGFIASWVVKFLLQXGYTVKATVRDPNDPKKTQHLLSLDGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSFD+VV GCEGVFH ASP   +VTDPQAEL+DPAVKGTLNVL SCAK PS+
Sbjct  61    FKADLLEEGSFDAVVDGCEGVFHMASPVLMSVTDPQAELLDPAVKGTLNVLRSCAKFPSI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSSI ++ + GKP + + VVDE+W+S   FC++ K+WY LSKTLAE+AAWKFVKE
Sbjct  121   KRVVLTSSIVSIVFTGKPLSADTVVDESWFSDPAFCEKAKLWYALSKTLAEEAAWKFVKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
              GI++V +NP + IGPLLQPTLN+SS  +L L +G   + NA++ W++V+D+ANAHILA 
Sbjct  181   NGIDLVAVNPGVAIGPLLQPTLNSSSELLLKLFDGTGKFPNATHRWVDVRDIANAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             ENPSA+GRY ++  VAHYS  VK L  L+P L LPEKCADD+PF PTYQ+SKE+A+ LGV
Sbjct  241   ENPSASGRYSIVGSVAHYSVAVKILRDLFPALNLPEKCADDQPFAPTYQISKERAETLGV  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
             V+TPL+ +LK+ VESLK+K FF
Sbjct  301   VYTPLDVTLKDAVESLKQKNFF  322



>ref|XP_004307230.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Fragaria 
vesca subsp. vesca]
Length=322

 Score =   471 bits (1211),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 267/322 (83%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S A K VCVTGASGYIASW+VK LLQRGY VKA+VR P+D KKT+HL +L+GAKERL L
Sbjct  1     MSAATKVVCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDKKKTEHLRALDGAKERLQL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             F+ADLLEEGSFDS+V G   VFHTASPFY N  DPQAELIDPA+KGTLNVL SC K PS+
Sbjct  61    FRADLLEEGSFDSIVDGSVAVFHTASPFYLNPNDPQAELIDPALKGTLNVLRSCVKVPSI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSS+AAVAYNG P  P+V++DE+W+S   FC++ K WY+LSKTLAE+AAWKF KE
Sbjct  121   KRVVITSSMAAVAYNGNPVAPDVIIDESWFSDPAFCEKSKAWYMLSKTLAEEAAWKFAKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             K I++VTINP  VIGPLLQPTLNTS   ILNLING E + N +Y +++V+DVANAHILAL
Sbjct  181   KCIDIVTINPGYVIGPLLQPTLNTSVEPILNLINGTEKFPNTTYRFVDVRDVANAHILAL  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             ENPSA+GRYC++  V H S++VK L  ++P L LPEK ADDKPF PTYQVSKE+A+ LGV
Sbjct  241   ENPSASGRYCLVGSVTHCSDIVKILRDIFPALSLPEKSADDKPFTPTYQVSKERAQILGV  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              +TPLE +LK+TVESL +K FF
Sbjct  301   NYTPLEGTLKDTVESLMDKNFF  322



>ref|XP_004307229.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Fragaria 
vesca subsp. vesca]
Length=323

 Score =   470 bits (1210),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 220/315 (70%), Positives = 265/315 (84%), Gaps = 0/315 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             V VTGASGYIASW+VK LLQRGY VKA+VR P+D KKT+HLLSL+GAKERL LFKADLLE
Sbjct  9     VSVTGASGYIASWLVKLLLQRGYTVKASVRDPNDKKKTEHLLSLDGAKERLQLFKADLLE  68

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EGSFDS+V G   VFHTASPFYHN +DPQ ELIDPA+KGTLNVL SC K PS+++V++TS
Sbjct  69    EGSFDSLVDGSVAVFHTASPFYHNPSDPQVELIDPALKGTLNVLRSCVKVPSIKRVIITS  128

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             S+AAVA+NGKP  P+VV+DE+W+S   FC++ K WY+LSKTLAE+AAWKF KEKGI++VT
Sbjct  129   SMAAVAFNGKPVAPDVVIDESWFSDPAFCEKSKAWYMLSKTLAEEAAWKFAKEKGIDIVT  188

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INP +VIGPLLQPTLNTS   IL LING E + N +Y +++V+DVANAHILA ENPSA+G
Sbjct  189   INPGLVIGPLLQPTLNTSVEPILKLINGTEKFPNTTYRFVDVRDVANAHILAFENPSASG  248

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             RYC++  V H S++VK L  ++P L LPEK ADDKPF PTYQVSKE+A+ LGV +T LE 
Sbjct  249   RYCLVGSVTHCSDIVKILRDIFPALSLPEKSADDKPFTPTYQVSKERAETLGVKYTALEV  308

Query  1135  SLKETVESLKEKGFF  1179
             +LK+TVESLK+K FF
Sbjct  309   TLKDTVESLKDKNFF  323



>gb|KGN48125.1| Cinnamoyl-CoA reductase [Cucumis sativus]
Length=612

 Score =   481 bits (1237),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/310 (71%), Positives = 271/310 (87%), Gaps = 0/310 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             +A KTVCVTG SGYIASWIVKFLLQRGY V+A+VR PDD  KT HL++L+GA ERLHLFK
Sbjct  4     VAAKTVCVTGGSGYIASWIVKFLLQRGYTVRASVRDPDDSIKTAHLVALDGADERLHLFK  63

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LLEEGSFDS + GC+GVFHTASPF+H+V+DPQAELI+PA+KGTLNVL S AK  SV++
Sbjct  64    ANLLEEGSFDSAIEGCQGVFHTASPFFHSVSDPQAELIEPALKGTLNVLNSVAKASSVKR  123

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAV+YN KP+TP+ +VDE+W+S  D C++ ++WY LSKTLAE+AAW FVKEKG
Sbjct  124   VVLTSSMAAVSYNTKPQTPQTIVDESWFSDPDMCRDQEIWYCLSKTLAEEAAWNFVKEKG  183

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I++VTINPAMVIGPLLQPTLNTS+ AILNLI+G ET+ N+++GW+NVKDVA AHI A E 
Sbjct  184   IDLVTINPAMVIGPLLQPTLNTSAQAILNLISGGETFPNSAFGWVNVKDVAKAHIEAYEI  243

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             P+ANGRYC++ER  HYSE+VK LH+LYP+++LP+K AD+K FV  YQVS EKAK+LG+ F
Sbjct  244   PTANGRYCLVERALHYSEIVKILHQLYPSIQLPQKAADEKLFVLAYQVSTEKAKSLGIDF  303

Query  1120  TPLEESLKET  1149
              PLE+SLKET
Sbjct  304   IPLEDSLKET  313


 Score =   405 bits (1042),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 235/287 (82%), Gaps = 11/287 (4%)
 Frame = +1

Query  319   VRYP-DDPKKTKHLLSLEGAKERLHLFKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTD  495
             +R P DDP KT HL++L GA ERLHLFKA+LLEEGSFDS + GC GVFHTASP +H+V+D
Sbjct  333   LRLPTDDPIKTAHLVALAGADERLHLFKANLLEEGSFDSAIEGCHGVFHTASPVFHSVSD  392

Query  496   PQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAAD  675
             PQAELIDPA+KGTLNVL S AK  SV++VV+TSS+AAV+YN KP+TP+ +VDE+W+S  D
Sbjct  393   PQAELIDPALKGTLNVLNSVAKASSVKRVVLTSSMAAVSYNTKPQTPQTIVDESWFSDPD  452

Query  676   FCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVTINPAMVIGPLLQPTLNTSSAAILNLIN  855
              C++ ++WY LSKTLAE+AAW FVKEKGI++VTINPAMVIGPLLQPTLNT          
Sbjct  453   MCRDQEIWYCLSKTLAEEAAWNFVKEKGIDLVTINPAMVIGPLLQPTLNTR---------  503

Query  856   GAETYSNASYGWINVKDVANAHILALENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRL  1035
               ET+ N+ +GW+NVKDVA  HI A E P+ANGRYC++ER  HYSE+VK LH+LYP+++L
Sbjct  504   -GETFPNSVFGWVNVKDVAKVHIEAYEIPTANGRYCLVERALHYSEIVKILHQLYPSIQL  562

Query  1036  PEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEESLKETVESLKEKGF  1176
             P++ AD+K FV  YQVS EKAK+LG+ F PLE+SLKETVESLKEK F
Sbjct  563   PQEAADEKLFVLAYQVSTEKAKSLGIDFIPLEDSLKETVESLKEKNF  609



>ref|XP_011080359.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum]
Length=323

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 224/323 (69%), Positives = 271/323 (84%), Gaps = 2/323 (1%)
 Frame = +1

Query  226   MKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKAD  405
             MKTVCVTGASGYIASW+VKFLLQRGY VKA VR  +DPKKT+HLL+L+GAKERL L KA+
Sbjct  1     MKTVCVTGASGYIASWLVKFLLQRGYTVKACVRDLNDPKKTEHLLALDGAKERLQLIKAN  60

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LL+EGSFD+ V GC+GVFHTASPF+    +PQAELIDPA+KGTLNVLGSCAK+PSV++VV
Sbjct  61    LLDEGSFDAAVDGCDGVFHTASPFHDPGDNPQAELIDPALKGTLNVLGSCAKSPSVKRVV  120

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +T+S+ +V  N +  +PEVV+DETWWS  DFC+  + WY LSKTLAE AAWKF KEKGI+
Sbjct  121   LTASVGSVYVNERTLSPEVVIDETWWSDLDFCRRTQQWYSLSKTLAEQAAWKFAKEKGID  180

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             ++ INP++VIGP+LQPTLNTSSA IL+++NGAETY N +YG +NVKDVANAHILA ENPS
Sbjct  181   LIVINPSLVIGPILQPTLNTSSAVILSMLNGAETYLNRTYGVVNVKDVANAHILAFENPS  240

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRY + E VAH+S +V+ L +LYPTL +PEKC DDK F P +Q+S+EKA+++GV F  
Sbjct  241   ANGRYILAESVAHFSRLVEILRELYPTLPIPEKCEDDK-FAPMHQLSREKAESIGVEFIS  299

Query  1126  LEESLKETVESLKEKGFF-VPSA  1191
             L ESLKETVESL EK F   PSA
Sbjct  300   LRESLKETVESLIEKKFLPAPSA  322



>gb|ACZ74591.1| cinnamoyl CoA reductase-like 2c [Panicum virgatum]
Length=327

 Score =   468 bits (1205),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 229/322 (71%), Positives = 265/322 (82%), Gaps = 11/322 (3%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             ++ A K VCVTGASGYIASWIVK LL RGY V+ATVR   DPKKT HL +L+GAK+RLH 
Sbjct  8     MTGAGKVVCVTGASGYIASWIVKLLLARGYTVRATVRDTADPKKTLHLSALDGAKDRLHF  67

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA LLEEGSFD+ V GCE VFHTASPFYHNV DP+AEL+DPAVKGTLNVLGSC K  S+
Sbjct  68    FKASLLEEGSFDAAVDGCETVFHTASPFYHNVKDPKAELLDPAVKGTLNVLGSCTKA-SI  126

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             +KVVVT S+AAVAYNGKPRTPEV+VDETW+S    C++ + WYVLSKTLAE+AAWKF ++
Sbjct  127   KKVVVTLSVAAVAYNGKPRTPEVIVDETWFSDPQICEKNQQWYVLSKTLAEEAAWKFSRD  186

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILA  930
              G+ +VTINPAMVIGPLLQPTLNTS+ AIL LING + TY N S+GW+NVKDVA AHILA
Sbjct  187   NGLEIVTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFSFGWVNVKDVALAHILA  246

Query  931   LENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLG  1110
              E PSA+GRYCM+ERVAHYSEVV  + K+         CADDKPFVPTYQVSKEK ++LG
Sbjct  247   YEVPSAHGRYCMVERVAHYSEVVNIIRKM---------CADDKPFVPTYQVSKEKIRSLG  297

Query  1111  VVFTPLEESLKETVESLKEKGF  1176
             +   PLE  ++ET+ESLKEKGF
Sbjct  298   IELIPLEMCIRETIESLKEKGF  319



>gb|ACZ74589.1| cinnamoyl CoA reductase-like 2a [Panicum virgatum]
Length=336

 Score =   469 bits (1206),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 235/322 (73%), Positives = 273/322 (85%), Gaps = 2/322 (1%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             ++ A K VCVTGASGYIASWIVK LL RGY V+ATVR   DPKKT HL +L+GAK+RLH 
Sbjct  8     MTGAGKVVCVTGASGYIASWIVKLLLARGYTVRATVRDTADPKKTLHLSALDGAKDRLHF  67

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA LLEEGSFD+ V GCE VFHTASPFYHNV DP+AEL+DPAVKGTLNVLGSC K  S+
Sbjct  68    FKASLLEEGSFDAAVDGCETVFHTASPFYHNVKDPKAELLDPAVKGTLNVLGSCTKA-SI  126

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             +KVVVTSS+AAVAYNGKPRTPEV+VDETW+S    C++ + WYVLSKTLAE+AAWKF ++
Sbjct  127   KKVVVTSSVAAVAYNGKPRTPEVIVDETWFSDPQICEKNQQWYVLSKTLAEEAAWKFSRD  186

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILA  930
              G+ +VTINPAMVIGPLLQPTLNTS+ AIL LING + TY N S+GW+NVKDVA AHILA
Sbjct  187   NGLEIVTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFSFGWVNVKDVALAHILA  246

Query  931   LENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLG  1110
              E PSA+GRYCM+ERVAHYSEVV  + K+YPT+ L +KCADDKPFVPTYQVSKEK ++LG
Sbjct  247   YEVPSAHGRYCMVERVAHYSEVVNIIRKMYPTIPLADKCADDKPFVPTYQVSKEKIRSLG  306

Query  1111  VVFTPLEESLKETVESLKEKGF  1176
             +   PLE  ++ET+ESLKEKGF
Sbjct  307   IELIPLEMCIRETIESLKEKGF  328



>ref|XP_011025487.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Populus 
euphratica]
Length=326

 Score =   468 bits (1204),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 221/318 (69%), Positives = 268/318 (84%), Gaps = 2/318 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K V VTGASGYIASW+VK LL+RGY VKA+VR P+D KKT+HLL+L GAKERL LFKADL
Sbjct  6     KVVSVTGASGYIASWLVKLLLERGYTVKASVRDPNDAKKTEHLLALGGAKERLQLFKADL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD VV GCE VFHTASPFY  V DPQAEL+DPA+KGT+NVL SC K PS+++VV+
Sbjct  66    LEEGSFDPVVEGCECVFHTASPFYFTVNDPQAELVDPALKGTVNVLRSCTKIPSIKRVVI  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV +NGK   P+VVVDETW+S +DFC++ K+WY LSKTLAE+AAWKF KE GI+M
Sbjct  126   TSSMAAVVFNGKSLAPDVVVDETWFSDSDFCEKSKLWYQLSKTLAEEAAWKFTKENGIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VT+NP +VIGPLLQPTLN S+ ++L+LINGA++Y N +Y W++V+DVA+AHI ALENPSA
Sbjct  186   VTLNPGLVIGPLLQPTLNQSAESVLDLINGAKSYPNTTYRWVDVRDVADAHIYALENPSA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPE--KCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             NGRYC++  V H SE VK L KLYP L +P+  +CADDKP +P YQVSKE+A +LGV +T
Sbjct  246   NGRYCLVGTVIHSSEAVKILSKLYPDLTIPKHGRCADDKPPMPKYQVSKERAASLGVKYT  305

Query  1123  PLEESLKETVESLKEKGF  1176
             PLE SLK+T+ESLKEK F
Sbjct  306   PLEASLKDTIESLKEKNF  323



>ref|XP_009395948.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Musa acuminata subsp. 
malaccensis]
Length=368

 Score =   468 bits (1205),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 222/320 (69%), Positives = 268/320 (84%), Gaps = 1/320 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S + K VCVTGASGYIASW+VK LLQRGY V+A+VR   DPKKT+HL +LEGA ERL  F
Sbjct  47    SGSGKVVCVTGASGYIASWLVKLLLQRGYTVRASVRDAADPKKTEHLRALEGASERLLFF  106

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LL+EGSFD+VV GC+GVFHTASPF+    DPQA++I+PAVKGTLNVL SC K  SV+
Sbjct  107   KANLLDEGSFDAVVNGCDGVFHTASPFHFAAADPQADIIEPAVKGTLNVLASCKKF-SVK  165

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VVVTSS+AAV YN KP+ P+VVVDETW+S  + CK  + WYVLSKTLAE+AAWKF KE 
Sbjct  166   RVVVTSSLAAVVYNDKPKNPDVVVDETWFSDPEVCKRDEQWYVLSKTLAEEAAWKFAKEN  225

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I++VTINP MV+GPLLQ TLNTSSA ILNLING+ T+ NA++GW+NV+DVA AHILA E
Sbjct  226   AIDIVTINPGMVVGPLLQSTLNTSSALILNLINGSSTFLNATFGWVNVQDVAKAHILAFE  285

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
              PSA+GRYC+ ERV+H+S++VK + +LYP L LPEKCADDKPFVP YQ+SKEK K+LG+ 
Sbjct  286   LPSASGRYCLAERVSHFSDIVKIIRELYPALPLPEKCADDKPFVPVYQISKEKYKSLGLD  345

Query  1117  FTPLEESLKETVESLKEKGF  1176
             + PLE S+KET+ESLKEK F
Sbjct  346   YIPLETSIKETIESLKEKNF  365



>ref|NP_001241540.1| uncharacterized protein LOC100799213 [Glycine max]
 gb|ACU19004.1| unknown [Glycine max]
 gb|KHN20641.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=328

 Score =   466 bits (1200),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 265/317 (84%), Gaps = 2/317 (1%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A K VCVTGASG+IASWIVKFLLQRGY V+ATVRYP + KK  HL+ LEGAKERL LFKA
Sbjct  6     AGKVVCVTGASGFIASWIVKFLLQRGYTVRATVRYPSNLKKVDHLVKLEGAKERLQLFKA  65

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             DLLEEGSFDSVV GC GVFHTASP    V DPQAEL+DPAVKGTLNVL SCAK+PSV++V
Sbjct  66    DLLEEGSFDSVVEGCHGVFHTASPVRFVVNDPQAELLDPAVKGTLNVLKSCAKSPSVKRV  125

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSSI+AVA+N +P+TP+VVVDETW+S  D C+E+++WY LSKTLAEDAAWKFV E  I
Sbjct  126   VLTSSISAVAFNRRPKTPQVVVDETWFSDPDVCRELELWYTLSKTLAEDAAWKFVNENSI  185

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +M++INP MV GPLLQP +N S   ILNLING + + N S+GW++VKDVANAHILA E  
Sbjct  186   DMISINPTMVAGPLLQPEINESVEPILNLING-KPFPNKSFGWVDVKDVANAHILAYEIA  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKA-KNLGVVF  1119
             SA+GRYC++ERV HYSE+   L  LYPTL++P+KC  D+P++PTYQ+S EKA K+LG+ F
Sbjct  245   SASGRYCLVERVIHYSELATILRGLYPTLQIPDKCEVDEPYIPTYQISTEKAKKDLGIEF  304

Query  1120  TPLEESLKETVESLKEK  1170
             TPLE SL+ETVES +EK
Sbjct  305   TPLEVSLRETVESFREK  321



>gb|AAD53967.1| aldehyde reductase [Vigna radiata]
Length=325

 Score =   466 bits (1200),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/321 (68%), Positives = 266/321 (83%), Gaps = 0/321 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             + A K VCVTGASGYIASW+VKFLL+RGY VKATVR  +DPKK  HLLSL+GAKERLHL 
Sbjct  3     TAAGKLVCVTGASGYIASWLVKFLLERGYTVKATVRDTNDPKKVDHLLSLDGAKERLHLV  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+LLEEGSFDS V G   VFHTASPF+++  DPQ EL+DPAVKGTLNVL SC  +P+++
Sbjct  63    KANLLEEGSFDSAVEGVHAVFHTASPFFNDAKDPQTELLDPAVKGTLNVLKSCVNSPTLK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSSIAAVA++ +P+ P+VVVDETW+S  ++CK   +WY LSKTLAEDAAWKF KE 
Sbjct  123   RVVLTSSIAAVAFSDRPKNPDVVVDETWYSDPEYCKRTGLWYNLSKTLAEDAAWKFAKEN  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
              I++VT+NPA+V+GPLLQP LNTS+A +L L+NGA+T+ NAS GW++VKDVA AHILA E
Sbjct  183   NIDLVTMNPALVVGPLLQPVLNTSAAIVLGLVNGAKTFKNASLGWVDVKDVALAHILAYE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             N SANGRY ++ERVAH+ +  K L  LYPTL++P+KC DDKP  P +QVSKEKAK+LG+ 
Sbjct  243   NASANGRYLLVERVAHFGDAAKILRDLYPTLQIPDKCEDDKPLEPIFQVSKEKAKSLGID  302

Query  1117  FTPLEESLKETVESLKEKGFF  1179
             + PLE SLK+TVESLKEK F 
Sbjct  303   YIPLEVSLKDTVESLKEKKFL  323



>ref|XP_007149030.1| hypothetical protein PHAVU_005G034600g [Phaseolus vulgaris]
 gb|ESW21024.1| hypothetical protein PHAVU_005G034600g [Phaseolus vulgaris]
Length=325

 Score =   465 bits (1196),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 214/318 (67%), Positives = 270/318 (85%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A + VCVTGASGYIASW+VKFLL+RGY VKATVR P++  K  HLL+L+GAKERLHL KA
Sbjct  5     AGQVVCVTGASGYIASWVVKFLLERGYTVKATVRDPNNSSKVDHLLNLDGAKERLHLVKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS V G   VFHTASPF++N  DPQ EL+DPA+KGTLNVL SC K+P++++V
Sbjct  65    NLLEEGSFDSAVEGVHAVFHTASPFFNNAKDPQTELLDPALKGTLNVLKSCVKSPTLKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAV++N +P+TP+VVVDETW+S  ++CKE  +WY LSKTLAEDAAWKF KE  I
Sbjct  125   VLTSSVAAVSFNYRPKTPDVVVDETWYSDPEYCKENGLWYNLSKTLAEDAAWKFAKENNI  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             ++VT+NPA+V+GPLLQP LNTSSA +L+L++G+ T+ N + GW++V+DVA AHILA E+ 
Sbjct  185   DLVTMNPALVVGPLLQPELNTSSAMVLSLVDGSPTFGNVTLGWVDVRDVAMAHILAYESA  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SANGRY ++ERVAH+S+VVK L  LYPTL+LPEKC DDKP+ P +QVSKEKAK+LG+ + 
Sbjct  245   SANGRYVLVERVAHFSDVVKFLRDLYPTLQLPEKCVDDKPYDPIFQVSKEKAKSLGIEYI  304

Query  1123  PLEESLKETVESLKEKGF  1176
             PLE S+K+TVESLKEK F
Sbjct  305   PLEVSIKDTVESLKEKNF  322



>emb|CBI40606.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   464 bits (1195),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 216/322 (67%), Positives = 266/322 (83%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +++A K VCVTG +GYIASW+VK LL RGY VKAT+R PDDPKKT+HLL+L+GAKERLHL
Sbjct  3     VAVAEKVVCVTGGAGYIASWLVKLLLLRGYTVKATLRNPDDPKKTEHLLALKGAKERLHL  62

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSFDS+V GCEGVFHTASP    VTDP+ ELIDPAVKGTLNVL SCAK P++
Sbjct  63    FKADLLEEGSFDSIVEGCEGVFHTASPVLLEVTDPKVELIDPAVKGTLNVLRSCAKVPAI  122

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSSI AV YNGKP T +V+VDETW+S   FC+E K+WYVLSKTLAE+AAWKF KE
Sbjct  123   RRVVVTSSIVAVIYNGKPLTSDVIVDETWFSDPAFCEESKLWYVLSKTLAEEAAWKFAKE  182

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
              GI++VT+NP ++IGP LQPT+N +   ILN+IN   T+ +++Y W++V+DVANAHI A 
Sbjct  183   HGIDLVTMNPGVMIGPPLQPTINLTMEIILNMINVPYTFPSSTYKWVDVRDVANAHIQAF  242

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E  SA+GRYCM+ER+ + SE +K LH+LYP + LP+K ADD+P  PTYQ+SKEK K+L +
Sbjct  243   EISSASGRYCMVERITYRSEAIKILHELYPAIHLPQKSADDEPLGPTYQISKEKVKSLAI  302

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              F PLE SLK+T+ESLKEK F 
Sbjct  303   DFIPLEVSLKDTIESLKEKNFI  324



>ref|XP_009413953.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=323

 Score =   463 bits (1191),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 228/321 (71%), Positives = 277/321 (86%), Gaps = 1/321 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S   K VCVTGASG+IASW+VKFLLQRGY V+A+VR P D KKT+HL +LEGA ERL L
Sbjct  1     MSGGGKVVCVTGASGFIASWLVKFLLQRGYTVRASVRDPADQKKTQHLRALEGATERLLL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+L EEGSFD VV GC+GVFHTASP+Y+ VT+PQAE+I+PAVKGTLNVL SC K+ SV
Sbjct  61    FKANLSEEGSFDVVVEGCDGVFHTASPYYYAVTNPQAEIIEPAVKGTLNVLASCKKS-SV  119

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             +KVVVTSS+AAVA N KPRTP+VVVDETW+S+ + C++ K WYVLSKTLAE+A WKF KE
Sbjct  120   KKVVVTSSMAAVACNSKPRTPDVVVDETWFSSPEVCEQQKKWYVLSKTLAEEAGWKFSKE  179

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
              G+++ TINP MV+GPLLQ TLNTSSAAILNLING+ T+ NA+YGW+NV+DVA AH+LA 
Sbjct  180   NGMDIATINPGMVMGPLLQSTLNTSSAAILNLINGSSTFPNATYGWVNVQDVAMAHVLAF  239

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRYC++ERV HYSE++K +H+LYP+ +LP+KCADDKPFVP YQVSKEK K+LG+
Sbjct  240   ELPSASGRYCLVERVVHYSELLKIIHELYPSFQLPDKCADDKPFVPVYQVSKEKFKSLGL  299

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              + PLE S+KET+ESLKEK F
Sbjct  300   DYIPLETSIKETIESLKEKNF  320



>gb|EMS47957.1| Dihydroflavonol-4-reductase [Triticum urartu]
Length=346

 Score =   463 bits (1191),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 224/337 (66%), Positives = 267/337 (79%), Gaps = 22/337 (7%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LL RGY V+ATVR   DPK+T HL +L+GAK+RLHLFKA L
Sbjct  3     KVVCVTGASGYIASWLVKLLLHRGYTVRATVRDTADPKRTLHLQALDGAKDRLHLFKASL  62

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD+ VAGC+ VFHTASPFYHNV DP+AEL+DPAV GTLNVL SC K  S+++V++
Sbjct  63    LEEGSFDAAVAGCDCVFHTASPFYHNVKDPKAELLDPAVNGTLNVLRSCKKA-SIKRVII  121

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMK-----------------MWYVLSKT  717
             TSS+AAVAYNGKPRTP+VVVDETW+S+A+ C++ +                  WYVLSKT
Sbjct  122   TSSMAAVAYNGKPRTPDVVVDETWFSSAEVCEKNEGDTIVVEDLGFVFSHKDQWYVLSKT  181

Query  718   LAEDAAWKFVKEKGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETY----SNASY  885
             LAE+AAWKF  + G  +VTINPAMVIGPLLQPTLNTS  AIL  ING   +     N S+
Sbjct  182   LAEEAAWKFANDNGFEIVTINPAMVIGPLLQPTLNTSVEAILKFINGMSDHLLHNPNFSF  241

Query  886   GWINVKDVANAHILALENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPF  1065
             GW+NVKDVA AHILA E PSANGRYCM+ERVAH+SE+VK +H++YP   +P+KCADD PF
Sbjct  242   GWVNVKDVALAHILAYEVPSANGRYCMVERVAHHSEIVKIIHEMYPNFPVPDKCADDAPF  301

Query  1066  VPTYQVSKEKAKNLGVVFTPLEESLKETVESLKEKGF  1176
             VP YQVSK+K ++LG+   PLE SLKET+ESL+EKGF
Sbjct  302   VPIYQVSKDKIRSLGMELIPLETSLKETIESLREKGF  338



>ref|XP_003607372.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AES89569.1| cinnamoyl-CoA reductase-like protein [Medicago truncatula]
Length=327

 Score =   462 bits (1188),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 218/316 (69%), Positives = 256/316 (81%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASW+VKFLLQRGY V+ATVR P +  K  HLL L+GAKERL LFKADL
Sbjct  9     KVVCVTGASGFIASWVVKFLLQRGYTVRATVRDPSNSNKVDHLLKLDGAKERLQLFKADL  68

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSV+ GC GVFHTASP +  VTDPQ +LIDPAVKGTLNV+ SCAK+PSVQ+VV+
Sbjct  69    LEEGSFDSVIQGCHGVFHTASPVHFVVTDPQTQLIDPAVKGTLNVVKSCAKSPSVQRVVL  128

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIA   Y GKPRTPEV VDETW+S  DF  + KMWY  +KT AE+AA KF+ E  I+ 
Sbjct  129   TSSIATALYTGKPRTPEVEVDETWFSNQDFLWQNKMWYQFAKTSAEEAATKFLTENNIDH  188

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V +NPA+ +GPLLQ  LN SS  ILNLING+ETY NA++GWINVKD+ANAHI A EN SA
Sbjct  189   VVMNPAVALGPLLQSELNESSTLILNLINGSETYMNAAFGWINVKDIANAHIQAYENASA  248

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERV H+SE+ K L  +YPTL++P+KCADDKP + T+QVSKEKAK LGV F PL
Sbjct  249   SGRYCLVERVIHFSELAKILRDMYPTLQIPDKCADDKPLMQTFQVSKEKAKTLGVEFIPL  308

Query  1129  EESLKETVESLKEKGF  1176
             E SL+E VES K+K F
Sbjct  309   EVSLREIVESFKDKKF  324



>ref|XP_004505624.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Cicer arietinum]
Length=325

 Score =   461 bits (1187),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 218/316 (69%), Positives = 257/316 (81%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLLQRGY V+ATVR P +PKK  HLL L+GAKERL LFKADL
Sbjct  7     KVVCVTGASGYIASWVVKFLLQRGYTVRATVRDPSNPKKVDHLLKLDGAKERLQLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSV+ GC GVFHTAS       DPQ +LIDPAVKGTLNV+ SCAK+PSV++VVV
Sbjct  67    LEEGSFDSVIQGCHGVFHTASAVLFVFDDPQTQLIDPAVKGTLNVVKSCAKSPSVKRVVV  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIA   YNG PRTPEVVVDETW+S +DF  E KMWY  +KT AE+ A KF+ E  I+ 
Sbjct  127   TSSIATALYNGAPRTPEVVVDETWFSNSDFLWEQKMWYQYAKTSAEEVATKFLTENNIDY  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V +NPA+ IGPLLQP LN SS  +LNL+NG+ET+ NA++GW+NVKDVANAHI A E+ SA
Sbjct  187   VVMNPAVTIGPLLQPELNGSSNLVLNLLNGSETFMNAAFGWVNVKDVANAHIEAYEDGSA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC+ ERV H+SE+   L ++YPTL++P+KCADDKP++ T+QVSKEKAK LG+ F PL
Sbjct  247   SGRYCLCERVIHFSELTNILRRMYPTLQIPDKCADDKPYMQTFQVSKEKAKTLGIEFIPL  306

Query  1129  EESLKETVESLKEKGF  1176
             EESLKE VES KEK F
Sbjct  307   EESLKEIVESFKEKKF  322



>gb|EYU46247.1| hypothetical protein MIMGU_mgv1a010028mg [Erythranthe guttata]
Length=291

 Score =   460 bits (1183),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 224/324 (69%), Positives = 257/324 (79%), Gaps = 33/324 (10%)
 Frame = +1

Query  226   MKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKAD  405
             MKTVCVTGASGYIASWIVKFLL+RGY VKA+VR   DP KT+HLL+L+GAKERLHL KA+
Sbjct  1     MKTVCVTGASGYIASWIVKFLLRRGYTVKASVRDTSDPNKTQHLLALDGAKERLHLIKAN  60

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LLEEGSFD+VV GC+GVFHTASPF+ + TDP+AELI+PA+KGTLNVL SCAKTP+V++VV
Sbjct  61    LLEEGSFDAVVDGCDGVFHTASPFFLSTTDPEAELINPALKGTLNVLRSCAKTPTVKRVV  120

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +TSSI AV  NGKPRTPEVVVDETWWS   FC++M+ WY+LSKTLAE+AAWKFVKEK   
Sbjct  121   LTSSIVAVFANGKPRTPEVVVDETWWSDPLFCRQMQQWYMLSKTLAEEAAWKFVKEK---  177

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
                                           GAE Y N + GW+NVKDVANAHILA ENPS
Sbjct  178   ------------------------------GAEAYPNVTSGWVNVKDVANAHILAFENPS  207

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRYCM+E VAH+SE+   L  LYPT RLPEKCADDKPFVPTYQVSKE+AK+LGV FTP
Sbjct  208   ANGRYCMVESVAHFSEIANILRGLYPTFRLPEKCADDKPFVPTYQVSKERAKSLGVEFTP  267

Query  1126  LEESLKETVESLKEKGFFVPSAAL  1197
             LEES+KETVESL+EK F  P+ A+
Sbjct  268   LEESIKETVESLEEKNFVKPTPAI  291



>ref|XP_009120887.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X2 [Brassica rapa]
Length=279

 Score =   459 bits (1181),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 214/272 (79%), Positives = 243/272 (89%), Gaps = 0/272 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLL RGY VKA+VR P DPKKT+HL+SL+GAKERLHLFKADL
Sbjct  8     KVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLDGAKERLHLFKADL  67

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GCEGVFHTASPFYH+V DPQAELIDPAVKGTLNVL SC K  SV++VVV
Sbjct  68    LEEGSFDSAIDGCEGVFHTASPFYHDVKDPQAELIDPAVKGTLNVLNSCTKASSVKRVVV  127

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+V VDETW+S  + CK  KMWYVLSKTLAEDAAWKF KEK +++
Sbjct  128   TSSMAAVAYNGKPRTPDVTVDETWFSDPEVCKTSKMWYVLSKTLAEDAAWKFAKEKDLDI  187

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINPAMVIGPLLQPTLNTS+AAILN INGA+T+SN+++GW+NVKDVANAHI A E PSA
Sbjct  188   VTINPAMVIGPLLQPTLNTSAAAILNFINGAKTFSNSTFGWVNVKDVANAHIQAYEVPSA  247

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEK  1044
             NGRYCM+ERV H+SE+V  L +LYP L+LPE+
Sbjct  248   NGRYCMVERVLHHSEIVNILRQLYPNLQLPER  279



>ref|XP_003634871.2| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Vitis vinifera]
Length=327

 Score =   461 bits (1185),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 216/323 (67%), Positives = 266/323 (82%), Gaps = 1/323 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +++A K VCVTG +GYIASW+VK LL RGY VKAT+R PDDPKKT+HLL+L+GAKERLHL
Sbjct  3     VAVAEKVVCVTGGAGYIASWLVKLLLLRGYTVKATLRNPDDPKKTEHLLALKGAKERLHL  62

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSFDS+V GCEGVFHTASP    VTDP+ ELIDPAVKGTLNVL SCAK P++
Sbjct  63    FKADLLEEGSFDSIVEGCEGVFHTASPVLLEVTDPKVELIDPAVKGTLNVLRSCAKVPAI  122

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSSI AV YNGKP T +V+VDETW+S   FC+E K+WYVLSKTLAE+AAWKF KE
Sbjct  123   RRVVVTSSIVAVIYNGKPLTSDVIVDETWFSDPAFCEESKLWYVLSKTLAEEAAWKFAKE  182

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAE-TYSNASYGWINVKDVANAHILA  930
              GI++VT+NP ++IGP LQPT+N +   ILN+IN    T+ +++Y W++V+DVANAHI A
Sbjct  183   HGIDLVTMNPGVMIGPPLQPTINLTMEIILNMINEVPYTFPSSTYKWVDVRDVANAHIQA  242

Query  931   LENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLG  1110
              E  SA+GRYCM+ER+ + SE +K LH+LYP + LP+K ADD+P  PTYQ+SKEK K+L 
Sbjct  243   FEISSASGRYCMVERITYRSEAIKILHELYPAIHLPQKSADDEPLGPTYQISKEKVKSLA  302

Query  1111  VVFTPLEESLKETVESLKEKGFF  1179
             + F PLE SLK+T+ESLKEK F 
Sbjct  303   IDFIPLEVSLKDTIESLKEKNFI  325



>ref|XP_009413950.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=323

 Score =   459 bits (1181),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 226/322 (70%), Positives = 276/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S   K VCVTGASG+IASW+VK LLQRGY V+A+VR P D KKT+HL +LEGA ERL L
Sbjct  1     MSGGGKVVCVTGASGFIASWLVKLLLQRGYTVRASVRDPADQKKTQHLRALEGATERLLL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             +KA+LLEEGSFD+VV GC+GVFHTASP Y  +T+PQAE+I+PAVKGTLNVL SC K+ SV
Sbjct  61    YKANLLEEGSFDAVVEGCDGVFHTASPLYLALTNPQAEIIEPAVKGTLNVLASCKKS-SV  119

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             +KVVVTSS+AAVA N KPRTP+VVVDETW+S+ + C++ K WYVLSKTLAE+A WKF KE
Sbjct  120   KKVVVTSSMAAVACNSKPRTPDVVVDETWFSSPEVCEQQKKWYVLSKTLAEEAGWKFSKE  179

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
              G+++ TINP MV+GPLLQ TLNTSSAAILNLING+ T+ NA+YGW+NV+DVA AH+LA 
Sbjct  180   NGMDIATINPGMVMGPLLQSTLNTSSAAILNLINGSSTFPNATYGWVNVQDVAMAHVLAF  239

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA+GRYC++ERV HYSE++K +H+LYP+ +LP+KCADDKPFVP YQVSKEK K+LG+
Sbjct  240   ELPSASGRYCLVERVVHYSELLKIIHELYPSFQLPDKCADDKPFVPVYQVSKEKFKSLGL  299

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              + PLE S+KET+ESLKEK F 
Sbjct  300   DYIPLETSIKETIESLKEKNFI  321



>ref|XP_003633516.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X1 [Vitis vinifera]
 emb|CBI29103.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   459 bits (1181),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 219/316 (69%), Positives = 264/316 (84%), Gaps = 1/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY VKATVR P+DPKKT+HLL+LEGAKERLHLFKA+L
Sbjct  6     KVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALEGAKERLHLFKANL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP    V DPQA+LIDPA+KGT++VLGSCAK PSV++VVV
Sbjct  66    LEEGSFDSVVDGCDGVFHTASPVVLIVDDPQAQLIDPALKGTMSVLGSCAKVPSVKRVVV  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+A+VA+NGKP  P+V+VDE+W+S   FC++ K+WY+LSKTLAE+AAWKF KE GI+M
Sbjct  126   TSSMASVAFNGKPLAPDVLVDESWFSDPVFCEKSKLWYMLSKTLAEEAAWKFAKENGIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINP  VIGPLLQPTLN S   +L L+ G +T+ N ++ W++V+DVA AHI A E P+A
Sbjct  186   VTINPGWVIGPLLQPTLNLSVEEVLKLLKG-DTFPNKTHRWVDVRDVAMAHIQAYELPTA  244

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
              GRYC++  + H SE +K L KLYP L LPEKCADDKP+ P Y VS+EK K+LG+ FTPL
Sbjct  245   RGRYCLVGSILHCSETMKILRKLYPALNLPEKCADDKPYEPAYMVSQEKTKSLGIDFTPL  304

Query  1129  EESLKETVESLKEKGF  1176
             E SLK+TVESL+EK F
Sbjct  305   EVSLKDTVESLREKNF  320



>emb|CBI24952.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   459 bits (1180),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 223/317 (70%), Positives = 262/317 (83%), Gaps = 1/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASW+VK LLQ  Y VKATVR P+DPKKT+HLLSL+GAKERLHLFKADL
Sbjct  7     KVVCVTGASGFIASWLVKLLLQHDYTVKATVRDPNDPKKTQHLLSLDGAKERLHLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP   +V +PQAELIDPA+KGT+NVL SCAK PSV++VVV
Sbjct  67    LEEGSFDSVVDGCDGVFHTASPVAMDVVNPQAELIDPALKGTINVLRSCAKFPSVKRVVV  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV + GKP T EV++DE+W+S    CKE K+WYVLSKTLAE+AAWKF KE GI+M
Sbjct  127   TSSMAAVVFTGKPLTSEVLIDESWFSDPVLCKESKLWYVLSKTLAEEAAWKFSKENGIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGA-ETYSNASYGWINVKDVANAHILALENPS  945
             VTINPA VIGPL+QPTLN S+  +LNLIN   +     SY  ++V+DVANAHI A E P 
Sbjct  187   VTINPAWVIGPLIQPTLNLSAEVVLNLINDTLQQLMKISYRLVDVRDVANAHIQAYEIPE  246

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             A+GRYC++E+  HYSE VK L KLYP L LPEKCADDKP+ P+ +VS+EK K+LG+ FTP
Sbjct  247   ASGRYCLVEKDLHYSETVKILRKLYPELPLPEKCADDKPYAPSSRVSQEKVKSLGIHFTP  306

Query  1126  LEESLKETVESLKEKGF  1176
             LE SLK+TVESLKEK F
Sbjct  307   LEVSLKDTVESLKEKNF  323



>ref|XP_007163919.1| hypothetical protein PHAVU_L005800g [Phaseolus vulgaris]
 gb|ESW35913.1| hypothetical protein PHAVU_L005800g [Phaseolus vulgaris]
Length=325

 Score =   458 bits (1179),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 215/318 (68%), Positives = 261/318 (82%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A + VCVTGASGYIASW+VKFLLQRGY VKATVR   DPKK  HLL+L+GAK+RLHL KA
Sbjct  5     AGQVVCVTGASGYIASWLVKFLLQRGYTVKATVRDLSDPKKVDHLLNLDGAKQRLHLVKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS V GC  VFHTASPF+    DPQ EL+DPAVKGTLNVL SC  +P++++V
Sbjct  65    NLLEEGSFDSAVQGCHAVFHTASPFFSGAKDPQTELLDPAVKGTLNVLKSCVNSPTLKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AA+  N +P+TP+VVVDETW+S  +FC++   WY LSKTLAE+ AWKF KE  I
Sbjct  125   VLTSSVAALLNNERPKTPDVVVDETWFSDPEFCRKNGGWYNLSKTLAEEVAWKFAKENNI  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             ++VTINPA+V GPLLQP LNTS+AA+LN +NG+ T+ N + GWI+V+DVANAHILA EN 
Sbjct  185   DLVTINPALVTGPLLQPVLNTSAAAVLNFVNGSPTFRNVTLGWIDVRDVANAHILAYENA  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SANGRY ++ERV H+S  +K L  LYPT++LPEKC DDKP+   YQVSKEKAK+LG+ +T
Sbjct  245   SANGRYLLVERVEHHSNAIKILRDLYPTIQLPEKCIDDKPYPAIYQVSKEKAKSLGLEYT  304

Query  1123  PLEESLKETVESLKEKGF  1176
             PLE SLK+TVESLKEK F
Sbjct  305   PLEVSLKDTVESLKEKKF  322



>emb|CBI29100.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   457 bits (1177),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 218/316 (69%), Positives = 264/316 (84%), Gaps = 1/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY VKATVR P+DPKKT+HLL+LEGAKERLHLF+A+L
Sbjct  6     KVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALEGAKERLHLFEANL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP    V DPQA+LIDPA+KGT+NVLGSCAK PSV++VVV
Sbjct  66    LEEGSFDSVVDGCDGVFHTASPVVMIVDDPQAQLIDPALKGTMNVLGSCAKVPSVKRVVV  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+A+VA+NGK   P+V+VDE+W+S   FC++ K+WY+LSKTLAE+AAWKF KE GI+M
Sbjct  126   TSSMASVAFNGKHLAPDVLVDESWFSDPVFCEKSKLWYMLSKTLAEEAAWKFAKENGIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINP  VIGPLLQPTLN S   +L L+ G +T+ N ++ W++V+DVA AHI A E P+A
Sbjct  186   VTINPGWVIGPLLQPTLNLSVEEVLKLLKG-DTFPNKTHRWVDVRDVAMAHIQAYELPTA  244

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
              GRYC++  + H SE +K L KLYP L LPEKCADDKP+ PTY VS+EK K+LG+ FTPL
Sbjct  245   RGRYCLVGSILHCSETMKILRKLYPALNLPEKCADDKPYEPTYMVSQEKTKSLGIDFTPL  304

Query  1129  EESLKETVESLKEKGF  1176
             E S+K+TVESL+EK F
Sbjct  305   EVSMKDTVESLREKNF  320



>ref|XP_010673673.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=325

 Score =   457 bits (1177),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 215/318 (68%), Positives = 262/318 (82%), Gaps = 1/318 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY VKATVR P+DPKK  HL SL+GAKERLHL  A+L
Sbjct  6     KVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKVDHLRSLDGAKERLHLLPANL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD+ V GCEGVFHTASPF+++  DP+AEL+ PA+KGTLNVL SCAK PS+++VV+
Sbjct  66    LEEGSFDAAVEGCEGVFHTASPFFNDTKDPEAELLVPALKGTLNVLNSCAKVPSIKRVVL  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS AAV  NG+P +PEVVVDE+W+S  +FC++ KMWYVLSKTLAE+AAWK  KEKGI++
Sbjct  126   TSSTAAVVCNGRPLSPEVVVDESWFSDPEFCRKFKMWYVLSKTLAEEAAWKLAKEKGIDL  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINP MVIGPLLQPTLNTS+A I +L +G+ETY N ++ W++VKDVA AHIL+ E PSA
Sbjct  186   VTINPGMVIGPLLQPTLNTSAATIASLFSGSETYPNMTFAWVHVKDVATAHILSFEVPSA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCA-DDKPFVPTYQVSKEKAKNLGVVFTP  1125
              GRYC++E V  Y+E+VK L +LYP   LPEKCA D+     +YQVSKEK+++LG+ + P
Sbjct  246   EGRYCLVETVTSYAEIVKILKELYPNASLPEKCAIDNNLLKASYQVSKEKSQSLGIDYIP  305

Query  1126  LEESLKETVESLKEKGFF  1179
                SL+ETVESLKEKGF 
Sbjct  306   FRTSLQETVESLKEKGFI  323



>gb|AES68255.2| cinnamyl-alcohol dehydrogenase-like protein [Medicago truncatula]
Length=295

 Score =   456 bits (1172),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 221/314 (70%), Positives = 258/314 (82%), Gaps = 31/314 (10%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             VCVTGASGYIASW+V+ LL RGY VKATVR P+DPKK  HL+ L+GAKERL LFK     
Sbjct  10    VCVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFK-----  64

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
                                       DPQAELIDPA+KGTLNVL SCAK+PS+++VV+TS
Sbjct  65    --------------------------DPQAELIDPALKGTLNVLNSCAKSPSLKRVVLTS  98

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             SIAAVAYNGKPRTP+VVVDETW++ ADFC +  +WYV+SKTLAE+AAWKFVKE  I+MVT
Sbjct  99    SIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENNIDMVT  158

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INPAMVIGPLLQP LNTS+AAILNLINGA+T+ NAS+GW+NVKDVANAHILA EN SA+G
Sbjct  159   INPAMVIGPLLQPVLNTSAAAILNLINGAQTFPNASFGWVNVKDVANAHILAYENASASG  218

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             R+C++ERVAHYSEVV+ L +LYP+L+LPEKCADDKP+VP YQVSKEKAK+LG+ +TPLE 
Sbjct  219   RHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGLEYTPLEV  278

Query  1135  SLKETVESLKEKGF  1176
             S+KETVESLKEK F
Sbjct  279   SIKETVESLKEKKF  292



>ref|XP_007163918.1| hypothetical protein PHAVU_L005700g [Phaseolus vulgaris]
 gb|ESW35912.1| hypothetical protein PHAVU_L005700g [Phaseolus vulgaris]
Length=325

 Score =   457 bits (1175),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 217/318 (68%), Positives = 261/318 (82%), Gaps = 0/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A + VCVTGASG+IASW+VKFLLQRGY VKATVR   DPKK  HLL+L+GAKERLHL KA
Sbjct  5     AGQVVCVTGASGFIASWLVKFLLQRGYTVKATVRDLSDPKKVDHLLNLDGAKERLHLVKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS V GC  VFHTASPF+    DPQ EL+DPAVKGTLNVL SC  +P++++V
Sbjct  65    NLLEEGSFDSAVQGCHAVFHTASPFFMGAKDPQTELLDPAVKGTLNVLKSCVNSPTLKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAV  N +P+TP+VVVDETW+S  +FC++   WY LSKTLAE+AAWKF KE  I
Sbjct  125   VLTSSVAAVVNNERPKTPDVVVDETWFSDPEFCRKNGGWYDLSKTLAEEAAWKFAKEHNI  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             ++VTINPA+V GPLLQP LNTS+AA+LN +NG+ T+ N + GWI+V+DVA AHILA EN 
Sbjct  185   DLVTINPALVSGPLLQPVLNTSAAAVLNFVNGSPTFKNITLGWIDVRDVAMAHILAYENA  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SANGRY ++ERV H+S  VK L  LYPT++LPEKC DDKP+   YQVSKEKAK+LG+ +T
Sbjct  245   SANGRYLLVERVEHHSNAVKILRDLYPTIQLPEKCIDDKPYPAIYQVSKEKAKSLGLEYT  304

Query  1123  PLEESLKETVESLKEKGF  1176
             PLE SLK+TVESLKEK F
Sbjct  305   PLEVSLKDTVESLKEKKF  322



>ref|XP_003598003.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AES68254.1| cinnamyl-alcohol dehydrogenase-like protein [Medicago truncatula]
Length=279

 Score =   455 bits (1170),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 211/270 (78%), Positives = 246/270 (91%), Gaps = 0/270 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             VCVTGASGYIASW+V+ LL RGY VKATVR P+DPKK  HL+ L+GAKERL LFKA+LLE
Sbjct  10    VCVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLE  69

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EG+FDSVV GC GVFHTASPFYH+V DPQAELIDPA+KGTLNVL SCAK+PS+++VV+TS
Sbjct  70    EGAFDSVVQGCHGVFHTASPFYHDVKDPQAELIDPALKGTLNVLNSCAKSPSLKRVVLTS  129

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             SIAAVAYNGKPRTP+VVVDETW++ ADFC +  +WYV+SKTLAE+AAWKFVKE  I+MVT
Sbjct  130   SIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENNIDMVT  189

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INPAMVIGPLLQP LNTS+AAILNLINGA+T+ NAS+GW+NVKDVANAHILA EN SA+G
Sbjct  190   INPAMVIGPLLQPVLNTSAAAILNLINGAQTFPNASFGWVNVKDVANAHILAYENASASG  249

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEK  1044
             R+C++ERVAHYSEVV+ L +LYP+L+LPEK
Sbjct  250   RHCLVERVAHYSEVVRILRELYPSLQLPEK  279



>ref|XP_009354348.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X3 [Pyrus x 
bretschneideri]
Length=630

 Score =   467 bits (1202),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 221/338 (65%), Positives = 269/338 (80%), Gaps = 0/338 (0%)
 Frame = +1

Query  166   NLRASEWrrkrarrrrISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKK  345
             N RA     K     R+S   K VCVTGASG+IASW+VKFLLQ+GY VKATVR P DPKK
Sbjct  293   NERAQSLGVKFTPLERMSGGSKVVCVTGASGFIASWVVKFLLQKGYTVKATVRDPIDPKK  352

Query  346   TKHLLSLEGAKERLHLFKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAV  525
             T+HLLSL+GAKERLHLFKADLLEEGSFD+V+ GCEGVFH ASP   +VTDPQAELIDPAV
Sbjct  353   TQHLLSLDGAKERLHLFKADLLEEGSFDAVIDGCEGVFHMASPVLMSVTDPQAELIDPAV  412

Query  526   KGTLNVLGSCAKTPSVQKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYV  705
             KGTLNVL SCAK PS+++VV+TSSI ++ + GKP + + VVDE+W+S   FC++ K+WY 
Sbjct  413   KGTLNVLRSCAKFPSIKRVVLTSSIVSIVFTGKPLSADTVVDESWFSDPAFCEKAKLWYA  472

Query  706   LSKTLAEDAAWKFVKEKGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASY  885
             LSKTLAE+AAWKF KE GI++V +NP M IGPLLQPTLN+SS  +L L +G   + N ++
Sbjct  473   LSKTLAEEAAWKFAKENGIDLVALNPGMAIGPLLQPTLNSSSEPLLKLFDGTGKFPNVTH  532

Query  886   GWINVKDVANAHILALENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPF  1065
              W++V+D+ANAHILA ENPSA+GRY ++  VAHYS  VK L  L+P L LPEKCADD+PF
Sbjct  533   RWVDVRDIANAHILAFENPSASGRYSIVGSVAHYSVAVKILRDLFPALSLPEKCADDQPF  592

Query  1066  VPTYQVSKEKAKNLGVVFTPLEESLKETVESLKEKGFF  1179
              PTY +SKE+A+ LGVV TPLE +LK+ VESLK+K FF
Sbjct  593   APTYHISKERAETLGVVCTPLEVTLKDAVESLKQKNFF  630


 Score =   454 bits (1167),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 212/306 (69%), Positives = 256/306 (84%), Gaps = 1/306 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             + A K V VTGASGYIASW+VK LLQRGY VKA+VR P+D KKT HLL+L+GAKERL LF
Sbjct  4     TRATKVVSVTGASGYIASWLVKLLLQRGYTVKASVRDPNDKKKTAHLLALDGAKERLQLF  63

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KADLLEEGSFDS+V G EGVFHTASPFYHNV+DPQAELIDPA+KGTLNVL SCAK PS++
Sbjct  64    KADLLEEGSFDSLVEGSEGVFHTASPFYHNVSDPQAELIDPALKGTLNVLRSCAKVPSIK  123

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+AAVA+NGKP  P+VVVDE+W+S    C++ K+WY++SKTLAE+AAWKF KE 
Sbjct  124   RVVITSSMAAVAFNGKPLAPDVVVDESWFSDVAVCEKSKLWYMISKTLAEEAAWKFAKEN  183

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI++ TINP +V GPLLQPTLNTS   +L L+N AE + N +Y W++V+DVA AHILALE
Sbjct  184   GIDIATINPGLVTGPLLQPTLNTSVEPVLKLVN-AERFPNTTYRWVDVRDVATAHILALE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             N SA+GRYC++ RV H S+ V  L  L+P L+LPE+CADDKPF PTYQVS E+A++LGV 
Sbjct  243   NASASGRYCLVGRVIHSSDTVNILRDLFPALKLPEECADDKPFTPTYQVSNERAQSLGVK  302

Query  1117  FTPLEE  1134
             FTPLE 
Sbjct  303   FTPLER  308



>ref|XP_004171433.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like [Cucumis 
sativus]
 gb|KGN48124.1| hypothetical protein Csa_6G439410 [Cucumis sativus]
Length=278

 Score =   454 bits (1168),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 211/274 (77%), Positives = 246/274 (90%), Gaps = 0/274 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A KTVCVTG SGYIASWIVKFLLQRGY VKA+VR P DP KT HLLSL+GA ERLHLFKA
Sbjct  5     AAKTVCVTGGSGYIASWIVKFLLQRGYTVKASVRNPADPIKTAHLLSLDGAAERLHLFKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFDS + GC+GVFHTASPF+HNVTDPQAELIDPA+KGTLNVL S AK+ SV++V
Sbjct  65    NLLEEGSFDSAIEGCQGVFHTASPFFHNVTDPQAELIDPALKGTLNVLKSVAKSSSVKRV  124

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAVAY+G+PR P+ V+DETW+S  + CKEMK+WYVLSKTLAE+AAW FVKEKGI
Sbjct  125   VLTSSMAAVAYSGQPRNPDTVIDETWFSNPEICKEMKLWYVLSKTLAEEAAWNFVKEKGI  184

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +MVTINPAMVIGPLLQPTLNTS+ AILNLI+GA+T+ N+++GW+NVKDVANAHILA E P
Sbjct  185   DMVTINPAMVIGPLLQPTLNTSAEAILNLISGAQTFPNSTFGWVNVKDVANAHILAYEVP  244

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEK  1044
             SANGRYC++E V HYS +VK LH LYP+L+LP+K
Sbjct  245   SANGRYCLVESVIHYSGIVKLLHDLYPSLQLPDK  278



>ref|XP_004509912.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Cicer arietinum]
 ref|XP_004509913.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Cicer arietinum]
Length=324

 Score =   456 bits (1172),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 212/317 (67%), Positives = 258/317 (81%), Gaps = 1/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASWIVKFLLQRGY V+ T+R P +PKK  HLL L+GAKERL LFKADL
Sbjct  7     KVVCVTGASGFIASWIVKFLLQRGYTVRGTLRDPSNPKKVDHLLKLDGAKERLQLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GC+GVFHTASP    V DPQ ELIDPA+KGTLNVL SCA++PSV++V++
Sbjct  67    LEEGSFDSAIEGCDGVFHTASPVRFVVNDPQVELIDPALKGTLNVLKSCARSPSVKRVIL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS++AV ++ +P TPEVVVDETW+S  DFC+E ++WY LSKTLAE AAWKFV E  I+M
Sbjct  127   TSSVSAVKFSSRPITPEVVVDETWFSDPDFCRESELWYTLSKTLAEAAAWKFVNENNIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V INP+MV+GPLLQP +N S   ILNLING   + N ++GW++VKDVA+AHILA E  SA
Sbjct  187   VVINPSMVVGPLLQPEINESVEPILNLINGV-PFPNNAFGWLDVKDVADAHILAYEIASA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             NGRYC+ ERV HYSE+ + L  LYPT+++ +KC +D+P+VP YQ+SKEKA +LGV FTPL
Sbjct  246   NGRYCLAERVVHYSEIARILRDLYPTIQISDKCVNDEPYVPPYQLSKEKANSLGVKFTPL  305

Query  1129  EESLKETVESLKEKGFF  1179
             E SLKETVES +EK   
Sbjct  306   EVSLKETVESFREKNIL  322



>ref|XP_007015094.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
4 [Theobroma cacao]
 gb|EOY32713.1| Cinnamyl alcohol dehydrogenase, 82967-79323, putative isoform 
4 [Theobroma cacao]
Length=288

 Score =   453 bits (1165),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 211/277 (76%), Positives = 249/277 (90%), Gaps = 0/277 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             KTVCVTGASGYIAS +VK LL RGY VKA+VR P+DP+KT+HLL+LEGA+ RL LFKA L
Sbjct  7     KTVCVTGASGYIASCLVKLLLLRGYTVKASVRDPNDPRKTQHLLALEGAEGRLKLFKATL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEE S+D+VV GCEGVFHTASPFYH+VTDPQAEL+DPAVKGTLNVL SCAKT SV++VV+
Sbjct  67    LEEDSYDAVVEGCEGVFHTASPFYHDVTDPQAELLDPAVKGTLNVLNSCAKTSSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAVAYNGKPRTP+VVVDETW++  D+CK +K+WYV+SKT+AEDAAWKF KEKGI+M
Sbjct  127   TSSMAAVAYNGKPRTPDVVVDETWFTDPDYCKGLKLWYVVSKTMAEDAAWKFAKEKGIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V INPAMVIGPLLQPTLNTS+AA+L+LI GAET+ NA++GW+NVKDVANAHI A E PSA
Sbjct  187   VAINPAMVIGPLLQPTLNTSAAAVLSLIKGAETFPNATFGWVNVKDVANAHIQAFEIPSA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDK  1059
             +GRYC++ERVAHYSE+VK L +LYP+ +LPEKC   K
Sbjct  247   SGRYCLVERVAHYSEIVKVLQELYPSFQLPEKCQRKK  283



>ref|XP_003567728.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Brachypodium distachyon]
Length=329

 Score =   454 bits (1169),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 210/315 (67%), Positives = 261/315 (83%), Gaps = 0/315 (0%)
 Frame = +1

Query  235   VCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADLLE  414
             VCVTGA G+IASWIVK LLQRG+ V+ T+R P DPKK +HL +L+G+ +RLHLFKADLLE
Sbjct  13    VCVTGAGGFIASWIVKLLLQRGHTVRGTLRDPADPKKIEHLRALDGSADRLHLFKADLLE  72

Query  415   EGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVVTS  594
             EGSFD+VV GCE VFHTASPFY+N  DPQ ELIDPAVKGTLNVL SC K  S+++VV+TS
Sbjct  73    EGSFDAVVDGCECVFHTASPFYNNPKDPQIELIDPAVKGTLNVLASCKKASSLKRVVLTS  132

Query  595   SIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINMVT  774
             S+AAV +   P +PEVVVD+T +S  + C++ K WYVLSKTLAE AAWKF K+ GI++VT
Sbjct  133   SMAAVVFTENPLSPEVVVDDTSFSIPELCEKAKEWYVLSKTLAEQAAWKFSKDNGIDLVT  192

Query  775   INPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSANG  954
             INPAMVIGPLLQPTLNTS+  +L LI+G+  Y N S+GW+NVKDVA AH+LA E PSA+G
Sbjct  193   INPAMVIGPLLQPTLNTSAQLVLYLISGSPVYLNYSFGWVNVKDVALAHVLACEVPSASG  252

Query  955   RYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPLEE  1134
             RYCM++RV H+SE+VK +H++YP+L +P+KCADD+PF PTYQVS++K K+LG+  TP E 
Sbjct  253   RYCMVDRVIHFSEIVKIIHEMYPSLPVPDKCADDQPFAPTYQVSRDKVKSLGIELTPFET  312

Query  1135  SLKETVESLKEKGFF  1179
             SLKET+E LK+K F 
Sbjct  313   SLKETIECLKDKSFI  327



>gb|KCW87178.1| hypothetical protein EUGRSUZ_B03705 [Eucalyptus grandis]
Length=326

 Score =   454 bits (1168),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 220/318 (69%), Positives = 261/318 (82%), Gaps = 1/318 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A KTVCVTGASGYIASW+VK LLQRGY VKA+VR P+DP+KT+HLL+L+GA+ERL LFKA
Sbjct  7     AGKTVCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDPEKTEHLLALDGARERLQLFKA  66

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFD +V GC GVFHTASPFYH+V DPQAEL+DPAVKGTLNVL SC+KTPSVQ+V
Sbjct  67    NLLEEGSFDPIVEGCVGVFHTASPFYHDVKDPQAELLDPAVKGTLNVLKSCSKTPSVQRV  126

Query  583   VVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGI  762
             V+TSS+AAV ++G P TP+V V E W+S  D  +E  MWY LSKTLAE+AAW+FV EKGI
Sbjct  127   VLTSSMAAVEHDGTPLTPDVEVKEDWFSDPDLLRENNMWYELSKTLAEEAAWEFVTEKGI  186

Query  763   NMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENP  942
             +MVTINP MVIGPLLQP LN  + AI NLINGA T+ +   GW+NVKDVANAHILA E P
Sbjct  187   DMVTINPGMVIGPLLQPKLNRGAVAIANLINGAPTFPDECCGWVNVKDVANAHILAFEVP  246

Query  943   SANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFT  1122
             SA GRYC++E V HY E+V+ L KLYP+L+LPEK  D   +VP Y VS ++A  LG+ + 
Sbjct  247   SARGRYCLVECVPHYYEIVRFLRKLYPSLQLPEK-DDSIRYVPVYWVSTKRANRLGIDYI  305

Query  1123  PLEESLKETVESLKEKGF  1176
              + +SLKETVESLKEKGF
Sbjct  306   DIYQSLKETVESLKEKGF  323



>emb|CBI40605.3| unnamed protein product [Vitis vinifera]
Length=327

 Score =   454 bits (1167),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 213/322 (66%), Positives = 263/322 (82%), Gaps = 1/322 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             ++A K VCVTGA+G+IASW+VK LL RGY VKAT+R PDDP KT+HLL+LEGAKERLHLF
Sbjct  4     AVAEKVVCVTGAAGFIASWLVKLLLLRGYTVKATLRNPDDPTKTQHLLALEGAKERLHLF  63

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KADLLEEGSFDS+V GCEGVFHTASP    V +P+ ELIDPAV GTLNVL SC K PS++
Sbjct  64    KADLLEEGSFDSIVEGCEGVFHTASPVLLEVANPKVELIDPAVNGTLNVLRSCTKVPSIR  123

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VVVTSSI A  +NGK  TP+V+VDETW+S   FC+E K+WYVLSKTLAE+AAWKF KE 
Sbjct  124   RVVVTSSIVATIFNGKTLTPDVIVDETWFSDPAFCEESKLWYVLSKTLAEEAAWKFAKEN  183

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLIN-GAETYSNASYGWINVKDVANAHILAL  933
             GI++VT+NP  VIGP LQPT+N +   ILNLIN GA+T+ +++Y W++V+DVANAH+ A 
Sbjct  184   GIDLVTMNPGFVIGPFLQPTINLTMEIILNLINGGAQTFPSSTYRWVDVRDVANAHVQAF  243

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E  SA+GRYC++ERV + SE +K L +LYP L LP+K ADD+P +PTYQ+SKEK K+L +
Sbjct  244   EISSASGRYCLVERVTYCSEAIKILQELYPALHLPQKNADDEPPMPTYQISKEKVKSLAI  303

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              F PLE SLK+T+E+LKEK F 
Sbjct  304   DFIPLEVSLKDTMENLKEKNFI  325



>emb|CBI29130.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   453 bits (1166),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 216/316 (68%), Positives = 263/316 (83%), Gaps = 1/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY VKATVR P+DPKKT+HLL+LEGAKERLHLFKA+L
Sbjct  6     KVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALEGAKERLHLFKANL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP    V DPQA+LIDPA+KGT++VLGSCAK PSV++VVV
Sbjct  66    LEEGSFDSVVDGCDGVFHTASPVVLIVDDPQAQLIDPALKGTMSVLGSCAKVPSVKRVVV  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+A+VA+NGKP  P+V+VDE+W+S   FC++ K+WY+LSKTLAE+AAWKF KE GI+M
Sbjct  126   TSSMASVAFNGKPLAPDVLVDESWFSDPVFCEKSKLWYMLSKTLAEEAAWKFAKENGIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINP  VIGPLLQPTLN S   +L L+ G + + N ++ W++V+DVA AHI A E  +A
Sbjct  186   VTINPGWVIGPLLQPTLNLSVEEVLKLLKG-DIFPNKTHRWVDVRDVAMAHIQAYELSTA  244

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
              GRYC++  + H SE +K L KLYP L LPEKCADD+P+ PTY VS+EK K+LG+ FTPL
Sbjct  245   RGRYCLVGSILHCSETMKILRKLYPALNLPEKCADDEPYEPTYMVSQEKTKSLGIDFTPL  304

Query  1129  EESLKETVESLKEKGF  1176
             E S+K+TVESL+EK F
Sbjct  305   EVSMKDTVESLREKNF  320



>gb|ABK21028.1| unknown [Picea sitchensis]
 gb|ABK22979.1| unknown [Picea sitchensis]
Length=326

 Score =   453 bits (1166),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 219/320 (68%), Positives = 271/320 (85%), Gaps = 0/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M+ + VCVTGASG+IASW+VK LL RGY+V+ATVR   +P+KTKHL +LEGA ERL L K
Sbjct  1     MSGRLVCVTGASGFIASWLVKLLLHRGYVVRATVRDLGNPEKTKHLHALEGANERLQLVK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LL+EG+FD+ V GCEGVFHTASPFY  V DPQAEL+DPAVKGTLNVL +CAK  SV++
Sbjct  61    ANLLDEGTFDAAVDGCEGVFHTASPFYIGVKDPQAELLDPAVKGTLNVLNACAKASSVKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VVVTSS+AAV YN +PR+P+ VVDETW+S A++CK++K+WY LSKT+AE++AWKF KEKG
Sbjct  121   VVVTSSVAAVTYNSRPRSPDTVVDETWFSDAEYCKQVKLWYHLSKTMAEESAWKFAKEKG  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I++VTINPAMVIG LLQPTLNTS AAIL L+NG+ TY N ++GW++VKDVA AHILA E 
Sbjct  181   IDIVTINPAMVIGTLLQPTLNTSCAAILQLMNGSSTYPNMTFGWVSVKDVAEAHILAFEV  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRY ++E+VAHYSE+VK L KLYP   +P KCADD PF PT+ VSKE+ + LG+ +
Sbjct  241   PSANGRYLLVEKVAHYSEIVKILSKLYPGCAVPTKCADDNPFPPTFTVSKERVEKLGLKY  300

Query  1120  TPLEESLKETVESLKEKGFF  1179
             TP+EE+L++TVESLKEK F 
Sbjct  301   TPIEEALRDTVESLKEKKFL  320



>ref|XP_004956189.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Setaria italica]
Length=322

 Score =   453 bits (1165),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 260/319 (82%), Gaps = 0/319 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             MA K VCVTGA G+IASWIVK LL+RGY V+ T+R P DPKKT+HL +LEG+ ERL LFK
Sbjct  1     MAAKVVCVTGAGGFIASWIVKLLLERGYTVRGTLRDPADPKKTEHLHALEGSAERLQLFK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             ADLL+EGSFD++V GC+ VFHTASPFY+N  DPQ ELIDPAVKGTLNVLGSC K  SV++
Sbjct  61    ADLLDEGSFDAIVEGCDCVFHTASPFYNNPKDPQVELIDPAVKGTLNVLGSCKKAASVKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             V++TSS+AAV +  KP +P+VVVDET +S  + C++ K WYVLSKTLAE AAWKF K+ G
Sbjct  121   VILTSSMAAVVFTEKPLSPDVVVDETSYSIPELCEKAKEWYVLSKTLAEQAAWKFSKDNG  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I++VTINPA+VIGPLLQPTLNTS+  IL LING+  Y N S+GW+NVKDVA AH+LA E 
Sbjct  181   IDLVTINPAVVIGPLLQPTLNTSAQIILYLINGSPVYLNYSFGWVNVKDVALAHVLAFET  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSA+GRY M+++V H+SEVVK +  +YP+L +PEKC DD+ F PTYQVS+E+  +LGV  
Sbjct  241   PSASGRYGMVDKVIHFSEVVKIIKDMYPSLPVPEKCVDDELFAPTYQVSRERITSLGVEL  300

Query  1120  TPLEESLKETVESLKEKGF  1176
             TP E SLKET+E LKE GF
Sbjct  301   TPFETSLKETIECLKENGF  319



>gb|ACZ74590.1| cinnamoyl CoA reductase-like 2b [Panicum virgatum]
Length=320

 Score =   453 bits (1165),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 265/314 (84%), Gaps = 2/314 (1%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             ++ A K VCVTGASGYIASWIVK LL RGY V+ATVR   DPKKT HL +L+GAK+RLH 
Sbjct  8     MTGAGKVVCVTGASGYIASWIVKLLLARGYTVRATVRDTADPKKTLHLSALDGAKDRLHF  67

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA LLEEGSFD+ V GCE VFHTASPFYHNV DP+AEL+DPAVKGTLNVLGSC K  S+
Sbjct  68    FKASLLEEGSFDAAVDGCETVFHTASPFYHNVKDPKAELLDPAVKGTLNVLGSCTKA-SI  126

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             +KVVVTSS+AAVAYNGKPRTPEV+VDETW+S    C++ + WYVLSKTLAE+AAWKF ++
Sbjct  127   KKVVVTSSVAAVAYNGKPRTPEVIVDETWFSDPQICEKNQQWYVLSKTLAEEAAWKFSRD  186

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLING-AETYSNASYGWINVKDVANAHILA  930
              G+ +VTINPAMVIGPLLQPTLNTS+ AIL LING + TY N S+GW+NVKDVA AHILA
Sbjct  187   NGLEIVTINPAMVIGPLLQPTLNTSAEAILKLINGSSSTYPNFSFGWVNVKDVALAHILA  246

Query  931   LENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLG  1110
              E PSA+GRYCM+ERVAHYSEVV  + K+YPT+ L +KCADDKPFVPTYQVSKEK ++LG
Sbjct  247   YEVPSAHGRYCMVERVAHYSEVVNIIRKMYPTIPLADKCADDKPFVPTYQVSKEKIRSLG  306

Query  1111  VVFTPLEESLKETV  1152
             +   PLE  ++ET+
Sbjct  307   IKLIPLEMCIRETI  320



>gb|ABK21248.1| unknown [Picea sitchensis]
 gb|ACN41127.1| unknown [Picea sitchensis]
Length=326

 Score =   452 bits (1162),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 218/320 (68%), Positives = 271/320 (85%), Gaps = 0/320 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M+ + VCVTGASG+IASW+VK LL RGY+V+ATVR   +P+KTKHL +LEGA ERL L K
Sbjct  1     MSGRLVCVTGASGFIASWLVKLLLHRGYVVRATVRDLGNPEKTKHLHALEGANERLQLVK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LL+EG+FD+ V GCEGVFHTASPFY  V DPQAE++DPAVKGTLNVL +CAK  SV++
Sbjct  61    ANLLDEGTFDAAVDGCEGVFHTASPFYIGVKDPQAEMLDPAVKGTLNVLNACAKASSVKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VVVTSS+AAV YN +PR+P+ VVDETW+S A++CK++K+WY LSKT+AE++AWKF KEKG
Sbjct  121   VVVTSSVAAVTYNSRPRSPDTVVDETWFSDAEYCKQVKLWYHLSKTMAEESAWKFAKEKG  180

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I++VTINPAMVIG LLQPTLNTS AAIL L+NG+ TY N ++GW++VKDVA AHILA E 
Sbjct  181   IDIVTINPAMVIGTLLQPTLNTSCAAILQLMNGSSTYPNMTFGWVSVKDVAEAHILAFEV  240

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRY ++E+VAHYSE+VK L KLYP   +P KCADD PF PT+ VSKE+ + LG+ +
Sbjct  241   PSANGRYLLVEKVAHYSELVKILSKLYPGCAVPTKCADDNPFPPTFTVSKERVEKLGLKY  300

Query  1120  TPLEESLKETVESLKEKGFF  1179
             TP+EE+L++TVESLKEK F 
Sbjct  301   TPIEEALRDTVESLKEKKFL  320



>ref|XP_007131547.1| hypothetical protein PHAVU_011G022400g [Phaseolus vulgaris]
 gb|ESW03541.1| hypothetical protein PHAVU_011G022400g [Phaseolus vulgaris]
Length=325

 Score =   452 bits (1162),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 210/316 (66%), Positives = 257/316 (81%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASWI+KFLLQRGY V+ATVR P   ++ +HLL L+GA+ERLHLFKADL
Sbjct  7     KVVCVTGASGFIASWIIKFLLQRGYTVRATVRDPSKRERVEHLLKLDGAEERLHLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS   GC GVFHTASP    + DPQ ELIDPA+KGTLNV+ SCAK+ SV++VV+
Sbjct  67    LEEGSFDSAFEGCHGVFHTASPVLLTINDPQNELIDPALKGTLNVVKSCAKSTSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+AAV YNG+PRTPEVVVDETW+S  +  ++ + WY LSKTLAEDAA  F+ E  I +
Sbjct  127   TSSVAAVLYNGRPRTPEVVVDETWFSDPNILRKDEKWYALSKTLAEDAARNFLNEHDIKL  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             + INPAM IGPLLQP +N SS+ IL+LING++T+ N S+GW+NVKDVANAHI + E  SA
Sbjct  187   IVINPAMSIGPLLQPEVNASSSTILSLINGSKTFPNLSFGWVNVKDVANAHIQSYEIDSA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++E+VAH+SEV K LH +YPTL++ +KC DD PFVP +Q SKEK K+LG+    L
Sbjct  247   SGRYCLLEKVAHFSEVAKILHHIYPTLQIADKCEDDDPFVPIFQASKEKVKSLGIELISL  306

Query  1129  EESLKETVESLKEKGF  1176
             EESL+ETVESLKEK F
Sbjct  307   EESLRETVESLKEKKF  322



>emb|CAN65489.1| hypothetical protein VITISV_003761 [Vitis vinifera]
Length=327

 Score =   452 bits (1162),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/323 (66%), Positives = 266/323 (82%), Gaps = 1/323 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +++A K VCVTG +G+IASW+VK LL RGY VKAT+R  DDPKKT+HLL+LEGAKERLHL
Sbjct  3     VAVAEKVVCVTGGAGFIASWLVKLLLLRGYTVKATLRNTDDPKKTEHLLALEGAKERLHL  62

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSFDS+V GCE VFHTASP    VTDP+ ELIDPAVKGTLNVL SCAK P++
Sbjct  63    FKADLLEEGSFDSIVEGCECVFHTASPVLLEVTDPKVELIDPAVKGTLNVLRSCAKVPAI  122

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSSIAAV YNGKP T +V+VDETW+S   FC+E K+WYVLSKTLAE+AAWKF KE
Sbjct  123   RRVVVTSSIAAVIYNGKPLTSDVIVDETWFSDPAFCEESKLWYVLSKTLAEEAAWKFAKE  182

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLIN-GAETYSNASYGWINVKDVANAHILA  930
              GI++VT+NP +V GPLLQPT+N +   +LN+IN GA+T+ +++Y W++V+DVANAH+ A
Sbjct  183   HGIDLVTMNPGVVTGPLLQPTINLTMEILLNMINGGAQTFPSSTYRWVDVRDVANAHVQA  242

Query  931   LENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLG  1110
              E  SA+GRYC++ERV + SE +K L +LYP L LP+K ADD+P + TYQ+SKEK K+L 
Sbjct  243   FEISSASGRYCLVERVTYCSEAIKILQELYPALHLPQKNADDEPPMATYQISKEKVKSLA  302

Query  1111  VVFTPLEESLKETVESLKEKGFF  1179
             + F PLE SLK+T+E+LKE  F 
Sbjct  303   IDFIPLEVSLKDTMENLKEMNFI  325



>gb|AFK46906.1| unknown [Lotus japonicus]
Length=324

 Score =   451 bits (1159),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 258/314 (82%), Gaps = 1/314 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASWIVKFLLQRGY V+ATVR P + KK +HL  L+GAKERLHLFKADL
Sbjct  7     KLVCVTGASGYIASWIVKFLLQRGYTVRATVRDPSNHKKVEHLFKLDGAKERLHLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSV+ GC+GVFHTASP    V DPQAELIDPAVKGTLNVL SCAK+PSV++VV+
Sbjct  67    LEEGSFDSVIQGCDGVFHTASPVRFIVKDPQAELIDPAVKGTLNVLKSCAKSPSVKRVVL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS++AV +N +P++PEVVVDETW+S   FC+E K+WY LSKTLAEDAAWKFV E  I+M
Sbjct  127   TSSVSAVQFNERPKSPEVVVDETWFSDPVFCRESKLWYTLSKTLAEDAAWKFVNENKIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V +NP++V GPLLQP +N S   ILNLING   + N+S GW++VKDVA AHI A E  SA
Sbjct  187   VVLNPSLVSGPLLQPEVNYSVERILNLINGV-PFPNSSMGWVDVKDVAKAHIQAYEIASA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ERV HYSE+ + L  LYPT+++  +C D+ P+VPTYQ S+EKAK+LG+ FTPL
Sbjct  246   SGRYCLVERVVHYSELARILGDLYPTIQISNRCEDNGPYVPTYQYSQEKAKSLGIEFTPL  305

Query  1129  EESLKETVESLKEK  1170
             E S+K TVES +EK
Sbjct  306   EISIKGTVESFREK  319



>emb|CBI38203.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   451 bits (1161),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 216/318 (68%), Positives = 258/318 (81%), Gaps = 0/318 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG IASW+VK LLQ  Y VKATVR P+DPK+T+HLLSL+GAKERLHLFKADL
Sbjct  7     KVVCVTGASGLIASWLVKLLLQNDYTVKATVRDPNDPKRTQHLLSLDGAKERLHLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSF+SVV GC+GVFHTASP   +V +PQAELIDPA+KG +NVL SCAK PSV++VVV
Sbjct  67    LEEGSFNSVVDGCDGVFHTASPVAMDVINPQAELIDPALKGIINVLRSCAKVPSVKRVVV  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+ +V + GKP T EV+++E+W+S    C E K+WYVLSKTLAE+AAWKF KE GI+M
Sbjct  127   TSSMTSVVFTGKPLTSEVLINESWFSDPVLCNESKLWYVLSKTLAEEAAWKFSKENGIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINP  VIGPLLQPTLN S+   LNLINGA+T+ N SY  ++V+DVANAHI A E P A
Sbjct  187   VTINPGGVIGPLLQPTLNLSAELFLNLINGAQTFPNRSYRLVDVRDVANAHIQAYEIPEA  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC++ER  H SE +K L KLYP L LPEKCADDKP+ P++ VS+EKA +LG  FTPL
Sbjct  247   SGRYCLVERDLHCSETLKILRKLYPDLPLPEKCADDKPYAPSFLVSQEKANSLGAHFTPL  306

Query  1129  EESLKETVESLKEKGFFV  1182
             E SLK+TVESL+ +   V
Sbjct  307   EVSLKDTVESLRRRTLSV  324



>ref|XP_010067836.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
 gb|KCW66054.1| hypothetical protein EUGRSUZ_G03344 [Eucalyptus grandis]
Length=324

 Score =   450 bits (1157),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 212/322 (66%), Positives = 257/322 (80%), Gaps = 0/322 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S   K VCVTG +GYIASW++  LL RGY VKAT+R  +D +KT+HLL+L GAKERLHL
Sbjct  1     MSTTEKVVCVTGGAGYIASWLINLLLHRGYTVKATIRDTNDSRKTQHLLALGGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSFDS+V GC  VFHTASP   + +DPQAE++DPAV+GTLNVL SCAK PS+
Sbjct  61    FKADLLEEGSFDSIVDGCGAVFHTASPVVFSASDPQAEIVDPAVRGTLNVLKSCAKVPSI  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VV+TSS+AAV +NGKP T  VVVDETW+S   FC+E K+WY+LSKTLAE AAWKF KE
Sbjct  121   KRVVLTSSMAAVVFNGKPLTSGVVVDETWFSDPVFCEESKLWYLLSKTLAEKAAWKFAKE  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
             K I++V +NP  VIGPLLQPT+N S   ILN +NG E + NASYG+++V+DVA AHI AL
Sbjct  181   KRIDLVVMNPGHVIGPLLQPTVNLSVELILNFVNGTEEFPNASYGFVDVRDVARAHIQAL  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             ENPSA+GRYC++  V H  ++ K LH LYPTLRLPEKC DDK  V  +Q+S+EK + LGV
Sbjct  241   ENPSASGRYCIVGGVMHRPDMSKILHHLYPTLRLPEKCEDDKLAVAAHQISREKVEGLGV  300

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              F PLE S+KETVESLKEKGF 
Sbjct  301   NFIPLEVSIKETVESLKEKGFL  322



>ref|XP_003628601.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AET03077.1| cinnamyl alcohol dehydrogenase [Medicago truncatula]
Length=323

 Score =   449 bits (1156),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 219/316 (69%), Positives = 254/316 (80%), Gaps = 1/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASWIVKFLLQRGY V+ATVR P +PKK  HLL L+GAKERL LFKADL
Sbjct  6     KVVCVTGASGFIASWIVKFLLQRGYTVRATVRDPSNPKKVDHLLKLDGAKERLQLFKADL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP    V DPQ ELIDPA+KGTLNVL SCAK+ SV++VV+
Sbjct  66    LEEGSFDSVVEGCDGVFHTASPVRFVVNDPQVELIDPALKGTLNVLKSCAKSTSVKRVVL  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS AAV++N +P+ PEVVVDETW+S  DFC+E K+WYVLSKTLAE AAWKFV E  I+M
Sbjct  126   TSSNAAVSFNTRPKNPEVVVDETWFSNPDFCRESKLWYVLSKTLAEAAAWKFVNENNIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V++NP MV GPLLQP +N S   ILNLING   + N + GW+NVKDVANAHI A E  SA
Sbjct  186   VSLNPTMVAGPLLQPEVNESVEPILNLINGI-PFPNKAIGWVNVKDVANAHIHAYEIASA  244

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GR  + ERV HYSE+   L  LYPTL + +KC DD P++PTYQ+SKEKAK+ G+ FTPL
Sbjct  245   SGRCLLAERVVHYSELAMILRDLYPTLPISDKCEDDGPYMPTYQISKEKAKSFGIEFTPL  304

Query  1129  EESLKETVESLKEKGF  1176
             E SLKETVES +EK F
Sbjct  305   EISLKETVESFREKKF  320



>ref|XP_006446144.1| hypothetical protein CICLE_v100159012mg, partial [Citrus clementina]
 gb|ESR59384.1| hypothetical protein CICLE_v100159012mg, partial [Citrus clementina]
 gb|KDO61222.1| hypothetical protein CISIN_1g0202661mg, partial [Citrus sinensis]
Length=284

 Score =   447 bits (1151),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 207/281 (74%), Positives = 245/281 (87%), Gaps = 0/281 (0%)
 Frame = +1

Query  334   DPKKTKHLLSLEGAKERLHLFKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELI  513
             DPKKT+HLL+L+GA ERL LFKA+LLEEGSFDS+V GC+GV HTASPFYH+  DPQ EL+
Sbjct  1     DPKKTRHLLALDGASERLQLFKANLLEEGSFDSIVDGCDGVCHTASPFYHDAKDPQVELL  60

Query  514   DPAVKGTLNVLGSCAKTPSVQKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMK  693
             DPAVKGTLNVL SCAK PS+++VV+TSS+AAV   GKPRTP+VVVDETW+S  + CK+ +
Sbjct  61    DPAVKGTLNVLNSCAKFPSIKRVVLTSSMAAVLNTGKPRTPDVVVDETWFSDPEVCKQSE  120

Query  694   MWYVLSKTLAEDAAWKFVKEKGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYS  873
             +WY LSKTLAEDAAWKF KEK I++VTINPAMVIGPLLQPTLNTS+AA+L+LI GA+TY 
Sbjct  121   LWYPLSKTLAEDAAWKFAKEKSIDLVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTYP  180

Query  874   NASYGWINVKDVANAHILALENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCAD  1053
             N ++GW+NVKDVANAHI A E PSANGRYC++ERV+HYSE+V  + +LYP  +LPEKCAD
Sbjct  181   NVTFGWVNVKDVANAHIQAFEVPSANGRYCLVERVSHYSEIVNIIRELYPAFQLPEKCAD  240

Query  1054  DKPFVPTYQVSKEKAKNLGVVFTPLEESLKETVESLKEKGF  1176
             DKP VPTYQV KEK KNLG+ F P+E SLKET+ESLKEKGF
Sbjct  241   DKPHVPTYQVLKEKVKNLGIEFIPVEVSLKETIESLKEKGF  281



>emb|CAN71341.1| hypothetical protein VITISV_002438 [Vitis vinifera]
Length=327

 Score =   449 bits (1154),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/323 (65%), Positives = 263/323 (81%), Gaps = 1/323 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +++A K VCVTGA+G+IASW+VK LL RGY VKAT+R PDDP KT+HLL+LEGAKERLHL
Sbjct  3     VAVAEKVVCVTGAAGFIASWLVKLLLLRGYTVKATLRNPDDPTKTEHLLALEGAKERLHL  62

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
              KADLLEEGSFDS+V GCEGVFHTASP    V +P+ ELIDPAV GTLNVL SC K PS+
Sbjct  63    CKADLLEEGSFDSIVEGCEGVFHTASPVLLEVANPKVELIDPAVNGTLNVLRSCTKVPSI  122

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSSI A  +NGK  TP+V+VDETW+S   FC+E K+WYVLSKTLAE+AAWKF KE
Sbjct  123   RRVVVTSSIVATIFNGKTLTPDVIVDETWFSDPAFCEESKLWYVLSKTLAEEAAWKFAKE  182

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLIN-GAETYSNASYGWINVKDVANAHILA  930
              GI++VT+NP  VIGP LQPT+N +   ILNLIN GA+T+ +++Y W++V+DVANAH+ A
Sbjct  183   NGIDLVTMNPGFVIGPFLQPTINLTMEIILNLINGGAQTFPSSTYRWVDVRDVANAHVQA  242

Query  931   LENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLG  1110
              E  SA+GRYC++ERV + SE +K L +L+P L LP+K ADD+P +PTYQ+SKEK K+L 
Sbjct  243   FEISSASGRYCLVERVTYCSEAIKILQELFPALYLPQKNADDEPPMPTYQISKEKVKSLA  302

Query  1111  VVFTPLEESLKETVESLKEKGFF  1179
             + F PLE SLK+T+E+LKEK F 
Sbjct  303   IDFIPLEVSLKDTMENLKEKNFI  325



>ref|XP_003633515.2| PREDICTED: LOW QUALITY PROTEIN: cinnamoyl-CoA reductase 1-like 
[Vitis vinifera]
Length=591

 Score =   457 bits (1177),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 218/316 (69%), Positives = 264/316 (84%), Gaps = 1/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VK LLQRGY VKATVR P+DPKKT+HLL+LEGAKERLHLF+A+L
Sbjct  6     KVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALEGAKERLHLFEANL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP    V DPQA+LIDPA+KGT+NVLGSCAK PSV++VVV
Sbjct  66    LEEGSFDSVVDGCDGVFHTASPVVMIVDDPQAQLIDPALKGTMNVLGSCAKVPSVKRVVV  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+A+VA+NGK   P+V+VDE+W+S   FC++ K+WY+LSKTLAE+AAWKF KE GI+M
Sbjct  126   TSSMASVAFNGKHLAPDVLVDESWFSDPVFCEKSKLWYMLSKTLAEEAAWKFAKENGIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINP  VIGPLLQPTLN S   +L L+ G +T+ N ++ W++V+DVA AHI A E P+A
Sbjct  186   VTINPGWVIGPLLQPTLNLSVEEVLKLLKG-DTFPNKTHRWVDVRDVAMAHIQAYELPTA  244

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
              GRYC++  + H SE +K L KLYP L LPEKCADDKP+ PTY VS+EK K+LG+ FTPL
Sbjct  245   RGRYCLVGSILHCSETMKILRKLYPALNLPEKCADDKPYEPTYMVSQEKTKSLGIDFTPL  304

Query  1129  EESLKETVESLKEKGF  1176
             E S+K+TVESL+EK F
Sbjct  305   EVSMKDTVESLREKNF  320


 Score =   359 bits (922),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 205/250 (82%), Gaps = 0/250 (0%)
 Frame = +1

Query  229  KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
            K V VTGASG+IASW+VK LLQ  Y +K TVR P+DPKKT+HLLSL+GA+ERLHLFKADL
Sbjct  336  KVVSVTGASGFIASWLVKLLLQHRYTLKXTVRDPNDPKKTQHLLSLDGAQERLHLFKADL  395

Query  409  LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
            LEEGSFDSVV GC+GVFHTASP      +PQ ELID A+KGT+NVL SC+K PSV++VVV
Sbjct  396  LEEGSFDSVVDGCDGVFHTASPVALEAINPQTELIDLALKGTINVLRSCSKVPSVKRVVV  455

Query  589  TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
            TSS+A+V + G+P TPEV++DE+W+S    CKE K WYVLSKTLAE+AAW F KE GI+M
Sbjct  456  TSSLASVLFTGEPLTPEVLIDESWFSDPVLCKESKQWYVLSKTLAEEAAWNFSKENGIDM  515

Query  769  VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
            VTINP  VIGPLLQPTLN S+  +LNLINGA+T+ N S  W++V+DVANAHI A E P A
Sbjct  516  VTINPGWVIGPLLQPTLNLSAEQVLNLINGAQTFPNISSWWVDVRDVANAHIQAYEIPEA  575

Query  949  NGRYCMIERV  978
            +GRYC++E +
Sbjct  576  SGRYCLVEGI  585



>ref|XP_002268122.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 emb|CBI40601.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   448 bits (1152),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 213/318 (67%), Positives = 258/318 (81%), Gaps = 1/318 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGA+G++ASW+VK LLQRGY V+ATVR P+DPKKT+HLLSL+GAKERL LFKADL
Sbjct  7     KVVCVTGAAGFVASWLVKLLLQRGYTVRATVRDPNDPKKTEHLLSLDGAKERLRLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD VV GC+GVFHTASP    VTDPQ ELIDPA+KGT+NVL SC+K PSV++VVV
Sbjct  67    LEEGSFDPVVDGCDGVFHTASPVVMQVTDPQTELIDPALKGTINVLRSCSKVPSVKRVVV  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS++AV  NGKP TPEV++DE+W+S A  CKE K+WY LSKTLAE+AAWKF KE GI+M
Sbjct  127   TSSMSAVEQNGKPLTPEVIIDESWFSDAVLCKESKLWYKLSKTLAEEAAWKFSKENGIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETY-SNASYGWINVKDVANAHILALENPS  945
             V INP  V+GPLLQPTLN S   IL L+NG +T+    SY W++ +DVANAHI A E P 
Sbjct  187   VMINPGWVLGPLLQPTLNLSVEEILKLLNGVQTFPKTTSYTWVDARDVANAHIQAFELPE  246

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             A+GRYC++  V+H SE +  LHKLYP + +PEK  D +  VPT++VS+EKAK+LG+ FTP
Sbjct  247   ASGRYCLVGTVSHRSETLNILHKLYPAIHIPEKWEDGQTCVPTFRVSQEKAKSLGIHFTP  306

Query  1126  LEESLKETVESLKEKGFF  1179
             LE S+K+TVESLKEK F 
Sbjct  307   LEVSMKDTVESLKEKNFI  324



>gb|AFK38743.1| unknown [Medicago truncatula]
Length=323

 Score =   447 bits (1151),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 218/316 (69%), Positives = 254/316 (80%), Gaps = 1/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASWIVKFLLQRGY V+ATVR P +PKK  HLL L+GAKERL LFKADL
Sbjct  6     KVVCVTGASGFIASWIVKFLLQRGYTVRATVRDPSNPKKVDHLLKLDGAKERLQLFKADL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP    V DPQ ELIDPA+KGTLNVL SCAK+ SV++VV+
Sbjct  66    LEEGSFDSVVEGCDGVFHTASPVRFVVNDPQVELIDPALKGTLNVLKSCAKSTSVKRVVL  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS AAV+++ +P+ PEVVVDETW+S  DFC+E K+WYVLSKTLAE AAWKFV E  I+M
Sbjct  126   TSSNAAVSFDTRPKNPEVVVDETWFSNPDFCRESKLWYVLSKTLAEAAAWKFVNENNIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V++NP MV GPLLQP +N S   ILNLING   + N + GW+NVKDVANAHI A E  SA
Sbjct  186   VSLNPTMVAGPLLQPEVNESVEPILNLINGI-PFPNKAIGWVNVKDVANAHIHAYEIASA  244

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GR  + ERV HYSE+   L  LYPTL + +KC DD P++PTYQ+SKEKAK+ G+ FTPL
Sbjct  245   SGRCLLAERVVHYSELAMILRDLYPTLPISDKCEDDGPYMPTYQISKEKAKSFGIEFTPL  304

Query  1129  EESLKETVESLKEKGF  1176
             E SLKETVES +EK F
Sbjct  305   EISLKETVESFREKKF  320



>ref|XP_002268322.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera]
 emb|CBI40597.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   447 bits (1151),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 213/318 (67%), Positives = 258/318 (81%), Gaps = 1/318 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGA+G++ASW+VK LLQRGY V+ATVR P+DPKKT+HLLSL+GAKERL LFKADL
Sbjct  7     KVVCVTGAAGFVASWLVKLLLQRGYTVRATVRDPNDPKKTEHLLSLDGAKERLRLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD VV GC+GVFHTASP    VTDPQ ELIDPA+KGT+NVL SC+K PSV++VVV
Sbjct  67    LEEGSFDPVVDGCDGVFHTASPVVMQVTDPQTELIDPALKGTINVLRSCSKVPSVKRVVV  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS++AV  NGKP TPEV++DE+W+S A  CKE K+WY LSKTLAE+AAWKF KE GI+M
Sbjct  127   TSSMSAVEQNGKPLTPEVIIDESWFSDAVLCKESKLWYKLSKTLAEEAAWKFSKENGIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETY-SNASYGWINVKDVANAHILALENPS  945
             V INP  V+GPLLQPTLN S   IL L+NG +T+    SY W++ +DVANAHI A E P 
Sbjct  187   VMINPGWVLGPLLQPTLNLSVEEILKLLNGVQTFPKTTSYTWVDARDVANAHIQAFELPE  246

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             A+GRYC++  V+H SE +  LHKLYP + +PEK  D +  VPT++VS+EKAK+LG+ FTP
Sbjct  247   ASGRYCLVGTVSHRSETLNILHKLYPAIHIPEKWEDGQTCVPTFRVSQEKAKSLGIHFTP  306

Query  1126  LEESLKETVESLKEKGFF  1179
             LE S+K+TVESLKEK F 
Sbjct  307   LEVSIKDTVESLKEKNFI  324



>ref|XP_010067832.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Eucalyptus grandis]
 gb|KCW66062.1| hypothetical protein EUGRSUZ_G03351 [Eucalyptus grandis]
Length=327

 Score =   447 bits (1151),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 213/317 (67%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTG +GYIASW+VK LLQRGY VKAT+R P+DPKKT+HLL+LEGAKERL LFKADL
Sbjct  9     KVVCVTGGAGYIASWVVKLLLQRGYTVKATMRDPNDPKKTEHLLALEGAKERLQLFKADL  68

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC GVFHTASP   +V DPQAELIDPA+KGTLNVL SCAK  S+++VVV
Sbjct  69    LEEGSFDSVVNGCIGVFHTASPVLLSVADPQAELIDPALKGTLNVLRSCAKVSSIKRVVV  128

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIA V+Y  KP     +VDETW+S  DFC++ K+WYVLSK LAE AAW+  KE  I++
Sbjct  129   TSSIATVSYIAKPLMSGDLVDETWFSDPDFCEKSKLWYVLSKILAEKAAWESAKENEIDL  188

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINP +VIGPLLQPT+N S   ILN +NGA+T+ N  Y + +V+DVANAH+LA ENPSA
Sbjct  189   VTINPGIVIGPLLQPTVNLSVEMILNFVNGAQTFPNECYCFADVRDVANAHVLAFENPSA  248

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
              GRYC++  V H  + +K L  LYPTL LP+KC DDKPF P Y+ S+EKA+ LGV FTPL
Sbjct  249   CGRYCVVGEVMHCHDALKILQNLYPTLHLPDKCEDDKPFAPKYEYSREKAEALGVEFTPL  308

Query  1129  EESLKETVESLKEKGFF  1179
             E SL++T+ESL+EKGF 
Sbjct  309   EISLRDTIESLREKGFI  325



>ref|XP_007131544.1| hypothetical protein PHAVU_011G022100g [Phaseolus vulgaris]
 gb|ESW03538.1| hypothetical protein PHAVU_011G022100g [Phaseolus vulgaris]
Length=323

 Score =   447 bits (1150),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 256/315 (81%), Gaps = 2/315 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASWIVKFLLQRGY V+ATVR P +PKK  HL++L+GAKERLHLFKADL
Sbjct  5     KIVCVTGASGYIASWIVKFLLQRGYTVRATVRDPGNPKKVSHLVNLDGAKERLHLFKADL  64

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP    V +PQAELIDPAVKGTLNVL SCAK+PSV++VV+
Sbjct  65    LEEGSFDSVVEGCDGVFHTASPVRFVVNNPQAELIDPAVKGTLNVLKSCAKSPSVKRVVL  124

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS++AVA NG+P+TPE V+DETW+S  D C+E+++WY LSKTLAEDAAWKFV E  I+M
Sbjct  125   TSSVSAVALNGRPKTPETVLDETWFSDPDVCRELELWYSLSKTLAEDAAWKFVNENNIDM  184

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V INP MV G LLQ  +N S   ILNLING + + N  +GW++VKDVANAHILA E  SA
Sbjct  185   VVINPTMVAGTLLQAEINESVEQILNLING-KPFQNKCFGWVDVKDVANAHILAYEIASA  243

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKA-KNLGVVFTP  1125
             +GRYC+ ERV HYSE+   L  LYPTL++P+KC  D+ ++PTYQ+S +KA K LG+   P
Sbjct  244   SGRYCLSERVIHYSELATILRDLYPTLQIPDKCEVDEAYIPTYQISTDKAKKELGIELIP  303

Query  1126  LEESLKETVESLKEK  1170
             LE S +ETVES +EK
Sbjct  304   LEVSFRETVESFREK  318



>gb|KEH19920.1| cinnamyl alcohol dehydrogenase [Medicago truncatula]
Length=324

 Score =   447 bits (1150),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 254/314 (81%), Gaps = 1/314 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGA+G+IASWIVKFLLQ GY V+ATVR+P + +K  HL+ L+GAKERL LFKADL
Sbjct  7     KVVCVTGANGFIASWIVKFLLQCGYTVRATVRHPSNSEKVDHLVKLDGAKERLQLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP    V DPQAELIDPA+KGTLNVL SCAK+PSV++V++
Sbjct  67    LEEGSFDSVVEGCDGVFHTASPVRFVVNDPQAELIDPALKGTLNVLQSCAKSPSVKRVIL  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSI+AV ++ +P+ P V+VDETW+S  D C+E K+WY LSKTLAE AAWKFV E  I+M
Sbjct  127   TSSISAVVFDTRPKNPGVIVDETWFSNPDLCRESKLWYTLSKTLAEAAAWKFVNENSIDM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V INP MV GPLLQP LN S   ILNLI+G   + N +YGW NVKDVANAHILA E  SA
Sbjct  187   VAINPTMVAGPLLQPELNGSVEPILNLISGI-PFPNKAYGWCNVKDVANAHILAYETASA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC+ ERV HYSE+   L  LYPTL++ +KC DD P++PTYQ+SKEKAK+LG+ FT L
Sbjct  246   SGRYCLAERVVHYSELAMILRDLYPTLQISDKCEDDGPYMPTYQISKEKAKSLGIEFTSL  305

Query  1129  EESLKETVESLKEK  1170
             E +LKETVES +EK
Sbjct  306   EVTLKETVESFREK  319



>ref|XP_003628576.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AET03052.1| cinnamyl alcohol dehydrogenase [Medicago truncatula]
Length=333

 Score =   447 bits (1150),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 254/314 (81%), Gaps = 1/314 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGA+G+IASWIVKFLLQ GY V+ATVR+P + +K  HL+ L+GAKERL LFKADL
Sbjct  16    KVVCVTGANGFIASWIVKFLLQCGYTVRATVRHPSNSEKVDHLVKLDGAKERLQLFKADL  75

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP    V DPQAELIDPA+KGTLNVL SCAK+PSV++V++
Sbjct  76    LEEGSFDSVVEGCDGVFHTASPVRFVVNDPQAELIDPALKGTLNVLQSCAKSPSVKRVIL  135

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSI+AV ++ +P+ P V+VDETW+S  D C+E K+WY LSKTLAE AAWKFV E  I+M
Sbjct  136   TSSISAVVFDTRPKNPGVIVDETWFSNPDLCRESKLWYTLSKTLAEAAAWKFVNENSIDM  195

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V INP MV GPLLQP LN S   ILNLI+G   + N +YGW NVKDVANAHILA E  SA
Sbjct  196   VAINPTMVAGPLLQPELNGSVEPILNLISGI-PFPNKAYGWCNVKDVANAHILAYETASA  254

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC+ ERV HYSE+   L  LYPTL++ +KC DD P++PTYQ+SKEKAK+LG+ FT L
Sbjct  255   SGRYCLAERVVHYSELAMILRDLYPTLQISDKCEDDGPYMPTYQISKEKAKSLGIEFTSL  314

Query  1129  EESLKETVESLKEK  1170
             E +LKETVES +EK
Sbjct  315   EVTLKETVESFREK  328



>ref|XP_008790956.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Phoenix 
dactylifera]
Length=311

 Score =   446 bits (1148),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/294 (71%), Positives = 248/294 (84%), Gaps = 0/294 (0%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S + K VCVTGASGYIASW+VK LLQRGY V+ TVR   DPK+T+HL +LEGA ERL L
Sbjct  1     MSGSGKVVCVTGASGYIASWLVKLLLQRGYTVRGTVRDLADPKRTEHLRALEGANERLQL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFDSVV GCEGVFHTASP Y N TDPQAELIDPAVKG LNV GSC KTPSV
Sbjct  61    FKANLLEEGSFDSVVEGCEGVFHTASPCYVNATDPQAELIDPAVKGALNVFGSCIKTPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSS+AAV +NG+P+TP+VV+D TW+S+ +FC++ K WY LSKTLAE+AAWKF K+
Sbjct  121   KRVVVTSSMAAVLHNGRPQTPDVVIDATWFSSVEFCEQEKKWYPLSKTLAEEAAWKFSKD  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               I+MVTI+P +VIGPLLQPTLN SSA +LNL+NG+ TY N  + W+NVKDVA AHILA 
Sbjct  181   NSIDMVTIHPGVVIGPLLQPTLNESSAMLLNLLNGSSTYPNLRFPWVNVKDVAMAHILAF  240

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEK  1095
             E PSA+GRY ++ERVAHYSE+VK L + YP L+LPEKC DDKPF+P YQVSKEK
Sbjct  241   EVPSASGRYFLVERVAHYSEIVKILREQYPALKLPEKCVDDKPFLPIYQVSKEK  294



>ref|XP_003607374.1| Dihydroflavonol-4-reductase [Medicago truncatula]
 gb|AES89571.1| cinnamyl-alcohol dehydrogenase-like protein [Medicago truncatula]
Length=325

 Score =   447 bits (1149),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/316 (66%), Positives = 250/316 (79%), Gaps = 0/316 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASGYIASW+VKFLLQRGY V+ATVR P +P K  HLL L+GAKERLHLFKADL
Sbjct  7     KVVCVTGASGYIASWLVKFLLQRGYTVRATVRDPSNPNKVDHLLKLDGAKERLHLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFD V+ GC GVFHTASP +  V DPQ +LIDPAVKG+LNVL SCAK+PSV++VV 
Sbjct  67    LEEGSFDHVIQGCHGVFHTASPAHFVVDDPQTQLIDPAVKGSLNVLRSCAKSPSVKRVVF  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIA   YNG PRTP+ VVDETW+S  D  +E KMWY  +K  AE+AA KF+ E  I+ 
Sbjct  127   TSSIATALYNGTPRTPDTVVDETWFSNLDLLREQKMWYQFAKVSAEEAATKFLTENDIDY  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             V +NPA+ IGPLLQP LN SS+ I +LI G++T+ NA++GWINVKDVANAHI A E+ S 
Sbjct  187   VVMNPAVTIGPLLQPELNGSSSLIFDLIKGSQTFLNATFGWINVKDVANAHIHAYEDAST  246

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
             +GRYC+ ERVAH SE+   L  +YPTL++P+KCA DKP + T+Q+SKEKAK LG+ F PL
Sbjct  247   SGRYCLAERVAHISELAIILRDMYPTLQIPDKCAGDKPLMQTFQISKEKAKTLGIEFIPL  306

Query  1129  EESLKETVESLKEKGF  1176
             E SL+E VES KEK F
Sbjct  307   EVSLREIVESFKEKEF  322



>ref|XP_010673662.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=329

 Score =   446 bits (1147),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 215/318 (68%), Positives = 260/318 (82%), Gaps = 1/318 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VC+TGASGYIASWIVK LL RGY V ATVR  +DPKK  HLL+L+GAKERLHLFKA+L
Sbjct  10    KKVCITGASGYIASWIVKLLLDRGYTVNATVRSLNDPKKVDHLLALDGAKERLHLFKANL  69

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDS + GC+GVFHTASP   + ++PQ ELIDPAVKGTLNVL SCAK P++++VV+
Sbjct  70    LEEGSFDSAICGCDGVFHTASPIKLDSSNPQDELIDPAVKGTLNVLASCAKVPTIKRVVI  129

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKM-WYVLSKTLAEDAAWKFVKEKGIN  765
             TSS+AAV    +P TPE VVDETW+S  + C++++M WY+LSKTLAE+AAWKFVKE GI+
Sbjct  130   TSSMAAVLCTPRPLTPETVVDETWFSVPEICEKLQMKWYLLSKTLAEEAAWKFVKENGID  189

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             MV+INPA+VIGPLLQPTLN SS A+ +LING+ETY N S+GW++VKDVA AHI A E PS
Sbjct  190   MVSINPAVVIGPLLQPTLNASSIAVSSLINGSETYQNVSFGWVHVKDVAEAHIRAFEIPS  249

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             ANGRY + E V H SEVVK L +LYP L+LP K +DDKPF PTY+VSKEK ++LG+ + P
Sbjct  250   ANGRYLLNESVNHVSEVVKILKELYPDLKLPTKPSDDKPFDPTYKVSKEKVESLGITYIP  309

Query  1126  LEESLKETVESLKEKGFF  1179
             L+ SLKETV+ L  K F 
Sbjct  310   LKVSLKETVDCLIAKKFI  327



>ref|XP_008790949.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Phoenix 
dactylifera]
Length=310

 Score =   445 bits (1145),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 253/321 (79%), Gaps = 21/321 (7%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S + K VCVTGASGYIASW+VK LLQRGY V+ TVR   DPK+T+HL +LEGA ERL L
Sbjct  1     MSGSGKVVCVTGASGYIASWLVKLLLQRGYTVRGTVRDLADPKRTEHLRALEGANERLQL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKA+LLEEGSFDSVV GCEGVFHTASP Y N TDPQAE IDPAVKGTLNV GSC KTPSV
Sbjct  61    FKANLLEEGSFDSVVEGCEGVFHTASPCYVNATDPQAEFIDPAVKGTLNVFGSCIKTPSV  120

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSS+A V  NG+P+TP+VVVD TW+S+A+FC++ K+WY LSKTLAE+AAWK+ K+
Sbjct  121   KRVVVTSSMATVVCNGRPQTPDVVVDATWFSSAEFCEQEKLWYPLSKTLAEEAAWKYSKD  180

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
               I+MVTI+P  VIG                      TY N S+GW+NVKDVA AHILA 
Sbjct  181   NSIDMVTIHPGAVIG---------------------STYPNLSFGWVNVKDVAMAHILAF  219

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E PSA GRYC++ERVAHYSE+VK L + YP L+LPEKCADDKPF P YQVSKEK K+LG+
Sbjct  220   EVPSARGRYCLVERVAHYSEIVKILREQYPALKLPEKCADDKPFPPIYQVSKEKEKSLGI  279

Query  1114  VFTPLEESLKETVESLKEKGF  1176
              + P+E S+KETVESLKEKGF
Sbjct  280   DYIPIETSIKETVESLKEKGF  300



>ref|XP_007149033.1| hypothetical protein PHAVU_005G034900g [Phaseolus vulgaris]
 gb|ESW21027.1| hypothetical protein PHAVU_005G034900g [Phaseolus vulgaris]
Length=326

 Score =   445 bits (1144),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 215/319 (67%), Positives = 258/319 (81%), Gaps = 1/319 (0%)
 Frame = +1

Query  223   AMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKA  402
             A + VCVTGASG+IASW+VKFLLQRGY VKATVR   DPKK  HL +L+GAKERL L KA
Sbjct  5     AGEVVCVTGASGFIASWLVKFLLQRGYTVKATVRDLSDPKKVDHLFNLDGAKERLTLIKA  64

Query  403   DLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKV  582
             +LLEEGSFD  V GC  VFHTASPF+    DPQAEL+DPA+KGTLNVL SC  +P++++V
Sbjct  65    NLLEEGSFDYAVQGCHAVFHTASPFFFIAKDPQAELLDPALKGTLNVLKSCVNSPTLKRV  124

Query  583   VVTSSIAAVAYNGKP-RTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             V+TSSIAAVA    P +TP+VVVDETW+S  +F +  + WY LSKTLAE+AAWKF KE  
Sbjct  125   VLTSSIAAVANKESPNKTPDVVVDETWFSDPEFLRRTEGWYDLSKTLAEEAAWKFAKENN  184

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I++VTINPA+V GPLLQP LNTS+AA+LN +NG+ T+ N S GWI+V+DVANAHILA EN
Sbjct  185   IDLVTINPALVSGPLLQPVLNTSAAAVLNFVNGSPTFKNVSVGWIDVRDVANAHILAYEN  244

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
              SANGRY ++ERV H+S  VK L  L+PT++LPEKC DDKP+   YQVSKEKAK+LG+ +
Sbjct  245   ASANGRYLLVERVEHHSNAVKILRDLFPTIQLPEKCIDDKPYPAIYQVSKEKAKSLGLEY  304

Query  1120  TPLEESLKETVESLKEKGF  1176
             TPLE SLK+TVESLKEK F
Sbjct  305   TPLEVSLKDTVESLKEKKF  323



>ref|XP_007131545.1| hypothetical protein PHAVU_011G022200g [Phaseolus vulgaris]
 gb|ESW03539.1| hypothetical protein PHAVU_011G022200g [Phaseolus vulgaris]
Length=325

 Score =   444 bits (1143),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 215/315 (68%), Positives = 256/315 (81%), Gaps = 2/315 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASWIV FLLQRGY V+ATVR P + KK  HL++LEGAKERLHLFKADL
Sbjct  7     KVVCVTGASGFIASWIVNFLLQRGYTVRATVRNPSNRKKVLHLVNLEGAKERLHLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC+GVFHTASP    V DPQA+LIDPAV GTLNVL SCAK+PSV++VV 
Sbjct  67    LEEGSFDSVVDGCDGVFHTASPVRFVVEDPQADLIDPAVMGTLNVLKSCAKSPSVKRVVF  126

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS AAV YN +P+TPEVV DETW+S  D C+E+KMWY LSKTLAE+AAWKFV E  INM
Sbjct  127   TSSTAAVVYNERPKTPEVVADETWFSDPDVCRELKMWYHLSKTLAEEAAWKFVNENNINM  186

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             +TINP MV G  LQP +N S   ILN+ING ++  N ++GW++VKDVANAHILA E  SA
Sbjct  187   ITINPGMVAGSFLQPEVNESIEYILNVING-KSIPNKAFGWVDVKDVANAHILAYEIASA  245

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKA-KNLGVVFTP  1125
             +GRYC+ E+V H SE+ + L  LYPTL++P+KC  D+P+V TYQ+SKEKA K+LG+  TP
Sbjct  246   SGRYCLTEKVIHSSELARILRDLYPTLQIPDKCEVDEPYVQTYQISKEKAKKSLGIELTP  305

Query  1126  LEESLKETVESLKEK  1170
             LE S++ETVES +EK
Sbjct  306   LEVSIRETVESFREK  320



>gb|KEH19926.1| cinnamyl alcohol dehydrogenase [Medicago truncatula]
Length=324

 Score =   444 bits (1143),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/317 (69%), Positives = 254/317 (80%), Gaps = 2/317 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYP-DDPKKTKHLLSLEGAKERLHLFKAD  405
             K VCVTGASG+IASWIVKFLLQRGY V+ATVR P  +PKK  HLL L+GAKERL LFKAD
Sbjct  6     KVVCVTGASGFIASWIVKFLLQRGYTVRATVRDPTGNPKKVDHLLKLDGAKERLQLFKAD  65

Query  406   LLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVV  585
             LLEEGSFDSVV GC+GVFHTASP    V DPQ ELIDPA+KGTLNVL SCAK+ SV++VV
Sbjct  66    LLEEGSFDSVVEGCDGVFHTASPVRFVVNDPQVELIDPALKGTLNVLKSCAKSTSVKRVV  125

Query  586   VTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGIN  765
             +TSS AAV++N +P+ PEVVVDETW+S  DFC+E K+WYVLSKTLAE AAWKFV E  I+
Sbjct  126   LTSSNAAVSFNTRPKNPEVVVDETWFSNPDFCRESKLWYVLSKTLAEAAAWKFVNENNID  185

Query  766   MVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPS  945
             MV++NP MV GPLLQP +N S   ILNLING   + N + GW+NVKDVANAHI A E  S
Sbjct  186   MVSLNPTMVAGPLLQPEVNESVEPILNLINGI-PFPNKAIGWVNVKDVANAHIHAYEIAS  244

Query  946   ANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTP  1125
             A+GR  + ERV HYSE+   L  LYPTL + +KC DD P++PTYQ+SKEKAK+ G+ FTP
Sbjct  245   ASGRCLLAERVVHYSELAMILRDLYPTLPISDKCEDDGPYMPTYQISKEKAKSFGIEFTP  304

Query  1126  LEESLKETVESLKEKGF  1176
             LE SLKETVES +EK F
Sbjct  305   LEISLKETVESFREKKF  321



>ref|XP_011025485.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X2 [Populus 
euphratica]
Length=328

 Score =   444 bits (1142),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 261/321 (81%), Gaps = 4/321 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTG SGYIASW+VK LL RGY VKATVR P+DPK+T+HLLSL+GAKERLHLFKA+L
Sbjct  6     KVVCVTGGSGYIASWLVKLLLHRGYTVKATVRDPNDPKRTEHLLSLDGAKERLHLFKANL  65

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             +EEGSFD VV GCE VFH ASP +    DPQA+LI+PAVKGTLNVL SCAK PSV++V++
Sbjct  66    VEEGSFDPVVDGCESVFHVASPAFLGTNDPQADLIEPAVKGTLNVLKSCAKFPSVKRVIL  125

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSS+A+VA+NGKP TP+VVVDETW+S + FC   K+WY+ SKTLAE+AAWKF KEKGI+M
Sbjct  126   TSSMASVAFNGKPLTPDVVVDETWFSDSAFCVSNKLWYMASKTLAEEAAWKFAKEKGIDM  185

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLIN----GAETYSNASYGWINVKDVANAHILALE  936
             VTI+P  VIGPLLQPTLN+S+   L+ IN    GA    +  Y +++V+DVA AHI ALE
Sbjct  186   VTIHPGFVIGPLLQPTLNSSAEMFLDHINGGAQGAPRLPSEIYRFVDVRDVAYAHIQALE  245

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
              PSA+GRYC++ RV H+S+ VK  H+LYPTL LPEKCAD+ P    Y+VSKEKAK LG+ 
Sbjct  246   IPSASGRYCLVGRVKHFSDAVKIAHELYPTLPLPEKCADENPSPLNYEVSKEKAKTLGLD  305

Query  1117  FTPLEESLKETVESLKEKGFF  1179
             FTPLE S+K+T+ESLKEKGF 
Sbjct  306   FTPLEVSVKDTLESLKEKGFL  326



>ref|XP_010067837.1| PREDICTED: cinnamoyl-CoA reductase 1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW66050.1| hypothetical protein EUGRSUZ_G03342 [Eucalyptus grandis]
Length=327

 Score =   444 bits (1141),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 211/317 (67%), Positives = 253/317 (80%), Gaps = 0/317 (0%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTG +GYIASW+VK LLQRGY VKAT+R P+DPKKT+HLL+LEGAKERL LFKADL
Sbjct  9     KVVCVTGGAGYIASWVVKLLLQRGYTVKATMRDPNDPKKTEHLLALEGAKERLQLFKADL  68

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQKVVV  588
             LEEGSFDSVV GC GVFHTASP   +V DPQAELIDPA+KGTLNVL SCAK  S+++VVV
Sbjct  69    LEEGSFDSVVNGCIGVFHTASPVLLSVADPQAELIDPALKGTLNVLRSCAKVSSIKRVVV  128

Query  589   TSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKGINM  768
             TSSIA V+Y  KP T   +VDETW+S  +FC++ K+WYVLSK LAE A W+  KE  I++
Sbjct  129   TSSIATVSYIAKPLTSGDLVDETWFSDPEFCEKSKLWYVLSKILAEKAEWELAKENEIDL  188

Query  769   VTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALENPSA  948
             VTINP +VIGPLLQPT+N S   ILN +NGA+T+ N  Y + +V+DVANAH+LA ENPSA
Sbjct  189   VTINPGIVIGPLLQPTVNLSVEVILNFVNGAQTFPNECYCFADVRDVANAHVLAFENPSA  248

Query  949   NGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVFTPL  1128
              GRYC++  V H  + +K L  LYPTL LP+KC DDKPF   Y+ S+EKA+ LGV FTPL
Sbjct  249   CGRYCVVGEVIHCHDALKILQNLYPTLHLPDKCEDDKPFASKYEYSREKAEALGVDFTPL  308

Query  1129  EESLKETVESLKEKGFF  1179
             E SL++T+ESL+EKGF 
Sbjct  309   EISLRDTIESLREKGFI  325



>ref|XP_004307228.1| PREDICTED: uncharacterized protein LOC101295856 [Fragaria vesca 
subsp. vesca]
Length=638

 Score =   454 bits (1169),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 218/320 (68%), Positives = 263/320 (82%), Gaps = 3/320 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASW+VK LLQRGY VKATVR P+D KKT+HLLSL+GAKERLHLFKADL
Sbjct  319   KVVCVTGASGFIASWLVKLLLQRGYTVKATVRNPNDQKKTEHLLSLDGAKERLHLFKADL  378

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNV---TDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             L+EGSFDSVV GCE VFH  SP    +   TDPQAELIDPA+KGTLNVLGSC K  SV++
Sbjct  379   LDEGSFDSVVDGCECVFHKPSPETPVIVPATDPQAELIDPALKGTLNVLGSCVKISSVKR  438

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VV+TSS+AAVAYNGK    +V +DE+W+S   FC++ K+WY LSKTLAE+AAWKF KEKG
Sbjct  439   VVITSSMAAVAYNGKHLADDVTIDESWFSDPAFCEKTKLWYQLSKTLAEEAAWKFAKEKG  498

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I+++TINP  VIGPLLQPTLN S   +L L+NG E + N ++ +++V+DVANAHILA EN
Sbjct  499   IDVITINPGWVIGPLLQPTLNFSVEPVLKLVNGTEKFLNTTHRFVDVRDVANAHILAFEN  558

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSA+GRYC++  + H SEVVK LH + P L LP KCADDKPF PTYQVSKE+A++LGV +
Sbjct  559   PSASGRYCLVGSIKHCSEVVKMLHDISPDLNLPNKCADDKPFTPTYQVSKERAQSLGVKY  618

Query  1120  TPLEESLKETVESLKEKGFF  1179
             TPLE +L++TVESLK+K FF
Sbjct  619   TPLEVTLEDTVESLKDKNFF  638


 Score =   437 bits (1125),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/306 (69%), Positives = 252/306 (82%), Gaps = 4/306 (1%)
 Frame = +1

Query  229   KTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFKADL  408
             K VCVTGASG+IASW+VK LLQRGY VKATVR P+D KKT+HLLSLEGAKERLHLFKADL
Sbjct  7     KVVCVTGASGFIASWLVKLLLQRGYTVKATVRDPNDQKKTEHLLSLEGAKERLHLFKADL  66

Query  409   LEEGSFDSVVAGCEGVFHTASPFYHNVTDPQ----AELIDPAVKGTLNVLGSCAKTPSVQ  576
             L+EGSFDSVV GCE VFHTAS    +VTDPQ    AEL+DPA+KGTLNVL SC K PSV+
Sbjct  67    LDEGSFDSVVDGCECVFHTASSVLLSVTDPQVHFFAELLDPALKGTLNVLESCVKVPSVK  126

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSSIA VA+NGKP T +V +DETW+S   FC++ K+WYVLSK LAE AAW+F KEK
Sbjct  127   RVVITSSIATVAFNGKPETSDVTIDETWFSDPAFCEKSKLWYVLSKILAEQAAWEFAKEK  186

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI++VTINPA VIGPLLQPTLN S+  +LNL+NG E + N +Y +++V+DVANAHILA E
Sbjct  187   GIDIVTINPAWVIGPLLQPTLNLSAEQVLNLVNGKEQFPNKNYRFVDVRDVANAHILAFE  246

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVV  1116
             NPSA GRYC++    H SE+VK L  ++PTL LP+KCADD+PF PT QVSKE+A++LGV 
Sbjct  247   NPSAWGRYCLVGSTNHCSEIVKMLSSIFPTLTLPDKCADDEPFPPTCQVSKERAQSLGVK  306

Query  1117  FTPLEE  1134
             +T LE 
Sbjct  307   YTLLER  312



>ref|XP_007052475.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOX96632.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=326

 Score =   443 bits (1139),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 213/322 (66%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             S A K VCVTGASGYIASW+VK LLQRGY VKATVR P+DPKKT+HLL+L+GAKERLHLF
Sbjct  3     SAAEKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALDGAKERLHLF  62

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KA+L +EG FDSVV GC+GVFHTASP   +  DPQAE+I PA+KGTLNVL SCAK PS++
Sbjct  63    KAELTDEGCFDSVVEGCQGVFHTASPVLFSPADPQAEIIGPALKGTLNVLKSCAKVPSIK  122

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VV+TSS+A+V +NGKP TP+V+VDETW+S   FC+E K+WY+ SKTLAE+AAW F K+ 
Sbjct  123   RVVLTSSMASVLFNGKPLTPDVMVDETWFSDPRFCEESKLWYMASKTLAEEAAWSFTKDN  182

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALE  936
             GI++VTINP +VIGPLLQP LN +S  ILNL  G  T+ + ++  I+V+DVA AHI A E
Sbjct  183   GIDLVTINPGVVIGPLLQPALNLTSELILNLTKGEHTFPSPTFRLIDVRDVAYAHIQAFE  242

Query  937   NPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCAD-DKPFVPTYQVSKEKAKNLGV  1113
              PSA+GRYC++ER+ HY E++K L + YP L L EKC D +KP   TYQ+SKEKAK+LGV
Sbjct  243   IPSASGRYCLVERIVHYLEILKVLSEHYPALGLQEKCGDLNKPLERTYQISKEKAKSLGV  302

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              F P E SLKE VESLKEKGF 
Sbjct  303   SFIPWEVSLKEIVESLKEKGFL  324



>ref|XP_002267167.2| PREDICTED: uncharacterized protein LOC100257572 isoform X2 [Vitis 
vinifera]
Length=638

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 213/322 (66%), Positives = 263/322 (82%), Gaps = 1/322 (0%)
 Frame = +1

Query  217   SMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLF  396
             ++A K VCVTGA+G+IASW+VK LL RGY VKAT+R PDDP KT+HLL+LEGAKERLHLF
Sbjct  315   AVAEKVVCVTGAAGFIASWLVKLLLLRGYTVKATLRNPDDPTKTQHLLALEGAKERLHLF  374

Query  397   KADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQ  576
             KADLLEEGSFDS+V GCEGVFHTASP    V +P+ ELIDPAV GTLNVL SC K PS++
Sbjct  375   KADLLEEGSFDSIVEGCEGVFHTASPVLLEVANPKVELIDPAVNGTLNVLRSCTKVPSIR  434

Query  577   KVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEK  756
             +VVVTSSI A  +NGK  TP+V+VDETW+S   FC+E K+WYVLSKTLAE+AAWKF KE 
Sbjct  435   RVVVTSSIVATIFNGKTLTPDVIVDETWFSDPAFCEESKLWYVLSKTLAEEAAWKFAKEN  494

Query  757   GINMVTINPAMVIGPLLQPTLNTSSAAILNLIN-GAETYSNASYGWINVKDVANAHILAL  933
             GI++VT+NP  VIGP LQPT+N +   ILNLIN GA+T+ +++Y W++V+DVANAH+ A 
Sbjct  495   GIDLVTMNPGFVIGPFLQPTINLTMEIILNLINGGAQTFPSSTYRWVDVRDVANAHVQAF  554

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E  SA+GRYC++ERV + SE +K L +LYP L LP+K ADD+P +PTYQ+SKEK K+L +
Sbjct  555   EISSASGRYCLVERVTYCSEAIKILQELYPALHLPQKNADDEPPMPTYQISKEKVKSLAI  614

Query  1114  VFTPLEESLKETVESLKEKGFF  1179
              F PLE SLK+T+E+LKEK F 
Sbjct  615   DFIPLEVSLKDTMENLKEKNFI  636


 Score =   446 bits (1148),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 213/327 (65%), Positives = 263/327 (80%), Gaps = 2/327 (1%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +++A K VCVTG +GYIASW+VK LL RGY VKAT+R PDDPKKT+HLL+L+GAKERLHL
Sbjct  3     VAVAEKVVCVTGGAGYIASWLVKLLLLRGYTVKATLRNPDDPKKTEHLLALKGAKERLHL  62

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSV  573
             FKADLLEEGSFDS+V GCEGVFHTASP    VTDP+ ELIDPAVKGTLNVL SCAK P++
Sbjct  63    FKADLLEEGSFDSIVEGCEGVFHTASPVLLEVTDPKVELIDPAVKGTLNVLRSCAKVPAI  122

Query  574   QKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKE  753
             ++VVVTSSI AV YNGKP T +V+VDETW+S   FC+E K+WYVLSKTLAE+AAWKF KE
Sbjct  123   RRVVVTSSIVAVIYNGKPLTSDVIVDETWFSDPAFCEESKLWYVLSKTLAEEAAWKFAKE  182

Query  754   KGINMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILAL  933
              GI++VT+NP ++IGP LQPT+N +   ILN+ING  T+ +++Y W++V+DVANAHI A 
Sbjct  183   HGIDLVTMNPGVMIGPPLQPTINLTMEIILNMING-NTFPSSTYKWVDVRDVANAHIQAF  241

Query  934   ENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGV  1113
             E  SA+GRYCM+ER+ + SE +K LH+LYP + LP+K ADD+P  PTYQ+SKEK K+L +
Sbjct  242   EISSASGRYCMVERITYRSEAIKILHELYPAIHLPQKSADDEPLGPTYQISKEKVKSLAI  301

Query  1114  VFTPLEESLKETVESLKEKGFFVPSAA  1194
              F PLE   K   E++ EK   V  AA
Sbjct  302   DFIPLERR-KGMSEAVAEKVVCVTGAA  327



>gb|ABK22554.1| unknown [Picea sitchensis]
Length=325

 Score =   441 bits (1134),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 266/317 (84%), Gaps = 1/317 (0%)
 Frame = +1

Query  220   MAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHLFK  399
             M+ + VCVTGASG+IASW+VK LL RGY+V+ATVR   +P+KTKHL +LEGA ERL L K
Sbjct  1     MSGRLVCVTGASGFIASWLVKLLLDRGYVVRATVRDLGNPEKTKHLHALEGANERLQLVK  60

Query  400   ADLLEEGSFDSVVAGCEGVFHTASPFYHNVTDPQAELIDPAVKGTLNVLGSCAKTPSVQK  579
             A+LL+EG+FD+ V GCEGVFHTASPFY  + DPQAE++DPAVKGT+NVL +CAK  SV++
Sbjct  61    ANLLDEGTFDAAVDGCEGVFHTASPFYIGIKDPQAEMLDPAVKGTINVLNACAKASSVKR  120

Query  580   VVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVKEKG  759
             VVVTSS+A+V +N +PR+P VV DETW+S A++CK+ K WY LSKTLAE+ AWKF KEKG
Sbjct  121   VVVTSSVASVIFNSRPRSPGVV-DETWFSDAEYCKQTKAWYQLSKTLAEETAWKFAKEKG  179

Query  760   INMVTINPAMVIGPLLQPTLNTSSAAILNLINGAETYSNASYGWINVKDVANAHILALEN  939
             I++VTINPAMVIG LLQP+LNTS AAIL L+NG+ TY N ++GW++VKDVA AHILA E 
Sbjct  180   IDIVTINPAMVIGTLLQPSLNTSCAAILQLMNGSSTYPNMTFGWVSVKDVAEAHILAFEV  239

Query  940   PSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNLGVVF  1119
             PSANGRY ++E+VAH SE+VK L KLYP   LP KCADD PFVPTY VSKE+ + LG+ +
Sbjct  240   PSANGRYLLVEKVAHCSEIVKILSKLYPGCTLPTKCADDNPFVPTYTVSKERIEKLGLKY  299

Query  1120  TPLEESLKETVESLKEK  1170
             TP+EE+L++TVESLKEK
Sbjct  300   TPIEEALRDTVESLKEK  316



>ref|XP_002314053.2| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa]
 gb|EEE88008.2| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa]
Length=326

 Score =   440 bits (1132),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 218/324 (67%), Positives = 262/324 (81%), Gaps = 2/324 (1%)
 Frame = +1

Query  214   ISMAMKTVCVTGASGYIASWIVKFLLQRGYIVKATVRYPDDPKKTKHLLSLEGAKERLHL  393
             +S   K VCVTGASGYIASW+VK LL RGY VKATVR P+DPK+T+HLL+L+GAKERLHL
Sbjct  1     MSAEGKVVCVTGASGYIASWLVKLLLHRGYTVKATVRDPNDPKRTEHLLNLDGAKERLHL  60

Query  394   FKADLLEEGSFDSVVAGCEGVFHTASPFYHNVT-DPQAELIDPAVKGTLNVLGSCAKTPS  570
             FKA+L+EEGSFD VV GCE VFH ASP       DPQA+LI+PAVKGTLNVL SCAK PS
Sbjct  61    FKANLVEEGSFDPVVDGCESVFHVASPVLLGTNIDPQADLIEPAVKGTLNVLKSCAKFPS  120

Query  571   VQKVVVTSSIAAVAYNGKPRTPEVVVDETWWSAADFCKEMKMWYVLSKTLAEDAAWKFVK  750
             V++V++TSS+A+V +NGKP TP VVVDETW+S + FC   K+WY+ SKTLAE+AAWKFVK
Sbjct  121   VKRVILTSSMASVIFNGKPLTPGVVVDETWFSDSAFCVSNKLWYMASKTLAEEAAWKFVK  180

Query  751   EKGINMVTINPAMVIGPLLQPTLNTSSAAILNLIN-GAETYSNASYGWINVKDVANAHIL  927
             EKGI+MVTINP  VIGPLLQPTL +++   L+ IN GA    +  Y +++V+DVA AHI 
Sbjct  181   EKGIDMVTINPGFVIGPLLQPTLKSTAELFLDRINGGAPGLPSEIYRFVDVRDVAYAHIQ  240

Query  928   ALENPSANGRYCMIERVAHYSEVVKKLHKLYPTLRLPEKCADDKPFVPTYQVSKEKAKNL  1107
             ALE PSA+GRYC++ RVAH+S+ VK  H+LYPTL LPEKCADDKP    Y+VSKEKAK L
Sbjct  241   ALEIPSASGRYCLVGRVAHFSDAVKIAHELYPTLPLPEKCADDKPSPLNYEVSKEKAKTL  300

Query  1108  GVVFTPLEESLKETVESLKEKGFF  1179
             G+ FTPLE S+K+ +ESLKEKGF 
Sbjct  301   GLDFTPLEVSVKDILESLKEKGFL  324



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3845111099284